Header -------------------------------------------------------- Search title orb_160921_AE-MF-2_#4-5.raw Timestamp 2016-09-28T01:17:35Z User lu-31 Email Report URI http://mascot.bioreg.kyushu-u.ac.jp/mascot/cgi/master_results.pl?file=D:/2016/20160928/F073884.dat Peak list data path D:\data\oda\160921_AE-MF-2\orb_160921_AE-MF-2_#4-5.raw Peak list format Mascot generic Search type MIS Mascot version 2.5.1 Database ipi_HUM_NEW Fasta file ipi_HUM_NEW_3.26.fasta Total sequences 67667 Total residues 28462731 Sequences after taxonomy filter 67667 Number of queries 8610 Fixed modifications -------------------------------------------------------- Identifier Name Delta Neutral loss 1 Carbamidomethyl (C) 57.021464 Variable modifications -------------------------------------------------------- Identifier Name Delta Neutral loss(es) 1 Oxidation (M) 15.994915 0 63.998285 Search Parameters -------------------------------------------------------- Taxonomy filter All entries Enzyme Trypsin Maximum Missed Cleavages 1 Fixed modifications Carbamidomethyl (C) Variable modifications Oxidation (M) Peptide Mass Tolerance 10 Peptide Mass Tolerance Units ppm Fragment Mass Tolerance 0.8 Fragment Mass Tolerance Units Da Mass values Monoisotopic Instrument type ESI-TRAP Format parameters -------------------------------------------------------- Significance threshold 0.05 Max. number of hits 0 Min. number of sig. unique sequences 1 Use MudPIT protein scoring 1 Ions score cut-off -1 Include same-set proteins 0 Include sub-set proteins 1 Include unassigned 0 Require bold red 0 Use homology threshold 1 Group protein families 1 Show duplicate peptides 1 Protein hits -------------------------------------------------------- prot_hit_num prot_family_member prot_acc prot_desc prot_score prot_mass prot_matches prot_matches_sig prot_sequences prot_sequences_sig pep_query pep_index pep_rank pep_isbold pep_isunique pep_exp_mz pep_exp_mr pep_exp_z pep_calc_mr pep_delta pep_miss pep_score pep_expect pep_res_before pep_seq pep_res_after pep_var_mod pep_var_mod_pos pep_summed_mod_pos pep_local_mod_pos pep_scan_title 1 1 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 919 60448 30 30 26 26 74 2616 1 0 0 314.6931 627.3717 2 627.3704 0.0013 0 26.28 0.037 R LPGVSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2760.2760.2.dta 1 1 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 919 60448 30 30 26 26 575 4682 1 0 0 414.2184 826.4222 2 826.4225 -0.0003 0 41.77 0.0013 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5115.5115.2.dta 1 1 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 919 60448 30 30 26 26 880 2448 1 0 0 453.7381 905.4616 2 905.4607 0.001 0 42.17 0.0019 R FLEQQNK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2576.2576.2.dta 1 1 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 919 60448 30 30 26 26 1045 2718 1 0 0 473.2597 944.5048 2 944.5039 0.0009 1 31.47 0.017 R GRLDSELR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2873.2873.2.dta 1 1 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 919 60448 30 30 26 26 1401 4065 1 0 0 513.7648 1025.515 2 1025.5142 0.0008 0 57.59 4.00E-06 R SGFSSISVSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4416.4416.2.dta 1 1 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 919 60448 30 30 26 26 1448 3309 1 0 0 519.2908 1036.567 2 1036.5665 0.0005 1 33.23 0.00092 R SLYGLGGSKR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3578.3578.2.dta 1 1 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 919 60448 30 30 26 26 1647 4604 1 0 0 361.5381 1081.5923 3 1081.592 0.0003 1 27.56 0.018 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5024.5024.3.dta 1 1 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 919 60448 30 30 26 26 1648 4597 1 0 0 541.8035 1081.5925 2 1081.592 0.0005 1 45.13 0.00051 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5015.5015.2.dta 1 1 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 919 60448 30 30 26 26 1704 1960 1 0 0 366.2087 1095.6044 3 1095.6036 0.0008 1 30.84 0.0019 R LRSEIDHVK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2026.2026.3.dta 1 1 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 919 60448 30 30 26 26 1836 2369 1 0 0 567.2827 1132.5509 2 1132.5546 -0.0038 1 47.01 0.00012 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2489.2489.2.dta 1 1 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 919 60448 30 30 26 26 1916 4349 1 0 0 577.2816 1152.5487 2 1152.5485 0.0002 0 39.48 0.00061 K EYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4726.4726.2.dta 1 1 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 919 60448 30 30 26 26 1946 3733 1 0 0 583.2939 1164.5732 2 1164.5775 -0.0043 0 83.38 1.00E-07 K YEELQVTAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4054.4054.2.dta 1 1 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 919 60448 30 30 26 26 2389 5837 1 0 0 632.3508 1262.6871 2 1262.687 0.0001 0 88.62 2.10E-08 K LALDVEIATYR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6548.6548.2.dta 1 1 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 919 60448 30 30 26 26 2593 2714 1 0 0 439.2384 1314.6933 3 1314.6891 0.0042 1 56.59 4.50E-05 R NTKQEIAEINR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2867.2867.3.dta 1 1 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 919 60448 30 30 26 26 2652 7034 1 0 0 665.3684 1328.7223 2 1328.7187 0.0035 0 62.11 3.90E-06 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.8052.8052.2.dta 1 1 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 919 60448 30 30 26 26 2741 3782 1 0 0 675.8647 1349.7149 2 1349.7191 -0.0041 1 69.6 2.00E-06 R TAAENEFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4107.4107.2.dta 1 1 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 919 60448 30 30 26 26 2742 3777 1 0 0 450.9136 1349.719 3 1349.7191 -0.0001 1 46.08 0.00017 R TAAENEFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4102.4102.3.dta 1 1 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 919 60448 30 30 26 26 2761 4641 1 0 0 679.3676 1356.7206 2 1356.7249 -0.0043 1 67.63 3.70E-06 K NKLEGLEDALQK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5068.5068.2.dta 1 1 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 919 60448 30 30 26 26 2762 4640 1 0 0 453.249 1356.7252 3 1356.7249 0.0003 1 52.18 1.70E-05 K NKLEGLEDALQK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5067.5067.3.dta 1 1 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 919 60448 30 30 26 26 2960 6433 1 0 0 704.36 1406.7054 2 1406.7041 0.0013 0 98.57 2.50E-09 K ADTLTDEINFLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7317.7317.2.dta 1 1 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 919 60448 30 30 26 26 3016 3507 1 0 0 712.819 1423.6235 2 1423.6263 -0.0028 0 61.37 2.70E-06 R GSGGLGGACGGAGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3805.3805.2.dta 1 1 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 919 60448 30 30 26 26 3122 4064 1 0 1 724.3915 1446.7685 2 1446.7678 0.0007 0 94.18 1.50E-09 R AIGGGLSSVGGGSSTIK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4415.4415.2.dta 1 1 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 919 60448 30 30 26 26 3229 3563 1 0 0 492.9391 1475.7954 3 1475.7984 -0.0029 1 22.58 0.014 R FLEQQNKVLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3867.3867.3.dta 1 1 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 919 60448 30 30 26 26 3319 5222 1 0 0 503.2781 1506.8124 3 1506.8116 0.0008 1 30.42 0.0014 R LLKEYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5743.5743.3.dta 1 1 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 919 60448 30 30 26 26 3633 4265 1 0 0 799.8827 1597.7508 2 1597.7519 -0.001 0 86.57 3.40E-08 R ISIGGGSCAISGGYGSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4634.4634.2.dta 1 1 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 919 60448 30 30 26 26 4027 3023 1 0 0 556.5931 1666.7576 3 1666.7594 -0.0018 1 59.25 4.50E-06 R SRGSGGLGGACGGAGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3225.3225.3.dta 1 1 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 919 60448 30 30 26 26 4188 4415 1 0 0 565.6188 1693.8345 3 1693.8345 0 1 30.12 0.0019 K DVDAAYMNKVELQAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4804.4804.3.dta 1 1 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 919 60448 30 30 26 26 4816 7436 1 0 0 630.9953 1889.9641 3 1889.9635 0.0006 0 40.45 0.00016 R QNLEPLFEQYINNLR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.8557.8557.3.dta 1 1 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 919 60448 30 30 26 26 6251 8273 1 0 0 806.7548 2417.2426 3 2417.2438 -0.0011 1 31.54 0.0031 R NLDLDSIIAEVKAQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9562.9562.3.dta 1 1 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 919 60448 30 30 26 26 6252 8282 1 0 0 605.3182 2417.2436 4 2417.2438 -0.0002 1 16.02 0.031 R NLDLDSIIAEVKAQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9573.9573.4.dta 1 2 IPI00554648.3 "Keratin, type II cytoskeletal 8" 891 53671 31 31 27 27 103 1175 1 0 1 322.2291 642.4437 2 642.4428 0.0009 1 38.2 0.00042 R AVVVKK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1171.1171.2.dta 1 2 IPI00554648.3 "Keratin, type II cytoskeletal 8" 891 53671 31 31 27 27 113 7641 1 0 1 323.6985 645.3824 2 645.381 0.0015 1 30.08 0.031 K KIETR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.881.881.2.dta 1 2 IPI00554648.3 "Keratin, type II cytoskeletal 8" 891 53671 31 31 27 27 575 4682 1 0 0 414.2184 826.4222 2 826.4225 -0.0003 0 41.77 0.0013 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5115.5115.2.dta 1 2 IPI00554648.3 "Keratin, type II cytoskeletal 8" 891 53671 31 31 27 27 745 2731 1 0 1 435.7188 869.4231 2 869.4243 -0.0012 0 44.72 0.0005 R ISSSSFSR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2887.2887.2.dta 1 2 IPI00554648.3 "Keratin, type II cytoskeletal 8" 891 53671 31 31 27 27 880 2448 1 0 0 453.7381 905.4616 2 905.4607 0.001 0 42.17 0.0019 R FLEQQNK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2576.2576.2.dta 1 2 IPI00554648.3 "Keratin, type II cytoskeletal 8" 891 53671 31 31 27 27 897 1655 1 0 1 456.2148 910.415 2 910.4145 0.0006 0 40.1 0.00025 R SYTSGPGSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1689.1689.2.dta 1 2 IPI00554648.3 "Keratin, type II cytoskeletal 8" 891 53671 31 31 27 27 987 2514 1 0 0 466.7373 931.46 2 931.461 -0.001 0 31.67 0.0031 K LLEGEESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2647.2647.2.dta 1 2 IPI00554648.3 "Keratin, type II cytoskeletal 8" 891 53671 31 31 27 27 1278 4289 1 0 1 500.7875 999.5605 2 999.56 0.0004 0 39.84 0.0013 R LQAEIEGLK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4660.4660.2.dta 1 2 IPI00554648.3 "Keratin, type II cytoskeletal 8" 891 53671 31 31 27 27 1422 5106 1 0 1 515.7877 1029.5609 2 1029.5607 0.0002 0 37.89 0.0035 K WSLLQQQK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5610.5610.2.dta 1 2 IPI00554648.3 "Keratin, type II cytoskeletal 8" 891 53671 31 31 27 27 1642 2006 1 0 1 361.1933 1080.558 3 1080.5564 0.0016 1 44.48 0.00022 K SYKVSTSGPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2076.2076.3.dta 1 2 IPI00554648.3 "Keratin, type II cytoskeletal 8" 891 53671 31 31 27 27 1647 4604 1 0 0 361.5381 1081.5923 3 1081.592 0.0003 1 27.56 0.018 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5024.5024.3.dta 1 2 IPI00554648.3 "Keratin, type II cytoskeletal 8" 891 53671 31 31 27 27 1648 4597 1 0 0 541.8035 1081.5925 2 1081.592 0.0005 1 45.13 0.00051 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5015.5015.2.dta 1 2 IPI00554648.3 "Keratin, type II cytoskeletal 8" 891 53671 31 31 27 27 1817 5003 1 0 1 565.3135 1128.6125 2 1128.6138 -0.0013 0 99.07 3.00E-09 K LSELEAALQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5491.5491.2.dta 1 2 IPI00554648.3 "Keratin, type II cytoskeletal 8" 891 53671 31 31 27 27 1855 4241 1 0 1 569.293 1136.5715 2 1136.5713 0.0002 0 59.13 3.40E-05 K YEELQSLAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4608.4608.2.dta 1 2 IPI00554648.3 "Keratin, type II cytoskeletal 8" 891 53671 31 31 27 27 1916 4349 1 0 0 577.2816 1152.5487 2 1152.5485 0.0002 0 39.48 0.00061 R EYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4726.4726.2.dta 1 2 IPI00554648.3 "Keratin, type II cytoskeletal 8" 891 53671 31 31 27 27 1976 3846 1 0 1 587.3212 1172.6278 2 1172.6289 -0.0011 0 52.4 2.20E-05 K LVSESSDVLPK - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4176.4176.2.dta 1 2 IPI00554648.3 "Keratin, type II cytoskeletal 8" 891 53671 31 31 27 27 2093 2503 1 0 1 601.3292 1200.6439 2 1200.6462 -0.0023 1 52.58 0.00012 R RQLETLGQEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2635.2635.2.dta 1 2 IPI00554648.3 "Keratin, type II cytoskeletal 8" 891 53671 31 31 27 27 2162 2319 1 0 1 403.536 1207.5862 3 1207.5867 -0.0004 1 37.89 0.00028 R TKTEISEMNR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2433.2433.3.dta 1 2 IPI00554648.3 "Keratin, type II cytoskeletal 8" 891 53671 31 31 27 27 2215 1493 1 0 1 612.7978 1223.581 2 1223.5816 -0.0005 1 19.47 0.019 R TKTEISEMNR N Oxidation (M) 0.0000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1514.1514.2.dta 1 2 IPI00554648.3 "Keratin, type II cytoskeletal 8" 891 53671 31 31 27 27 2437 6291 1 0 0 639.3584 1276.7022 2 1276.7027 -0.0004 0 79.72 1.50E-07 K LALDIEIATYR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7122.7122.2.dta 1 2 IPI00554648.3 "Keratin, type II cytoskeletal 8" 891 53671 31 31 27 27 2620 6479 1 0 1 660.8406 1319.6667 2 1319.6642 0.0025 0 92.41 1.30E-08 R SLDMDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7377.7377.2.dta 1 2 IPI00554648.3 "Keratin, type II cytoskeletal 8" 891 53671 31 31 27 27 2697 3489 1 0 1 671.3763 1340.7381 2 1340.7412 -0.003 1 60.49 1.10E-05 R LQAEIEGLKGQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3784.3784.2.dta 1 2 IPI00554648.3 "Keratin, type II cytoskeletal 8" 891 53671 31 31 27 27 2704 5364 1 0 1 672.8411 1343.6677 2 1343.6681 -0.0004 0 82.2 2.60E-08 R ASLEAAIADAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5912.5912.2.dta 1 2 IPI00554648.3 "Keratin, type II cytoskeletal 8" 891 53671 31 31 27 27 2995 6622 1 0 1 710.378 1418.7414 2 1418.7405 0.0009 0 62.9 1.60E-06 R LEGLTDEINFLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7545.7545.2.dta 1 2 IPI00554648.3 "Keratin, type II cytoskeletal 8" 891 53671 31 31 27 27 3205 3978 1 0 1 737.3925 1472.7705 2 1472.7722 -0.0017 1 65.72 5.40E-06 R DGKLVSESSDVLPK - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4317.4317.2.dta 1 2 IPI00554648.3 "Keratin, type II cytoskeletal 8" 891 53671 31 31 27 27 3206 3974 1 0 1 491.9312 1472.7719 3 1472.7722 -0.0003 1 59.09 2.40E-05 R DGKLVSESSDVLPK - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4313.4313.3.dta 1 2 IPI00554648.3 "Keratin, type II cytoskeletal 8" 891 53671 31 31 27 27 3240 5015 1 0 1 494.2623 1479.7651 3 1479.7643 0.0008 1 32.7 0.0025 R TEMENEFVLIKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5505.5505.3.dta 1 2 IPI00554648.3 "Keratin, type II cytoskeletal 8" 891 53671 31 31 27 27 3286 4481 1 0 1 499.5935 1495.7588 3 1495.7592 -0.0004 1 34.56 0.00057 R TEMENEFVLIKK D Oxidation (M) 0.001000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4883.4883.3.dta 1 2 IPI00554648.3 "Keratin, type II cytoskeletal 8" 891 53671 31 31 27 27 4502 4480 1 0 1 599.9496 1796.8271 3 1796.825 0.0021 1 68.98 1.20E-06 K DVDEAYMNKVELESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4882.4882.3.dta 1 2 IPI00554648.3 "Keratin, type II cytoskeletal 8" 891 53671 31 31 27 27 5707 5533 1 0 1 763.3743 2287.101 3 2287.1041 -0.0032 1 27.24 0.0028 R AEAESMYQIKYEELQSLAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6133.6133.3.dta 1 2 IPI00554648.3 "Keratin, type II cytoskeletal 8" 891 53671 31 31 27 27 6130 7846 1 0 1 794.3927 2380.1563 3 2380.158 -0.0017 1 51.95 2.70E-05 R SLDMDSIIAEVKAQYEDIANR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9056.9056.3.dta 1 3 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 886 60247 30 30 26 26 74 2616 1 0 0 314.6931 627.3717 2 627.3704 0.0013 0 26.28 0.037 R LPGVSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2760.2760.2.dta 1 3 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 886 60247 30 30 26 26 575 4682 1 0 0 414.2184 826.4222 2 826.4225 -0.0003 0 41.77 0.0013 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5115.5115.2.dta 1 3 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 886 60247 30 30 26 26 880 2448 1 0 0 453.7381 905.4616 2 905.4607 0.001 0 42.17 0.0019 R FLEQQNK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2576.2576.2.dta 1 3 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 886 60247 30 30 26 26 1045 2718 1 0 0 473.2597 944.5048 2 944.5039 0.0009 1 31.47 0.017 R GRLDSELR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2873.2873.2.dta 1 3 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 886 60247 30 30 26 26 1401 4065 1 0 0 513.7648 1025.515 2 1025.5142 0.0008 0 57.59 4.00E-06 R SGFSSISVSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4416.4416.2.dta 1 3 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 886 60247 30 30 26 26 1448 3309 1 0 0 519.2908 1036.567 2 1036.5665 0.0005 1 33.23 0.00092 R SLYGLGGSKR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3578.3578.2.dta 1 3 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 886 60247 30 30 26 26 1647 4604 1 0 0 361.5381 1081.5923 3 1081.592 0.0003 1 27.56 0.018 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5024.5024.3.dta 1 3 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 886 60247 30 30 26 26 1648 4597 1 0 0 541.8035 1081.5925 2 1081.592 0.0005 1 45.13 0.00051 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5015.5015.2.dta 1 3 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 886 60247 30 30 26 26 1704 1960 1 0 0 366.2087 1095.6044 3 1095.6036 0.0008 1 30.84 0.0019 R LRSEIDHVK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2026.2026.3.dta 1 3 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 886 60247 30 30 26 26 1836 2369 1 0 0 567.2827 1132.5509 2 1132.5546 -0.0038 1 47.01 0.00012 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2489.2489.2.dta 1 3 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 886 60247 30 30 26 26 1916 4349 1 0 0 577.2816 1152.5487 2 1152.5485 0.0002 0 39.48 0.00061 K EYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4726.4726.2.dta 1 3 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 886 60247 30 30 26 26 1946 3733 1 0 0 583.2939 1164.5732 2 1164.5775 -0.0043 0 83.38 1.00E-07 K YEELQVTAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4054.4054.2.dta 1 3 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 886 60247 30 30 26 26 2389 5837 1 0 0 632.3508 1262.6871 2 1262.687 0.0001 0 88.62 2.10E-08 K LALDVEIATYR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6548.6548.2.dta 1 3 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 886 60247 30 30 26 26 2593 2714 1 0 0 439.2384 1314.6933 3 1314.6891 0.0042 1 56.59 4.50E-05 R NTKQEIAEINR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2867.2867.3.dta 1 3 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 886 60247 30 30 26 26 2652 7034 1 0 0 665.3684 1328.7223 2 1328.7187 0.0035 0 62.11 3.90E-06 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.8052.8052.2.dta 1 3 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 886 60247 30 30 26 26 2741 3782 1 0 0 675.8647 1349.7149 2 1349.7191 -0.0041 1 69.6 2.00E-06 R TAAENEFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4107.4107.2.dta 1 3 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 886 60247 30 30 26 26 2742 3777 1 0 0 450.9136 1349.719 3 1349.7191 -0.0001 1 46.08 0.00017 R TAAENEFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4102.4102.3.dta 1 3 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 886 60247 30 30 26 26 2761 4641 1 0 0 679.3676 1356.7206 2 1356.7249 -0.0043 1 67.63 3.70E-06 K NKLEGLEDALQK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5068.5068.2.dta 1 3 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 886 60247 30 30 26 26 2762 4640 1 0 0 453.249 1356.7252 3 1356.7249 0.0003 1 52.18 1.70E-05 K NKLEGLEDALQK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5067.5067.3.dta 1 3 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 886 60247 30 30 26 26 2960 6433 1 0 0 704.36 1406.7054 2 1406.7041 0.0013 0 98.57 2.50E-09 K ADTLTDEINFLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7317.7317.2.dta 1 3 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 886 60247 30 30 26 26 3016 3507 1 0 0 712.819 1423.6235 2 1423.6263 -0.0028 0 61.37 2.70E-06 R GSGGLGGACGGAGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3805.3805.2.dta 1 3 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 886 60247 30 30 26 26 3061 3343 1 0 1 718.3714 1434.7282 2 1434.7315 -0.0032 0 45.78 5.10E-05 R ATGGGLSSVGGGSSTIK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3618.3618.2.dta 1 3 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 886 60247 30 30 26 26 3319 5222 1 0 0 503.2781 1506.8124 3 1506.8116 0.0008 1 30.42 0.0014 R LLKEYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5743.5743.3.dta 1 3 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 886 60247 30 30 26 26 3633 4265 1 0 0 799.8827 1597.7508 2 1597.7519 -0.001 0 86.57 3.40E-08 R ISIGGGSCAISGGYGSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4634.4634.2.dta 1 3 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 886 60247 30 30 26 26 4027 3023 1 0 0 556.5931 1666.7576 3 1666.7594 -0.0018 1 59.25 4.50E-06 R SRGSGGLGGACGGAGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3225.3225.3.dta 1 3 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 886 60247 30 30 26 26 4188 4415 1 0 0 565.6188 1693.8345 3 1693.8345 0 1 30.12 0.0019 K DVDAAYMNKVELQAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4804.4804.3.dta 1 3 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 886 60247 30 30 26 26 4420 5236 1 0 0 587.3243 1758.9512 3 1758.9516 -0.0004 1 35.37 0.00098 K VLDTKWTLLQEQGTK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5760.5760.3.dta 1 3 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 886 60247 30 30 26 26 4816 7436 1 0 0 630.9953 1889.9641 3 1889.9635 0.0006 0 40.45 0.00016 R QNLEPLFEQYINNLR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.8557.8557.3.dta 1 3 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 886 60247 30 30 26 26 6251 8273 1 0 0 806.7548 2417.2426 3 2417.2438 -0.0011 1 31.54 0.0031 R NLDLDSIIAEVKAQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9562.9562.3.dta 1 3 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 886 60247 30 30 26 26 6252 8282 1 0 0 605.3182 2417.2436 4 2417.2438 -0.0002 1 16.02 0.031 R NLDLDSIIAEVKAQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9573.9573.4.dta 1 4 IPI00220327.3 "Keratin, type II cytoskeletal 1" 707 66149 18 18 18 18 1164 4193 1 0 1 487.269 972.5235 2 972.524 -0.0005 0 50.66 0.00023 K IEISELNR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4556.4556.2.dta 1 4 IPI00220327.3 "Keratin, type II cytoskeletal 1" 707 66149 18 18 18 18 1273 3079 1 0 1 500.2262 998.4378 2 998.4379 -0.0001 0 40.56 0.00036 K DVDGAYMTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3299.3299.2.dta 1 4 IPI00220327.3 "Keratin, type II cytoskeletal 1" 707 66149 18 18 18 18 1676 1417 1 0 1 546.7543 1091.494 2 1091.4956 -0.0016 0 81.51 8.60E-08 R GSGGGSSGGSIGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1430.1430.2.dta 1 4 IPI00220327.3 "Keratin, type II cytoskeletal 1" 707 66149 18 18 18 18 1983 1447 1 0 1 588.3026 1174.5906 2 1174.5942 -0.0037 1 28.67 0.0078 R VDQLKSDQSR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1464.1464.2.dta 1 4 IPI00220327.3 "Keratin, type II cytoskeletal 1" 707 66149 18 18 18 18 2004 4285 1 0 1 590.3035 1178.5924 2 1178.5931 -0.0007 0 57.39 3.70E-05 K YEELQITAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4655.4655.2.dta 1 4 IPI00220327.3 "Keratin, type II cytoskeletal 1" 707 66149 18 18 18 18 2395 4552 1 0 1 633.3206 1264.6266 2 1264.6299 -0.0033 0 66.07 5.20E-06 R TNAENEFVTIK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4964.4964.2.dta 1 4 IPI00220327.3 "Keratin, type II cytoskeletal 1" 707 66149 18 18 18 18 2437 6291 1 0 1 639.3584 1276.7022 2 1276.7027 -0.0004 0 79.72 1.50E-07 K LALDLEIATYR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7122.7122.2.dta 1 4 IPI00220327.3 "Keratin, type II cytoskeletal 1" 707 66149 18 18 18 18 2534 3664 1 0 1 651.8525 1301.6904 2 1301.6939 -0.0035 1 30.05 0.005 R NSKIEISELNR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3977.3977.2.dta 1 4 IPI00220327.3 "Keratin, type II cytoskeletal 1" 707 66149 18 18 18 18 2535 7043 1 0 1 651.8619 1301.7092 2 1301.7078 0.0014 0 99 2.20E-09 R SLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.8065.8065.2.dta 1 4 IPI00220327.3 "Keratin, type II cytoskeletal 1" 707 66149 18 18 18 18 2687 2521 1 0 1 670.8373 1339.6601 2 1339.6619 -0.0018 1 69.53 1.20E-06 K SKAEAESLYQSK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2655.2655.2.dta 1 4 IPI00220327.3 "Keratin, type II cytoskeletal 1" 707 66149 18 18 18 18 2906 3620 1 0 1 697.3688 1392.723 2 1392.7249 -0.0019 1 66.9 1.10E-06 R TNAENEFVTIKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3928.3928.2.dta 1 4 IPI00220327.3 "Keratin, type II cytoskeletal 1" 707 66149 18 18 18 18 3227 5809 1 0 1 738.378 1474.7414 2 1474.7416 -0.0002 0 51.23 5.60E-05 K WELLQQVDTSTR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6511.6511.2.dta 1 4 IPI00220327.3 "Keratin, type II cytoskeletal 1" 707 66149 18 18 18 18 3228 4063 1 0 1 738.3967 1474.7788 2 1474.778 0.0008 0 76.28 2.80E-07 R FLEQQNQVLQTK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4414.4414.2.dta 1 4 IPI00220327.3 "Keratin, type II cytoskeletal 1" 707 66149 18 18 18 18 4434 4256 1 0 1 883.3698 1764.7251 2 1764.7275 -0.0024 0 105.24 7.30E-11 R FSSCGGGGGSFGAGGGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4624.4624.2.dta 1 4 IPI00220327.3 "Keratin, type II cytoskeletal 1" 707 66149 18 18 18 18 5705 4937 1 0 1 762.7128 2285.1167 3 2285.1175 -0.0008 1 29.73 0.0016 K AEAESLYQSKYEELQITAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5417.5417.3.dta 1 4 IPI00220327.3 "Keratin, type II cytoskeletal 1" 707 66149 18 18 18 18 6143 2501 1 0 1 795.3217 2382.9433 3 2382.9447 -0.0013 0 48.48 1.40E-05 R GGGGGGYGSGGSSYGSGGGSYGSGGGGGGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2633.2633.3.dta 1 4 IPI00220327.3 "Keratin, type II cytoskeletal 1" 707 66149 18 18 18 18 6671 3780 1 0 1 855.7247 2564.1522 3 2564.1595 -0.0074 0 15.54 0.035 R MSGECAPNVSVSVSTSHTTISGGGSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4105.4105.3.dta 1 4 IPI00220327.3 "Keratin, type II cytoskeletal 1" 707 66149 18 18 18 18 7849 6187 1 0 1 978.1762 2931.5068 3 2931.509 -0.0022 1 63.95 3.20E-06 R FLEQQNQVLQTKWELLQQVDTSTR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6989.6989.3.dta 1 5 IPI00306959.10 "Keratin, type II cytoskeletal 7" 538 51443 18 18 16 16 575 4682 1 0 0 414.2184 826.4222 2 826.4225 -0.0003 0 41.77 0.0013 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5115.5115.2.dta 1 5 IPI00306959.10 "Keratin, type II cytoskeletal 7" 538 51443 18 18 16 16 880 2448 1 0 0 453.7381 905.4616 2 905.4607 0.001 0 42.17 0.0019 R FLEQQNK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2576.2576.2.dta 1 5 IPI00306959.10 "Keratin, type II cytoskeletal 7" 538 51443 18 18 16 16 987 2514 1 0 0 466.7373 931.46 2 931.461 -0.001 0 31.67 0.0031 K LLEGEESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2647.2647.2.dta 1 5 IPI00306959.10 "Keratin, type II cytoskeletal 7" 538 51443 18 18 16 16 1481 5163 1 0 1 523.2874 1044.5603 2 1044.5604 -0.0001 0 35.84 0.0012 K WTLLQEQK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5677.5677.2.dta 1 5 IPI00306959.10 "Keratin, type II cytoskeletal 7" 538 51443 18 18 16 16 1647 4604 1 0 0 361.5381 1081.5923 3 1081.592 0.0003 1 27.56 0.018 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5024.5024.3.dta 1 5 IPI00306959.10 "Keratin, type II cytoskeletal 7" 538 51443 18 18 16 16 1648 4597 1 0 0 541.8035 1081.5925 2 1081.592 0.0005 1 45.13 0.00051 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5015.5015.2.dta 1 5 IPI00306959.10 "Keratin, type II cytoskeletal 7" 538 51443 18 18 16 16 1719 3628 1 0 1 552.7924 1103.5703 2 1103.5724 -0.0021 0 56.07 4.90E-05 R SAYGGPVGAGIR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3937.3937.2.dta 1 5 IPI00306959.10 "Keratin, type II cytoskeletal 7" 538 51443 18 18 16 16 2304 1603 1 0 1 623.3243 1244.6341 2 1244.636 -0.0019 1 25.67 0.037 R VRQEESEQIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1632.1632.2.dta 1 5 IPI00306959.10 "Keratin, type II cytoskeletal 7" 538 51443 18 18 16 16 2426 6775 1 0 1 636.8563 1271.698 2 1271.6973 0.0007 0 102.66 9.60E-10 R SLDLDGIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7728.7728.2.dta 1 5 IPI00306959.10 "Keratin, type II cytoskeletal 7" 538 51443 18 18 16 16 2437 6291 1 0 0 639.3584 1276.7022 2 1276.7027 -0.0004 0 79.72 1.50E-07 K LALDIEIATYR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7122.7122.2.dta 1 5 IPI00306959.10 "Keratin, type II cytoskeletal 7" 538 51443 18 18 16 16 2729 4205 1 0 1 450.2538 1347.7395 3 1347.7398 -0.0003 1 21.73 0.012 R TAAENEFVVLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4569.4569.3.dta 1 5 IPI00306959.10 "Keratin, type II cytoskeletal 7" 538 51443 18 18 16 16 2986 6270 1 0 1 709.8679 1417.7212 2 1417.7201 0.001 0 81.41 3.00E-08 K VDALNDEINFLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7095.7095.2.dta 1 5 IPI00306959.10 "Keratin, type II cytoskeletal 7" 538 51443 18 18 16 16 3107 3211 1 0 1 721.3909 1440.7673 2 1440.7684 -0.0011 1 67.28 7.30E-07 R LQAEIDNIKNQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3451.3451.2.dta 1 5 IPI00306959.10 "Keratin, type II cytoskeletal 7" 538 51443 18 18 16 16 3108 3202 1 0 1 481.2632 1440.7676 3 1440.7684 -0.0008 1 39.48 0.0003 R LQAEIDNIKNQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3441.3441.3.dta 1 5 IPI00306959.10 "Keratin, type II cytoskeletal 7" 538 51443 18 18 16 16 3111 6892 1 0 1 721.9041 1441.7937 2 1441.7929 0.0008 0 86.26 9.80E-09 R LPDIFEAQIAGLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7867.7867.2.dta 1 5 IPI00306959.10 "Keratin, type II cytoskeletal 7" 538 51443 18 18 16 16 5288 6364 1 0 1 696.7045 2087.0918 3 2087.0898 0.0019 1 60.42 2.20E-06 K VELEAKVDALNDEINFLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7235.7235.3.dta 1 5 IPI00306959.10 "Keratin, type II cytoskeletal 7" 538 51443 18 18 16 16 5460 8068 1 0 1 741.7123 2222.1152 3 2222.114 0.0012 1 28.05 0.0074 R SLDLDGIIAEVKAQYEEMAK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9317.9317.3.dta 1 5 IPI00306959.10 "Keratin, type II cytoskeletal 7" 538 51443 18 18 16 16 6369 6542 1 0 1 817.1192 2448.3358 3 2448.3336 0.0022 1 23.69 0.019 R EVTINQSLLAPLRLDADPSLQR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7456.7456.3.dta 1 6 IPI00009867.2 "Keratin, type II cytoskeletal 5" 456 62637 16 16 15 15 575 4682 1 0 0 414.2184 826.4222 2 826.4225 -0.0003 0 41.77 0.0013 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5115.5115.2.dta 1 6 IPI00009867.2 "Keratin, type II cytoskeletal 5" 456 62637 16 16 15 15 727 1911 1 0 1 433.1993 864.384 2 864.3839 0.0001 0 63.22 1.20E-06 R SGGGGGGGFGR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1973.1973.2.dta 1 6 IPI00009867.2 "Keratin, type II cytoskeletal 5" 456 62637 16 16 15 15 880 2448 1 0 0 453.7381 905.4616 2 905.4607 0.001 0 42.17 0.0019 R FLEQQNK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2576.2576.2.dta 1 6 IPI00009867.2 "Keratin, type II cytoskeletal 5" 456 62637 16 16 15 15 1045 2718 1 0 0 473.2597 944.5048 2 944.5039 0.0009 1 31.47 0.017 R GRLDSELR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2873.2873.2.dta 1 6 IPI00009867.2 "Keratin, type II cytoskeletal 5" 456 62637 16 16 15 15 1348 1915 1 0 1 508.2344 1014.4543 2 1014.4552 -0.0009 0 14.51 0.044 K HEISEMNR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1977.1977.2.dta 1 6 IPI00009867.2 "Keratin, type II cytoskeletal 5" 456 62637 16 16 15 15 1647 4604 1 0 0 361.5381 1081.5923 3 1081.592 0.0003 1 27.56 0.018 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5024.5024.3.dta 1 6 IPI00009867.2 "Keratin, type II cytoskeletal 5" 456 62637 16 16 15 15 1648 4597 1 0 0 541.8035 1081.5925 2 1081.592 0.0005 1 45.13 0.00051 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5015.5015.2.dta 1 6 IPI00009867.2 "Keratin, type II cytoskeletal 5" 456 62637 16 16 15 15 1836 2369 1 0 0 567.2827 1132.5509 2 1132.5546 -0.0038 1 47.01 0.00012 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2489.2489.2.dta 1 6 IPI00009867.2 "Keratin, type II cytoskeletal 5" 456 62637 16 16 15 15 2058 2723 1 0 1 597.7911 1193.5676 2 1193.5676 0 0 68.66 2.90E-06 K YEELQQTAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2878.2878.2.dta 1 6 IPI00009867.2 "Keratin, type II cytoskeletal 5" 456 62637 16 16 15 15 2389 5837 1 0 0 632.3508 1262.6871 2 1262.687 0.0001 0 88.62 2.10E-08 K LALDVEIATYR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6548.6548.2.dta 1 6 IPI00009867.2 "Keratin, type II cytoskeletal 5" 456 62637 16 16 15 15 2652 7034 1 0 0 665.3684 1328.7223 2 1328.7187 0.0035 0 62.11 3.90E-06 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.8052.8052.2.dta 1 6 IPI00009867.2 "Keratin, type II cytoskeletal 5" 456 62637 16 16 15 15 2964 4036 1 0 1 705.8424 1409.6703 2 1409.6722 -0.0019 0 90.24 4.20E-09 R VSLAGACGVGGYGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4382.4382.2.dta 1 6 IPI00009867.2 "Keratin, type II cytoskeletal 5" 456 62637 16 16 15 15 2966 4238 1 0 1 705.8636 1409.7127 2 1409.7151 -0.0023 0 31.14 0.0012 R SFSTASAITPSVSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4604.4604.2.dta 1 6 IPI00009867.2 "Keratin, type II cytoskeletal 5" 456 62637 16 16 15 15 4420 5236 1 0 0 587.3243 1758.9512 3 1758.9516 -0.0004 1 35.37 0.00098 K VLDTKWTLLQEQGTK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5760.5760.3.dta 1 6 IPI00009867.2 "Keratin, type II cytoskeletal 5" 456 62637 16 16 15 15 4816 7436 1 0 0 630.9953 1889.9641 3 1889.9635 0.0006 0 40.45 0.00016 R QNLEPLFEQYINNLR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.8557.8557.3.dta 1 6 IPI00009867.2 "Keratin, type II cytoskeletal 5" 456 62637 16 16 15 15 6212 8306 1 0 1 802.0827 2403.2263 3 2403.2281 -0.0018 1 34.24 0.00062 R NLDLDSIIAEVKAQYEEIANR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9601.9601.3.dta 1 7 IPI00418471.6 Vimentin 303 53676 11 11 11 11 880 2448 1 0 0 453.7381 905.4616 2 905.4607 0.001 0 42.17 0.0019 R FLEQQNK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2576.2576.2.dta 1 7 IPI00418471.6 Vimentin 303 53676 11 11 11 11 987 2514 1 0 0 466.7373 931.46 2 931.461 -0.001 0 31.67 0.0031 K LLEGEESR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2647.2647.2.dta 1 7 IPI00418471.6 Vimentin 303 53676 11 11 11 11 1391 2099 1 0 1 512.2587 1022.5028 2 1022.5032 -0.0005 0 35.75 0.00083 R QQYESVAAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2184.2184.2.dta 1 7 IPI00418471.6 Vimentin 303 53676 11 11 11 11 2566 4886 1 0 1 655.305 1308.5954 2 1308.5986 -0.0032 0 47.61 0.00023 K NLQEAEEWYK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5354.5354.2.dta 1 7 IPI00418471.6 Vimentin 303 53676 11 11 11 11 3031 3994 1 0 1 714.8583 1427.702 2 1427.7045 -0.0025 0 63.54 1.10E-06 R SLYASSPGGVYATR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4336.4336.2.dta 1 7 IPI00418471.6 Vimentin 303 53676 11 11 11 11 3378 4414 1 0 1 509.9473 1526.82 3 1526.8205 -0.0005 1 27.45 0.025 R HLREYQDLLNVK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4803.4803.3.dta 1 7 IPI00418471.6 Vimentin 303 53676 11 11 11 11 3414 5520 1 0 1 513.9747 1538.9024 3 1538.9032 -0.0008 1 34.29 0.0011 K ILLAELEQLKGQGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6119.6119.3.dta 1 7 IPI00418471.6 Vimentin 303 53676 11 11 11 11 3599 3632 1 0 1 529.9366 1586.7879 3 1586.79 -0.0021 1 47.64 0.00034 R TNEKVELQELNDR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3941.3941.3.dta 1 7 IPI00418471.6 Vimentin 303 53676 11 11 11 11 4129 5053 1 0 1 563.6123 1687.8151 3 1687.8199 -0.0048 1 45.81 5.10E-05 R VEVERDNLAEDIMR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5547.5547.3.dta 1 7 IPI00418471.6 Vimentin 303 53676 11 11 11 11 4459 3971 1 0 1 592.9592 1775.8557 3 1775.855 0.0006 1 44.79 0.0003 K FADLSEAANRNNDALR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4310.4310.3.dta 1 7 IPI00418471.6 Vimentin 303 53676 11 11 11 11 5346 7402 1 0 1 1063.535 2125.0555 2 2125.0579 -0.0024 0 86.43 7.90E-09 R LLQDSVDFSLADAINTEFK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.8516.8516.2.dta 1 8 IPI00166205.2 Keratin-78 51 57728 3 3 3 3 880 2448 1 0 0 453.7381 905.4616 2 905.4607 0.001 0 42.17 0.0019 R FLEQQNK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2576.2576.2.dta 1 8 IPI00166205.2 Keratin-78 51 57728 3 3 3 3 2925 4991 1 0 1 466.575 1396.703 3 1396.6987 0.0044 0 25.78 0.0052 R TLNNQFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5476.5476.3.dta 1 8 IPI00166205.2 Keratin-78 51 57728 3 3 3 3 3229 3563 1 0 0 492.9391 1475.7954 3 1475.7984 -0.0029 1 22.58 0.014 R FLEQQNKVLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3867.3867.3.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 931 60273 30 30 26 26 74 2616 1 0 0 314.6931 627.3717 2 627.3704 0.0013 0 26.28 0.037 R LPGVSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2760.2760.2.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 931 60273 30 30 26 26 575 4682 1 0 0 414.2184 826.4222 2 826.4225 -0.0003 0 41.77 0.0013 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5115.5115.2.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 931 60273 30 30 26 26 880 2448 1 0 0 453.7381 905.4616 2 905.4607 0.001 0 42.17 0.0019 R FLEQQNK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2576.2576.2.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 931 60273 30 30 26 26 1045 2718 1 0 0 473.2597 944.5048 2 944.5039 0.0009 1 31.47 0.017 R GRLDSELR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2873.2873.2.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 931 60273 30 30 26 26 1401 4065 1 0 0 513.7648 1025.515 2 1025.5142 0.0008 0 57.59 4.00E-06 R SGFSSISVSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4416.4416.2.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 931 60273 30 30 26 26 1448 3309 1 0 0 519.2908 1036.567 2 1036.5665 0.0005 1 33.23 0.00092 R SLYGLGGSKR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3578.3578.2.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 931 60273 30 30 26 26 1647 4604 1 0 0 361.5381 1081.5923 3 1081.592 0.0003 1 27.56 0.018 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5024.5024.3.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 931 60273 30 30 26 26 1648 4597 1 0 0 541.8035 1081.5925 2 1081.592 0.0005 1 45.13 0.00051 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5015.5015.2.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 931 60273 30 30 26 26 1704 1960 1 0 0 366.2087 1095.6044 3 1095.6036 0.0008 1 30.84 0.0019 R LRSEIDHVK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2026.2026.3.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 931 60273 30 30 26 26 1836 2369 1 0 0 567.2827 1132.5509 2 1132.5546 -0.0038 1 47.01 0.00012 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2489.2489.2.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 931 60273 30 30 26 26 1916 4349 1 0 0 577.2816 1152.5487 2 1152.5485 0.0002 0 39.48 0.00061 K EYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4726.4726.2.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 931 60273 30 30 26 26 1946 3733 1 0 0 583.2939 1164.5732 2 1164.5775 -0.0043 0 83.38 1.00E-07 K YEELQVTAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4054.4054.2.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 931 60273 30 30 26 26 2389 5837 1 0 0 632.3508 1262.6871 2 1262.687 0.0001 0 88.62 2.10E-08 K LALDVEIATYR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6548.6548.2.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 931 60273 30 30 26 26 2593 2714 1 0 0 439.2384 1314.6933 3 1314.6891 0.0042 1 56.59 4.50E-05 R NTKQEIAEINR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2867.2867.3.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 931 60273 30 30 26 26 2652 7034 1 0 0 665.3684 1328.7223 2 1328.7187 0.0035 0 62.11 3.90E-06 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.8052.8052.2.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 931 60273 30 30 26 26 2741 3782 1 0 0 675.8647 1349.7149 2 1349.7191 -0.0041 1 69.6 2.00E-06 R TAAENEFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4107.4107.2.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 931 60273 30 30 26 26 2742 3777 1 0 0 450.9136 1349.719 3 1349.7191 -0.0001 1 46.08 0.00017 R TAAENEFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4102.4102.3.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 931 60273 30 30 26 26 2761 4641 1 0 0 679.3676 1356.7206 2 1356.7249 -0.0043 1 67.63 3.70E-06 K NKLEGLEDALQK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5068.5068.2.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 931 60273 30 30 26 26 2762 4640 1 0 0 453.249 1356.7252 3 1356.7249 0.0003 1 52.18 1.70E-05 K NKLEGLEDALQK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5067.5067.3.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 931 60273 30 30 26 26 2960 6433 1 0 0 704.36 1406.7054 2 1406.7041 0.0013 0 98.57 2.50E-09 K ADTLTDEINFLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7317.7317.2.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 931 60273 30 30 26 26 3016 3507 1 0 0 712.819 1423.6235 2 1423.6263 -0.0028 0 61.37 2.70E-06 R GSGGLGGACGGAGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3805.3805.2.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 931 60273 30 30 26 26 3122 4064 1 0 1 724.3915 1446.7685 2 1446.7678 0.0007 0 94.18 1.50E-09 R AIGGGLSSVGGGSSTIK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4415.4415.2.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 931 60273 30 30 26 26 3319 5222 1 0 0 503.2781 1506.8124 3 1506.8116 0.0008 1 30.42 0.0014 R LLKEYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5743.5743.3.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 931 60273 30 30 26 26 3633 4265 1 0 0 799.8827 1597.7508 2 1597.7519 -0.001 0 86.57 3.40E-08 R ISIGGGSCAISGGYGSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4634.4634.2.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 931 60273 30 30 26 26 4027 3023 1 0 0 556.5931 1666.7576 3 1666.7594 -0.0018 1 59.25 4.50E-06 R SRGSGGLGGACGGAGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3225.3225.3.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 931 60273 30 30 26 26 4188 4415 1 0 0 565.6188 1693.8345 3 1693.8345 0 1 30.12 0.0019 K DVDAAYMNKVELQAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4804.4804.3.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 931 60273 30 30 26 26 4420 5236 1 0 0 587.3243 1758.9512 3 1758.9516 -0.0004 1 35.37 0.00098 K VLDTKWTLLQEQGTK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5760.5760.3.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 931 60273 30 30 26 26 4816 7436 1 0 0 630.9953 1889.9641 3 1889.9635 0.0006 0 40.45 0.00016 R QNLEPLFEQYINNLR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.8557.8557.3.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 931 60273 30 30 26 26 6251 8273 1 0 0 806.7548 2417.2426 3 2417.2438 -0.0011 1 31.54 0.0031 R NLDLDSIIAEVKAQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9562.9562.3.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 931 60273 30 30 26 26 6252 8282 1 0 0 605.3182 2417.2436 4 2417.2438 -0.0002 1 16.02 0.031 R NLDLDSIIAEVKAQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9573.9573.4.dta 1 IPI00816709.1 Keratin 6C 892 60245 27 27 24 24 74 2616 1 0 0 314.6931 627.3717 2 627.3704 0.0013 0 26.28 0.037 R LPGVSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2760.2760.2.dta 1 IPI00816709.1 Keratin 6C 892 60245 27 27 24 24 575 4682 1 0 0 414.2184 826.4222 2 826.4225 -0.0003 0 41.77 0.0013 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5115.5115.2.dta 1 IPI00816709.1 Keratin 6C 892 60245 27 27 24 24 1045 2718 1 0 0 473.2597 944.5048 2 944.5039 0.0009 1 31.47 0.017 R GRLDSELR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2873.2873.2.dta 1 IPI00816709.1 Keratin 6C 892 60245 27 27 24 24 1401 4065 1 0 0 513.7648 1025.515 2 1025.5142 0.0008 0 57.59 4.00E-06 R SGFSSISVSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4416.4416.2.dta 1 IPI00816709.1 Keratin 6C 892 60245 27 27 24 24 1448 3309 1 0 0 519.2908 1036.567 2 1036.5665 0.0005 1 33.23 0.00092 R SLYGLGGSKR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3578.3578.2.dta 1 IPI00816709.1 Keratin 6C 892 60245 27 27 24 24 1704 1960 1 0 0 366.2087 1095.6044 3 1095.6036 0.0008 1 30.84 0.0019 R LRSEIDHVK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2026.2026.3.dta 1 IPI00816709.1 Keratin 6C 892 60245 27 27 24 24 1836 2369 1 0 0 567.2827 1132.5509 2 1132.5546 -0.0038 1 47.01 0.00012 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2489.2489.2.dta 1 IPI00816709.1 Keratin 6C 892 60245 27 27 24 24 1916 4349 1 0 0 577.2816 1152.5487 2 1152.5485 0.0002 0 39.48 0.00061 K EYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4726.4726.2.dta 1 IPI00816709.1 Keratin 6C 892 60245 27 27 24 24 1946 3733 1 0 0 583.2939 1164.5732 2 1164.5775 -0.0043 0 83.38 1.00E-07 K YEELQVTAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4054.4054.2.dta 1 IPI00816709.1 Keratin 6C 892 60245 27 27 24 24 2389 5837 1 0 0 632.3508 1262.6871 2 1262.687 0.0001 0 88.62 2.10E-08 K LALDVEIATYR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6548.6548.2.dta 1 IPI00816709.1 Keratin 6C 892 60245 27 27 24 24 2593 2714 1 0 0 439.2384 1314.6933 3 1314.6891 0.0042 1 56.59 4.50E-05 R NTKQEIAEINR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2867.2867.3.dta 1 IPI00816709.1 Keratin 6C 892 60245 27 27 24 24 2652 7034 1 0 0 665.3684 1328.7223 2 1328.7187 0.0035 0 62.11 3.90E-06 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.8052.8052.2.dta 1 IPI00816709.1 Keratin 6C 892 60245 27 27 24 24 2741 3782 1 0 0 675.8647 1349.7149 2 1349.7191 -0.0041 1 69.6 2.00E-06 R TAAENEFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4107.4107.2.dta 1 IPI00816709.1 Keratin 6C 892 60245 27 27 24 24 2742 3777 1 0 0 450.9136 1349.719 3 1349.7191 -0.0001 1 46.08 0.00017 R TAAENEFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4102.4102.3.dta 1 IPI00816709.1 Keratin 6C 892 60245 27 27 24 24 2761 4641 1 0 0 679.3676 1356.7206 2 1356.7249 -0.0043 1 67.63 3.70E-06 K NKLEGLEDALQK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5068.5068.2.dta 1 IPI00816709.1 Keratin 6C 892 60245 27 27 24 24 2762 4640 1 0 0 453.249 1356.7252 3 1356.7249 0.0003 1 52.18 1.70E-05 K NKLEGLEDALQK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5067.5067.3.dta 1 IPI00816709.1 Keratin 6C 892 60245 27 27 24 24 2960 6433 1 0 0 704.36 1406.7054 2 1406.7041 0.0013 0 98.57 2.50E-09 K ADTLTDEINFLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7317.7317.2.dta 1 IPI00816709.1 Keratin 6C 892 60245 27 27 24 24 3016 3507 1 0 0 712.819 1423.6235 2 1423.6263 -0.0028 0 61.37 2.70E-06 R GSGGLGGACGGAGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3805.3805.2.dta 1 IPI00816709.1 Keratin 6C 892 60245 27 27 24 24 3122 4064 1 0 1 724.3915 1446.7685 2 1446.7678 0.0007 0 94.18 1.50E-09 R AIGGGLSSVGGGSSTIK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4415.4415.2.dta 1 IPI00816709.1 Keratin 6C 892 60245 27 27 24 24 3319 5222 1 0 0 503.2781 1506.8124 3 1506.8116 0.0008 1 30.42 0.0014 R LLKEYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5743.5743.3.dta 1 IPI00816709.1 Keratin 6C 892 60245 27 27 24 24 3633 4265 1 0 0 799.8827 1597.7508 2 1597.7519 -0.001 0 86.57 3.40E-08 R ISIGGGSCAISGGYGSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4634.4634.2.dta 1 IPI00816709.1 Keratin 6C 892 60245 27 27 24 24 4027 3023 1 0 0 556.5931 1666.7576 3 1666.7594 -0.0018 1 59.25 4.50E-06 R SRGSGGLGGACGGAGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3225.3225.3.dta 1 IPI00816709.1 Keratin 6C 892 60245 27 27 24 24 4188 4415 1 0 0 565.6188 1693.8345 3 1693.8345 0 1 30.12 0.0019 K DVDAAYMNKVELQAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4804.4804.3.dta 1 IPI00816709.1 Keratin 6C 892 60245 27 27 24 24 4420 5236 1 0 0 587.3243 1758.9512 3 1758.9516 -0.0004 1 35.37 0.00098 K VLDTKWTLLQEQGTK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5760.5760.3.dta 1 IPI00816709.1 Keratin 6C 892 60245 27 27 24 24 4816 7436 1 0 0 630.9953 1889.9641 3 1889.9635 0.0006 0 40.45 0.00016 R QNLEPLFEQYINNLR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.8557.8557.3.dta 1 IPI00816709.1 Keratin 6C 892 60245 27 27 24 24 6251 8273 1 0 0 806.7548 2417.2426 3 2417.2438 -0.0011 1 31.54 0.0031 R NLDLDSIIAEVKAQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9562.9562.3.dta 1 IPI00816709.1 Keratin 6C 892 60245 27 27 24 24 6252 8282 1 0 0 605.3182 2417.2436 4 2417.2438 -0.0002 1 16.02 0.031 R NLDLDSIIAEVKAQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9573.9573.4.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 878 60293 29 29 25 25 74 2616 1 0 0 314.6931 627.3717 2 627.3704 0.0013 0 26.28 0.037 R LPGVSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2760.2760.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 878 60293 29 29 25 25 575 4682 1 0 0 414.2184 826.4222 2 826.4225 -0.0003 0 41.77 0.0013 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5115.5115.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 878 60293 29 29 25 25 880 2448 1 0 0 453.7381 905.4616 2 905.4607 0.001 0 42.17 0.0019 R FLEQQNK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2576.2576.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 878 60293 29 29 25 25 1045 2718 1 0 0 473.2597 944.5048 2 944.5039 0.0009 1 31.47 0.017 R GRLDSELR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2873.2873.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 878 60293 29 29 25 25 1448 3309 1 0 0 519.2908 1036.567 2 1036.5665 0.0005 1 33.23 0.00092 R SLYGLGGSKR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3578.3578.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 878 60293 29 29 25 25 1647 4604 1 0 0 361.5381 1081.5923 3 1081.592 0.0003 1 27.56 0.018 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5024.5024.3.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 878 60293 29 29 25 25 1648 4597 1 0 0 541.8035 1081.5925 2 1081.592 0.0005 1 45.13 0.00051 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5015.5015.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 878 60293 29 29 25 25 1704 1960 1 0 0 366.2087 1095.6044 3 1095.6036 0.0008 1 30.84 0.0019 R LRSEIDHVK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2026.2026.3.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 878 60293 29 29 25 25 1836 2369 1 0 0 567.2827 1132.5509 2 1132.5546 -0.0038 1 47.01 0.00012 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2489.2489.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 878 60293 29 29 25 25 1916 4349 1 0 0 577.2816 1152.5487 2 1152.5485 0.0002 0 39.48 0.00061 K EYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4726.4726.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 878 60293 29 29 25 25 1946 3733 1 0 0 583.2939 1164.5732 2 1164.5775 -0.0043 0 83.38 1.00E-07 K YEELQVTAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4054.4054.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 878 60293 29 29 25 25 2389 5837 1 0 0 632.3508 1262.6871 2 1262.687 0.0001 0 88.62 2.10E-08 K LALDVEIATYR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6548.6548.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 878 60293 29 29 25 25 2593 2714 1 0 0 439.2384 1314.6933 3 1314.6891 0.0042 1 56.59 4.50E-05 R NTKQEIAEINR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2867.2867.3.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 878 60293 29 29 25 25 2652 7034 1 0 0 665.3684 1328.7223 2 1328.7187 0.0035 0 62.11 3.90E-06 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.8052.8052.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 878 60293 29 29 25 25 2741 3782 1 0 0 675.8647 1349.7149 2 1349.7191 -0.0041 1 69.6 2.00E-06 R TAAENEFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4107.4107.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 878 60293 29 29 25 25 2742 3777 1 0 0 450.9136 1349.719 3 1349.7191 -0.0001 1 46.08 0.00017 R TAAENEFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4102.4102.3.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 878 60293 29 29 25 25 2761 4641 1 0 0 679.3676 1356.7206 2 1356.7249 -0.0043 1 67.63 3.70E-06 K NKLEGLEDALQK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5068.5068.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 878 60293 29 29 25 25 2762 4640 1 0 0 453.249 1356.7252 3 1356.7249 0.0003 1 52.18 1.70E-05 K NKLEGLEDALQK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5067.5067.3.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 878 60293 29 29 25 25 2960 6433 1 0 0 704.36 1406.7054 2 1406.7041 0.0013 0 98.57 2.50E-09 K ADTLTDEINFLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7317.7317.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 878 60293 29 29 25 25 3016 3507 1 0 0 712.819 1423.6235 2 1423.6263 -0.0028 0 61.37 2.70E-06 R GSGGLGGACGGAGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3805.3805.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 878 60293 29 29 25 25 3122 4064 1 0 1 724.3915 1446.7685 2 1446.7678 0.0007 0 94.18 1.50E-09 R AIGGGLSSVGGGSSTIK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4415.4415.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 878 60293 29 29 25 25 3229 3563 1 0 0 492.9391 1475.7954 3 1475.7984 -0.0029 1 22.58 0.014 R FLEQQNKVLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3867.3867.3.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 878 60293 29 29 25 25 3319 5222 1 0 0 503.2781 1506.8124 3 1506.8116 0.0008 1 30.42 0.0014 R LLKEYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5743.5743.3.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 878 60293 29 29 25 25 3633 4265 1 0 0 799.8827 1597.7508 2 1597.7519 -0.001 0 86.57 3.40E-08 R ISIGGGSCAISGGYGSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4634.4634.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 878 60293 29 29 25 25 4027 3023 1 0 0 556.5931 1666.7576 3 1666.7594 -0.0018 1 59.25 4.50E-06 R SRGSGGLGGACGGAGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3225.3225.3.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 878 60293 29 29 25 25 4188 4415 1 0 0 565.6188 1693.8345 3 1693.8345 0 1 30.12 0.0019 K DVDAAYMNKVELQAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4804.4804.3.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 878 60293 29 29 25 25 4816 7436 1 0 0 630.9953 1889.9641 3 1889.9635 0.0006 0 40.45 0.00016 R QNLEPLFEQYINNLR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.8557.8557.3.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 878 60293 29 29 25 25 6251 8273 1 0 0 806.7548 2417.2426 3 2417.2438 -0.0011 1 31.54 0.0031 R NLDLDSIIAEVKAQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9562.9562.3.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 878 60293 29 29 25 25 6252 8282 1 0 0 605.3182 2417.2436 4 2417.2438 -0.0002 1 16.02 0.031 R NLDLDSIIAEVKAQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9573.9573.4.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 680 42557 21 21 18 18 880 2448 1 0 0 453.7381 905.4616 2 905.4607 0.001 0 42.17 0.0019 R FLEQQNK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2576.2576.2.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 680 42557 21 21 18 18 1045 2718 1 0 0 473.2597 944.5048 2 944.5039 0.0009 1 31.47 0.017 R GRLDSELR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2873.2873.2.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 680 42557 21 21 18 18 1704 1960 1 0 0 366.2087 1095.6044 3 1095.6036 0.0008 1 30.84 0.0019 R LRSEIDHVK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2026.2026.3.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 680 42557 21 21 18 18 1836 2369 1 0 0 567.2827 1132.5509 2 1132.5546 -0.0038 1 47.01 0.00012 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2489.2489.2.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 680 42557 21 21 18 18 1916 4349 1 0 0 577.2816 1152.5487 2 1152.5485 0.0002 0 39.48 0.00061 K EYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4726.4726.2.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 680 42557 21 21 18 18 1946 3733 1 0 0 583.2939 1164.5732 2 1164.5775 -0.0043 0 83.38 1.00E-07 K YEELQVTAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4054.4054.2.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 680 42557 21 21 18 18 2389 5837 1 0 0 632.3508 1262.6871 2 1262.687 0.0001 0 88.62 2.10E-08 K LALDVEIATYR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6548.6548.2.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 680 42557 21 21 18 18 2593 2714 1 0 0 439.2384 1314.6933 3 1314.6891 0.0042 1 56.59 4.50E-05 R NTKQEIAEINR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2867.2867.3.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 680 42557 21 21 18 18 2652 7034 1 0 0 665.3684 1328.7223 2 1328.7187 0.0035 0 62.11 3.90E-06 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.8052.8052.2.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 680 42557 21 21 18 18 2741 3782 1 0 0 675.8647 1349.7149 2 1349.7191 -0.0041 1 69.6 2.00E-06 R TAAENEFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4107.4107.2.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 680 42557 21 21 18 18 2742 3777 1 0 0 450.9136 1349.719 3 1349.7191 -0.0001 1 46.08 0.00017 R TAAENEFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4102.4102.3.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 680 42557 21 21 18 18 2761 4641 1 0 0 679.3676 1356.7206 2 1356.7249 -0.0043 1 67.63 3.70E-06 K NKLEGLEDALQK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5068.5068.2.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 680 42557 21 21 18 18 2762 4640 1 0 0 453.249 1356.7252 3 1356.7249 0.0003 1 52.18 1.70E-05 K NKLEGLEDALQK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5067.5067.3.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 680 42557 21 21 18 18 2960 6433 1 0 0 704.36 1406.7054 2 1406.7041 0.0013 0 98.57 2.50E-09 K ADTLTDEINFLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7317.7317.2.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 680 42557 21 21 18 18 3122 4064 1 0 1 724.3915 1446.7685 2 1446.7678 0.0007 0 94.18 1.50E-09 R AIGGGLSSVGGGSSTIK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4415.4415.2.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 680 42557 21 21 18 18 3319 5222 1 0 0 503.2781 1506.8124 3 1506.8116 0.0008 1 30.42 0.0014 R LLKEYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5743.5743.3.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 680 42557 21 21 18 18 4188 4415 1 0 0 565.6188 1693.8345 3 1693.8345 0 1 30.12 0.0019 K DVDAAYMNKVELQAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4804.4804.3.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 680 42557 21 21 18 18 4420 5236 1 0 0 587.3243 1758.9512 3 1758.9516 -0.0004 1 35.37 0.00098 K VLDTKWTLLQEQGTK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5760.5760.3.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 680 42557 21 21 18 18 4816 7436 1 0 0 630.9953 1889.9641 3 1889.9635 0.0006 0 40.45 0.00016 R QNLEPLFEQYINNLR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.8557.8557.3.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 680 42557 21 21 18 18 6251 8273 1 0 0 806.7548 2417.2426 3 2417.2438 -0.0011 1 31.54 0.0031 R NLDLDSIIAEVKAQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9562.9562.3.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 680 42557 21 21 18 18 6252 8282 1 0 0 605.3182 2417.2436 4 2417.2438 -0.0002 1 16.02 0.031 R NLDLDSIIAEVKAQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9573.9573.4.dta 1 IPI00793917.1 27 kDa protein 563 26765 15 15 14 14 987 2514 1 0 0 466.7373 931.46 2 931.461 -0.001 0 31.67 0.0031 K LLEGEESR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2647.2647.2.dta 1 IPI00793917.1 27 kDa protein 563 26765 15 15 14 14 1278 4289 1 0 1 500.7875 999.5605 2 999.56 0.0004 0 39.84 0.0013 R LQAEIEGLK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4660.4660.2.dta 1 IPI00793917.1 27 kDa protein 563 26765 15 15 14 14 1817 5003 1 0 1 565.3135 1128.6125 2 1128.6138 -0.0013 0 99.07 3.00E-09 K LSELEAALQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5491.5491.2.dta 1 IPI00793917.1 27 kDa protein 563 26765 15 15 14 14 1855 4241 1 0 1 569.293 1136.5715 2 1136.5713 0.0002 0 59.13 3.40E-05 K YEELQSLAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4608.4608.2.dta 1 IPI00793917.1 27 kDa protein 563 26765 15 15 14 14 1916 4349 1 0 0 577.2816 1152.5487 2 1152.5485 0.0002 0 39.48 0.00061 R EYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4726.4726.2.dta 1 IPI00793917.1 27 kDa protein 563 26765 15 15 14 14 2162 2319 1 0 1 403.536 1207.5862 3 1207.5867 -0.0004 1 37.89 0.00028 R TKTEISEMNR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2433.2433.3.dta 1 IPI00793917.1 27 kDa protein 563 26765 15 15 14 14 2215 1493 1 0 1 612.7978 1223.581 2 1223.5816 -0.0005 1 19.47 0.019 R TKTEISEMNR N Oxidation (M) 0.0000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1514.1514.2.dta 1 IPI00793917.1 27 kDa protein 563 26765 15 15 14 14 2437 6291 1 0 0 639.3584 1276.7022 2 1276.7027 -0.0004 0 79.72 1.50E-07 K LALDIEIATYR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7122.7122.2.dta 1 IPI00793917.1 27 kDa protein 563 26765 15 15 14 14 2620 6479 1 0 1 660.8406 1319.6667 2 1319.6642 0.0025 0 92.41 1.30E-08 R SLDMDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7377.7377.2.dta 1 IPI00793917.1 27 kDa protein 563 26765 15 15 14 14 2697 3489 1 0 1 671.3763 1340.7381 2 1340.7412 -0.003 1 60.49 1.10E-05 R LQAEIEGLKGQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3784.3784.2.dta 1 IPI00793917.1 27 kDa protein 563 26765 15 15 14 14 2704 5364 1 0 1 672.8411 1343.6677 2 1343.6681 -0.0004 0 82.2 2.60E-08 R ASLEAAIADAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5912.5912.2.dta 1 IPI00793917.1 27 kDa protein 563 26765 15 15 14 14 2995 6622 1 0 1 710.378 1418.7414 2 1418.7405 0.0009 0 62.9 1.60E-06 R LEGLTDEINFLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7545.7545.2.dta 1 IPI00793917.1 27 kDa protein 563 26765 15 15 14 14 4502 4480 1 0 1 599.9496 1796.8271 3 1796.825 0.0021 1 68.98 1.20E-06 K DVDEAYMNKVELESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4882.4882.3.dta 1 IPI00793917.1 27 kDa protein 563 26765 15 15 14 14 5707 5533 1 0 1 763.3743 2287.101 3 2287.1041 -0.0032 1 27.24 0.0028 R AEAESMYQIKYEELQSLAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6133.6133.3.dta 1 IPI00793917.1 27 kDa protein 563 26765 15 15 14 14 6130 7846 1 0 1 794.3927 2380.1563 3 2380.158 -0.0017 1 51.95 2.70E-05 R SLDMDSIIAEVKAQYEDIANR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9056.9056.3.dta 1 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 512 47891 13 13 13 13 103 1175 1 0 1 322.2291 642.4437 2 642.4428 0.0009 1 38.2 0.00042 R AVVVKK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1171.1171.2.dta 1 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 512 47891 13 13 13 13 880 2448 1 0 0 453.7381 905.4616 2 905.4607 0.001 0 42.17 0.0019 R FLEQQNK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2576.2576.2.dta 1 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 512 47891 13 13 13 13 1422 5106 1 0 1 515.7877 1029.5609 2 1029.5607 0.0002 0 37.89 0.0035 K WSLLQQQK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5610.5610.2.dta 1 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 512 47891 13 13 13 13 1817 5003 1 0 1 565.3135 1128.6125 2 1128.6138 -0.0013 0 99.07 3.00E-09 K LSELEAALQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5491.5491.2.dta 1 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 512 47891 13 13 13 13 1855 4241 1 0 1 569.293 1136.5715 2 1136.5713 0.0002 0 59.13 3.40E-05 K YEELQSLAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4608.4608.2.dta 1 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 512 47891 13 13 13 13 1916 4349 1 0 0 577.2816 1152.5487 2 1152.5485 0.0002 0 39.48 0.00061 R EYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4726.4726.2.dta 1 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 512 47891 13 13 13 13 2093 2503 1 0 1 601.3292 1200.6439 2 1200.6462 -0.0023 1 52.58 0.00012 R RQLETLGQEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2635.2635.2.dta 1 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 512 47891 13 13 13 13 2437 6291 1 0 0 639.3584 1276.7022 2 1276.7027 -0.0004 0 79.72 1.50E-07 K LALDIEIATYR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7122.7122.2.dta 1 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 512 47891 13 13 13 13 2620 6479 1 0 1 660.8406 1319.6667 2 1319.6642 0.0025 0 92.41 1.30E-08 R SLDMDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7377.7377.2.dta 1 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 512 47891 13 13 13 13 2704 5364 1 0 1 672.8411 1343.6677 2 1343.6681 -0.0004 0 82.2 2.60E-08 R ASLEAAIADAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5912.5912.2.dta 1 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 512 47891 13 13 13 13 2995 6622 1 0 1 710.378 1418.7414 2 1418.7405 0.0009 0 62.9 1.60E-06 R LEGLTDEINFLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7545.7545.2.dta 1 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 512 47891 13 13 13 13 4502 4480 1 0 1 599.9496 1796.8271 3 1796.825 0.0021 1 68.98 1.20E-06 K DVDEAYMNKVELESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4882.4882.3.dta 1 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 512 47891 13 13 13 13 5707 5533 1 0 1 763.3743 2287.101 3 2287.1041 -0.0032 1 27.24 0.0028 R AEAESMYQIKYEELQSLAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6133.6133.3.dta 1 IPI00787392.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 1" 411 30826 9 9 9 9 103 1175 1 0 1 322.2291 642.4437 2 642.4428 0.0009 1 38.2 0.00042 R AVVVKK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1171.1171.2.dta 1 IPI00787392.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 1" 411 30826 9 9 9 9 1817 5003 1 0 1 565.3135 1128.6125 2 1128.6138 -0.0013 0 99.07 3.00E-09 K LSELEAALQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5491.5491.2.dta 1 IPI00787392.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 1" 411 30826 9 9 9 9 1855 4241 1 0 1 569.293 1136.5715 2 1136.5713 0.0002 0 59.13 3.40E-05 K YEELQSLAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4608.4608.2.dta 1 IPI00787392.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 1" 411 30826 9 9 9 9 1916 4349 1 0 0 577.2816 1152.5487 2 1152.5485 0.0002 0 39.48 0.00061 R EYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4726.4726.2.dta 1 IPI00787392.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 1" 411 30826 9 9 9 9 2437 6291 1 0 0 639.3584 1276.7022 2 1276.7027 -0.0004 0 79.72 1.50E-07 K LALDIEIATYR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7122.7122.2.dta 1 IPI00787392.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 1" 411 30826 9 9 9 9 2620 6479 1 0 1 660.8406 1319.6667 2 1319.6642 0.0025 0 92.41 1.30E-08 R SLDMDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7377.7377.2.dta 1 IPI00787392.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 1" 411 30826 9 9 9 9 2704 5364 1 0 1 672.8411 1343.6677 2 1343.6681 -0.0004 0 82.2 2.60E-08 R ASLEAAIADAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5912.5912.2.dta 1 IPI00787392.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 1" 411 30826 9 9 9 9 2995 6622 1 0 1 710.378 1418.7414 2 1418.7405 0.0009 0 62.9 1.60E-06 R LEGLTDEINFLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7545.7545.2.dta 1 IPI00787392.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 1" 411 30826 9 9 9 9 5707 5533 1 0 1 763.3743 2287.101 3 2287.1041 -0.0032 1 27.24 0.0028 R AEAESMYQIKYEELQSLAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6133.6133.3.dta 1 IPI00795725.1 17 kDa protein 354 16798 10 10 9 9 1278 4289 1 0 1 500.7875 999.5605 2 999.56 0.0004 0 39.84 0.0013 R LQAEIEGLK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4660.4660.2.dta 1 IPI00795725.1 17 kDa protein 354 16798 10 10 9 9 1855 4241 1 0 1 569.293 1136.5715 2 1136.5713 0.0002 0 59.13 3.40E-05 K YEELQSLAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4608.4608.2.dta 1 IPI00795725.1 17 kDa protein 354 16798 10 10 9 9 2162 2319 1 0 1 403.536 1207.5862 3 1207.5867 -0.0004 1 37.89 0.00028 R TKTEISEMNR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2433.2433.3.dta 1 IPI00795725.1 17 kDa protein 354 16798 10 10 9 9 2215 1493 1 0 1 612.7978 1223.581 2 1223.5816 -0.0005 1 19.47 0.019 R TKTEISEMNR N Oxidation (M) 0.0000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1514.1514.2.dta 1 IPI00795725.1 17 kDa protein 354 16798 10 10 9 9 2620 6479 1 0 1 660.8406 1319.6667 2 1319.6642 0.0025 0 92.41 1.30E-08 R SLDMDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7377.7377.2.dta 1 IPI00795725.1 17 kDa protein 354 16798 10 10 9 9 2697 3489 1 0 1 671.3763 1340.7381 2 1340.7412 -0.003 1 60.49 1.10E-05 R LQAEIEGLKGQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3784.3784.2.dta 1 IPI00795725.1 17 kDa protein 354 16798 10 10 9 9 2704 5364 1 0 1 672.8411 1343.6677 2 1343.6681 -0.0004 0 82.2 2.60E-08 R ASLEAAIADAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5912.5912.2.dta 1 IPI00795725.1 17 kDa protein 354 16798 10 10 9 9 2995 6622 1 0 1 710.378 1418.7414 2 1418.7405 0.0009 0 62.9 1.60E-06 R LEGLTDEINFLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7545.7545.2.dta 1 IPI00795725.1 17 kDa protein 354 16798 10 10 9 9 5707 5533 1 0 1 763.3743 2287.101 3 2287.1041 -0.0032 1 27.24 0.0028 R AEAESMYQIKYEELQSLAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6133.6133.3.dta 1 IPI00795725.1 17 kDa protein 354 16798 10 10 9 9 6130 7846 1 0 1 794.3927 2380.1563 3 2380.158 -0.0017 1 51.95 2.70E-05 R SLDMDSIIAEVKAQYEDIANR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9056.9056.3.dta 1 IPI00792642.1 25 kDa protein 342 24809 12 12 10 10 575 4682 1 0 0 414.2184 826.4222 2 826.4225 -0.0003 0 41.77 0.0013 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5115.5115.2.dta 1 IPI00792642.1 25 kDa protein 342 24809 12 12 10 10 880 2448 1 0 0 453.7381 905.4616 2 905.4607 0.001 0 42.17 0.0019 R FLEQQNK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2576.2576.2.dta 1 IPI00792642.1 25 kDa protein 342 24809 12 12 10 10 1422 5106 1 0 1 515.7877 1029.5609 2 1029.5607 0.0002 0 37.89 0.0035 K WSLLQQQK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5610.5610.2.dta 1 IPI00792642.1 25 kDa protein 342 24809 12 12 10 10 1647 4604 1 0 0 361.5381 1081.5923 3 1081.592 0.0003 1 27.56 0.018 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5024.5024.3.dta 1 IPI00792642.1 25 kDa protein 342 24809 12 12 10 10 1648 4597 1 0 0 541.8035 1081.5925 2 1081.592 0.0005 1 45.13 0.00051 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5015.5015.2.dta 1 IPI00792642.1 25 kDa protein 342 24809 12 12 10 10 2093 2503 1 0 1 601.3292 1200.6439 2 1200.6462 -0.0023 1 52.58 0.00012 R RQLETLGQEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2635.2635.2.dta 1 IPI00792642.1 25 kDa protein 342 24809 12 12 10 10 2620 6479 1 0 1 660.8406 1319.6667 2 1319.6642 0.0025 0 92.41 1.30E-08 R SLDMDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7377.7377.2.dta 1 IPI00792642.1 25 kDa protein 342 24809 12 12 10 10 2995 6622 1 0 1 710.378 1418.7414 2 1418.7405 0.0009 0 62.9 1.60E-06 R LEGLTDEINFLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7545.7545.2.dta 1 IPI00792642.1 25 kDa protein 342 24809 12 12 10 10 3240 5015 1 0 1 494.2623 1479.7651 3 1479.7643 0.0008 1 32.7 0.0025 R TEMENEFVLIKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5505.5505.3.dta 1 IPI00792642.1 25 kDa protein 342 24809 12 12 10 10 3286 4481 1 0 1 499.5935 1495.7588 3 1495.7592 -0.0004 1 34.56 0.00057 R TEMENEFVLIKK D Oxidation (M) 0.001000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4883.4883.3.dta 1 IPI00792642.1 25 kDa protein 342 24809 12 12 10 10 4502 4480 1 0 1 599.9496 1796.8271 3 1796.825 0.0021 1 68.98 1.20E-06 K DVDEAYMNKVELESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4882.4882.3.dta 1 IPI00792642.1 25 kDa protein 342 24809 12 12 10 10 6130 7846 1 0 1 794.3927 2380.1563 3 2380.158 -0.0017 1 51.95 2.70E-05 R SLDMDSIIAEVKAQYEDIANR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9056.9056.3.dta 1 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 289 66110 10 10 8 8 575 4682 1 0 0 414.2184 826.4222 2 826.4225 -0.0003 0 41.77 0.0013 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5115.5115.2.dta 1 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 289 66110 10 10 8 8 1164 4193 1 0 1 487.269 972.5235 2 972.524 -0.0005 0 50.66 0.00023 K IEISELNR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4556.4556.2.dta 1 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 289 66110 10 10 8 8 1647 4604 1 0 0 361.5381 1081.5923 3 1081.592 0.0003 1 27.56 0.018 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5024.5024.3.dta 1 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 289 66110 10 10 8 8 1648 4597 1 0 0 541.8035 1081.5925 2 1081.592 0.0005 1 45.13 0.00051 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5015.5015.2.dta 1 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 289 66110 10 10 8 8 1836 2369 1 0 0 567.2827 1132.5509 2 1132.5546 -0.0038 1 47.01 0.00012 R KLLEGEECR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2489.2489.2.dta 1 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 289 66110 10 10 8 8 2389 5837 1 0 0 632.3508 1262.6871 2 1262.687 0.0001 0 88.62 2.10E-08 K LALDVEIATYR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6548.6548.2.dta 1 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 289 66110 10 10 8 8 2652 7034 1 0 0 665.3684 1328.7223 2 1328.7187 0.0035 0 62.11 3.90E-06 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.8052.8052.2.dta 1 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 289 66110 10 10 8 8 3228 4063 1 0 1 738.3967 1474.7788 2 1474.778 0.0008 0 76.28 2.80E-07 R FLEQQNQVLQTK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4414.4414.2.dta 1 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 289 66110 10 10 8 8 6251 8273 1 0 0 806.7548 2417.2426 3 2417.2438 -0.0011 1 31.54 0.0031 R NLDLDSIIAEVKAQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9562.9562.3.dta 1 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 289 66110 10 10 8 8 6252 8282 1 0 0 605.3182 2417.2436 4 2417.2438 -0.0002 1 16.02 0.031 R NLDLDSIIAEVKAQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9573.9573.4.dta 1 IPI00005859.2 Keratin-75 275 59809 9 9 8 8 575 4682 1 0 0 414.2184 826.4222 2 826.4225 -0.0003 0 41.77 0.0013 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5115.5115.2.dta 1 IPI00005859.2 Keratin-75 275 59809 9 9 8 8 880 2448 1 0 0 453.7381 905.4616 2 905.4607 0.001 0 42.17 0.0019 R FLEQQNK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2576.2576.2.dta 1 IPI00005859.2 Keratin-75 275 59809 9 9 8 8 1647 4604 1 0 0 361.5381 1081.5923 3 1081.592 0.0003 1 27.56 0.018 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5024.5024.3.dta 1 IPI00005859.2 Keratin-75 275 59809 9 9 8 8 1648 4597 1 0 0 541.8035 1081.5925 2 1081.592 0.0005 1 45.13 0.00051 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5015.5015.2.dta 1 IPI00005859.2 Keratin-75 275 59809 9 9 8 8 1836 2369 1 0 0 567.2827 1132.5509 2 1132.5546 -0.0038 1 47.01 0.00012 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2489.2489.2.dta 1 IPI00005859.2 Keratin-75 275 59809 9 9 8 8 1946 3733 1 0 0 583.2939 1164.5732 2 1164.5775 -0.0043 0 83.38 1.00E-07 K YEELQVTAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4054.4054.2.dta 1 IPI00005859.2 Keratin-75 275 59809 9 9 8 8 2389 5837 1 0 0 632.3508 1262.6871 2 1262.687 0.0001 0 88.62 2.10E-08 K LALDVEIATYR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6548.6548.2.dta 1 IPI00005859.2 Keratin-75 275 59809 9 9 8 8 2652 7034 1 0 0 665.3684 1328.7223 2 1328.7187 0.0035 0 62.11 3.90E-06 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.8052.8052.2.dta 1 IPI00005859.2 Keratin-75 275 59809 9 9 8 8 3229 3563 1 0 0 492.9391 1475.7954 3 1475.7984 -0.0029 1 22.58 0.014 R FLEQQNKVLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3867.3867.3.dta 1 IPI00796330.1 18 kDa protein 240 18135 8 8 6 6 1045 2718 1 0 0 473.2597 944.5048 2 944.5039 0.0009 1 31.47 0.017 R GRLDSELR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2873.2873.2.dta 1 IPI00796330.1 18 kDa protein 240 18135 8 8 6 6 2652 7034 1 0 0 665.3684 1328.7223 2 1328.7187 0.0035 0 62.11 3.90E-06 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.8052.8052.2.dta 1 IPI00796330.1 18 kDa protein 240 18135 8 8 6 6 2741 3782 1 0 0 675.8647 1349.7149 2 1349.7191 -0.0041 1 69.6 2.00E-06 R TAAENEFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4107.4107.2.dta 1 IPI00796330.1 18 kDa protein 240 18135 8 8 6 6 2742 3777 1 0 0 450.9136 1349.719 3 1349.7191 -0.0001 1 46.08 0.00017 R TAAENEFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4102.4102.3.dta 1 IPI00796330.1 18 kDa protein 240 18135 8 8 6 6 2960 6433 1 0 0 704.36 1406.7054 2 1406.7041 0.0013 0 98.57 2.50E-09 K ADTLTDEINFLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7317.7317.2.dta 1 IPI00796330.1 18 kDa protein 240 18135 8 8 6 6 4188 4415 1 0 0 565.6188 1693.8345 3 1693.8345 0 1 30.12 0.0019 K DVDAAYMNKVELQAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4804.4804.3.dta 1 IPI00796330.1 18 kDa protein 240 18135 8 8 6 6 6251 8273 1 0 0 806.7548 2417.2426 3 2417.2438 -0.0011 1 31.54 0.0031 R NLDLDSIIAEVKAQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9562.9562.3.dta 1 IPI00796330.1 18 kDa protein 240 18135 8 8 6 6 6252 8282 1 0 0 605.3182 2417.2436 4 2417.2438 -0.0002 1 16.02 0.031 R NLDLDSIIAEVKAQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9573.9573.4.dta 1 IPI00290857.2 "Keratin, type II cytoskeletal 3" 219 64636 8 8 6 6 575 4682 1 0 0 414.2184 826.4222 2 826.4225 -0.0003 0 41.77 0.0013 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5115.5115.2.dta 1 IPI00290857.2 "Keratin, type II cytoskeletal 3" 219 64636 8 8 6 6 880 2448 1 0 0 453.7381 905.4616 2 905.4607 0.001 0 42.17 0.0019 R FLEQQNK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2576.2576.2.dta 1 IPI00290857.2 "Keratin, type II cytoskeletal 3" 219 64636 8 8 6 6 1647 4604 1 0 0 361.5381 1081.5923 3 1081.592 0.0003 1 27.56 0.018 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5024.5024.3.dta 1 IPI00290857.2 "Keratin, type II cytoskeletal 3" 219 64636 8 8 6 6 1648 4597 1 0 0 541.8035 1081.5925 2 1081.592 0.0005 1 45.13 0.00051 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5015.5015.2.dta 1 IPI00290857.2 "Keratin, type II cytoskeletal 3" 219 64636 8 8 6 6 2389 5837 1 0 0 632.3508 1262.6871 2 1262.687 0.0001 0 88.62 2.10E-08 K LALDVEIATYR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6548.6548.2.dta 1 IPI00290857.2 "Keratin, type II cytoskeletal 3" 219 64636 8 8 6 6 2741 3782 1 0 0 675.8647 1349.7149 2 1349.7191 -0.0041 1 69.6 2.00E-06 R TAAENEFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4107.4107.2.dta 1 IPI00290857.2 "Keratin, type II cytoskeletal 3" 219 64636 8 8 6 6 2742 3777 1 0 0 450.9136 1349.719 3 1349.7191 -0.0001 1 46.08 0.00017 R TAAENEFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4102.4102.3.dta 1 IPI00290857.2 "Keratin, type II cytoskeletal 3" 219 64636 8 8 6 6 3229 3563 1 0 0 492.9391 1475.7954 3 1475.7984 -0.0029 1 22.58 0.014 R FLEQQNKVLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3867.3867.3.dta 1 IPI00791912.1 22 kDa protein 218 22195 11 11 9 9 575 4682 1 0 0 414.2184 826.4222 2 826.4225 -0.0003 0 41.77 0.0013 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5115.5115.2.dta 1 IPI00791912.1 22 kDa protein 218 22195 11 11 9 9 745 2731 1 0 1 435.7188 869.4231 2 869.4243 -0.0012 0 44.72 0.0005 R ISSSSFSR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2887.2887.2.dta 1 IPI00791912.1 22 kDa protein 218 22195 11 11 9 9 880 2448 1 0 0 453.7381 905.4616 2 905.4607 0.001 0 42.17 0.0019 R FLEQQNK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2576.2576.2.dta 1 IPI00791912.1 22 kDa protein 218 22195 11 11 9 9 897 1655 1 0 1 456.2148 910.415 2 910.4145 0.0006 0 40.1 0.00025 R SYTSGPGSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1689.1689.2.dta 1 IPI00791912.1 22 kDa protein 218 22195 11 11 9 9 1422 5106 1 0 1 515.7877 1029.5609 2 1029.5607 0.0002 0 37.89 0.0035 K WSLLQQQK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5610.5610.2.dta 1 IPI00791912.1 22 kDa protein 218 22195 11 11 9 9 1642 2006 1 0 1 361.1933 1080.558 3 1080.5564 0.0016 1 44.48 0.00022 K SYKVSTSGPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2076.2076.3.dta 1 IPI00791912.1 22 kDa protein 218 22195 11 11 9 9 1647 4604 1 0 0 361.5381 1081.5923 3 1081.592 0.0003 1 27.56 0.018 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5024.5024.3.dta 1 IPI00791912.1 22 kDa protein 218 22195 11 11 9 9 1648 4597 1 0 0 541.8035 1081.5925 2 1081.592 0.0005 1 45.13 0.00051 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5015.5015.2.dta 1 IPI00791912.1 22 kDa protein 218 22195 11 11 9 9 2093 2503 1 0 1 601.3292 1200.6439 2 1200.6462 -0.0023 1 52.58 0.00012 R RQLETLGQEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2635.2635.2.dta 1 IPI00791912.1 22 kDa protein 218 22195 11 11 9 9 3240 5015 1 0 1 494.2623 1479.7651 3 1479.7643 0.0008 1 32.7 0.0025 R TEMENEFVLIKK - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5505.5505.3.dta 1 IPI00791912.1 22 kDa protein 218 22195 11 11 9 9 3286 4481 1 0 1 499.5935 1495.7588 3 1495.7592 -0.0004 1 34.56 0.00057 R TEMENEFVLIKK - Oxidation (M) 0.001000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4883.4883.3.dta 1 IPI00241841.8 keratin 6L 217 58085 9 9 8 8 575 4682 1 0 0 414.2184 826.4222 2 826.4225 -0.0003 0 41.77 0.0013 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5115.5115.2.dta 1 IPI00241841.8 keratin 6L 217 58085 9 9 8 8 880 2448 1 0 0 453.7381 905.4616 2 905.4607 0.001 0 42.17 0.0019 R FLEQQNK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2576.2576.2.dta 1 IPI00241841.8 keratin 6L 217 58085 9 9 8 8 1045 2718 1 0 0 473.2597 944.5048 2 944.5039 0.0009 1 31.47 0.017 R GRLDSELR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2873.2873.2.dta 1 IPI00241841.8 keratin 6L 217 58085 9 9 8 8 1647 4604 1 0 0 361.5381 1081.5923 3 1081.592 0.0003 1 27.56 0.018 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5024.5024.3.dta 1 IPI00241841.8 keratin 6L 217 58085 9 9 8 8 1648 4597 1 0 0 541.8035 1081.5925 2 1081.592 0.0005 1 45.13 0.00051 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5015.5015.2.dta 1 IPI00241841.8 keratin 6L 217 58085 9 9 8 8 1855 4241 2 0 1 569.293 1136.5715 2 1136.5713 0.0002 0 46.92 0.00056 K YEELQVTAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4608.4608.2.dta 1 IPI00241841.8 keratin 6L 217 58085 9 9 8 8 2389 5837 1 0 0 632.3508 1262.6871 2 1262.687 0.0001 0 88.62 2.10E-08 K LALDVEIATYR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6548.6548.2.dta 1 IPI00241841.8 keratin 6L 217 58085 9 9 8 8 2652 7034 1 0 0 665.3684 1328.7223 2 1328.7187 0.0035 0 62.11 3.90E-06 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.8052.8052.2.dta 1 IPI00241841.8 keratin 6L 217 58085 9 9 8 8 3229 3563 1 0 0 492.9391 1475.7954 3 1475.7984 -0.0029 1 22.58 0.014 R FLEQQNKVLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3867.3867.3.dta 1 IPI00795197.1 24 kDa protein 217 24107 6 6 6 6 1348 1915 1 0 1 508.2344 1014.4543 2 1014.4552 -0.0009 0 14.51 0.044 K HEISEMNR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1977.1977.2.dta 1 IPI00795197.1 24 kDa protein 217 24107 6 6 6 6 1836 2369 1 0 0 567.2827 1132.5509 2 1132.5546 -0.0038 1 47.01 0.00012 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2489.2489.2.dta 1 IPI00795197.1 24 kDa protein 217 24107 6 6 6 6 2058 2723 1 0 1 597.7911 1193.5676 2 1193.5676 0 0 68.66 2.90E-06 K YEELQQTAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2878.2878.2.dta 1 IPI00795197.1 24 kDa protein 217 24107 6 6 6 6 2389 5837 1 0 0 632.3508 1262.6871 2 1262.687 0.0001 0 88.62 2.10E-08 K LALDVEIATYR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6548.6548.2.dta 1 IPI00795197.1 24 kDa protein 217 24107 6 6 6 6 2652 7034 1 0 0 665.3684 1328.7223 2 1328.7187 0.0035 0 62.11 3.90E-06 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.8052.8052.2.dta 1 IPI00795197.1 24 kDa protein 217 24107 6 6 6 6 6212 8306 1 0 1 802.0827 2403.2263 3 2403.2281 -0.0018 1 34.24 0.00062 R NLDLDSIIAEVKAQYEEIANR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9601.9601.3.dta 1 IPI00792167.1 9 kDa protein 213 8852 4 4 4 4 2426 6775 1 0 1 636.8563 1271.698 2 1271.6973 0.0007 0 102.66 9.60E-10 R SLDLDGIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7728.7728.2.dta 1 IPI00792167.1 9 kDa protein 213 8852 4 4 4 4 2986 6270 1 0 1 709.8679 1417.7212 2 1417.7201 0.001 0 81.41 3.00E-08 K VDALNDEINFLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7095.7095.2.dta 1 IPI00792167.1 9 kDa protein 213 8852 4 4 4 4 5288 6364 1 0 1 696.7045 2087.0918 3 2087.0898 0.0019 1 60.42 2.20E-06 K VELEAKVDALNDEINFLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7235.7235.3.dta 1 IPI00792167.1 9 kDa protein 213 8852 4 4 4 4 5460 8068 1 0 1 741.7123 2222.1152 3 2222.114 0.0012 1 28.05 0.0074 R SLDLDGIIAEVKAQYEEMAK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9317.9317.3.dta 1 IPI00017870.1 Keratin-8-like protein 1 190 55459 7 7 6 6 575 4682 1 0 0 414.2184 826.4222 2 826.4225 -0.0003 0 41.77 0.0013 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5115.5115.2.dta 1 IPI00017870.1 Keratin-8-like protein 1 190 55459 7 7 6 6 987 2514 1 0 0 466.7373 931.46 2 931.461 -0.001 0 31.67 0.0031 K LLEGEESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2647.2647.2.dta 1 IPI00017870.1 Keratin-8-like protein 1 190 55459 7 7 6 6 1422 5106 1 0 1 515.7877 1029.5609 2 1029.5607 0.0002 0 37.89 0.0035 K WSLLQQQK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5610.5610.2.dta 1 IPI00017870.1 Keratin-8-like protein 1 190 55459 7 7 6 6 1817 5003 1 0 1 565.3135 1128.6125 2 1128.6138 -0.0013 0 99.07 3.00E-09 K LSELEAALQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5491.5491.2.dta 1 IPI00017870.1 Keratin-8-like protein 1 190 55459 7 7 6 6 2093 2503 1 0 1 601.3292 1200.6439 2 1200.6462 -0.0023 1 52.58 0.00012 R RQLETLGQEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2635.2635.2.dta 1 IPI00017870.1 Keratin-8-like protein 1 190 55459 7 7 6 6 2162 2319 1 0 1 403.536 1207.5862 3 1207.5867 -0.0004 1 37.89 0.00028 R TKTEISEMNR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2433.2433.3.dta 1 IPI00017870.1 Keratin-8-like protein 1 190 55459 7 7 6 6 2215 1493 1 0 1 612.7978 1223.581 2 1223.5816 -0.0005 1 19.47 0.019 R TKTEISEMNR N Oxidation (M) 0.0000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1514.1514.2.dta 1 IPI00008359.1 "Keratin, type II cytoskeletal 2 oral" 189 66400 8 8 7 7 575 4682 1 0 0 414.2184 826.4222 2 826.4225 -0.0003 0 41.77 0.0013 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5115.5115.2.dta 1 IPI00008359.1 "Keratin, type II cytoskeletal 2 oral" 189 66400 8 8 7 7 880 2448 1 0 0 453.7381 905.4616 2 905.4607 0.001 0 42.17 0.0019 R FLEQQNK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2576.2576.2.dta 1 IPI00008359.1 "Keratin, type II cytoskeletal 2 oral" 189 66400 8 8 7 7 1647 4604 1 0 0 361.5381 1081.5923 3 1081.592 0.0003 1 27.56 0.018 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5024.5024.3.dta 1 IPI00008359.1 "Keratin, type II cytoskeletal 2 oral" 189 66400 8 8 7 7 1648 4597 1 0 0 541.8035 1081.5925 2 1081.592 0.0005 1 45.13 0.00051 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5015.5015.2.dta 1 IPI00008359.1 "Keratin, type II cytoskeletal 2 oral" 189 66400 8 8 7 7 1836 2369 1 0 0 567.2827 1132.5509 2 1132.5546 -0.0038 1 47.01 0.00012 R KLLEGEECR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2489.2489.2.dta 1 IPI00008359.1 "Keratin, type II cytoskeletal 2 oral" 189 66400 8 8 7 7 2389 5837 1 0 0 632.3508 1262.6871 2 1262.687 0.0001 0 88.62 2.10E-08 K LALDVEIATYR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6548.6548.2.dta 1 IPI00008359.1 "Keratin, type II cytoskeletal 2 oral" 189 66400 8 8 7 7 3229 3563 1 0 0 492.9391 1475.7954 3 1475.7984 -0.0029 1 22.58 0.014 R FLEQQNKVLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3867.3867.3.dta 1 IPI00008359.1 "Keratin, type II cytoskeletal 2 oral" 189 66400 8 8 7 7 4188 4415 1 0 1 565.6188 1693.8345 3 1693.8345 0 1 30.12 0.0019 K DVDAAFMNKVELQAK V Oxidation (M) 0.000000100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4804.4804.3.dta 1 IPI00791341.1 20 kDa protein 186 19686 9 9 8 8 575 4682 1 0 0 414.2184 826.4222 2 826.4225 -0.0003 0 41.77 0.0013 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5115.5115.2.dta 1 IPI00791341.1 20 kDa protein 186 19686 9 9 8 8 745 2731 1 0 1 435.7188 869.4231 2 869.4243 -0.0012 0 44.72 0.0005 R ISSSSFSR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2887.2887.2.dta 1 IPI00791341.1 20 kDa protein 186 19686 9 9 8 8 880 2448 1 0 0 453.7381 905.4616 2 905.4607 0.001 0 42.17 0.0019 R FLEQQNK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2576.2576.2.dta 1 IPI00791341.1 20 kDa protein 186 19686 9 9 8 8 897 1655 1 0 1 456.2148 910.415 2 910.4145 0.0006 0 40.1 0.00025 R SYTSGPGSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1689.1689.2.dta 1 IPI00791341.1 20 kDa protein 186 19686 9 9 8 8 1422 5106 1 0 1 515.7877 1029.5609 2 1029.5607 0.0002 0 37.89 0.0035 K WSLLQQQK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5610.5610.2.dta 1 IPI00791341.1 20 kDa protein 186 19686 9 9 8 8 1642 2006 1 0 1 361.1933 1080.558 3 1080.5564 0.0016 1 44.48 0.00022 K SYKVSTSGPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2076.2076.3.dta 1 IPI00791341.1 20 kDa protein 186 19686 9 9 8 8 1647 4604 1 0 0 361.5381 1081.5923 3 1081.592 0.0003 1 27.56 0.018 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5024.5024.3.dta 1 IPI00791341.1 20 kDa protein 186 19686 9 9 8 8 1648 4597 1 0 0 541.8035 1081.5925 2 1081.592 0.0005 1 45.13 0.00051 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5015.5015.2.dta 1 IPI00791341.1 20 kDa protein 186 19686 9 9 8 8 2093 2503 1 0 1 601.3292 1200.6439 2 1200.6462 -0.0023 1 52.58 0.00012 R RQLETLGQEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2635.2635.2.dta 1 IPI00793202.1 14 kDa protein 185 14435 6 6 5 5 1422 5106 1 0 1 515.7877 1029.5609 2 1029.5607 0.0002 0 37.89 0.0035 K WSLLQQQK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5610.5610.2.dta 1 IPI00793202.1 14 kDa protein 185 14435 6 6 5 5 2093 2503 1 0 1 601.3292 1200.6439 2 1200.6462 -0.0023 1 52.58 0.00012 R RQLETLGQEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2635.2635.2.dta 1 IPI00793202.1 14 kDa protein 185 14435 6 6 5 5 2995 6622 1 0 1 710.378 1418.7414 2 1418.7405 0.0009 0 62.9 1.60E-06 R LEGLTDEINFLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7545.7545.2.dta 1 IPI00793202.1 14 kDa protein 185 14435 6 6 5 5 3240 5015 1 0 1 494.2623 1479.7651 3 1479.7643 0.0008 1 32.7 0.0025 R TEMENEFVLIKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5505.5505.3.dta 1 IPI00793202.1 14 kDa protein 185 14435 6 6 5 5 3286 4481 1 0 1 499.5935 1495.7588 3 1495.7592 -0.0004 1 34.56 0.00057 R TEMENEFVLIKK D Oxidation (M) 0.001000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4883.4883.3.dta 1 IPI00793202.1 14 kDa protein 185 14435 6 6 5 5 4502 4480 1 0 1 599.9496 1796.8271 3 1796.825 0.0021 1 68.98 1.20E-06 K DVDEAYMNKVELESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4882.4882.3.dta 1 IPI00655639.1 Hypothetical protein (Fragment) 178 12922 4 4 3 3 2426 6775 1 0 1 636.8563 1271.698 2 1271.6973 0.0007 0 102.66 9.60E-10 R SLDLDGIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7728.7728.2.dta 1 IPI00655639.1 Hypothetical protein (Fragment) 178 12922 4 4 3 3 3107 3211 1 0 1 721.3909 1440.7673 2 1440.7684 -0.0011 1 67.28 7.30E-07 R LQAEIDNIKNQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3451.3451.2.dta 1 IPI00655639.1 Hypothetical protein (Fragment) 178 12922 4 4 3 3 3108 3202 1 0 1 481.2632 1440.7676 3 1440.7684 -0.0008 1 39.48 0.0003 R LQAEIDNIKNQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3441.3441.3.dta 1 IPI00655639.1 Hypothetical protein (Fragment) 178 12922 4 4 3 3 5460 8068 1 0 1 741.7123 2222.1152 3 2222.114 0.0012 1 28.05 0.0074 R SLDLDGIIAEVKAQYEEMAK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9317.9317.3.dta 1 IPI00793849.1 Protein 124 22010 3 3 3 3 2058 2723 1 0 1 597.7911 1193.5676 2 1193.5676 0 0 68.66 2.90E-06 K YEELQQTAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2878.2878.2.dta 1 IPI00793849.1 Protein 124 22010 3 3 3 3 2652 7034 1 0 0 665.3684 1328.7223 2 1328.7187 0.0035 0 62.11 3.90E-06 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.8052.8052.2.dta 1 IPI00793849.1 Protein 124 22010 3 3 3 3 6212 8306 1 0 1 802.0827 2403.2263 3 2403.2281 -0.0018 1 34.24 0.00062 R NLDLDSIIAEVKAQYEEIANR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9601.9601.3.dta 1 IPI00793572.1 6 kDa protein 124 6322 2 2 2 2 2986 6270 1 0 1 709.8679 1417.7212 2 1417.7201 0.001 0 81.41 3.00E-08 K VDALNDEINFLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7095.7095.2.dta 1 IPI00793572.1 6 kDa protein 124 6322 2 2 2 2 5288 6364 1 0 1 696.7045 2087.0918 3 2087.0898 0.0019 1 60.42 2.20E-06 K VELEAKVDALNDEINFLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7235.7235.3.dta 1 IPI00794362.1 Protein 124 13787 4 4 4 4 1348 1915 1 0 1 508.2344 1014.4543 2 1014.4552 -0.0009 0 14.51 0.044 K HEISEMNR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1977.1977.2.dta 1 IPI00794362.1 Protein 124 13787 4 4 4 4 2058 2723 1 0 1 597.7911 1193.5676 2 1193.5676 0 0 68.66 2.90E-06 K YEELQQTAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2878.2878.2.dta 1 IPI00794362.1 Protein 124 13787 4 4 4 4 2652 7034 1 0 0 665.3684 1328.7223 2 1328.7187 0.0035 0 62.11 3.90E-06 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.8052.8052.2.dta 1 IPI00794362.1 Protein 124 13787 4 4 4 4 6212 8306 1 0 1 802.0827 2403.2263 3 2403.2281 -0.0018 1 34.24 0.00062 R NLDLDSIIAEVKAQYEEIANR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9601.9601.3.dta 1 IPI00376379.3 Keratin 77 119 62050 4 4 3 3 575 4682 1 0 0 414.2184 826.4222 2 826.4225 -0.0003 0 41.77 0.0013 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5115.5115.2.dta 1 IPI00376379.3 Keratin 77 119 62050 4 4 3 3 1647 4604 1 0 0 361.5381 1081.5923 3 1081.592 0.0003 1 27.56 0.018 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5024.5024.3.dta 1 IPI00376379.3 Keratin 77 119 62050 4 4 3 3 1648 4597 1 0 0 541.8035 1081.5925 2 1081.592 0.0005 1 45.13 0.00051 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5015.5015.2.dta 1 IPI00376379.3 Keratin 77 119 62050 4 4 3 3 3228 4063 1 0 1 738.3967 1474.7788 2 1474.778 0.0008 0 76.28 2.80E-07 R FLEQQNQVLQTK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4414.4414.2.dta 1 IPI00215804.4 "similar to Keratin, type II cytoskeletal 8" 116 23165 2 2 2 2 103 1175 1 0 1 322.2291 642.4437 2 642.4428 0.0009 1 38.2 0.00042 R AVVVKK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1171.1171.2.dta 1 IPI00215804.4 "similar to Keratin, type II cytoskeletal 8" 116 23165 2 2 2 2 1817 5003 1 0 1 565.3135 1128.6125 2 1128.6138 -0.0013 0 99.07 3.00E-09 K LSELEAALQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5491.5491.2.dta 1 IPI00300052.1 Keratin type II cuticular Hb4 107 65938 6 6 5 5 575 4682 1 0 0 414.2184 826.4222 2 826.4225 -0.0003 0 41.77 0.0013 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5115.5115.2.dta 1 IPI00300052.1 Keratin type II cuticular Hb4 107 65938 6 6 5 5 880 2448 1 0 0 453.7381 905.4616 2 905.4607 0.001 0 42.17 0.0019 R FLEQQNK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2576.2576.2.dta 1 IPI00300052.1 Keratin type II cuticular Hb4 107 65938 6 6 5 5 987 2514 1 0 0 466.7373 931.46 2 931.461 -0.001 0 31.67 0.0031 R LLEGEESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2647.2647.2.dta 1 IPI00300052.1 Keratin type II cuticular Hb4 107 65938 6 6 5 5 1647 4604 1 0 0 361.5381 1081.5923 3 1081.592 0.0003 1 27.56 0.018 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5024.5024.3.dta 1 IPI00300052.1 Keratin type II cuticular Hb4 107 65938 6 6 5 5 1648 4597 1 0 0 541.8035 1081.5925 2 1081.592 0.0005 1 45.13 0.00051 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5015.5015.2.dta 1 IPI00300052.1 Keratin type II cuticular Hb4 107 65938 6 6 5 5 2389 5837 2 0 1 632.3508 1262.6871 2 1262.687 0.0001 0 38.32 0.0022 K LGLDIEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6548.6548.2.dta 1 IPI00290078.5 keratin 4 97 64442 2 2 2 2 575 4682 1 0 0 414.2184 826.4222 2 826.4225 -0.0003 0 41.77 0.0013 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5115.5115.2.dta 1 IPI00290078.5 keratin 4 97 64442 2 2 2 2 2437 6291 1 0 0 639.3584 1276.7022 2 1276.7027 -0.0004 0 79.72 1.50E-07 K LALDIEIATYR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7122.7122.2.dta 1 IPI00025363.1 "Isoform 1 of Glial fibrillary acidic protein, astrocyte" 96 49907 2 2 2 2 880 2448 1 0 0 453.7381 905.4616 2 905.4607 0.001 0 42.17 0.0019 R FLEQQNK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2576.2576.2.dta 1 IPI00025363.1 "Isoform 1 of Glial fibrillary acidic protein, astrocyte" 96 49907 2 2 2 2 2437 6291 1 0 0 639.3584 1276.7022 2 1276.7027 -0.0004 0 79.72 1.50E-07 K LALDIEIATYR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7122.7122.2.dta 1 IPI00174775.2 Keratin 6 irs3 92 59457 4 4 3 3 575 4682 1 0 0 414.2184 826.4222 2 826.4225 -0.0003 0 41.77 0.0013 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5115.5115.2.dta 1 IPI00174775.2 Keratin 6 irs3 92 59457 4 4 3 3 1647 4604 1 0 0 361.5381 1081.5923 3 1081.592 0.0003 1 27.56 0.018 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5024.5024.3.dta 1 IPI00174775.2 Keratin 6 irs3 92 59457 4 4 3 3 1648 4597 1 0 0 541.8035 1081.5925 2 1081.592 0.0005 1 45.13 0.00051 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5015.5015.2.dta 1 IPI00174775.2 Keratin 6 irs3 92 59457 4 4 3 3 1836 2369 1 0 0 567.2827 1132.5509 2 1132.5546 -0.0038 1 47.01 0.00012 R KLLEGEECR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2489.2489.2.dta 1 IPI00791554.1 17 kDa protein 90 17100 2 2 2 2 987 2514 1 0 0 466.7373 931.46 2 931.461 -0.001 0 31.67 0.0031 K LLEGEESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2647.2647.2.dta 1 IPI00791554.1 17 kDa protein 90 17100 2 2 2 2 2437 6291 1 0 0 639.3584 1276.7022 2 1276.7027 -0.0004 0 79.72 1.50E-07 K LALDIEIATYR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7122.7122.2.dta 1 IPI00736200.1 "similar to Keratin, type II cytoskeletal 2 oral" 89 36906 1 1 1 1 2389 5837 1 0 0 632.3508 1262.6871 2 1262.687 0.0001 0 88.62 2.10E-08 K LALDVEIATYR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6548.6548.2.dta 1 IPI00552689.1 Vimentin 86 20138 3 3 3 3 1391 2099 1 0 1 512.2587 1022.5028 2 1022.5032 -0.0005 0 35.75 0.00083 R QQYESVAAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2184.2184.2.dta 1 IPI00552689.1 Vimentin 86 20138 3 3 3 3 2566 4886 1 0 1 655.305 1308.5954 2 1308.5986 -0.0032 0 47.61 0.00023 K NLQEAEEWYK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5354.5354.2.dta 1 IPI00552689.1 Vimentin 86 20138 3 3 3 3 4459 3971 1 0 1 592.9592 1775.8557 3 1775.855 0.0006 1 44.79 0.0003 K FADLSEAANRNNDALR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4310.4310.3.dta 1 IPI00103481.3 Keratin-72 83 56470 5 5 4 4 575 4682 1 0 0 414.2184 826.4222 2 826.4225 -0.0003 0 41.77 0.0013 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5115.5115.2.dta 1 IPI00103481.3 Keratin-72 83 56470 5 5 4 4 1647 4604 1 0 0 361.5381 1081.5923 3 1081.592 0.0003 1 27.56 0.018 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5024.5024.3.dta 1 IPI00103481.3 Keratin-72 83 56470 5 5 4 4 1648 4597 1 0 0 541.8035 1081.5925 2 1081.592 0.0005 1 45.13 0.00051 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5015.5015.2.dta 1 IPI00103481.3 Keratin-72 83 56470 5 5 4 4 2729 4205 1 0 1 450.2538 1347.7395 3 1347.7398 -0.0003 1 21.73 0.012 R TAAENEFVVLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4569.4569.3.dta 1 IPI00103481.3 Keratin-72 83 56470 5 5 4 4 4188 4415 1 0 0 565.6188 1693.8345 3 1693.8345 0 1 30.12 0.0019 K DVDAAYMNKVELQAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4804.4804.3.dta 1 IPI00375843.2 Keratin-80 80 54728 1 1 1 1 2437 6291 1 0 0 639.3584 1276.7022 2 1276.7027 -0.0004 0 79.72 1.50E-07 K LALDIEIATYR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7122.7122.2.dta 1 IPI00793778.1 Keratin 79 10027 2 2 2 2 2652 7034 1 0 0 665.3684 1328.7223 2 1328.7187 0.0035 0 62.11 3.90E-06 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.8052.8052.2.dta 1 IPI00793778.1 Keratin 79 10027 2 2 2 2 6212 8306 1 0 1 802.0827 2403.2263 3 2403.2281 -0.0018 1 34.24 0.00062 R NLDLDSIIAEVKAQYEEIANR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9601.9601.3.dta 1 IPI00061200.3 Keratin-71 66 57769 3 3 2 2 575 4682 1 0 0 414.2184 826.4222 2 826.4225 -0.0003 0 41.77 0.0013 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5115.5115.2.dta 1 IPI00061200.3 Keratin-71 66 57769 3 3 2 2 1647 4604 1 0 0 361.5381 1081.5923 3 1081.592 0.0003 1 27.56 0.018 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5024.5024.3.dta 1 IPI00061200.3 Keratin-71 66 57769 3 3 2 2 1648 4597 1 0 0 541.8035 1081.5925 2 1081.592 0.0005 1 45.13 0.00051 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5015.5015.2.dta 1 IPI00465084.6 Desmin 61 53560 3 3 3 3 987 2514 1 0 0 466.7373 931.46 2 931.461 -0.001 0 31.67 0.0031 K LLEGEESR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2647.2647.2.dta 1 IPI00465084.6 Desmin 61 53560 3 3 3 3 3378 4414 1 0 1 509.9473 1526.82 3 1526.8205 -0.0005 1 27.45 0.025 R HLREYQDLLNVK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4803.4803.3.dta 1 IPI00465084.6 Desmin 61 53560 3 3 3 3 3599 3632 1 0 1 529.9366 1586.7879 3 1586.79 -0.0021 1 47.64 0.00034 R TNEKVELQELNDR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3941.3941.3.dta 1 IPI00217437.4 Tau-tubulin kinase 61 185741 3 3 3 3 113 7641 1 0 1 323.6985 645.3824 2 645.381 0.0015 1 30.08 0.031 K KIETR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.881.881.2.dta 1 IPI00217437.4 Tau-tubulin kinase 61 185741 3 3 3 3 880 2448 1 0 0 453.7381 905.4616 2 905.4607 0.001 0 42.17 0.0019 R FLEQQNK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2576.2576.2.dta 1 IPI00217437.4 Tau-tubulin kinase 61 185741 3 3 3 3 1916 4349 1 0 0 577.2816 1152.5487 2 1152.5485 0.0002 0 39.48 0.00061 R EYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4726.4726.2.dta 1 IPI00013164.4 Isoform 1 of Peripherin 58 53732 2 2 2 2 987 2514 1 0 0 466.7373 931.46 2 931.461 -0.001 0 31.67 0.0031 K LLEGEESR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2647.2647.2.dta 1 IPI00013164.4 Isoform 1 of Peripherin 58 53732 2 2 2 2 2566 4886 1 0 1 655.305 1308.5954 2 1308.5986 -0.0032 0 47.61 0.00023 K NLQEAEEWYK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5354.5354.2.dta 1 IPI00032541.1 Keratin type II cuticular Hb5 58 57306 3 3 3 3 880 2448 1 0 0 453.7381 905.4616 2 905.4607 0.001 0 42.17 0.0019 R FLEQQNK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2576.2576.2.dta 1 IPI00032541.1 Keratin type II cuticular Hb5 58 57306 3 3 3 3 2389 5837 2 0 1 632.3508 1262.6871 2 1262.687 0.0001 0 38.32 0.0022 K LGLDIEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6548.6548.2.dta 1 IPI00032541.1 Keratin type II cuticular Hb5 58 57306 3 3 3 3 2729 4205 1 0 1 450.2538 1347.7395 3 1347.7398 -0.0003 1 21.73 0.012 R ATAENEFVVLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4569.4569.3.dta 1 IPI00182654.5 "Keratin, hair, basic, 1" 54 57059 2 2 2 2 880 2448 1 0 0 453.7381 905.4616 2 905.4607 0.001 0 42.17 0.0019 R FLEQQNK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2576.2576.2.dta 1 IPI00182654.5 "Keratin, hair, basic, 1" 54 57059 2 2 2 2 2389 5837 2 0 1 632.3508 1262.6871 2 1262.687 0.0001 0 38.32 0.0022 K LGLDIEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6548.6548.2.dta 1 IPI00748057.2 "Similar to Keratin, type II cytoskeletal 8" 50 11491 2 2 1 1 3240 5015 1 0 1 494.2623 1479.7651 3 1479.7643 0.0008 1 32.7 0.0025 R TEMENEFVLIKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5505.5505.3.dta 1 IPI00748057.2 "Similar to Keratin, type II cytoskeletal 8" 50 11491 2 2 1 1 3286 4481 1 0 1 499.5935 1495.7588 3 1495.7592 -0.0004 1 34.56 0.00057 R TEMENEFVLIKK D Oxidation (M) 0.001000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4883.4883.3.dta 1 IPI00021751.5 Neurofilament triplet H protein 47 112640 1 1 1 1 1836 2369 1 0 0 567.2827 1132.5509 2 1132.5546 -0.0038 1 47.01 0.00012 R KLLEGEECR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2489.2489.2.dta 1 IPI00794179.1 Desmin 38 32382 2 2 2 2 987 2514 1 0 0 466.7373 931.46 2 931.461 -0.001 0 31.67 0.0031 K LLEGEESR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2647.2647.2.dta 1 IPI00794179.1 Desmin 38 32382 2 2 2 2 3378 4414 1 0 1 509.9473 1526.82 3 1526.8205 -0.0005 1 27.45 0.025 R HLREYQDLLNVK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4803.4803.3.dta 1 IPI00001453.2 Alpha-internexin 27 55528 1 1 1 1 3378 4414 1 0 1 509.9473 1526.82 3 1526.8205 -0.0005 1 27.45 0.025 R HLREYQDLLNVK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4803.4803.3.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 655 48029 26 26 20 20 249 3313 1 1 1 359.7002 717.3858 2 717.3843 0.0015 0 27.01 0.019 K IMADIR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3583.3583.2.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 655 48029 26 26 20 20 288 2615 1 1 1 367.6978 733.381 2 733.3792 0.0017 0 31.4 0.02 K IMADIR A Oxidation (M) 0.010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2759.2759.2.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 655 48029 26 26 20 20 949 1418 2 1 1 462.7679 923.5213 2 923.5188 0.0024 1 33.25 0.0065 K IREHLEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1431.1431.2.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 655 48029 26 26 20 20 1189 5098 1 1 1 491.7243 981.4341 2 981.4345 -0.0004 0 23.75 0.05 R DWSHYFK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5600.5600.2.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 655 48029 26 26 20 20 1459 4489 1 1 0 521.3065 1040.5984 2 1040.5978 0.0005 0 50.41 6.20E-05 R IVLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4893.4893.2.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 655 48029 26 26 20 20 1565 4010 1 1 1 533.2819 1064.5492 2 1064.5502 -0.001 0 41.94 0.00017 K LEAEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4353.4353.2.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 655 48029 26 26 20 20 1685 2568 1 1 1 547.2849 1092.5553 2 1092.5563 -0.0011 1 26.9 0.004 R AQYDELARK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2707.2707.2.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 655 48029 26 26 20 20 1979 2712 1 1 1 587.8271 1173.6397 2 1173.6353 0.0044 1 44.14 0.00048 R KVIDDTNITR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2865.2865.2.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 655 48029 26 26 20 20 2283 3660 1 1 1 620.3226 1238.6306 2 1238.6329 -0.0023 1 28.74 0.0085 R VKYETELAMR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3973.3973.2.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 655 48029 26 26 20 20 2284 3652 1 1 1 413.8853 1238.6341 3 1238.6329 0.0012 1 34.95 0.0066 R VKYETELAMR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3963.3963.3.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 655 48029 26 26 20 20 2500 4268 1 1 1 646.8629 1291.7113 2 1291.7136 -0.0023 1 33.87 0.0023 K VKLEAEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4637.4637.2.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 655 48029 26 26 20 20 2501 4266 1 1 1 431.5789 1291.7149 3 1291.7136 0.0014 1 36.19 0.00061 K VKLEAEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4635.4635.3.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 655 48029 26 26 20 20 2616 4136 1 1 1 660.3386 1318.6626 2 1318.6629 -0.0004 0 83.98 7.80E-08 R AQIFANTVDNAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4492.4492.2.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 655 48029 26 26 20 20 2918 2826 1 1 1 465.9149 1394.7228 3 1394.7266 -0.0038 1 30.85 0.0015 R QSVENDIHGLRK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3005.3005.3.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 655 48029 26 26 20 20 2919 2840 1 1 1 698.3708 1394.7271 2 1394.7266 0.0005 1 16.51 0.028 R QSVENDIHGLRK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3020.3020.2.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 655 48029 26 26 20 20 2994 5680 1 1 1 710.3779 1418.7412 2 1418.7405 0.0007 0 58.06 3.20E-05 R QAQEYEALLNIK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6350.6350.2.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 655 48029 26 26 20 20 3303 2413 1 1 1 502.2659 1503.776 3 1503.7781 -0.0021 1 35.54 0.00046 R IVDGKVVSETNDTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2538.2538.3.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 655 48029 26 26 20 20 3304 2414 1 1 1 752.8954 1503.7763 2 1503.7781 -0.0017 1 63.52 1.90E-06 R IVDGKVVSETNDTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2539.2539.2.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 655 48029 26 26 20 20 3311 6056 1 1 1 753.8781 1505.7417 2 1505.7395 0.0021 0 89.69 5.30E-09 R TVQSLEIDLDSMR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6832.6832.2.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 655 48029 26 26 20 20 5242 5758 1 1 1 1030.0489 2058.0833 2 2058.0858 -0.0024 1 52.17 1.30E-05 K IIEDLRAQIFANTVDNAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6449.6449.2.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 655 48029 26 26 20 20 5243 5742 1 1 1 687.0364 2058.0873 3 2058.0858 0.0015 1 47.49 3.50E-05 K IIEDLRAQIFANTVDNAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6428.6428.3.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 655 48029 26 26 20 20 5408 8011 1 1 1 1089.0924 2176.1703 2 2176.17 0.0002 1 40.36 0.00016 R LQLETEIEALKEELLFMK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9253.9253.2.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 655 48029 26 26 20 20 7067 8379 1 1 1 890.803 2669.3873 3 2669.3846 0.0027 0 65.22 7.70E-07 R YALQMEQLNGILLHLESELAQTR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9690.9690.3.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 655 48029 26 26 20 20 7280 6334 1 1 1 914.0903 2739.2492 3 2739.2545 -0.0053 0 30.08 0.0026 R LLEDGEDFNLGDALDSSNSMQTIQK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7192.7192.3.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 655 48029 26 26 20 20 7318 5213 1 1 1 688.1055 2748.393 4 2748.393 0 1 61.05 9.00E-06 K NHEEEVKGLQAQIASSGLTVEVDAPK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5731.5731.4.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 655 48029 26 26 20 20 7660 4384 1 1 1 952.1396 2853.3969 3 2853.4005 -0.0036 0 56.98 4.50E-06 R SLGSVQAPSYGARPVSSAASVYAGAGGSGSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4763.4763.3.dta 2 2 IPI00217963.3 "Keratin, type I cytoskeletal 16" 636 51578 18 18 16 16 1561 3696 1 0 0 532.8102 1063.6059 2 1063.6026 0.0034 1 57.63 1.80E-05 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4012.4012.2.dta 2 2 IPI00217963.3 "Keratin, type I cytoskeletal 16" 636 51578 18 18 16 16 1702 6025 1 0 1 548.7694 1095.5243 2 1095.5237 0.0006 0 53.75 5.40E-05 R DAETWFLSK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6796.6796.2.dta 2 2 IPI00217963.3 "Keratin, type I cytoskeletal 16" 636 51578 18 18 16 16 1722 1863 1 0 0 553.7658 1105.5171 2 1105.5186 -0.0015 0 57.14 3.80E-05 K VTMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1921.1921.2.dta 2 2 IPI00217963.3 "Keratin, type I cytoskeletal 16" 636 51578 18 18 16 16 1723 3329 1 0 0 553.7847 1105.5549 2 1105.555 -0.0001 0 75.66 5.70E-07 R ISSVLAGGSCR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3603.3603.2.dta 2 2 IPI00217963.3 "Keratin, type I cytoskeletal 16" 636 51578 18 18 16 16 1786 3530 1 0 0 561.7916 1121.5686 2 1121.5717 -0.0031 0 55.56 3.80E-05 R LEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3831.3831.2.dta 2 2 IPI00217963.3 "Keratin, type I cytoskeletal 16" 636 51578 18 18 16 16 2372 2948 1 0 1 420.5628 1258.6667 3 1258.6669 -0.0003 1 29.46 0.016 R TKYEHELALR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3139.3139.3.dta 2 2 IPI00217963.3 "Keratin, type I cytoskeletal 16" 636 51578 18 18 16 16 2375 2405 1 0 1 630.7886 1259.5627 2 1259.563 -0.0003 0 60.05 2.30E-06 R EVFTSSSSSSSR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2529.2529.2.dta 2 2 IPI00217963.3 "Keratin, type I cytoskeletal 16" 636 51578 18 18 16 16 2438 2932 1 0 0 639.7934 1277.5722 2 1277.5783 -0.006 0 68.72 9.40E-07 K GSCGIGGGIGGGSSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3122.3122.2.dta 2 2 IPI00217963.3 "Keratin, type I cytoskeletal 16" 636 51578 18 18 16 16 2680 3516 1 0 1 669.834 1337.6534 2 1337.6575 -0.0041 0 83.95 4.30E-08 R APSTYGGGLSVSSR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3815.3815.2.dta 2 2 IPI00217963.3 "Keratin, type I cytoskeletal 16" 636 51578 18 18 16 16 2860 4112 1 0 0 690.3661 1378.7177 2 1378.7204 -0.0027 1 59.65 2.60E-06 K TRLEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4467.4467.2.dta 2 2 IPI00217963.3 "Keratin, type I cytoskeletal 16" 636 51578 18 18 16 16 3051 3380 1 0 0 717.3633 1432.712 2 1432.7157 -0.0037 1 49.76 8.40E-05 K ASLENSLEETKGR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3658.3658.2.dta 2 2 IPI00217963.3 "Keratin, type I cytoskeletal 16" 636 51578 18 18 16 16 3052 3378 1 0 0 478.5781 1432.7124 3 1432.7157 -0.0034 1 30.61 0.002 K ASLENSLEETKGR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3656.3656.3.dta 2 2 IPI00217963.3 "Keratin, type I cytoskeletal 16" 636 51578 18 18 16 16 4406 4051 1 0 1 586.634 1756.8801 3 1756.8784 0.0017 1 32.6 0.00088 R QRPSEIKDYSPYFK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4400.4400.3.dta 2 2 IPI00217963.3 "Keratin, type I cytoskeletal 16" 636 51578 18 18 16 16 4836 4491 1 0 1 633.2961 1896.8666 3 1896.8709 -0.0043 1 18.59 0.023 R ILNEMRDQYEQMAEK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4895.4895.3.dta 2 2 IPI00217963.3 "Keratin, type I cytoskeletal 16" 636 51578 18 18 16 16 5255 5970 1 0 1 1032.5747 2063.1349 2 2063.1375 -0.0026 0 87.77 5.90E-09 K IIAATIENAQPILQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6719.6719.2.dta 2 2 IPI00217963.3 "Keratin, type I cytoskeletal 16" 636 51578 18 18 16 16 5256 5959 1 0 1 688.7203 2063.1392 3 2063.1375 0.0017 0 87.11 6.80E-09 K IIAATIENAQPILQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6704.6704.3.dta 2 2 IPI00217963.3 "Keratin, type I cytoskeletal 16" 636 51578 18 18 16 16 5394 7460 1 0 1 723.036 2166.086 3 2166.0878 -0.0018 1 25.16 0.0044 R TDLEMQIEGLKEELAYLR K Oxidation (M) 0.000010000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.8588.8588.3.dta 2 2 IPI00217963.3 "Keratin, type I cytoskeletal 16" 636 51578 18 18 16 16 5965 3364 1 0 1 784.0351 2349.0835 3 2349.0833 0.0002 0 36.9 0.00035 R LLEGEDAHLSSQQASGQSYSSR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3641.3641.3.dta 2 3 IPI00384444.5 "Keratin, type I cytoskeletal 14" 576 51875 20 20 19 19 204 4606 1 0 0 350.7339 699.4533 2 699.4531 0.0002 0 35.98 0.00083 K ILLDVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5026.5026.2.dta 2 3 IPI00384444.5 "Keratin, type I cytoskeletal 14" 576 51875 20 20 19 19 1217 2730 1 0 0 495.2731 988.5316 2 988.5301 0.0015 1 30.01 0.026 K SEISELRR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2886.2886.2.dta 2 3 IPI00384444.5 "Keratin, type I cytoskeletal 14" 576 51875 20 20 19 19 1561 3696 1 0 0 532.8102 1063.6059 2 1063.6026 0.0034 1 57.63 1.80E-05 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4012.4012.2.dta 2 3 IPI00384444.5 "Keratin, type I cytoskeletal 14" 576 51875 20 20 19 19 1722 1863 1 0 0 553.7658 1105.5171 2 1105.5186 -0.0015 0 57.14 3.80E-05 K VTMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1921.1921.2.dta 2 3 IPI00384444.5 "Keratin, type I cytoskeletal 14" 576 51875 20 20 19 19 1723 3329 1 0 0 553.7847 1105.5549 2 1105.555 -0.0001 0 75.66 5.70E-07 R ISSVLAGGSCR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3603.3603.2.dta 2 3 IPI00384444.5 "Keratin, type I cytoskeletal 14" 576 51875 20 20 19 19 1786 3530 1 0 0 561.7916 1121.5686 2 1121.5717 -0.0031 0 55.56 3.80E-05 R LEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3831.3831.2.dta 2 3 IPI00384444.5 "Keratin, type I cytoskeletal 14" 576 51875 20 20 19 19 2294 2737 1 0 0 621.7805 1241.5464 2 1241.5458 0.0005 0 19.19 0.016 K NHEEEMNALR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2893.2893.2.dta 2 3 IPI00384444.5 "Keratin, type I cytoskeletal 14" 576 51875 20 20 19 19 2398 3709 1 0 1 633.8361 1265.6576 2 1265.6615 -0.004 1 42.4 0.00011 R TKYETELNLR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4026.4026.2.dta 2 3 IPI00384444.5 "Keratin, type I cytoskeletal 14" 576 51875 20 20 19 19 2438 2932 1 0 0 639.7934 1277.5722 2 1277.5783 -0.006 0 68.72 9.40E-07 K GSCGIGGGIGGGSSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3122.3122.2.dta 2 3 IPI00384444.5 "Keratin, type I cytoskeletal 14" 576 51875 20 20 19 19 2778 4417 1 0 0 454.2382 1359.6927 3 1359.6929 -0.0001 1 16.65 0.037 R MSVEADINGLRR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4807.4807.3.dta 2 3 IPI00384444.5 "Keratin, type I cytoskeletal 14" 576 51875 20 20 19 19 2783 2894 1 0 0 681.3469 1360.6792 2 1360.6834 -0.0042 0 85.61 1.10E-08 R EVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3079.3079.2.dta 2 3 IPI00384444.5 "Keratin, type I cytoskeletal 14" 576 51875 20 20 19 19 2860 4112 1 0 0 690.3661 1378.7177 2 1378.7204 -0.0027 1 59.65 2.60E-06 K TRLEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4467.4467.2.dta 2 3 IPI00384444.5 "Keratin, type I cytoskeletal 14" 576 51875 20 20 19 19 3022 3467 1 0 1 713.3517 1424.6889 2 1424.6896 -0.0006 0 61.8 1.60E-06 R APSTYGGGLSVSSSR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3760.3760.2.dta 2 3 IPI00384444.5 "Keratin, type I cytoskeletal 14" 576 51875 20 20 19 19 3051 3380 1 0 0 717.3633 1432.712 2 1432.7157 -0.0037 1 49.76 8.40E-05 K ASLENSLEETKGR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3658.3658.2.dta 2 3 IPI00384444.5 "Keratin, type I cytoskeletal 14" 576 51875 20 20 19 19 3052 3378 1 0 0 478.5781 1432.7124 3 1432.7157 -0.0034 1 30.61 0.002 K ASLENSLEETKGR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3656.3656.3.dta 2 3 IPI00384444.5 "Keratin, type I cytoskeletal 14" 576 51875 20 20 19 19 3096 3310 1 0 0 719.854 1437.6935 2 1437.6922 0.0013 1 31.19 0.0066 R ILNEMRDQYEK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3579.3579.2.dta 2 3 IPI00384444.5 "Keratin, type I cytoskeletal 14" 576 51875 20 20 19 19 4361 4147 1 0 1 581.302 1740.8842 3 1740.8835 0.0007 1 34.65 0.00056 R QRPAEIKDYSPYFK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4504.4504.3.dta 2 3 IPI00384444.5 "Keratin, type I cytoskeletal 14" 576 51875 20 20 19 19 5316 3768 1 0 0 702.0206 2103.0399 3 2103.0444 -0.0045 1 63.83 4.70E-06 K TEELNREVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4092.4092.3.dta 2 3 IPI00384444.5 "Keratin, type I cytoskeletal 14" 576 51875 20 20 19 19 5344 7401 1 0 1 708.3703 2122.0891 3 2122.0867 0.0024 1 18.3 0.028 R ADLEMQIESLKEELAYLK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.8515.8515.3.dta 2 3 IPI00384444.5 "Keratin, type I cytoskeletal 14" 576 51875 20 20 19 19 5772 3907 1 0 1 770.36 2308.0583 3 2308.0567 0.0016 0 47.07 3.90E-05 R LLEGEDAHLSSSQFSSGSQSSR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4243.4243.3.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 507 48361 18 18 17 17 204 4606 1 0 0 350.7339 699.4533 2 699.4531 0.0002 0 35.98 0.00083 K ILLDVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5026.5026.2.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 507 48361 18 18 17 17 927 1446 1 0 1 461.2235 920.4324 2 920.4312 0.0012 0 35.34 0.0044 K GSSGLGGGSSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1463.1463.2.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 507 48361 18 18 17 17 1217 2730 1 0 0 495.2731 988.5316 2 988.5301 0.0015 1 30.01 0.026 K SEISELRR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2886.2886.2.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 507 48361 18 18 17 17 1270 7174 1 0 1 499.7538 997.4931 2 997.4941 -0.001 0 25.47 0.031 R EQVHQTTR - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.822.822.2.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 507 48361 18 18 17 17 1434 2579 1 0 1 517.7562 1033.4979 2 1033.4975 0.0004 0 73.03 1.00E-06 R LSGGLGAGSCR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2719.2719.2.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 507 48361 18 18 17 17 1548 2512 1 0 1 531.7529 1061.4912 2 1061.4924 -0.0012 0 47.68 0.0003 K ATMQNLNDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2645.2645.2.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 507 48361 18 18 17 17 1561 3696 1 0 0 532.8102 1063.6059 2 1063.6026 0.0034 1 57.63 1.80E-05 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4012.4012.2.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 507 48361 18 18 17 17 1622 1575 1 0 1 539.7506 1077.4867 2 1077.4873 -0.0006 0 41.31 0.001 K ATMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1602.1602.2.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 507 48361 18 18 17 17 1786 3530 1 0 0 561.7916 1121.5686 2 1121.5717 -0.0031 0 55.56 3.80E-05 R LEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3831.3831.2.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 507 48361 18 18 17 17 2294 2737 1 0 0 621.7805 1241.5464 2 1241.5458 0.0005 0 19.19 0.016 K NHEEEMNALR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2893.2893.2.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 507 48361 18 18 17 17 2709 3992 1 0 1 673.3452 1344.6758 2 1344.6772 -0.0015 0 91.36 7.00E-09 R ALEEANTELEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4334.4334.2.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 507 48361 18 18 17 17 2783 2894 1 0 0 681.3469 1360.6792 2 1360.6834 -0.0042 0 85.61 1.10E-08 R EVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3079.3079.2.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 507 48361 18 18 17 17 2860 4112 1 0 0 690.3661 1378.7177 2 1378.7204 -0.0027 1 59.65 2.60E-06 K TRLEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4467.4467.2.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 507 48361 18 18 17 17 2943 3736 1 0 1 702.3383 1402.6621 2 1402.6688 -0.0067 0 75.5 1.70E-07 K ASLEGNLAETENR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4057.4057.2.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 507 48361 18 18 17 17 3096 3310 1 0 0 719.854 1437.6935 2 1437.6922 0.0013 1 31.19 0.0066 R ILNEMRDQYEK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3579.3579.2.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 507 48361 18 18 17 17 3338 3839 1 0 1 506.2594 1515.7565 3 1515.7569 -0.0004 0 20.06 0.023 R LLEGEDAHLTQYK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4169.4169.3.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 507 48361 18 18 17 17 5316 3768 1 0 0 702.0206 2103.0399 3 2103.0444 -0.0045 1 63.83 4.70E-06 K TEELNREVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4092.4092.3.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 507 48361 18 18 17 17 7978 7919 1 0 1 1008.5483 3022.6232 3 3022.6298 -0.0066 1 21.49 0.028 R TIEELQNKILTATVDNANILLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9138.9138.3.dta 2 5 IPI00479145.2 "Keratin, type I cytoskeletal 19" 483 44065 16 16 15 15 680 4741 1 0 1 425.7323 849.45 2 849.4497 0.0002 0 51.06 9.60E-05 R FGPGVAFR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5184.5184.2.dta 2 5 IPI00479145.2 "Keratin, type I cytoskeletal 19" 483 44065 16 16 15 15 1236 1401 1 0 1 498.2548 994.495 2 994.4944 0.0005 0 31.57 0.0011 R APSIHGGSGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1413.1413.2.dta 2 5 IPI00479145.2 "Keratin, type I cytoskeletal 19" 483 44065 16 16 15 15 1312 3214 1 0 1 336.8463 1007.5171 3 1007.5188 -0.0017 1 23.04 0.027 K IRDWYQK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3454.3454.3.dta 2 5 IPI00479145.2 "Keratin, type I cytoskeletal 19" 483 44065 16 16 15 15 1459 4489 1 0 0 521.3065 1040.5984 2 1040.5978 0.0005 0 50.41 6.20E-05 R IVLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4893.4893.2.dta 2 5 IPI00479145.2 "Keratin, type I cytoskeletal 19" 483 44065 16 16 15 15 1561 3696 1 0 0 532.8102 1063.6059 2 1063.6026 0.0034 1 57.63 1.80E-05 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4012.4012.2.dta 2 5 IPI00479145.2 "Keratin, type I cytoskeletal 19" 483 44065 16 16 15 15 1598 3764 1 0 1 537.3012 1072.5879 2 1072.5876 0.0002 0 61.69 7.40E-06 K ILGATIENSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4088.4088.2.dta 2 5 IPI00479145.2 "Keratin, type I cytoskeletal 19" 483 44065 16 16 15 15 1786 3530 1 0 0 561.7916 1121.5686 2 1121.5717 -0.0031 0 55.56 3.80E-05 R LEQEIATYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3831.3831.2.dta 2 5 IPI00479145.2 "Keratin, type I cytoskeletal 19" 483 44065 16 16 15 15 2298 4005 1 0 1 622.3291 1242.6437 2 1242.6455 -0.0019 0 70.72 4.20E-07 R ALEAANGELEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4348.4348.2.dta 2 5 IPI00479145.2 "Keratin, type I cytoskeletal 19" 483 44065 16 16 15 15 2778 4417 1 0 0 454.2382 1359.6927 3 1359.6929 -0.0001 1 16.65 0.037 R MSVEADINGLRR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4807.4807.3.dta 2 5 IPI00479145.2 "Keratin, type I cytoskeletal 19" 483 44065 16 16 15 15 2808 4114 1 0 1 683.3585 1364.7024 2 1364.7048 -0.0024 1 59.53 2.10E-05 K SRLEQEIATYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4469.4469.2.dta 2 5 IPI00479145.2 "Keratin, type I cytoskeletal 19" 483 44065 16 16 15 15 2810 4116 2 0 1 455.9087 1364.7043 3 1364.7048 -0.0005 1 20.69 0.013 K SRLEQEIATYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4471.4471.3.dta 2 5 IPI00479145.2 "Keratin, type I cytoskeletal 19" 483 44065 16 16 15 15 2889 4562 1 0 1 695.3431 1388.6716 2 1388.6783 -0.0067 0 93.1 6.80E-09 K AALEDTLAETEAR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4975.4975.2.dta 2 5 IPI00479145.2 "Keratin, type I cytoskeletal 19" 483 44065 16 16 15 15 3448 4242 1 0 1 777.8777 1553.7408 2 1553.7434 -0.0026 0 104.38 1.60E-10 R QSSATSSFGGLGGGSVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4609.4609.2.dta 2 5 IPI00479145.2 "Keratin, type I cytoskeletal 19" 483 44065 16 16 15 15 4853 3884 1 0 1 635.637 1903.8891 3 1903.8911 -0.0021 0 23.5 0.0062 R SLLEGQEDHYNNLSASK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4218.4218.3.dta 2 5 IPI00479145.2 "Keratin, type I cytoskeletal 19" 483 44065 16 16 15 15 4924 4802 1 0 1 639.969 1916.8852 3 1916.8904 -0.0053 1 20.76 0.016 R DYSHYYTTIQDLRDK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5250.5250.3.dta 2 5 IPI00479145.2 "Keratin, type I cytoskeletal 19" 483 44065 16 16 15 15 5471 3641 1 0 1 743.3605 2227.0598 3 2227.0651 -0.0053 1 40.19 0.0013 R TEELNREVAGHTEQLQMSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3951.3951.3.dta 2 6 IPI00009865.1 "Keratin, type I cytoskeletal 10" 482 59711 15 15 12 12 1424 4961 1 0 1 516.303 1030.5914 2 1030.591 0.0004 0 57.82 6.00E-06 R VLDELTLTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5443.5443.2.dta 2 6 IPI00009865.1 "Keratin, type I cytoskeletal 10" 482 59711 15 15 12 12 1561 3696 1 0 0 532.8102 1063.6059 2 1063.6026 0.0034 1 57.63 1.80E-05 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4012.4012.2.dta 2 6 IPI00009865.1 "Keratin, type I cytoskeletal 10" 482 59711 15 15 12 12 1722 1863 1 0 0 553.7658 1105.5171 2 1105.5186 -0.0015 0 57.14 3.80E-05 K VTMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1921.1921.2.dta 2 6 IPI00009865.1 "Keratin, type I cytoskeletal 10" 482 59711 15 15 12 12 2269 3578 1 0 1 412.2314 1233.6725 3 1233.6717 0.0008 1 46.8 0.00024 R LKYENEVALR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3883.3883.3.dta 2 6 IPI00009865.1 "Keratin, type I cytoskeletal 10" 482 59711 15 15 12 12 2383 3244 1 0 1 631.8024 1261.5902 2 1261.5899 0.0003 0 70.39 1.50E-06 R SLLEGEGSSGGGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3497.3497.2.dta 2 6 IPI00009865.1 "Keratin, type I cytoskeletal 10" 482 59711 15 15 12 12 2864 3730 1 0 1 691.3254 1380.6363 2 1380.6408 -0.0045 0 81.08 2.50E-08 R ALEESNYELEGK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4051.4051.2.dta 2 6 IPI00009865.1 "Keratin, type I cytoskeletal 10" 482 59711 15 15 12 12 2893 4589 1 0 1 695.8447 1389.6748 2 1389.6736 0.0012 0 49.91 7.90E-05 K QSLEASLAETEGR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5005.5005.2.dta 2 6 IPI00009865.1 "Keratin, type I cytoskeletal 10" 482 59711 15 15 12 12 3058 4142 1 0 1 717.8874 1433.7602 2 1433.7626 -0.0024 1 41.33 0.00055 K IRLENEIQTYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4498.4498.2.dta 2 6 IPI00009865.1 "Keratin, type I cytoskeletal 10" 482 59711 15 15 12 12 3059 4137 1 0 1 478.928 1433.7622 3 1433.7626 -0.0004 1 27.21 0.033 K IRLENEIQTYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4493.4493.3.dta 2 6 IPI00009865.1 "Keratin, type I cytoskeletal 10" 482 59711 15 15 12 12 3271 2573 1 0 1 747.3699 1492.7253 2 1492.727 -0.0017 1 42 0.0003 R SQYEQLAEQNRK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2712.2712.2.dta 2 6 IPI00009865.1 "Keratin, type I cytoskeletal 10" 482 59711 15 15 12 12 4236 5226 1 0 1 854.3881 1706.7616 2 1706.7649 -0.0033 0 20.52 0.012 K GSLGGGFSSGGFSGGSFSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5747.5747.2.dta 2 6 IPI00009865.1 "Keratin, type I cytoskeletal 10" 482 59711 15 15 12 12 4237 5215 1 0 1 854.3892 1706.7638 2 1706.7649 -0.0011 0 76.49 6.70E-08 K GSLGGGFSSGGFSGGSFSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5733.5733.2.dta 2 6 IPI00009865.1 "Keratin, type I cytoskeletal 10" 482 59711 15 15 12 12 7309 8295 1 0 1 916.1445 2745.4118 3 2745.4119 -0.0002 0 21.72 0.0092 R YCVQLSQIQAQISALEEQLQQIR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9589.9589.3.dta 2 6 IPI00009865.1 "Keratin, type I cytoskeletal 10" 482 59711 15 15 12 12 8012 7925 1 0 1 1018.2136 3051.6189 3 3051.62 -0.0011 1 73.18 1.60E-07 K TIDDLKNQILNLTTDNANILLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9144.9144.3.dta 2 6 IPI00009865.1 "Keratin, type I cytoskeletal 10" 482 59711 15 15 12 12 8013 7930 1 0 1 763.9128 3051.6223 4 3051.62 0.0023 1 38.15 0.00051 K TIDDLKNQILNLTTDNANILLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9149.9149.4.dta 2 7 IPI00290077.1 "Keratin, type I cytoskeletal 15" 138 49365 4 4 4 4 1467 4645 1 0 1 521.7983 1041.5821 2 1041.5818 0.0003 0 26.98 0.012 R VILEIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5072.5072.2.dta 2 7 IPI00290077.1 "Keratin, type I cytoskeletal 15" 138 49365 4 4 4 4 1561 3696 1 0 0 532.8102 1063.6059 2 1063.6026 0.0034 1 57.63 1.80E-05 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4012.4012.2.dta 2 7 IPI00290077.1 "Keratin, type I cytoskeletal 15" 138 49365 4 4 4 4 1786 3530 1 0 0 561.7916 1121.5686 2 1121.5717 -0.0031 0 55.56 3.80E-05 R LEQEIATYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3831.3831.2.dta 2 7 IPI00290077.1 "Keratin, type I cytoskeletal 15" 138 49365 4 4 4 4 2860 4112 1 0 0 690.3661 1378.7177 2 1378.7204 -0.0027 1 59.65 2.60E-06 K TRLEQEIATYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4467.4467.2.dta 2 IPI00554788.4 49 kDa protein 616 48793 25 25 19 19 249 3313 1 0 1 359.7002 717.3858 2 717.3843 0.0015 0 27.01 0.019 K IMADIR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3583.3583.2.dta 2 IPI00554788.4 49 kDa protein 616 48793 25 25 19 19 288 2615 1 0 1 367.6978 733.381 2 733.3792 0.0017 0 31.4 0.02 K IMADIR A Oxidation (M) 0.010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2759.2759.2.dta 2 IPI00554788.4 49 kDa protein 616 48793 25 25 19 19 949 1418 2 0 1 462.7679 923.5213 2 923.5188 0.0024 1 33.25 0.0065 K IREHLEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1431.1431.2.dta 2 IPI00554788.4 49 kDa protein 616 48793 25 25 19 19 1189 5098 1 0 1 491.7243 981.4341 2 981.4345 -0.0004 0 23.75 0.05 R DWSHYFK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5600.5600.2.dta 2 IPI00554788.4 49 kDa protein 616 48793 25 25 19 19 1459 4489 1 0 0 521.3065 1040.5984 2 1040.5978 0.0005 0 50.41 6.20E-05 R IVLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4893.4893.2.dta 2 IPI00554788.4 49 kDa protein 616 48793 25 25 19 19 1565 4010 1 0 1 533.2819 1064.5492 2 1064.5502 -0.001 0 41.94 0.00017 K LEAEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4353.4353.2.dta 2 IPI00554788.4 49 kDa protein 616 48793 25 25 19 19 1685 2568 1 0 1 547.2849 1092.5553 2 1092.5563 -0.0011 1 26.9 0.004 R AQYDELARK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2707.2707.2.dta 2 IPI00554788.4 49 kDa protein 616 48793 25 25 19 19 1979 2712 1 0 1 587.8271 1173.6397 2 1173.6353 0.0044 1 44.14 0.00048 R KVIDDTNITR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2865.2865.2.dta 2 IPI00554788.4 49 kDa protein 616 48793 25 25 19 19 2283 3660 1 0 1 620.3226 1238.6306 2 1238.6329 -0.0023 1 28.74 0.0085 R VKYETELAMR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3973.3973.2.dta 2 IPI00554788.4 49 kDa protein 616 48793 25 25 19 19 2284 3652 1 0 1 413.8853 1238.6341 3 1238.6329 0.0012 1 34.95 0.0066 R VKYETELAMR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3963.3963.3.dta 2 IPI00554788.4 49 kDa protein 616 48793 25 25 19 19 2500 4268 1 0 1 646.8629 1291.7113 2 1291.7136 -0.0023 1 33.87 0.0023 K VKLEAEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4637.4637.2.dta 2 IPI00554788.4 49 kDa protein 616 48793 25 25 19 19 2501 4266 1 0 1 431.5789 1291.7149 3 1291.7136 0.0014 1 36.19 0.00061 K VKLEAEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4635.4635.3.dta 2 IPI00554788.4 49 kDa protein 616 48793 25 25 19 19 2616 4136 1 0 1 660.3386 1318.6626 2 1318.6629 -0.0004 0 83.98 7.80E-08 R AQIFANTVDNAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4492.4492.2.dta 2 IPI00554788.4 49 kDa protein 616 48793 25 25 19 19 2918 2826 1 0 1 465.9149 1394.7228 3 1394.7266 -0.0038 1 30.85 0.0015 R QSVENDIHGLRK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3005.3005.3.dta 2 IPI00554788.4 49 kDa protein 616 48793 25 25 19 19 2919 2840 1 0 1 698.3708 1394.7271 2 1394.7266 0.0005 1 16.51 0.028 R QSVENDIHGLRK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3020.3020.2.dta 2 IPI00554788.4 49 kDa protein 616 48793 25 25 19 19 2994 5680 1 0 1 710.3779 1418.7412 2 1418.7405 0.0007 0 58.06 3.20E-05 R QAQEYEALLNIK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6350.6350.2.dta 2 IPI00554788.4 49 kDa protein 616 48793 25 25 19 19 3303 2413 1 0 1 502.2659 1503.776 3 1503.7781 -0.0021 1 35.54 0.00046 R IVDGKVVSETNDTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2538.2538.3.dta 2 IPI00554788.4 49 kDa protein 616 48793 25 25 19 19 3304 2414 1 0 1 752.8954 1503.7763 2 1503.7781 -0.0017 1 63.52 1.90E-06 R IVDGKVVSETNDTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2539.2539.2.dta 2 IPI00554788.4 49 kDa protein 616 48793 25 25 19 19 3311 6056 1 0 1 753.8781 1505.7417 2 1505.7395 0.0021 0 89.69 5.30E-09 R TVQSLEIDLDSMR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6832.6832.2.dta 2 IPI00554788.4 49 kDa protein 616 48793 25 25 19 19 5242 5758 1 0 1 1030.0489 2058.0833 2 2058.0858 -0.0024 1 52.17 1.30E-05 K IIEDLRAQIFANTVDNAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6449.6449.2.dta 2 IPI00554788.4 49 kDa protein 616 48793 25 25 19 19 5243 5742 1 0 1 687.0364 2058.0873 3 2058.0858 0.0015 1 47.49 3.50E-05 K IIEDLRAQIFANTVDNAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6428.6428.3.dta 2 IPI00554788.4 49 kDa protein 616 48793 25 25 19 19 5408 8011 1 0 1 1089.0924 2176.1703 2 2176.17 0.0002 1 40.36 0.00016 R LQLETEIEALKEELLFMK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9253.9253.2.dta 2 IPI00554788.4 49 kDa protein 616 48793 25 25 19 19 7067 8379 1 0 1 890.803 2669.3873 3 2669.3846 0.0027 0 65.22 7.70E-07 R YALQMEQLNGILLHLESELAQTR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9690.9690.3.dta 2 IPI00554788.4 49 kDa protein 616 48793 25 25 19 19 7280 6334 1 0 1 914.0903 2739.2492 3 2739.2545 -0.0053 0 30.08 0.0026 R LLEDGEDFNLGDALDSSNSMQTIQK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7192.7192.3.dta 2 IPI00554788.4 49 kDa protein 616 48793 25 25 19 19 7660 4384 1 0 1 952.1396 2853.3969 3 2853.4005 -0.0036 0 56.98 4.50E-06 R SLGSVQAPSYGARPVSSAASVYAGAGGSGSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4763.4763.3.dta 2 IPI00383111.2 57 kDa protein 437 56699 14 14 11 11 1424 4961 1 0 1 516.303 1030.5914 2 1030.591 0.0004 0 57.82 6.00E-06 R VLDELTLTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5443.5443.2.dta 2 IPI00383111.2 57 kDa protein 437 56699 14 14 11 11 1561 3696 1 0 0 532.8102 1063.6059 2 1063.6026 0.0034 1 57.63 1.80E-05 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4012.4012.2.dta 2 IPI00383111.2 57 kDa protein 437 56699 14 14 11 11 1722 1863 1 0 0 553.7658 1105.5171 2 1105.5186 -0.0015 0 57.14 3.80E-05 K VTMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1921.1921.2.dta 2 IPI00383111.2 57 kDa protein 437 56699 14 14 11 11 2269 3578 1 0 1 412.2314 1233.6725 3 1233.6717 0.0008 1 46.8 0.00024 R LKYENEVALR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3883.3883.3.dta 2 IPI00383111.2 57 kDa protein 437 56699 14 14 11 11 2864 3730 1 0 1 691.3254 1380.6363 2 1380.6408 -0.0045 0 81.08 2.50E-08 R ALEESNYELEGK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4051.4051.2.dta 2 IPI00383111.2 57 kDa protein 437 56699 14 14 11 11 2893 4589 1 0 1 695.8447 1389.6748 2 1389.6736 0.0012 0 49.91 7.90E-05 K QSLEASLAETEGR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5005.5005.2.dta 2 IPI00383111.2 57 kDa protein 437 56699 14 14 11 11 3058 4142 1 0 1 717.8874 1433.7602 2 1433.7626 -0.0024 1 41.33 0.00055 K IRLENEIQTYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4498.4498.2.dta 2 IPI00383111.2 57 kDa protein 437 56699 14 14 11 11 3059 4137 1 0 1 478.928 1433.7622 3 1433.7626 -0.0004 1 27.21 0.033 K IRLENEIQTYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4493.4493.3.dta 2 IPI00383111.2 57 kDa protein 437 56699 14 14 11 11 3271 2573 1 0 1 747.3699 1492.7253 2 1492.727 -0.0017 1 42 0.0003 R SQYEQLAEQNRK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2712.2712.2.dta 2 IPI00383111.2 57 kDa protein 437 56699 14 14 11 11 4236 5226 1 0 1 854.3881 1706.7616 2 1706.7649 -0.0033 0 20.52 0.012 K GSLGGGFSSGGFSGGSFSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5747.5747.2.dta 2 IPI00383111.2 57 kDa protein 437 56699 14 14 11 11 4237 5215 1 0 1 854.3892 1706.7638 2 1706.7649 -0.0011 0 76.49 6.70E-08 K GSLGGGFSSGGFSGGSFSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5733.5733.2.dta 2 IPI00383111.2 57 kDa protein 437 56699 14 14 11 11 7309 8295 1 0 1 916.1445 2745.4118 3 2745.4119 -0.0002 0 21.72 0.0092 R YCVQLSQIQAQISALEEQLQQIR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9589.9589.3.dta 2 IPI00383111.2 57 kDa protein 437 56699 14 14 11 11 8012 7925 1 0 1 1018.2136 3051.6189 3 3051.62 -0.0011 1 73.18 1.60E-07 K TIDDLKNQILNLTTDNANILLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9144.9144.3.dta 2 IPI00383111.2 57 kDa protein 437 56699 14 14 11 11 8013 7930 1 0 1 763.9128 3051.6223 4 3051.62 0.0023 1 38.15 0.00051 K TIDDLKNQILNLTTDNANILLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9149.9149.4.dta 2 IPI00791852.1 42 kDa protein 353 41729 12 12 11 11 927 1446 1 0 1 461.2235 920.4324 2 920.4312 0.0012 0 35.34 0.0044 K GSSGLGGGSSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1463.1463.2.dta 2 IPI00791852.1 42 kDa protein 353 41729 12 12 11 11 1217 2730 1 0 0 495.2731 988.5316 2 988.5301 0.0015 1 30.01 0.026 K SEISELRR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2886.2886.2.dta 2 IPI00791852.1 42 kDa protein 353 41729 12 12 11 11 1434 2579 1 0 1 517.7562 1033.4979 2 1033.4975 0.0004 0 73.03 1.00E-06 R LSGGLGAGSCR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2719.2719.2.dta 2 IPI00791852.1 42 kDa protein 353 41729 12 12 11 11 1548 2512 1 0 1 531.7529 1061.4912 2 1061.4924 -0.0012 0 47.68 0.0003 K ATMQNLNDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2645.2645.2.dta 2 IPI00791852.1 42 kDa protein 353 41729 12 12 11 11 1561 3696 1 0 0 532.8102 1063.6059 2 1063.6026 0.0034 1 57.63 1.80E-05 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4012.4012.2.dta 2 IPI00791852.1 42 kDa protein 353 41729 12 12 11 11 1622 1575 1 0 1 539.7506 1077.4867 2 1077.4873 -0.0006 0 41.31 0.001 K ATMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1602.1602.2.dta 2 IPI00791852.1 42 kDa protein 353 41729 12 12 11 11 2294 2737 1 0 0 621.7805 1241.5464 2 1241.5458 0.0005 0 19.19 0.016 K NHEEEMNALR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2893.2893.2.dta 2 IPI00791852.1 42 kDa protein 353 41729 12 12 11 11 2709 3992 1 0 1 673.3452 1344.6758 2 1344.6772 -0.0015 0 91.36 7.00E-09 R ALEEANTELEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4334.4334.2.dta 2 IPI00791852.1 42 kDa protein 353 41729 12 12 11 11 2783 2894 1 0 0 681.3469 1360.6792 2 1360.6834 -0.0042 0 85.61 1.10E-08 R EVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3079.3079.2.dta 2 IPI00791852.1 42 kDa protein 353 41729 12 12 11 11 3096 3310 1 0 0 719.854 1437.6935 2 1437.6922 0.0013 1 31.19 0.0066 R ILNEMRDQYEK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3579.3579.2.dta 2 IPI00791852.1 42 kDa protein 353 41729 12 12 11 11 5316 3768 1 0 0 702.0206 2103.0399 3 2103.0444 -0.0045 1 63.83 4.70E-06 K TEELNREVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4092.4092.3.dta 2 IPI00791852.1 42 kDa protein 353 41729 12 12 11 11 7978 7919 1 0 1 1008.5483 3022.6232 3 3022.6298 -0.0066 1 21.49 0.028 R TIEELQNKILTATVDNANILLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9138.9138.3.dta 2 IPI00792454.1 30 kDa protein 318 30075 13 13 12 12 204 4606 1 0 0 350.7339 699.4533 2 699.4531 0.0002 0 35.98 0.00083 K ILLDVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5026.5026.2.dta 2 IPI00792454.1 30 kDa protein 318 30075 13 13 12 12 1217 2730 1 0 0 495.2731 988.5316 2 988.5301 0.0015 1 30.01 0.026 K SEISELRR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2886.2886.2.dta 2 IPI00792454.1 30 kDa protein 318 30075 13 13 12 12 1786 3530 1 0 0 561.7916 1121.5686 2 1121.5717 -0.0031 0 55.56 3.80E-05 R LEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3831.3831.2.dta 2 IPI00792454.1 30 kDa protein 318 30075 13 13 12 12 2294 2737 1 0 0 621.7805 1241.5464 2 1241.5458 0.0005 0 19.19 0.016 K NHEEEMNALR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2893.2893.2.dta 2 IPI00792454.1 30 kDa protein 318 30075 13 13 12 12 2778 4417 1 0 0 454.2382 1359.6927 3 1359.6929 -0.0001 1 16.65 0.037 - MSVEADINGLRR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4807.4807.3.dta 2 IPI00792454.1 30 kDa protein 318 30075 13 13 12 12 2783 2894 1 0 0 681.3469 1360.6792 2 1360.6834 -0.0042 0 85.61 1.10E-08 R EVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3079.3079.2.dta 2 IPI00792454.1 30 kDa protein 318 30075 13 13 12 12 2860 4112 1 0 0 690.3661 1378.7177 2 1378.7204 -0.0027 1 59.65 2.60E-06 K TRLEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4467.4467.2.dta 2 IPI00792454.1 30 kDa protein 318 30075 13 13 12 12 3051 3380 1 0 0 717.3633 1432.712 2 1432.7157 -0.0037 1 49.76 8.40E-05 K ASLENSLEETKGR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3658.3658.2.dta 2 IPI00792454.1 30 kDa protein 318 30075 13 13 12 12 3052 3378 1 0 0 478.5781 1432.7124 3 1432.7157 -0.0034 1 30.61 0.002 K ASLENSLEETKGR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3656.3656.3.dta 2 IPI00792454.1 30 kDa protein 318 30075 13 13 12 12 3096 3310 1 0 0 719.854 1437.6935 2 1437.6922 0.0013 1 31.19 0.0066 R ILNEMRDQYEK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3579.3579.2.dta 2 IPI00792454.1 30 kDa protein 318 30075 13 13 12 12 5316 3768 1 0 0 702.0206 2103.0399 3 2103.0444 -0.0045 1 63.83 4.70E-06 K TEELNREVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4092.4092.3.dta 2 IPI00792454.1 30 kDa protein 318 30075 13 13 12 12 5344 7401 1 0 1 708.3703 2122.0891 3 2122.0867 0.0024 1 18.3 0.028 R ADLEMQIESLKEELAYLK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.8515.8515.3.dta 2 IPI00792454.1 30 kDa protein 318 30075 13 13 12 12 5772 3907 1 0 1 770.36 2308.0583 3 2308.0567 0.0016 0 47.07 3.90E-05 R LLEGEDAHLSSSQFSSGSQSSR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4243.4243.3.dta 2 IPI00747707.1 KRT17 protein 304 41332 12 12 12 12 204 4606 1 0 0 350.7339 699.4533 2 699.4531 0.0002 0 35.98 0.00083 K ILLDVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5026.5026.2.dta 2 IPI00747707.1 KRT17 protein 304 41332 12 12 12 12 1217 2730 1 0 0 495.2731 988.5316 2 988.5301 0.0015 1 30.01 0.026 K SEISELRR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2886.2886.2.dta 2 IPI00747707.1 KRT17 protein 304 41332 12 12 12 12 1270 7174 1 0 1 499.7538 997.4931 2 997.4941 -0.001 0 25.47 0.031 R EQVHQTTR - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.822.822.2.dta 2 IPI00747707.1 KRT17 protein 304 41332 12 12 12 12 1786 3530 1 0 0 561.7916 1121.5686 2 1121.5717 -0.0031 0 55.56 3.80E-05 R LEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3831.3831.2.dta 2 IPI00747707.1 KRT17 protein 304 41332 12 12 12 12 2294 2737 1 0 0 621.7805 1241.5464 2 1241.5458 0.0005 0 19.19 0.016 K NHEEEMNALR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2893.2893.2.dta 2 IPI00747707.1 KRT17 protein 304 41332 12 12 12 12 2783 2894 1 0 0 681.3469 1360.6792 2 1360.6834 -0.0042 0 85.61 1.10E-08 R EVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3079.3079.2.dta 2 IPI00747707.1 KRT17 protein 304 41332 12 12 12 12 2860 4112 1 0 0 690.3661 1378.7177 2 1378.7204 -0.0027 1 59.65 2.60E-06 K TRLEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4467.4467.2.dta 2 IPI00747707.1 KRT17 protein 304 41332 12 12 12 12 2943 3736 1 0 1 702.3383 1402.6621 2 1402.6688 -0.0067 0 75.5 1.70E-07 K ASLEGNLAETENR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4057.4057.2.dta 2 IPI00747707.1 KRT17 protein 304 41332 12 12 12 12 3096 3310 1 0 0 719.854 1437.6935 2 1437.6922 0.0013 1 31.19 0.0066 R ILNEMRDQYEK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3579.3579.2.dta 2 IPI00747707.1 KRT17 protein 304 41332 12 12 12 12 3338 3839 1 0 1 506.2594 1515.7565 3 1515.7569 -0.0004 0 20.06 0.023 R LLEGEDAHLTQYK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4169.4169.3.dta 2 IPI00747707.1 KRT17 protein 304 41332 12 12 12 12 5316 3768 1 0 0 702.0206 2103.0399 3 2103.0444 -0.0045 1 63.83 4.70E-06 K TEELNREVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4092.4092.3.dta 2 IPI00747707.1 KRT17 protein 304 41332 12 12 12 12 7978 7919 1 0 1 1008.5483 3022.6232 3 3022.6298 -0.0066 1 21.49 0.028 R TIEELQNKILTATVDNANILLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9138.9138.3.dta 2 IPI00240503.7 48 kDa protein 276 48750 8 8 7 7 927 1446 1 0 1 461.2235 920.4324 2 920.4312 0.0012 0 35.34 0.0044 K GSSGLGGGSSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1463.1463.2.dta 2 IPI00240503.7 48 kDa protein 276 48750 8 8 7 7 1548 2512 1 0 1 531.7529 1061.4912 2 1061.4924 -0.0012 0 47.68 0.0003 K ATMQNLNDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2645.2645.2.dta 2 IPI00240503.7 48 kDa protein 276 48750 8 8 7 7 1561 3696 1 0 0 532.8102 1063.6059 2 1063.6026 0.0034 1 57.63 1.80E-05 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4012.4012.2.dta 2 IPI00240503.7 48 kDa protein 276 48750 8 8 7 7 1622 1575 1 0 1 539.7506 1077.4867 2 1077.4873 -0.0006 0 41.31 0.001 K ATMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1602.1602.2.dta 2 IPI00240503.7 48 kDa protein 276 48750 8 8 7 7 2783 2894 1 0 0 681.3469 1360.6792 2 1360.6834 -0.0042 0 85.61 1.10E-08 R EVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3079.3079.2.dta 2 IPI00240503.7 48 kDa protein 276 48750 8 8 7 7 2943 3736 1 0 1 702.3383 1402.6621 2 1402.6688 -0.0067 0 75.5 1.70E-07 K ASLEGNLAETENR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4057.4057.2.dta 2 IPI00240503.7 48 kDa protein 276 48750 8 8 7 7 3338 3839 1 0 1 506.2594 1515.7565 3 1515.7569 -0.0004 0 20.06 0.023 R LLEGEDAHLTQYK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4169.4169.3.dta 2 IPI00240503.7 48 kDa protein 276 48750 8 8 7 7 5316 3768 1 0 0 702.0206 2103.0399 3 2103.0444 -0.0045 1 63.83 4.70E-06 K TEELNREVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4092.4092.3.dta 2 IPI00180956.6 49 kDa protein 272 49001 7 7 6 6 927 1446 1 0 1 461.2235 920.4324 2 920.4312 0.0012 0 35.34 0.0044 K GSSGLGGGSSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1463.1463.2.dta 2 IPI00180956.6 49 kDa protein 272 49001 7 7 6 6 1548 2512 1 0 1 531.7529 1061.4912 2 1061.4924 -0.0012 0 47.68 0.0003 K ATMQNLNDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2645.2645.2.dta 2 IPI00180956.6 49 kDa protein 272 49001 7 7 6 6 1561 3696 1 0 0 532.8102 1063.6059 2 1063.6026 0.0034 1 57.63 1.80E-05 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4012.4012.2.dta 2 IPI00180956.6 49 kDa protein 272 49001 7 7 6 6 1622 1575 1 0 1 539.7506 1077.4867 2 1077.4873 -0.0006 0 41.31 0.001 K ATMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1602.1602.2.dta 2 IPI00180956.6 49 kDa protein 272 49001 7 7 6 6 2783 2894 1 0 0 681.3469 1360.6792 2 1360.6834 -0.0042 0 85.61 1.10E-08 R EVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3079.3079.2.dta 2 IPI00180956.6 49 kDa protein 272 49001 7 7 6 6 2943 3736 1 0 1 702.3383 1402.6621 2 1402.6688 -0.0067 0 75.5 1.70E-07 K ASLEGNLAETENR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4057.4057.2.dta 2 IPI00180956.6 49 kDa protein 272 49001 7 7 6 6 5316 3768 1 0 0 702.0206 2103.0399 3 2103.0444 -0.0045 1 63.83 4.70E-06 K TEELNREVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4092.4092.3.dta 2 IPI00791156.1 31 kDa protein 241 30866 9 9 8 8 927 1446 1 0 1 461.2235 920.4324 2 920.4312 0.0012 0 35.34 0.0044 K GSSGLGGGSSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1463.1463.2.dta 2 IPI00791156.1 31 kDa protein 241 30866 9 9 8 8 1434 2579 1 0 1 517.7562 1033.4979 2 1033.4975 0.0004 0 73.03 1.00E-06 R LSGGLGAGSCR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2719.2719.2.dta 2 IPI00791156.1 31 kDa protein 241 30866 9 9 8 8 1548 2512 1 0 1 531.7529 1061.4912 2 1061.4924 -0.0012 0 47.68 0.0003 K ATMQNLNDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2645.2645.2.dta 2 IPI00791156.1 31 kDa protein 241 30866 9 9 8 8 1561 3696 1 0 0 532.8102 1063.6059 2 1063.6026 0.0034 1 57.63 1.80E-05 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4012.4012.2.dta 2 IPI00791156.1 31 kDa protein 241 30866 9 9 8 8 1622 1575 1 0 1 539.7506 1077.4867 2 1077.4873 -0.0006 0 41.31 0.001 K ATMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1602.1602.2.dta 2 IPI00791156.1 31 kDa protein 241 30866 9 9 8 8 2294 2737 1 0 0 621.7805 1241.5464 2 1241.5458 0.0005 0 19.19 0.016 K NHEEEMNALR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2893.2893.2.dta 2 IPI00791156.1 31 kDa protein 241 30866 9 9 8 8 2709 3992 1 0 1 673.3452 1344.6758 2 1344.6772 -0.0015 0 91.36 7.00E-09 R ALEEANTELEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4334.4334.2.dta 2 IPI00791156.1 31 kDa protein 241 30866 9 9 8 8 3096 3310 1 0 0 719.854 1437.6935 2 1437.6922 0.0013 1 31.19 0.0066 R ILNEMRDQYEK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3579.3579.2.dta 2 IPI00791156.1 31 kDa protein 241 30866 9 9 8 8 7978 7919 1 0 1 1008.5483 3022.6232 3 3022.6298 -0.0066 1 21.49 0.028 R TIEELQNKILTATVDNANILLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9138.9138.3.dta 2 IPI00789750.1 27 kDa protein 241 26775 9 9 9 9 1722 1863 1 0 0 553.7658 1105.5171 2 1105.5186 -0.0015 0 57.14 3.80E-05 K VTMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1921.1921.2.dta 2 IPI00789750.1 27 kDa protein 241 26775 9 9 9 9 1723 3329 1 0 0 553.7847 1105.5549 2 1105.555 -0.0001 0 75.66 5.70E-07 R ISSVLAGGSCR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3603.3603.2.dta 2 IPI00789750.1 27 kDa protein 241 26775 9 9 9 9 2294 2737 1 0 0 621.7805 1241.5464 2 1241.5458 0.0005 0 19.19 0.016 K NHEEEMNALR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2893.2893.2.dta 2 IPI00789750.1 27 kDa protein 241 26775 9 9 9 9 2398 3709 1 0 1 633.8361 1265.6576 2 1265.6615 -0.004 1 42.4 0.00011 R TKYETELNLR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4026.4026.2.dta 2 IPI00789750.1 27 kDa protein 241 26775 9 9 9 9 2438 2932 1 0 0 639.7934 1277.5722 2 1277.5783 -0.006 0 68.72 9.40E-07 K GSCGIGGGIGGGSSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3122.3122.2.dta 2 IPI00789750.1 27 kDa protein 241 26775 9 9 9 9 2778 4417 1 0 0 454.2382 1359.6927 3 1359.6929 -0.0001 1 16.65 0.037 R MSVEADINGLRR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4807.4807.3.dta 2 IPI00789750.1 27 kDa protein 241 26775 9 9 9 9 3022 3467 1 0 1 713.3517 1424.6889 2 1424.6896 -0.0006 0 61.8 1.60E-06 R APSTYGGGLSVSSSR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3760.3760.2.dta 2 IPI00789750.1 27 kDa protein 241 26775 9 9 9 9 3096 3310 1 0 0 719.854 1437.6935 2 1437.6922 0.0013 1 31.19 0.0066 R ILNEMRDQYEK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3579.3579.2.dta 2 IPI00789750.1 27 kDa protein 241 26775 9 9 9 9 5344 7401 1 0 1 708.3703 2122.0891 3 2122.0867 0.0024 1 18.3 0.028 R ADLEMQIESLKEELAYLK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.8515.8515.3.dta 2 IPI00794807.1 15 kDa protein 240 15435 7 7 6 6 1565 4010 1 0 1 533.2819 1064.5492 2 1064.5502 -0.001 0 41.94 0.00017 K LEAEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4353.4353.2.dta 2 IPI00794807.1 15 kDa protein 240 15435 7 7 6 6 1685 2568 1 0 1 547.2849 1092.5553 2 1092.5563 -0.0011 1 26.9 0.004 R AQYDELARK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2707.2707.2.dta 2 IPI00794807.1 15 kDa protein 240 15435 7 7 6 6 2500 4268 1 0 1 646.8629 1291.7113 2 1291.7136 -0.0023 1 33.87 0.0023 K VKLEAEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4637.4637.2.dta 2 IPI00794807.1 15 kDa protein 240 15435 7 7 6 6 2501 4266 1 0 1 431.5789 1291.7149 3 1291.7136 0.0014 1 36.19 0.00061 K VKLEAEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4635.4635.3.dta 2 IPI00794807.1 15 kDa protein 240 15435 7 7 6 6 2994 5680 1 0 1 710.3779 1418.7412 2 1418.7405 0.0007 0 58.06 3.20E-05 R QAQEYEALLNIK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6350.6350.2.dta 2 IPI00794807.1 15 kDa protein 240 15435 7 7 6 6 3311 6056 1 0 1 753.8781 1505.7417 2 1505.7395 0.0021 0 89.69 5.30E-09 R TVQSLEIDLDSMR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6832.6832.2.dta 2 IPI00794807.1 15 kDa protein 240 15435 7 7 6 6 7067 8379 1 0 1 890.803 2669.3873 3 2669.3846 0.0027 0 65.22 7.70E-07 R YALQMEQLNGILLHLESELAQTR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9690.9690.3.dta 2 IPI00794047.1 18 kDa protein 228 18209 7 7 6 6 927 1446 1 0 1 461.2235 920.4324 2 920.4312 0.0012 0 35.34 0.0044 K GSSGLGGGSSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1463.1463.2.dta 2 IPI00794047.1 18 kDa protein 228 18209 7 7 6 6 1434 2579 1 0 1 517.7562 1033.4979 2 1033.4975 0.0004 0 73.03 1.00E-06 R LSGGLGAGSCR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2719.2719.2.dta 2 IPI00794047.1 18 kDa protein 228 18209 7 7 6 6 1548 2512 1 0 1 531.7529 1061.4912 2 1061.4924 -0.0012 0 47.68 0.0003 K ATMQNLNDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2645.2645.2.dta 2 IPI00794047.1 18 kDa protein 228 18209 7 7 6 6 1561 3696 1 0 0 532.8102 1063.6059 2 1063.6026 0.0034 1 57.63 1.80E-05 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4012.4012.2.dta 2 IPI00794047.1 18 kDa protein 228 18209 7 7 6 6 1622 1575 1 0 1 539.7506 1077.4867 2 1077.4873 -0.0006 0 41.31 0.001 K ATMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1602.1602.2.dta 2 IPI00794047.1 18 kDa protein 228 18209 7 7 6 6 2709 3992 1 0 1 673.3452 1344.6758 2 1344.6772 -0.0015 0 91.36 7.00E-09 R ALEEANTELEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4334.4334.2.dta 2 IPI00794047.1 18 kDa protein 228 18209 7 7 6 6 7978 7919 1 0 1 1008.5483 3022.6232 3 3022.6298 -0.0066 1 21.49 0.028 R TIEELQNKILTATVDNANILLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9138.9138.3.dta 2 IPI00794267.1 18 kDa protein 228 18099 7 7 6 6 949 1418 2 0 1 462.7679 923.5213 2 923.5188 0.0024 1 33.25 0.0065 K IREHLEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1431.1431.2.dta 2 IPI00794267.1 18 kDa protein 228 18099 7 7 6 6 1189 5098 1 0 1 491.7243 981.4341 2 981.4345 -0.0004 0 23.75 0.05 R DWSHYFK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5600.5600.2.dta 2 IPI00794267.1 18 kDa protein 228 18099 7 7 6 6 1459 4489 1 0 0 521.3065 1040.5984 2 1040.5978 0.0005 0 50.41 6.20E-05 R IVLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4893.4893.2.dta 2 IPI00794267.1 18 kDa protein 228 18099 7 7 6 6 2616 4136 1 0 1 660.3386 1318.6626 2 1318.6629 -0.0004 0 83.98 7.80E-08 R AQIFANTVDNAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4492.4492.2.dta 2 IPI00794267.1 18 kDa protein 228 18099 7 7 6 6 5242 5758 1 0 1 1030.0489 2058.0833 2 2058.0858 -0.0024 1 52.17 1.30E-05 K IIEDLRAQIFANTVDNAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6449.6449.2.dta 2 IPI00794267.1 18 kDa protein 228 18099 7 7 6 6 5243 5742 1 0 1 687.0364 2058.0873 3 2058.0858 0.0015 1 47.49 3.50E-05 K IIEDLRAQIFANTVDNAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6428.6428.3.dta 2 IPI00794267.1 18 kDa protein 228 18099 7 7 6 6 7660 4384 1 0 1 952.1396 2853.3969 3 2853.4005 -0.0036 0 56.98 4.50E-06 R SLGSVQAPSYGARPVSSAASVYAGAGGSGSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4763.4763.3.dta 2 IPI00789536.1 MGC102966 protein 220 15752 5 5 4 4 1561 3696 1 0 0 532.8102 1063.6059 2 1063.6026 0.0034 1 57.63 1.80E-05 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4012.4012.2.dta 2 IPI00789536.1 MGC102966 protein 220 15752 5 5 4 4 4406 4051 1 0 1 586.634 1756.8801 3 1756.8784 0.0017 1 32.6 0.00088 R QRPSEIKDYSPYFK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4400.4400.3.dta 2 IPI00789536.1 MGC102966 protein 220 15752 5 5 4 4 5255 5970 1 0 1 1032.5747 2063.1349 2 2063.1375 -0.0026 0 87.77 5.90E-09 K IIAATIENAQPILQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6719.6719.2.dta 2 IPI00789536.1 MGC102966 protein 220 15752 5 5 4 4 5256 5959 1 0 1 688.7203 2063.1392 3 2063.1375 0.0017 0 87.11 6.80E-09 K IIAATIENAQPILQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6704.6704.3.dta 2 IPI00789536.1 MGC102966 protein 220 15752 5 5 4 4 5394 7460 1 0 1 723.036 2166.086 3 2166.0878 -0.0018 1 25.16 0.0044 R TDLEMQIEGLKEELAYLR K Oxidation (M) 0.000010000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.8588.8588.3.dta 2 IPI00794644.1 21 kDa protein 216 20831 6 6 6 6 680 4741 1 0 1 425.7323 849.45 2 849.4497 0.0002 0 51.06 9.60E-05 R FGPGVAFR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5184.5184.2.dta 2 IPI00794644.1 21 kDa protein 216 20831 6 6 6 6 1236 1401 1 0 1 498.2548 994.495 2 994.4944 0.0005 0 31.57 0.0011 R APSIHGGSGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1413.1413.2.dta 2 IPI00794644.1 21 kDa protein 216 20831 6 6 6 6 1459 4489 1 0 0 521.3065 1040.5984 2 1040.5978 0.0005 0 50.41 6.20E-05 R IVLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4893.4893.2.dta 2 IPI00794644.1 21 kDa protein 216 20831 6 6 6 6 1561 3696 1 0 0 532.8102 1063.6059 2 1063.6026 0.0034 1 57.63 1.80E-05 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4012.4012.2.dta 2 IPI00794644.1 21 kDa protein 216 20831 6 6 6 6 2778 4417 1 0 0 454.2382 1359.6927 3 1359.6929 -0.0001 1 16.65 0.037 R MSVEADINGLRR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4807.4807.3.dta 2 IPI00794644.1 21 kDa protein 216 20831 6 6 6 6 3448 4242 1 0 1 777.8777 1553.7408 2 1553.7434 -0.0026 0 104.38 1.60E-10 R QSSATSSFGGLGGGSVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4609.4609.2.dta 2 IPI00794731.1 15 kDa protein 203 15182 6 6 5 5 1786 3530 1 0 0 561.7916 1121.5686 2 1121.5717 -0.0031 0 55.56 3.80E-05 R LEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3831.3831.2.dta 2 IPI00794731.1 15 kDa protein 203 15182 6 6 5 5 2375 2405 1 0 1 630.7886 1259.5627 2 1259.563 -0.0003 0 60.05 2.30E-06 R EVFTSSSSSSSR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2529.2529.2.dta 2 IPI00794731.1 15 kDa protein 203 15182 6 6 5 5 2860 4112 1 0 0 690.3661 1378.7177 2 1378.7204 -0.0027 1 59.65 2.60E-06 K TRLEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4467.4467.2.dta 2 IPI00794731.1 15 kDa protein 203 15182 6 6 5 5 3051 3380 1 0 0 717.3633 1432.712 2 1432.7157 -0.0037 1 49.76 8.40E-05 K ASLENSLEETKGR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3658.3658.2.dta 2 IPI00794731.1 15 kDa protein 203 15182 6 6 5 5 3052 3378 1 0 0 478.5781 1432.7124 3 1432.7157 -0.0034 1 30.61 0.002 K ASLENSLEETKGR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3656.3656.3.dta 2 IPI00794731.1 15 kDa protein 203 15182 6 6 5 5 5965 3364 1 0 1 784.0351 2349.0835 3 2349.0833 0.0002 0 36.9 0.00035 R LLEGEDAHLSSQQASGQSYSSR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3641.3641.3.dta 2 IPI00795719.1 16 kDa protein 193 16241 3 3 2 2 1561 3696 1 0 0 532.8102 1063.6059 2 1063.6026 0.0034 1 57.63 1.80E-05 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4012.4012.2.dta 2 IPI00795719.1 16 kDa protein 193 16241 3 3 2 2 5255 5970 1 0 1 1032.5747 2063.1349 2 2063.1375 -0.0026 0 87.77 5.90E-09 K IIAATIENAQPILQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6719.6719.2.dta 2 IPI00795719.1 16 kDa protein 193 16241 3 3 2 2 5256 5959 1 0 1 688.7203 2063.1392 3 2063.1375 0.0017 0 87.11 6.80E-09 K IIAATIENAQPILQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6704.6704.3.dta 2 IPI00654614.1 Epidermal type I keratin (Fragment) 191 17892 7 7 6 6 204 4606 1 0 0 350.7339 699.4533 2 699.4531 0.0002 0 35.98 0.00083 K ILLDVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5026.5026.2.dta 2 IPI00654614.1 Epidermal type I keratin (Fragment) 191 17892 7 7 6 6 1217 2730 1 0 0 495.2731 988.5316 2 988.5301 0.0015 1 30.01 0.026 K SEISELRR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2886.2886.2.dta 2 IPI00654614.1 Epidermal type I keratin (Fragment) 191 17892 7 7 6 6 1786 3530 1 0 0 561.7916 1121.5686 2 1121.5717 -0.0031 0 55.56 3.80E-05 R LEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3831.3831.2.dta 2 IPI00654614.1 Epidermal type I keratin (Fragment) 191 17892 7 7 6 6 2860 4112 1 0 0 690.3661 1378.7177 2 1378.7204 -0.0027 1 59.65 2.60E-06 K TRLEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4467.4467.2.dta 2 IPI00654614.1 Epidermal type I keratin (Fragment) 191 17892 7 7 6 6 3051 3380 1 0 0 717.3633 1432.712 2 1432.7157 -0.0037 1 49.76 8.40E-05 K ASLENSLEETKGR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3658.3658.2.dta 2 IPI00654614.1 Epidermal type I keratin (Fragment) 191 17892 7 7 6 6 3052 3378 1 0 0 478.5781 1432.7124 3 1432.7157 -0.0034 1 30.61 0.002 K ASLENSLEETKGR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3656.3656.3.dta 2 IPI00654614.1 Epidermal type I keratin (Fragment) 191 17892 7 7 6 6 5772 3907 1 0 1 770.36 2308.0583 3 2308.0567 0.0016 0 47.07 3.90E-05 R LLEGEDAHLSSSQFSSGSQSSR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4243.4243.3.dta 2 IPI00790191.1 25 kDa protein 189 25322 7 7 6 6 1786 3530 1 0 0 561.7916 1121.5686 2 1121.5717 -0.0031 0 55.56 3.80E-05 R LEQEIATYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3831.3831.2.dta 2 IPI00790191.1 25 kDa protein 189 25322 7 7 6 6 2778 4417 1 0 0 454.2382 1359.6927 3 1359.6929 -0.0001 1 16.65 0.037 - MSVEADINGLRR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4807.4807.3.dta 2 IPI00790191.1 25 kDa protein 189 25322 7 7 6 6 2808 4114 1 0 1 683.3585 1364.7024 2 1364.7048 -0.0024 1 59.53 2.10E-05 K SRLEQEIATYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4469.4469.2.dta 2 IPI00790191.1 25 kDa protein 189 25322 7 7 6 6 2810 4116 2 0 1 455.9087 1364.7043 3 1364.7048 -0.0005 1 20.69 0.013 K SRLEQEIATYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4471.4471.3.dta 2 IPI00790191.1 25 kDa protein 189 25322 7 7 6 6 2889 4562 1 0 1 695.3431 1388.6716 2 1388.6783 -0.0067 0 93.1 6.80E-09 K AALEDTLAETEAR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4975.4975.2.dta 2 IPI00790191.1 25 kDa protein 189 25322 7 7 6 6 4853 3884 1 0 1 635.637 1903.8891 3 1903.8911 -0.0021 0 23.5 0.0062 R SLLEGQEDHYNNLSASK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4218.4218.3.dta 2 IPI00790191.1 25 kDa protein 189 25322 7 7 6 6 5471 3641 1 0 1 743.3605 2227.0598 3 2227.0651 -0.0053 1 40.19 0.0013 R TEELNREVAGHTEQLQMSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3951.3951.3.dta 2 IPI00795353.1 11 kDa protein 187 10894 7 7 5 5 1565 4010 1 0 1 533.2819 1064.5492 2 1064.5502 -0.001 0 41.94 0.00017 K LEAEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4353.4353.2.dta 2 IPI00795353.1 11 kDa protein 187 10894 7 7 5 5 2500 4268 1 0 1 646.8629 1291.7113 2 1291.7136 -0.0023 1 33.87 0.0023 K VKLEAEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4637.4637.2.dta 2 IPI00795353.1 11 kDa protein 187 10894 7 7 5 5 2501 4266 1 0 1 431.5789 1291.7149 3 1291.7136 0.0014 1 36.19 0.00061 K VKLEAEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4635.4635.3.dta 2 IPI00795353.1 11 kDa protein 187 10894 7 7 5 5 2994 5680 1 0 1 710.3779 1418.7412 2 1418.7405 0.0007 0 58.06 3.20E-05 R QAQEYEALLNIK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6350.6350.2.dta 2 IPI00795353.1 11 kDa protein 187 10894 7 7 5 5 3303 2413 1 0 1 502.2659 1503.776 3 1503.7781 -0.0021 1 35.54 0.00046 R IVDGKVVSETNDTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2538.2538.3.dta 2 IPI00795353.1 11 kDa protein 187 10894 7 7 5 5 3304 2414 1 0 1 752.8954 1503.7763 2 1503.7781 -0.0017 1 63.52 1.90E-06 R IVDGKVVSETNDTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2539.2539.2.dta 2 IPI00795353.1 11 kDa protein 187 10894 7 7 5 5 7280 6334 1 0 1 914.0903 2739.2492 3 2739.2545 -0.0053 0 30.08 0.0026 R LLEDGEDFNLGDALDSSNSMQTIQK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7192.7192.3.dta 2 IPI00184195.2 19 kDa protein 184 18696 7 7 7 7 1312 3214 1 0 1 336.8463 1007.5171 3 1007.5188 -0.0017 1 23.04 0.027 K IRDWYQK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3454.3454.3.dta 2 IPI00184195.2 19 kDa protein 184 18696 7 7 7 7 1459 4489 1 0 0 521.3065 1040.5984 2 1040.5978 0.0005 0 50.41 6.20E-05 R IVLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4893.4893.2.dta 2 IPI00184195.2 19 kDa protein 184 18696 7 7 7 7 1561 3696 1 0 0 532.8102 1063.6059 2 1063.6026 0.0034 1 57.63 1.80E-05 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4012.4012.2.dta 2 IPI00184195.2 19 kDa protein 184 18696 7 7 7 7 1598 3764 1 0 1 537.3012 1072.5879 2 1072.5876 0.0002 0 61.69 7.40E-06 K ILGATIENSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4088.4088.2.dta 2 IPI00184195.2 19 kDa protein 184 18696 7 7 7 7 2298 4005 1 0 1 622.3291 1242.6437 2 1242.6455 -0.0019 0 70.72 4.20E-07 R ALEAANGELEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4348.4348.2.dta 2 IPI00184195.2 19 kDa protein 184 18696 7 7 7 7 2778 4417 1 0 0 454.2382 1359.6927 3 1359.6929 -0.0001 1 16.65 0.037 R MSVEADINGLRR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4807.4807.3.dta 2 IPI00184195.2 19 kDa protein 184 18696 7 7 7 7 4924 4802 1 0 1 639.969 1916.8852 3 1916.8904 -0.0053 1 20.76 0.016 R DYSHYYTTIQDLRDK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5250.5250.3.dta 2 IPI00793186.1 9 kDa protein 144 9417 4 4 4 4 204 4606 1 0 0 350.7339 699.4533 2 699.4531 0.0002 0 35.98 0.00083 K ILLDVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5026.5026.2.dta 2 IPI00793186.1 9 kDa protein 144 9417 4 4 4 4 1786 3530 1 0 0 561.7916 1121.5686 2 1121.5717 -0.0031 0 55.56 3.80E-05 R LEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3831.3831.2.dta 2 IPI00793186.1 9 kDa protein 144 9417 4 4 4 4 2860 4112 1 0 0 690.3661 1378.7177 2 1378.7204 -0.0027 1 59.65 2.60E-06 K TRLEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4467.4467.2.dta 2 IPI00793186.1 9 kDa protein 144 9417 4 4 4 4 5772 3907 1 0 1 770.36 2308.0583 3 2308.0567 0.0016 0 47.07 3.90E-05 R LLEGEDAHLSSSQFSSGSQSSR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4243.4243.3.dta 2 IPI00791348.1 20 kDa protein 121 19811 2 2 2 2 1723 3329 1 0 0 553.7847 1105.5549 2 1105.555 -0.0001 0 75.66 5.70E-07 R ISSVLAGGSCR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3603.3603.2.dta 2 IPI00791348.1 20 kDa protein 121 19811 2 2 2 2 2438 2932 1 0 0 639.7934 1277.5722 2 1277.5783 -0.006 0 68.72 9.40E-07 K GSCGIGGGIGGGSSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3122.3122.2.dta 2 IPI00783306.1 Similar to keratin 14 113 9604 4 4 3 3 204 4606 1 0 0 350.7339 699.4533 2 699.4531 0.0002 0 35.98 0.00083 K ILLDVK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5026.5026.2.dta 2 IPI00783306.1 Similar to keratin 14 113 9604 4 4 3 3 1786 3530 1 0 0 561.7916 1121.5686 2 1121.5717 -0.0031 0 55.56 3.80E-05 R LEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3831.3831.2.dta 2 IPI00783306.1 Similar to keratin 14 113 9604 4 4 3 3 3051 3380 1 0 0 717.3633 1432.712 2 1432.7157 -0.0037 1 49.76 8.40E-05 K ASLENSLEETKGR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3658.3658.2.dta 2 IPI00783306.1 Similar to keratin 14 113 9604 4 4 3 3 3052 3378 1 0 0 478.5781 1432.7124 3 1432.7157 -0.0034 1 30.61 0.002 K ASLENSLEETKGR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3656.3656.3.dta 2 IPI00792629.1 18 kDa protein 110 18074 4 4 3 3 927 1446 1 0 1 461.2235 920.4324 2 920.4312 0.0012 0 35.34 0.0044 K GSSGLGGGSSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1463.1463.2.dta 2 IPI00792629.1 18 kDa protein 110 18074 4 4 3 3 1548 2512 1 0 1 531.7529 1061.4912 2 1061.4924 -0.0012 0 47.68 0.0003 K ATMQNLNDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2645.2645.2.dta 2 IPI00792629.1 18 kDa protein 110 18074 4 4 3 3 1561 3696 1 0 0 532.8102 1063.6059 2 1063.6026 0.0034 1 57.63 1.80E-05 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4012.4012.2.dta 2 IPI00792629.1 18 kDa protein 110 18074 4 4 3 3 1622 1575 1 0 1 539.7506 1077.4867 2 1077.4873 -0.0006 0 41.31 0.001 K ATMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1602.1602.2.dta 2 IPI00009866.6 "Isoform 1 of Keratin, type I cytoskeletal 13" 102 49898 3 3 3 3 1467 4645 1 0 1 521.7983 1041.5821 2 1041.5818 0.0003 0 26.98 0.012 R VILEIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5072.5072.2.dta 2 IPI00009866.6 "Isoform 1 of Keratin, type I cytoskeletal 13" 102 49898 3 3 3 3 1786 3530 1 0 0 561.7916 1121.5686 2 1121.5717 -0.0031 0 55.56 3.80E-05 R LEQEIATYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3831.3831.2.dta 2 IPI00009866.6 "Isoform 1 of Keratin, type I cytoskeletal 13" 102 49898 3 3 3 3 2860 4112 1 0 0 690.3661 1378.7177 2 1378.7204 -0.0027 1 59.65 2.60E-06 K TRLEQEIATYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4467.4467.2.dta 2 IPI00021298.1 "Keratin, type I cytoskeletal 20" 95 48514 2 2 2 2 1786 3530 1 0 0 561.7916 1121.5686 2 1121.5717 -0.0031 0 55.56 3.80E-05 R LEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3831.3831.2.dta 2 IPI00021298.1 "Keratin, type I cytoskeletal 20" 95 48514 2 2 2 2 2860 4112 1 0 0 690.3661 1378.7177 2 1378.7204 -0.0027 1 59.65 2.60E-06 K TRLEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4467.4467.2.dta 2 IPI00790298.1 20 kDa protein 91 19591 1 1 1 1 2709 3992 1 0 1 673.3452 1344.6758 2 1344.6772 -0.0015 0 91.36 7.00E-09 R ALEEANTELEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4334.4334.2.dta 2 IPI00791342.1 13 kDa protein 81 13121 2 2 2 2 1561 3696 1 0 0 532.8102 1063.6059 2 1063.6026 0.0034 1 57.63 1.80E-05 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4012.4012.2.dta 2 IPI00791342.1 13 kDa protein 81 13121 2 2 2 2 2398 3709 1 0 1 633.8361 1265.6576 2 1265.6615 -0.004 1 42.4 0.00011 R TKYETELNLR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4026.4026.2.dta 2 IPI00748465.1 44 kDa protein 78 44811 4 4 3 3 1189 5098 1 0 1 491.7243 981.4341 2 981.4345 -0.0004 0 23.75 0.05 R DWSHYFK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5600.5600.2.dta 2 IPI00748465.1 44 kDa protein 78 44811 4 4 3 3 1565 4010 1 0 1 533.2819 1064.5492 2 1064.5502 -0.001 0 41.94 0.00017 K LEAEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4353.4353.2.dta 2 IPI00748465.1 44 kDa protein 78 44811 4 4 3 3 2500 4268 1 0 1 646.8629 1291.7113 2 1291.7136 -0.0023 1 33.87 0.0023 K VKLEAEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4637.4637.2.dta 2 IPI00748465.1 44 kDa protein 78 44811 4 4 3 3 2501 4266 1 0 1 431.5789 1291.7149 3 1291.7136 0.0014 1 36.19 0.00061 K VKLEAEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4635.4635.3.dta 2 IPI00793702.1 7 kDa protein 65 6580 1 1 1 1 7067 8379 1 0 1 890.803 2669.3873 3 2669.3846 0.0027 0 65.22 7.70E-07 R YALQMEQLNGILLHLESELAQTR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9690.9690.3.dta 2 IPI00304458.1 "Keratin, type I cytoskeletal 23" 64 48209 2 2 1 1 1548 2512 1 0 1 531.7529 1061.4912 2 1061.4924 -0.0012 0 47.68 0.0003 K ATMQNLNDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2645.2645.2.dta 2 IPI00304458.1 "Keratin, type I cytoskeletal 23" 64 48209 2 2 1 1 1622 1575 1 0 1 539.7506 1077.4867 2 1077.4873 -0.0006 0 41.31 0.001 K ATMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1602.1602.2.dta 2 IPI00015309.1 "Keratin, type I cytoskeletal 12" 58 53592 1 1 1 1 1561 3696 1 0 0 532.8102 1063.6059 2 1063.6026 0.0034 1 57.63 1.80E-05 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4012.4012.2.dta 2 IPI00328103.2 Keratin-27 57 50419 1 1 1 1 1722 1863 1 0 0 553.7658 1105.5171 2 1105.5186 -0.0015 0 57.14 3.80E-05 K VTMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1921.1921.2.dta 2 IPI00166126.2 Keratin 222 pseudogene 56 34308 1 1 1 1 1786 3530 1 0 0 561.7916 1121.5686 2 1121.5717 -0.0031 0 55.56 3.80E-05 R LEQEIATYR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3831.3831.2.dta 2 IPI00743092.1 36 kDa protein 45 36504 2 2 2 2 1189 5098 1 0 1 491.7243 981.4341 2 981.4345 -0.0004 0 23.75 0.05 R DWSHYFK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5600.5600.2.dta 2 IPI00743092.1 36 kDa protein 45 36504 2 2 2 2 5408 8011 1 0 1 1089.0924 2176.1703 2 2176.17 0.0002 1 40.36 0.00016 R LQLETEIEALKEELLFMK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9253.9253.2.dta 2 IPI00550661.2 "Isoform 2 of Keratin, type I cytoskeletal 13" 27 38783 1 1 1 1 1467 4645 1 0 1 521.7983 1041.5821 2 1041.5818 0.0003 0 26.98 0.012 R VILEIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5072.5072.2.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 605 42052 24 24 18 18 109 4705 1 1 0 322.7203 643.4261 2 643.4268 -0.0008 0 32.03 0.004 R GILTLK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5143.5143.2.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 605 42052 24 24 18 18 476 3837 1 1 0 400.7715 799.5285 2 799.528 0.0005 1 25.32 0.016 K RGILTLK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4167.4167.2.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 605 42052 24 24 18 18 870 1959 1 1 1 453.229 904.4434 2 904.4436 -0.0003 1 42.99 0.0014 K CDVDIRK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2025.2025.2.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 605 42052 24 24 18 18 937 2198 1 1 1 308.5277 922.5614 3 922.56 0.0014 1 24.91 0.016 K IIAPPERK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2300.2300.3.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 605 42052 24 24 18 18 1338 5167 1 1 1 507.7443 1013.474 2 1013.4739 0 0 46.16 6.70E-05 R DLTDYLMK I Oxidation (M) 0.00000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5681.5681.2.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 605 42052 24 24 18 18 1444 3556 1 1 1 518.8278 1035.641 2 1035.644 -0.0031 1 31.55 0.0015 K IKIIAPPER K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3859.3859.2.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 605 42052 24 24 18 18 1829 3729 1 1 1 566.765 1131.5155 2 1131.5197 -0.0042 0 59.88 3.60E-06 R GYSFTTTAER E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4050.4050.2.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 605 42052 24 24 18 18 1996 3555 1 1 1 589.309 1176.6035 2 1176.606 -0.0025 0 28.68 0.0085 K EITALAPSTMK I Oxidation (M) 0.00000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3858.3858.2.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 605 42052 24 24 18 18 2030 2243 1 1 1 594.285 1186.5555 2 1186.5587 -0.0032 0 23.8 0.0059 R HQGVMVGMGQK D Oxidation (M) 0.00001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2348.2348.2.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 605 42052 24 24 18 18 2031 1867 1 1 1 594.2861 1186.5576 2 1186.5587 -0.0011 0 34.5 0.00058 R HQGVMVGMGQK D Oxidation (M) 0.00000001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1925.1925.2.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 605 42052 24 24 18 18 2749 2059 1 1 1 677.8146 1353.6147 2 1353.6161 -0.0013 1 53.54 9.50E-06 K DSYVGDEAQSKR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2136.2136.2.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 605 42052 24 24 18 18 2750 2058 1 1 1 452.2127 1353.6162 3 1353.6161 0.0001 1 43.4 0.00039 K DSYVGDEAQSKR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2135.2135.3.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 605 42052 24 24 18 18 3334 4091 1 1 0 505.9208 1514.7405 3 1514.7419 -0.0014 0 32.71 0.0034 K IWHHTFYNELR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4444.4444.3.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 605 42052 24 24 18 18 3335 3117 1 1 0 758.8539 1515.6933 2 1515.6954 -0.002 0 69.09 3.30E-07 K QEYDESGPSIVHR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3346.3346.2.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 605 42052 24 24 18 18 3336 3109 1 1 0 506.2387 1515.6943 3 1515.6954 -0.0011 0 38.1 0.00028 K QEYDESGPSIVHR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3335.3335.3.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 605 42052 24 24 18 18 3439 4054 1 1 1 516.9431 1547.8075 3 1547.8051 0.0024 1 31.39 0.0054 R MQKEITALAPSTMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4403.4403.3.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 605 42052 24 24 18 18 3746 6174 1 1 1 541.9525 1622.8357 3 1622.8338 0.0019 1 20.31 0.021 R LDLAGRDLTDYLMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6974.6974.3.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 605 42052 24 24 18 18 4487 5430 1 1 0 895.9494 1789.8843 2 1789.8846 -0.0004 0 41.88 0.00013 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6005.6005.2.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 605 42052 24 24 18 18 4488 5788 1 1 0 895.9495 1789.8845 2 1789.8846 -0.0001 0 77.13 3.30E-07 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6485.6485.2.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 605 42052 24 24 18 18 4489 5813 1 1 0 597.6356 1789.885 3 1789.8846 0.0004 0 46.94 4.90E-05 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6515.6515.3.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 605 42052 24 24 18 18 5018 4946 1 1 1 652.026 1953.0562 3 1953.0571 -0.0009 0 37.26 0.0014 R VAPEEHPVLLTEAPLNPK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5427.5427.3.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 605 42052 24 24 18 18 6615 7223 1 1 1 1275.5917 2549.1688 2 2549.1665 0.0023 0 73.81 1.20E-07 K LCYVALDFEQEMATAASSSSLEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.8280.8280.2.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 605 42052 24 24 18 18 6616 7216 1 1 1 850.7315 2549.1727 3 2549.1665 0.0062 0 93.93 1.60E-09 K LCYVALDFEQEMATAASSSSLEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.8271.8271.3.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 605 42052 24 24 18 18 8142 6035 1 1 1 796.6595 3182.6088 4 3182.6071 0.0018 0 21.04 0.024 R TTGIVMDSGDGVTHTVPIYEGYALPHAILR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6807.6807.4.dta 3 2 IPI00739539.2 "similar to Prostate, ovary, testis expressed protein on chromosome 2" 245 123020 9 9 6 6 109 4705 1 0 0 322.7203 643.4261 2 643.4268 -0.0008 0 32.03 0.004 R GILTLK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5143.5143.2.dta 3 2 IPI00739539.2 "similar to Prostate, ovary, testis expressed protein on chromosome 2" 245 123020 9 9 6 6 476 3837 1 0 0 400.7715 799.5285 2 799.528 0.0005 1 25.32 0.016 K RGILTLK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4167.4167.2.dta 3 2 IPI00739539.2 "similar to Prostate, ovary, testis expressed protein on chromosome 2" 245 123020 9 9 6 6 3334 4091 1 0 0 505.9208 1514.7405 3 1514.7419 -0.0014 0 32.71 0.0034 K IWHHTFYNELR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4444.4444.3.dta 3 2 IPI00739539.2 "similar to Prostate, ovary, testis expressed protein on chromosome 2" 245 123020 9 9 6 6 3335 3117 1 0 0 758.8539 1515.6933 2 1515.6954 -0.002 0 69.09 3.30E-07 K QEYDESGPSIVHR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3346.3346.2.dta 3 2 IPI00739539.2 "similar to Prostate, ovary, testis expressed protein on chromosome 2" 245 123020 9 9 6 6 3336 3109 1 0 0 506.2387 1515.6943 3 1515.6954 -0.0011 0 38.1 0.00028 K QEYDESGPSIVHR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3335.3335.3.dta 3 2 IPI00739539.2 "similar to Prostate, ovary, testis expressed protein on chromosome 2" 245 123020 9 9 6 6 4487 5430 1 0 0 895.9494 1789.8843 2 1789.8846 -0.0004 0 41.88 0.00013 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6005.6005.2.dta 3 2 IPI00739539.2 "similar to Prostate, ovary, testis expressed protein on chromosome 2" 245 123020 9 9 6 6 4488 5788 1 0 0 895.9495 1789.8845 2 1789.8846 -0.0001 0 77.13 3.30E-07 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6485.6485.2.dta 3 2 IPI00739539.2 "similar to Prostate, ovary, testis expressed protein on chromosome 2" 245 123020 9 9 6 6 4489 5813 1 0 0 597.6356 1789.885 3 1789.8846 0.0004 0 46.94 4.90E-05 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6515.6515.3.dta 3 2 IPI00739539.2 "similar to Prostate, ovary, testis expressed protein on chromosome 2" 245 123020 9 9 6 6 7619 7084 1 0 1 947.118 2838.3321 3 2838.3085 0.0236 0 27.19 0.0028 K ALQLNELTMDDDTAVLVIDNGSGMCK A Oxidation (M) 0.00000000000000000000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.8111.8111.3.dta 3 IPI00794523.2 ACTG1 protein 472 28478 16 16 12 12 870 1959 1 0 1 453.229 904.4434 2 904.4436 -0.0003 1 42.99 0.0014 K CDVDIRK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2025.2025.2.dta 3 IPI00794523.2 ACTG1 protein 472 28478 16 16 12 12 937 2198 1 0 1 308.5277 922.5614 3 922.56 0.0014 1 24.91 0.016 K IIAPPERK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2300.2300.3.dta 3 IPI00794523.2 ACTG1 protein 472 28478 16 16 12 12 1338 5167 1 0 1 507.7443 1013.474 2 1013.4739 0 0 46.16 6.70E-05 R DLTDYLMK I Oxidation (M) 0.00000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5681.5681.2.dta 3 IPI00794523.2 ACTG1 protein 472 28478 16 16 12 12 1444 3556 1 0 1 518.8278 1035.641 2 1035.644 -0.0031 1 31.55 0.0015 K IKIIAPPER K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3859.3859.2.dta 3 IPI00794523.2 ACTG1 protein 472 28478 16 16 12 12 1829 3729 1 0 1 566.765 1131.5155 2 1131.5197 -0.0042 0 59.88 3.60E-06 R GYSFTTTAER E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4050.4050.2.dta 3 IPI00794523.2 ACTG1 protein 472 28478 16 16 12 12 1996 3555 1 0 1 589.309 1176.6035 2 1176.606 -0.0025 0 28.68 0.0085 K EITALAPSTMK I Oxidation (M) 0.00000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3858.3858.2.dta 3 IPI00794523.2 ACTG1 protein 472 28478 16 16 12 12 3335 3117 1 0 0 758.8539 1515.6933 2 1515.6954 -0.002 0 69.09 3.30E-07 K QEYDESGPSIVHR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3346.3346.2.dta 3 IPI00794523.2 ACTG1 protein 472 28478 16 16 12 12 3336 3109 1 0 0 506.2387 1515.6943 3 1515.6954 -0.0011 0 38.1 0.00028 K QEYDESGPSIVHR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3335.3335.3.dta 3 IPI00794523.2 ACTG1 protein 472 28478 16 16 12 12 3439 4054 1 0 1 516.9431 1547.8075 3 1547.8051 0.0024 1 31.39 0.0054 R MQKEITALAPSTMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4403.4403.3.dta 3 IPI00794523.2 ACTG1 protein 472 28478 16 16 12 12 3746 6174 1 0 1 541.9525 1622.8357 3 1622.8338 0.0019 1 20.31 0.021 R LDLAGRDLTDYLMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6974.6974.3.dta 3 IPI00794523.2 ACTG1 protein 472 28478 16 16 12 12 4487 5430 1 0 0 895.9494 1789.8843 2 1789.8846 -0.0004 0 41.88 0.00013 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6005.6005.2.dta 3 IPI00794523.2 ACTG1 protein 472 28478 16 16 12 12 4488 5788 1 0 0 895.9495 1789.8845 2 1789.8846 -0.0001 0 77.13 3.30E-07 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6485.6485.2.dta 3 IPI00794523.2 ACTG1 protein 472 28478 16 16 12 12 4489 5813 1 0 0 597.6356 1789.885 3 1789.8846 0.0004 0 46.94 4.90E-05 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6515.6515.3.dta 3 IPI00794523.2 ACTG1 protein 472 28478 16 16 12 12 6615 7223 1 0 1 1275.5917 2549.1688 2 2549.1665 0.0023 0 73.81 1.20E-07 K LCYVALDFEQEMATAASSSSLEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.8280.8280.2.dta 3 IPI00794523.2 ACTG1 protein 472 28478 16 16 12 12 6616 7216 1 0 1 850.7315 2549.1727 3 2549.1665 0.0062 0 93.93 1.60E-09 K LCYVALDFEQEMATAASSSSLEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.8271.8271.3.dta 3 IPI00794523.2 ACTG1 protein 472 28478 16 16 12 12 8142 6035 1 0 1 796.6595 3182.6088 4 3182.6071 0.0018 0 21.04 0.024 R TTGIVMDSGDGVTHTVPIYEGYALPHAILR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6807.6807.4.dta 3 IPI00021428.1 "Actin, alpha skeletal muscle" 319 42366 16 16 12 12 109 4705 1 0 0 322.7203 643.4261 2 643.4268 -0.0008 0 32.03 0.004 R GILTLK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5143.5143.2.dta 3 IPI00021428.1 "Actin, alpha skeletal muscle" 319 42366 16 16 12 12 476 3837 1 0 0 400.7715 799.5285 2 799.528 0.0005 1 25.32 0.016 K RGILTLK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4167.4167.2.dta 3 IPI00021428.1 "Actin, alpha skeletal muscle" 319 42366 16 16 12 12 937 2198 1 0 1 308.5277 922.5614 3 922.56 0.0014 1 24.91 0.016 K IIAPPERK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2300.2300.3.dta 3 IPI00021428.1 "Actin, alpha skeletal muscle" 319 42366 16 16 12 12 1338 5167 1 0 1 507.7443 1013.474 2 1013.4739 0 0 46.16 6.70E-05 R DLTDYLMK I Oxidation (M) 0.00000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5681.5681.2.dta 3 IPI00021428.1 "Actin, alpha skeletal muscle" 319 42366 16 16 12 12 1444 3556 1 0 1 518.8278 1035.641 2 1035.644 -0.0031 1 31.55 0.0015 K IKIIAPPER K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3859.3859.2.dta 3 IPI00021428.1 "Actin, alpha skeletal muscle" 319 42366 16 16 12 12 1996 3555 1 0 1 589.309 1176.6035 2 1176.606 -0.0025 0 28.68 0.0085 K EITALAPSTMK I Oxidation (M) 0.00000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3858.3858.2.dta 3 IPI00021428.1 "Actin, alpha skeletal muscle" 319 42366 16 16 12 12 2030 2243 1 0 1 594.285 1186.5555 2 1186.5587 -0.0032 0 23.8 0.0059 R HQGVMVGMGQK D Oxidation (M) 0.00001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2348.2348.2.dta 3 IPI00021428.1 "Actin, alpha skeletal muscle" 319 42366 16 16 12 12 2031 1867 1 0 1 594.2861 1186.5576 2 1186.5587 -0.0011 0 34.5 0.00058 R HQGVMVGMGQK D Oxidation (M) 0.00000001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1925.1925.2.dta 3 IPI00021428.1 "Actin, alpha skeletal muscle" 319 42366 16 16 12 12 2749 2059 1 0 1 677.8146 1353.6147 2 1353.6161 -0.0013 1 53.54 9.50E-06 K DSYVGDEAQSKR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2136.2136.2.dta 3 IPI00021428.1 "Actin, alpha skeletal muscle" 319 42366 16 16 12 12 2750 2058 1 0 1 452.2127 1353.6162 3 1353.6161 0.0001 1 43.4 0.00039 K DSYVGDEAQSKR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2135.2135.3.dta 3 IPI00021428.1 "Actin, alpha skeletal muscle" 319 42366 16 16 12 12 3334 4091 1 0 0 505.9208 1514.7405 3 1514.7419 -0.0014 0 32.71 0.0034 K IWHHTFYNELR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4444.4444.3.dta 3 IPI00021428.1 "Actin, alpha skeletal muscle" 319 42366 16 16 12 12 3439 4054 1 0 1 516.9431 1547.8075 3 1547.8051 0.0024 1 31.39 0.0054 R MQKEITALAPSTMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4403.4403.3.dta 3 IPI00021428.1 "Actin, alpha skeletal muscle" 319 42366 16 16 12 12 3746 6174 1 0 1 541.9525 1622.8357 3 1622.8338 0.0019 1 20.31 0.021 R LDLAGRDLTDYLMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6974.6974.3.dta 3 IPI00021428.1 "Actin, alpha skeletal muscle" 319 42366 16 16 12 12 4487 5430 1 0 0 895.9494 1789.8843 2 1789.8846 -0.0004 0 41.88 0.00013 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6005.6005.2.dta 3 IPI00021428.1 "Actin, alpha skeletal muscle" 319 42366 16 16 12 12 4488 5788 1 0 0 895.9495 1789.8845 2 1789.8846 -0.0001 0 77.13 3.30E-07 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6485.6485.2.dta 3 IPI00021428.1 "Actin, alpha skeletal muscle" 319 42366 16 16 12 12 4489 5813 1 0 0 597.6356 1789.885 3 1789.8846 0.0004 0 46.94 4.90E-05 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6515.6515.3.dta 3 IPI00008603.1 "Actin, aortic smooth muscle" 307 42381 15 15 11 11 109 4705 1 0 0 322.7203 643.4261 2 643.4268 -0.0008 0 32.03 0.004 R GILTLK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5143.5143.2.dta 3 IPI00008603.1 "Actin, aortic smooth muscle" 307 42381 15 15 11 11 476 3837 1 0 0 400.7715 799.5285 2 799.528 0.0005 1 25.32 0.016 K RGILTLK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4167.4167.2.dta 3 IPI00008603.1 "Actin, aortic smooth muscle" 307 42381 15 15 11 11 937 2198 1 0 1 308.5277 922.5614 3 922.56 0.0014 1 24.91 0.016 K IIAPPERK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2300.2300.3.dta 3 IPI00008603.1 "Actin, aortic smooth muscle" 307 42381 15 15 11 11 1338 5167 1 0 1 507.7443 1013.474 2 1013.4739 0 0 46.16 6.70E-05 R DLTDYLMK I Oxidation (M) 0.00000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5681.5681.2.dta 3 IPI00008603.1 "Actin, aortic smooth muscle" 307 42381 15 15 11 11 1444 3556 1 0 1 518.8278 1035.641 2 1035.644 -0.0031 1 31.55 0.0015 K IKIIAPPER K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3859.3859.2.dta 3 IPI00008603.1 "Actin, aortic smooth muscle" 307 42381 15 15 11 11 1996 3555 1 0 1 589.309 1176.6035 2 1176.606 -0.0025 0 28.68 0.0085 K EITALAPSTMK I Oxidation (M) 0.00000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3858.3858.2.dta 3 IPI00008603.1 "Actin, aortic smooth muscle" 307 42381 15 15 11 11 2030 2243 1 0 1 594.285 1186.5555 2 1186.5587 -0.0032 0 23.8 0.0059 R HQGVMVGMGQK D Oxidation (M) 0.00001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2348.2348.2.dta 3 IPI00008603.1 "Actin, aortic smooth muscle" 307 42381 15 15 11 11 2031 1867 1 0 1 594.2861 1186.5576 2 1186.5587 -0.0011 0 34.5 0.00058 R HQGVMVGMGQK D Oxidation (M) 0.00000001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1925.1925.2.dta 3 IPI00008603.1 "Actin, aortic smooth muscle" 307 42381 15 15 11 11 2749 2059 1 0 1 677.8146 1353.6147 2 1353.6161 -0.0013 1 53.54 9.50E-06 K DSYVGDEAQSKR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2136.2136.2.dta 3 IPI00008603.1 "Actin, aortic smooth muscle" 307 42381 15 15 11 11 2750 2058 1 0 1 452.2127 1353.6162 3 1353.6161 0.0001 1 43.4 0.00039 K DSYVGDEAQSKR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2135.2135.3.dta 3 IPI00008603.1 "Actin, aortic smooth muscle" 307 42381 15 15 11 11 3439 4054 1 0 1 516.9431 1547.8075 3 1547.8051 0.0024 1 31.39 0.0054 R MQKEITALAPSTMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4403.4403.3.dta 3 IPI00008603.1 "Actin, aortic smooth muscle" 307 42381 15 15 11 11 3746 6174 1 0 1 541.9525 1622.8357 3 1622.8338 0.0019 1 20.31 0.021 R LDLAGRDLTDYLMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6974.6974.3.dta 3 IPI00008603.1 "Actin, aortic smooth muscle" 307 42381 15 15 11 11 4487 5430 1 0 0 895.9494 1789.8843 2 1789.8846 -0.0004 0 41.88 0.00013 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6005.6005.2.dta 3 IPI00008603.1 "Actin, aortic smooth muscle" 307 42381 15 15 11 11 4488 5788 1 0 0 895.9495 1789.8845 2 1789.8846 -0.0001 0 77.13 3.30E-07 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6485.6485.2.dta 3 IPI00008603.1 "Actin, aortic smooth muscle" 307 42381 15 15 11 11 4489 5813 1 0 0 597.6356 1789.885 3 1789.8846 0.0004 0 46.94 4.90E-05 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6515.6515.3.dta 3 IPI00514530.4 "Actin, alpha 1, skeletal muscle" 290 38138 13 13 9 9 937 2198 1 0 1 308.5277 922.5614 3 922.56 0.0014 1 24.91 0.016 K IIAPPERK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2300.2300.3.dta 3 IPI00514530.4 "Actin, alpha 1, skeletal muscle" 290 38138 13 13 9 9 1338 5167 1 0 1 507.7443 1013.474 2 1013.4739 0 0 46.16 6.70E-05 R DLTDYLMK I Oxidation (M) 0.00000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5681.5681.2.dta 3 IPI00514530.4 "Actin, alpha 1, skeletal muscle" 290 38138 13 13 9 9 1444 3556 1 0 1 518.8278 1035.641 2 1035.644 -0.0031 1 31.55 0.0015 K IKIIAPPER K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3859.3859.2.dta 3 IPI00514530.4 "Actin, alpha 1, skeletal muscle" 290 38138 13 13 9 9 1996 3555 1 0 1 589.309 1176.6035 2 1176.606 -0.0025 0 28.68 0.0085 K EITALAPSTMK I Oxidation (M) 0.00000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3858.3858.2.dta 3 IPI00514530.4 "Actin, alpha 1, skeletal muscle" 290 38138 13 13 9 9 2030 2243 1 0 1 594.285 1186.5555 2 1186.5587 -0.0032 0 23.8 0.0059 R HQGVMVGMGQK D Oxidation (M) 0.00001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2348.2348.2.dta 3 IPI00514530.4 "Actin, alpha 1, skeletal muscle" 290 38138 13 13 9 9 2031 1867 1 0 1 594.2861 1186.5576 2 1186.5587 -0.0011 0 34.5 0.00058 R HQGVMVGMGQK D Oxidation (M) 0.00000001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1925.1925.2.dta 3 IPI00514530.4 "Actin, alpha 1, skeletal muscle" 290 38138 13 13 9 9 2749 2059 1 0 1 677.8146 1353.6147 2 1353.6161 -0.0013 1 53.54 9.50E-06 K DSYVGDEAQSKR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2136.2136.2.dta 3 IPI00514530.4 "Actin, alpha 1, skeletal muscle" 290 38138 13 13 9 9 2750 2058 1 0 1 452.2127 1353.6162 3 1353.6161 0.0001 1 43.4 0.00039 K DSYVGDEAQSKR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2135.2135.3.dta 3 IPI00514530.4 "Actin, alpha 1, skeletal muscle" 290 38138 13 13 9 9 3439 4054 1 0 1 516.9431 1547.8075 3 1547.8051 0.0024 1 31.39 0.0054 R MQKEITALAPSTMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4403.4403.3.dta 3 IPI00514530.4 "Actin, alpha 1, skeletal muscle" 290 38138 13 13 9 9 3746 6174 1 0 1 541.9525 1622.8357 3 1622.8338 0.0019 1 20.31 0.021 R LDLAGRDLTDYLMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6974.6974.3.dta 3 IPI00514530.4 "Actin, alpha 1, skeletal muscle" 290 38138 13 13 9 9 4487 5430 1 0 0 895.9494 1789.8843 2 1789.8846 -0.0004 0 41.88 0.00013 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6005.6005.2.dta 3 IPI00514530.4 "Actin, alpha 1, skeletal muscle" 290 38138 13 13 9 9 4488 5788 1 0 0 895.9495 1789.8845 2 1789.8846 -0.0001 0 77.13 3.30E-07 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6485.6485.2.dta 3 IPI00514530.4 "Actin, alpha 1, skeletal muscle" 290 38138 13 13 9 9 4489 5813 1 0 0 597.6356 1789.885 3 1789.8846 0.0004 0 46.94 4.90E-05 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6515.6515.3.dta 3 IPI00515047.1 "Actin, alpha 1, skeletal muscle" 285 32370 14 14 10 10 109 4705 1 0 0 322.7203 643.4261 2 643.4268 -0.0008 0 32.03 0.004 R GILTLK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5143.5143.2.dta 3 IPI00515047.1 "Actin, alpha 1, skeletal muscle" 285 32370 14 14 10 10 476 3837 1 0 0 400.7715 799.5285 2 799.528 0.0005 1 25.32 0.016 K RGILTLK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4167.4167.2.dta 3 IPI00515047.1 "Actin, alpha 1, skeletal muscle" 285 32370 14 14 10 10 937 2198 1 0 1 308.5277 922.5614 3 922.56 0.0014 1 24.91 0.016 K IIAPPERK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2300.2300.3.dta 3 IPI00515047.1 "Actin, alpha 1, skeletal muscle" 285 32370 14 14 10 10 1444 3556 1 0 1 518.8278 1035.641 2 1035.644 -0.0031 1 31.55 0.0015 K IKIIAPPER K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3859.3859.2.dta 3 IPI00515047.1 "Actin, alpha 1, skeletal muscle" 285 32370 14 14 10 10 1996 3555 1 0 1 589.309 1176.6035 2 1176.606 -0.0025 0 28.68 0.0085 K EITALAPSTMK I Oxidation (M) 0.00000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3858.3858.2.dta 3 IPI00515047.1 "Actin, alpha 1, skeletal muscle" 285 32370 14 14 10 10 2030 2243 1 0 1 594.285 1186.5555 2 1186.5587 -0.0032 0 23.8 0.0059 R HQGVMVGMGQK D Oxidation (M) 0.00001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2348.2348.2.dta 3 IPI00515047.1 "Actin, alpha 1, skeletal muscle" 285 32370 14 14 10 10 2031 1867 1 0 1 594.2861 1186.5576 2 1186.5587 -0.0011 0 34.5 0.00058 R HQGVMVGMGQK D Oxidation (M) 0.00000001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1925.1925.2.dta 3 IPI00515047.1 "Actin, alpha 1, skeletal muscle" 285 32370 14 14 10 10 2749 2059 1 0 1 677.8146 1353.6147 2 1353.6161 -0.0013 1 53.54 9.50E-06 K DSYVGDEAQSKR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2136.2136.2.dta 3 IPI00515047.1 "Actin, alpha 1, skeletal muscle" 285 32370 14 14 10 10 2750 2058 1 0 1 452.2127 1353.6162 3 1353.6161 0.0001 1 43.4 0.00039 K DSYVGDEAQSKR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2135.2135.3.dta 3 IPI00515047.1 "Actin, alpha 1, skeletal muscle" 285 32370 14 14 10 10 3334 4091 1 0 0 505.9208 1514.7405 3 1514.7419 -0.0014 0 32.71 0.0034 K IWHHTFYNELR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4444.4444.3.dta 3 IPI00515047.1 "Actin, alpha 1, skeletal muscle" 285 32370 14 14 10 10 3439 4054 1 0 1 516.9431 1547.8075 3 1547.8051 0.0024 1 31.39 0.0054 R MQKEITALAPSTMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4403.4403.3.dta 3 IPI00515047.1 "Actin, alpha 1, skeletal muscle" 285 32370 14 14 10 10 4487 5430 1 0 0 895.9494 1789.8843 2 1789.8846 -0.0004 0 41.88 0.00013 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6005.6005.2.dta 3 IPI00515047.1 "Actin, alpha 1, skeletal muscle" 285 32370 14 14 10 10 4488 5788 1 0 0 895.9495 1789.8845 2 1789.8846 -0.0001 0 77.13 3.30E-07 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6485.6485.2.dta 3 IPI00515047.1 "Actin, alpha 1, skeletal muscle" 285 32370 14 14 10 10 4489 5813 1 0 0 597.6356 1789.885 3 1789.8846 0.0004 0 46.94 4.90E-05 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6515.6515.3.dta 3 IPI00003269.1 hypothetical protein LOC345651 236 42318 11 11 8 8 870 1959 1 0 1 453.229 904.4434 2 904.4436 -0.0003 1 42.99 0.0014 K CDVDIRK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2025.2025.2.dta 3 IPI00003269.1 hypothetical protein LOC345651 236 42318 11 11 8 8 937 2198 1 0 1 308.5277 922.5614 3 922.56 0.0014 1 24.91 0.016 K IIAPPERK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2300.2300.3.dta 3 IPI00003269.1 hypothetical protein LOC345651 236 42318 11 11 8 8 1338 5167 1 0 1 507.7443 1013.474 2 1013.4739 0 0 46.16 6.70E-05 R DLTDYLMK I Oxidation (M) 0.00000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5681.5681.2.dta 3 IPI00003269.1 hypothetical protein LOC345651 236 42318 11 11 8 8 1444 3556 1 0 1 518.8278 1035.641 2 1035.644 -0.0031 1 31.55 0.0015 K IKIIAPPER K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3859.3859.2.dta 3 IPI00003269.1 hypothetical protein LOC345651 236 42318 11 11 8 8 2030 2243 1 0 1 594.285 1186.5555 2 1186.5587 -0.0032 0 23.8 0.0059 R HQGVMVGMGQK D Oxidation (M) 0.00001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2348.2348.2.dta 3 IPI00003269.1 hypothetical protein LOC345651 236 42318 11 11 8 8 2031 1867 1 0 1 594.2861 1186.5576 2 1186.5587 -0.0011 0 34.5 0.00058 R HQGVMVGMGQK D Oxidation (M) 0.00000001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1925.1925.2.dta 3 IPI00003269.1 hypothetical protein LOC345651 236 42318 11 11 8 8 3746 6174 1 0 1 541.9525 1622.8357 3 1622.8338 0.0019 1 20.31 0.021 R LDLAGRDLTDYLMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6974.6974.3.dta 3 IPI00003269.1 hypothetical protein LOC345651 236 42318 11 11 8 8 4487 5430 1 0 0 895.9494 1789.8843 2 1789.8846 -0.0004 0 41.88 0.00013 R SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6005.6005.2.dta 3 IPI00003269.1 hypothetical protein LOC345651 236 42318 11 11 8 8 4488 5788 1 0 0 895.9495 1789.8845 2 1789.8846 -0.0001 0 77.13 3.30E-07 R SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6485.6485.2.dta 3 IPI00003269.1 hypothetical protein LOC345651 236 42318 11 11 8 8 4489 5813 1 0 0 597.6356 1789.885 3 1789.8846 0.0004 0 46.94 4.90E-05 R SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6515.6515.3.dta 3 IPI00003269.1 hypothetical protein LOC345651 236 42318 11 11 8 8 5018 4946 2 0 1 652.026 1953.0562 3 1953.0571 -0.0009 0 28.11 0.012 R VAPDEHPILLTEAPLNPK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5427.5427.3.dta 3 IPI00816229.1 ACTA2 protein (Fragment) 226 37125 11 11 8 8 109 4705 1 0 0 322.7203 643.4261 2 643.4268 -0.0008 0 32.03 0.004 R GILTLK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5143.5143.2.dta 3 IPI00816229.1 ACTA2 protein (Fragment) 226 37125 11 11 8 8 476 3837 1 0 0 400.7715 799.5285 2 799.528 0.0005 1 25.32 0.016 K RGILTLK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4167.4167.2.dta 3 IPI00816229.1 ACTA2 protein (Fragment) 226 37125 11 11 8 8 1338 5167 1 0 1 507.7443 1013.474 2 1013.4739 0 0 46.16 6.70E-05 R DLTDYLMK I Oxidation (M) 0.00000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5681.5681.2.dta 3 IPI00816229.1 ACTA2 protein (Fragment) 226 37125 11 11 8 8 1996 3555 1 0 1 589.309 1176.6035 2 1176.606 -0.0025 0 28.68 0.0085 K EITALAPSTMK I Oxidation (M) 0.00000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3858.3858.2.dta 3 IPI00816229.1 ACTA2 protein (Fragment) 226 37125 11 11 8 8 2030 2243 1 0 1 594.285 1186.5555 2 1186.5587 -0.0032 0 23.8 0.0059 R HQGVMVGMGQK D Oxidation (M) 0.00001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2348.2348.2.dta 3 IPI00816229.1 ACTA2 protein (Fragment) 226 37125 11 11 8 8 2031 1867 1 0 1 594.2861 1186.5576 2 1186.5587 -0.0011 0 34.5 0.00058 R HQGVMVGMGQK D Oxidation (M) 0.00000001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1925.1925.2.dta 3 IPI00816229.1 ACTA2 protein (Fragment) 226 37125 11 11 8 8 3439 4054 1 0 1 516.9431 1547.8075 3 1547.8051 0.0024 1 31.39 0.0054 R MQKEITALAPSTMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4403.4403.3.dta 3 IPI00816229.1 ACTA2 protein (Fragment) 226 37125 11 11 8 8 3746 6174 1 0 1 541.9525 1622.8357 3 1622.8338 0.0019 1 20.31 0.021 R LDLAGRDLTDYLMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6974.6974.3.dta 3 IPI00816229.1 ACTA2 protein (Fragment) 226 37125 11 11 8 8 4487 5430 1 0 0 895.9494 1789.8843 2 1789.8846 -0.0004 0 41.88 0.00013 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6005.6005.2.dta 3 IPI00816229.1 ACTA2 protein (Fragment) 226 37125 11 11 8 8 4488 5788 1 0 0 895.9495 1789.8845 2 1789.8846 -0.0001 0 77.13 3.30E-07 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6485.6485.2.dta 3 IPI00816229.1 ACTA2 protein (Fragment) 226 37125 11 11 8 8 4489 5813 1 0 0 597.6356 1789.885 3 1789.8846 0.0004 0 46.94 4.90E-05 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6515.6515.3.dta 3 IPI00555900.1 FKSG30 215 42331 6 6 3 3 3334 4091 1 0 0 505.9208 1514.7405 3 1514.7419 -0.0014 0 32.71 0.0034 K IWHHTFYNELR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4444.4444.3.dta 3 IPI00555900.1 FKSG30 215 42331 6 6 3 3 3335 3117 1 0 0 758.8539 1515.6933 2 1515.6954 -0.002 0 69.09 3.30E-07 K QEYDESGPSIVHR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3346.3346.2.dta 3 IPI00555900.1 FKSG30 215 42331 6 6 3 3 3336 3109 1 0 0 506.2387 1515.6943 3 1515.6954 -0.0011 0 38.1 0.00028 K QEYDESGPSIVHR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3335.3335.3.dta 3 IPI00555900.1 FKSG30 215 42331 6 6 3 3 4487 5430 1 0 0 895.9494 1789.8843 2 1789.8846 -0.0004 0 41.88 0.00013 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6005.6005.2.dta 3 IPI00555900.1 FKSG30 215 42331 6 6 3 3 4488 5788 1 0 0 895.9495 1789.8845 2 1789.8846 -0.0001 0 77.13 3.30E-07 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6485.6485.2.dta 3 IPI00555900.1 FKSG30 215 42331 6 6 3 3 4489 5813 1 0 0 597.6356 1789.885 3 1789.8846 0.0004 0 46.94 4.90E-05 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6515.6515.3.dta 3 IPI00414057.2 Actin alpha 1 skeletal muscle protein 175 28454 11 11 9 9 109 4705 1 0 0 322.7203 643.4261 2 643.4268 -0.0008 0 32.03 0.004 R GILTLK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5143.5143.2.dta 3 IPI00414057.2 Actin alpha 1 skeletal muscle protein 175 28454 11 11 9 9 476 3837 1 0 0 400.7715 799.5285 2 799.528 0.0005 1 25.32 0.016 K RGILTLK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4167.4167.2.dta 3 IPI00414057.2 Actin alpha 1 skeletal muscle protein 175 28454 11 11 9 9 937 2198 1 0 1 308.5277 922.5614 3 922.56 0.0014 1 24.91 0.016 K IIAPPERK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2300.2300.3.dta 3 IPI00414057.2 Actin alpha 1 skeletal muscle protein 175 28454 11 11 9 9 1444 3556 1 0 1 518.8278 1035.641 2 1035.644 -0.0031 1 31.55 0.0015 K IKIIAPPER K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3859.3859.2.dta 3 IPI00414057.2 Actin alpha 1 skeletal muscle protein 175 28454 11 11 9 9 1996 3555 1 0 1 589.309 1176.6035 2 1176.606 -0.0025 0 28.68 0.0085 K EITALAPSTMK I Oxidation (M) 0.00000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3858.3858.2.dta 3 IPI00414057.2 Actin alpha 1 skeletal muscle protein 175 28454 11 11 9 9 2030 2243 1 0 1 594.285 1186.5555 2 1186.5587 -0.0032 0 23.8 0.0059 R HQGVMVGMGQK D Oxidation (M) 0.00001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2348.2348.2.dta 3 IPI00414057.2 Actin alpha 1 skeletal muscle protein 175 28454 11 11 9 9 2031 1867 1 0 1 594.2861 1186.5576 2 1186.5587 -0.0011 0 34.5 0.00058 R HQGVMVGMGQK D Oxidation (M) 0.00000001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1925.1925.2.dta 3 IPI00414057.2 Actin alpha 1 skeletal muscle protein 175 28454 11 11 9 9 2749 2059 1 0 1 677.8146 1353.6147 2 1353.6161 -0.0013 1 53.54 9.50E-06 K DSYVGDEAQSKR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2136.2136.2.dta 3 IPI00414057.2 Actin alpha 1 skeletal muscle protein 175 28454 11 11 9 9 2750 2058 1 0 1 452.2127 1353.6162 3 1353.6161 0.0001 1 43.4 0.00039 K DSYVGDEAQSKR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2135.2135.3.dta 3 IPI00414057.2 Actin alpha 1 skeletal muscle protein 175 28454 11 11 9 9 3334 4091 1 0 0 505.9208 1514.7405 3 1514.7419 -0.0014 0 32.71 0.0034 K IWHHTFYNELR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4444.4444.3.dta 3 IPI00414057.2 Actin alpha 1 skeletal muscle protein 175 28454 11 11 9 9 3439 4054 1 0 1 516.9431 1547.8075 3 1547.8051 0.0024 1 31.39 0.0054 R MQKEITALAPSTMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4403.4403.3.dta 3 IPI00790339.1 22 kDa protein 151 22189 8 8 6 6 109 4705 1 0 0 322.7203 643.4261 2 643.4268 -0.0008 0 32.03 0.004 R GILTLK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5143.5143.2.dta 3 IPI00790339.1 22 kDa protein 151 22189 8 8 6 6 476 3837 1 0 0 400.7715 799.5285 2 799.528 0.0005 1 25.32 0.016 K RGILTLK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4167.4167.2.dta 3 IPI00790339.1 22 kDa protein 151 22189 8 8 6 6 2030 2243 1 0 1 594.285 1186.5555 2 1186.5587 -0.0032 0 23.8 0.0059 R HQGVMVGMGQK D Oxidation (M) 0.00001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2348.2348.2.dta 3 IPI00790339.1 22 kDa protein 151 22189 8 8 6 6 2031 1867 1 0 1 594.2861 1186.5576 2 1186.5587 -0.0011 0 34.5 0.00058 R HQGVMVGMGQK D Oxidation (M) 0.00000001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1925.1925.2.dta 3 IPI00790339.1 22 kDa protein 151 22189 8 8 6 6 2749 2059 1 0 1 677.8146 1353.6147 2 1353.6161 -0.0013 1 53.54 9.50E-06 K DSYVGDEAQSKR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2136.2136.2.dta 3 IPI00790339.1 22 kDa protein 151 22189 8 8 6 6 2750 2058 1 0 1 452.2127 1353.6162 3 1353.6161 0.0001 1 43.4 0.00039 K DSYVGDEAQSKR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2135.2135.3.dta 3 IPI00790339.1 22 kDa protein 151 22189 8 8 6 6 3334 4091 1 0 0 505.9208 1514.7405 3 1514.7419 -0.0014 0 32.71 0.0034 K IWHHTFYNELR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4444.4444.3.dta 3 IPI00790339.1 22 kDa protein 151 22189 8 8 6 6 5018 4946 1 0 1 652.026 1953.0562 3 1953.0571 -0.0009 0 37.26 0.0014 R VAPEEHPVLLTEAPLNPK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5427.5427.3.dta 3 IPI00738655.2 "similar to Prostate, ovary, testis expressed protein on chromosome 2" 134 118740 6 6 5 5 109 4705 1 0 0 322.7203 643.4261 2 643.4268 -0.0008 0 32.03 0.004 R GILTLK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5143.5143.2.dta 3 IPI00738655.2 "similar to Prostate, ovary, testis expressed protein on chromosome 2" 134 118740 6 6 5 5 476 3837 1 0 0 400.7715 799.5285 2 799.528 0.0005 1 25.32 0.016 K RGILTLK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4167.4167.2.dta 3 IPI00738655.2 "similar to Prostate, ovary, testis expressed protein on chromosome 2" 134 118740 6 6 5 5 3334 4091 1 0 0 505.9208 1514.7405 3 1514.7419 -0.0014 0 32.71 0.0034 K IWHHTFYNELR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4444.4444.3.dta 3 IPI00738655.2 "similar to Prostate, ovary, testis expressed protein on chromosome 2" 134 118740 6 6 5 5 3335 3117 1 0 0 758.8539 1515.6933 2 1515.6954 -0.002 0 69.09 3.30E-07 K QEYDESGPSIVHR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3346.3346.2.dta 3 IPI00738655.2 "similar to Prostate, ovary, testis expressed protein on chromosome 2" 134 118740 6 6 5 5 3336 3109 1 0 0 506.2387 1515.6943 3 1515.6954 -0.0011 0 38.1 0.00028 K QEYDESGPSIVHR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3335.3335.3.dta 3 IPI00738655.2 "similar to Prostate, ovary, testis expressed protein on chromosome 2" 134 118740 6 6 5 5 7619 7084 1 0 1 947.118 2838.3321 3 2838.3085 0.0236 0 27.19 0.0028 K ALQLNELTMDDDTAVLVIDNGSGMCK A Oxidation (M) 0.00000000000000000000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.8111.8111.3.dta 3 IPI00645534.1 "Actin, alpha 2, smooth muscle, aorta" 123 16919 6 6 4 4 109 4705 1 0 0 322.7203 643.4261 2 643.4268 -0.0008 0 32.03 0.004 R GILTLK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5143.5143.2.dta 3 IPI00645534.1 "Actin, alpha 2, smooth muscle, aorta" 123 16919 6 6 4 4 476 3837 1 0 0 400.7715 799.5285 2 799.528 0.0005 1 25.32 0.016 K RGILTLK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4167.4167.2.dta 3 IPI00645534.1 "Actin, alpha 2, smooth muscle, aorta" 123 16919 6 6 4 4 2030 2243 1 0 1 594.285 1186.5555 2 1186.5587 -0.0032 0 23.8 0.0059 R HQGVMVGMGQK D Oxidation (M) 0.00001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2348.2348.2.dta 3 IPI00645534.1 "Actin, alpha 2, smooth muscle, aorta" 123 16919 6 6 4 4 2031 1867 1 0 1 594.2861 1186.5576 2 1186.5587 -0.0011 0 34.5 0.00058 R HQGVMVGMGQK D Oxidation (M) 0.00000001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1925.1925.2.dta 3 IPI00645534.1 "Actin, alpha 2, smooth muscle, aorta" 123 16919 6 6 4 4 2749 2059 1 0 1 677.8146 1353.6147 2 1353.6161 -0.0013 1 53.54 9.50E-06 K DSYVGDEAQSKR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2136.2136.2.dta 3 IPI00645534.1 "Actin, alpha 2, smooth muscle, aorta" 123 16919 6 6 4 4 2750 2058 1 0 1 452.2127 1353.6162 3 1353.6161 0.0001 1 43.4 0.00039 K DSYVGDEAQSKR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2135.2135.3.dta 3 IPI00748022.1 similar to actin-like protein 122 46576 5 5 4 4 109 4705 1 0 0 322.7203 643.4261 2 643.4268 -0.0008 0 32.03 0.004 R GILTLK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5143.5143.2.dta 3 IPI00748022.1 similar to actin-like protein 122 46576 5 5 4 4 476 3837 1 0 0 400.7715 799.5285 2 799.528 0.0005 1 25.32 0.016 K RGILTLK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4167.4167.2.dta 3 IPI00748022.1 similar to actin-like protein 122 46576 5 5 4 4 3334 4091 1 0 0 505.9208 1514.7405 3 1514.7419 -0.0014 0 32.71 0.0034 K IWHHTFYNELR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4444.4444.3.dta 3 IPI00748022.1 similar to actin-like protein 122 46576 5 5 4 4 3335 3117 1 0 0 758.8539 1515.6933 2 1515.6954 -0.002 0 69.09 3.30E-07 K QEYDESGPSIVHR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3346.3346.2.dta 3 IPI00748022.1 similar to actin-like protein 122 46576 5 5 4 4 3336 3109 1 0 0 506.2387 1515.6943 3 1515.6954 -0.0011 0 38.1 0.00028 K QEYDESGPSIVHR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3335.3335.3.dta 3 IPI00807522.1 FSD1L protein (Fragment) 54 11457 3 3 3 3 1338 5167 1 0 1 507.7443 1013.474 2 1013.4739 0 0 46.16 6.70E-05 R DLTDYLMK I Oxidation (M) 0.00000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5681.5681.2.dta 3 IPI00807522.1 FSD1L protein (Fragment) 54 11457 3 3 3 3 3746 6174 1 0 1 541.9525 1622.8357 3 1622.8338 0.0019 1 20.31 0.021 R LDLAGRDLTDYLMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6974.6974.3.dta 3 IPI00807522.1 FSD1L protein (Fragment) 54 11457 3 3 3 3 8142 6035 1 0 1 796.6595 3182.6088 4 3182.6071 0.0018 0 21.04 0.024 R TTGIVMDSGDGVTHTVPIYEGYALPHAILR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6807.6807.4.dta 3 IPI00555733.1 Actin-like protein (Fragment) 49 11861 2 2 2 2 3334 4091 1 0 0 505.9208 1514.7405 3 1514.7419 -0.0014 0 32.71 0.0034 K IWHHTFYNELR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4444.4444.3.dta 3 IPI00555733.1 Actin-like protein (Fragment) 49 11861 2 2 2 2 5018 4946 1 0 1 652.026 1953.0562 3 1953.0571 -0.0009 0 37.26 0.0014 R VAPEEHPVLLTEAPLNPK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5427.5427.3.dta 3 IPI00739998.1 "Similar to Actin, cytoplasmic 1" 43 22865 1 1 1 1 870 1959 1 0 1 453.229 904.4434 2 904.4436 -0.0003 1 42.99 0.0014 K CDVDIRK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2025.2025.2.dta 3 IPI00444605.1 "CDNA FLJ45296 fis, clone BRHIP3003340, moderately similar to Actin, alpha skeletal muscle 2" 40 23821 2 2 2 2 1996 3555 1 0 1 589.309 1176.6035 2 1176.606 -0.0025 0 28.68 0.0085 K EITALAPSTMK I Oxidation (M) 0.00000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3858.3858.2.dta 3 IPI00444605.1 "CDNA FLJ45296 fis, clone BRHIP3003340, moderately similar to Actin, alpha skeletal muscle 2" 40 23821 2 2 2 2 3439 4054 1 0 1 516.9431 1547.8075 3 1547.8051 0.0024 1 31.39 0.0054 R MQKEITALAPSTMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4403.4403.3.dta 3 IPI00556300.1 Actin-like protein (Fragment) 33 11634 1 1 1 1 3334 4091 1 0 0 505.9208 1514.7405 3 1514.7419 -0.0014 0 32.71 0.0034 K IWHHTFYNELR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4444.4444.3.dta 4 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 488 57510 17 17 12 12 168 2374 1 1 0 343.2395 684.4644 2 684.4646 -0.0002 1 24.21 0.017 R ILGVKR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2494.2494.2.dta 4 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 488 57510 17 17 12 12 1120 2186 1 1 1 481.7973 961.5801 2 961.5808 -0.0007 1 39.12 0.00046 R KVTSVSTLK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2287.2287.2.dta 4 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 488 57510 17 17 12 12 1474 4131 1 1 1 522.7498 1043.485 2 1043.4858 -0.0009 0 18.54 0.042 R QLNMYGFR K Oxidation (M) 0.00010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4486.4486.2.dta 4 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 488 57510 17 17 12 12 1518 3413 1 1 1 527.7557 1053.4968 2 1053.4992 -0.0024 0 40.11 0.00017 K HENEALWR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3696.3696.2.dta 4 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 488 57510 17 17 12 12 1545 5351 1 1 1 530.8074 1059.6002 2 1059.5998 0.0004 0 65.87 3.50E-06 K LLTDVQLMK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5894.5894.2.dta 4 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 488 57510 17 17 12 12 1604 3301 1 1 1 538.2581 1074.5017 2 1074.5029 -0.0012 0 38.99 0.00022 K HNNMASFVR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3569.3569.2.dta 4 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 488 57510 17 17 12 12 1614 4441 1 1 1 538.8046 1075.5947 2 1075.5947 0 0 40.19 0.0019 K LLTDVQLMK G Oxidation (M) 0.000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4835.4835.2.dta 4 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 488 57510 17 17 12 12 2646 3983 1 1 1 664.3688 1326.723 2 1326.7255 -0.0025 1 32.73 0.0021 R GQEQLLENIKR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4323.4323.2.dta 4 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 488 57510 17 17 12 12 2647 3969 1 1 1 443.249 1326.7251 3 1326.7255 -0.0005 1 42.64 0.001 R GQEQLLENIKR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4308.4308.3.dta 4 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 488 57510 17 17 12 12 2959 3175 1 1 1 703.8901 1405.7656 2 1405.7664 -0.0008 1 64.1 2.30E-06 K VTSVSTLKSEDIK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3412.3412.2.dta 4 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 488 57510 17 17 12 12 3469 3163 1 1 1 520.9665 1559.8776 3 1559.8784 -0.0007 0 38.68 0.00024 K VVHIEQGGLVKPER D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3399.3399.3.dta 4 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 488 57510 17 17 12 12 3470 3162 1 1 1 390.977 1559.879 4 1559.8784 0.0006 0 40.47 0.00016 K VVHIEQGGLVKPER D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3398.3398.4.dta 4 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 488 57510 17 17 12 12 3478 4949 1 1 1 522.2335 1563.6786 3 1563.6776 0.0009 0 17.98 0.021 R DDTEFQHPCFLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5430.5430.3.dta 4 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 488 57510 17 17 12 12 3688 4195 1 1 1 807.9001 1613.7857 2 1613.7897 -0.0039 0 106.39 2.30E-10 R ESEPAPASVTALTDAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4558.4558.2.dta 4 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 488 57510 17 17 12 12 3689 4534 1 1 1 807.9006 1613.7867 2 1613.7897 -0.0029 0 92.9 3.00E-09 R ESEPAPASVTALTDAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4945.4945.2.dta 4 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 488 57510 17 17 12 12 3690 4549 1 1 1 538.9373 1613.7899 3 1613.7897 0.0003 0 45.01 0.00041 R ESEPAPASVTALTDAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4961.4961.3.dta 4 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 488 57510 17 17 12 12 7593 8151 1 1 1 941.8406 2822.4999 3 2822.5025 -0.0026 0 45.48 0.00012 R VEEASPGRPSSVDTLLSPTALIDSILR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9419.9419.3.dta 4 IPI00012878.1 Heat shock factor protein 2 42 60482 2 2 2 2 1474 4131 1 0 1 522.7498 1043.485 2 1043.4858 -0.0009 0 18.54 0.042 R QLNMYGFR K Oxidation (M) 0.00010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4486.4486.2.dta 4 IPI00012878.1 Heat shock factor protein 2 42 60482 2 2 2 2 1604 3301 1 0 1 538.2581 1074.5017 2 1074.5029 -0.0012 0 38.99 0.00022 K HNNMASFVR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3569.3569.2.dta 4 IPI00008456.1 Isoform HSF4B of Heat shock factor protein 4 19 53362 1 1 1 1 1474 4131 1 0 1 522.7498 1043.485 2 1043.4858 -0.0009 0 18.54 0.042 R QLNMYGFR K Oxidation (M) 0.00010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4486.4486.2.dta 5 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 474 62320 15 15 15 15 164 1621 1 1 1 342.7064 683.3983 2 683.3966 0.0017 0 34.65 0.0037 K GPAAIQK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1652.1652.2.dta 5 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 474 62320 15 15 15 15 462 1181 1 1 1 399.1802 796.3459 2 796.3464 -0.0005 0 15.48 0.035 R GGSGGSYGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1176.1176.2.dta 5 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 474 62320 15 15 15 15 522 1328 1 1 1 406.7528 811.4911 2 811.4916 -0.0004 1 31.68 0.0058 K KGPAAIQK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1333.1333.2.dta 5 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 474 62320 15 15 15 15 829 5054 1 1 1 449.2101 896.4056 2 896.4062 -0.0006 0 34.1 0.00063 R MTLDDFR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5548.5548.2.dta 5 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 474 62320 15 15 15 15 1544 4833 1 1 1 530.7852 1059.5559 2 1059.556 -0.0001 0 49.13 0.00016 K TLLDIDNTR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5294.5294.2.dta 5 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 474 62320 15 15 15 15 1924 4135 1 1 1 579.2991 1156.5836 2 1156.5836 -0.0001 0 67.42 4.80E-07 R QGVDADINGLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4491.4491.2.dta 5 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 474 62320 15 15 15 15 2250 2638 1 1 1 616.8015 1231.5885 2 1231.5906 -0.0021 0 102.12 2.70E-10 R SGGGGGGGLGSGGSIR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2784.2784.2.dta 5 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 474 62320 15 15 15 15 2270 2144 1 1 1 618.2676 1234.5207 2 1234.5215 -0.0007 0 83.6 2.20E-08 R FSSSSGYGGGSSR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2242.2242.2.dta 5 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 474 62320 15 15 15 15 2557 4448 1 1 1 436.5641 1306.6703 3 1306.6703 0 1 41.41 0.00099 R IKFEMEQNLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4844.4844.3.dta 5 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 474 62320 15 15 15 15 4491 1941 1 1 1 597.9138 1790.7194 3 1790.7205 -0.001 0 18.47 0.023 R GGSGGSYGGGGSGGGYGGGSGSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2005.2005.3.dta 5 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 474 62320 15 15 15 15 4624 5915 1 1 1 613.3279 1836.9618 3 1836.9581 0.0037 0 64.44 1.20E-06 R HGVQELEIELQSQLSK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6654.6654.3.dta 5 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 474 62320 15 15 15 15 4666 5694 1 1 1 617.9781 1850.9126 3 1850.9196 -0.007 1 28.94 0.0029 K TLNDMRQEYEQLIAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6369.6369.3.dta 5 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 474 62320 15 15 15 15 5050 5552 1 1 1 656.0235 1965.0487 3 1965.0531 -0.0044 1 78.12 4.70E-08 R HGVQELEIELQSQLSKK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6159.6159.3.dta 5 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 474 62320 15 15 15 15 6528 5251 1 1 1 837.3817 2509.1233 3 2509.1245 -0.0012 0 54 8.60E-06 K EIETYHNLLEGGQEDFESSGAGK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5781.5781.3.dta 5 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 474 62320 15 15 15 15 7797 7423 1 1 1 968.1396 2901.3969 3 2901.4032 -0.0063 1 25.17 0.0044 K NYSPYYNTIDDLKDQIVDLTVGNNK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.8539.8539.3.dta 6 1 IPI00465248.5 Isoform alpha-enolase of Alpha-enolase 360 47481 12 12 10 10 491 3498 1 1 1 403.73 805.4455 2 805.4446 0.0009 0 27.05 0.032 K YNQLLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3795.3795.2.dta 6 1 IPI00465248.5 Isoform alpha-enolase of Alpha-enolase 360 47481 12 12 10 10 1591 3953 1 1 1 358.183 1071.5271 3 1071.5237 0.0035 1 14.11 0.047 R SGKYDLDFK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4290.4290.3.dta 6 1 IPI00465248.5 Isoform alpha-enolase of Alpha-enolase 360 47481 12 12 10 10 1889 3212 1 1 1 572.311 1142.6074 2 1142.6084 -0.001 0 38.83 0.00088 R IGAEVYHNLK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3452.3452.2.dta 6 1 IPI00465248.5 Isoform alpha-enolase of Alpha-enolase 360 47481 12 12 10 10 1890 3195 1 1 1 381.8766 1142.6081 3 1142.6084 -0.0003 0 43.15 0.00034 R IGAEVYHNLK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3434.3434.3.dta 6 1 IPI00465248.5 Isoform alpha-enolase of Alpha-enolase 360 47481 12 12 10 10 2956 5600 1 1 1 703.8616 1405.7086 2 1405.7089 -0.0003 0 84.82 7.40E-08 R GNPTVEVDLFTSK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6237.6237.2.dta 6 1 IPI00465248.5 Isoform alpha-enolase of Alpha-enolase 360 47481 12 12 10 10 3023 5899 1 1 1 713.3666 1424.7186 2 1424.7187 -0.0001 0 63.29 1.20E-06 R YISPDQLADLYK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6632.6632.2.dta 6 1 IPI00465248.5 Isoform alpha-enolase of Alpha-enolase 360 47481 12 12 10 10 3785 4544 1 1 1 817.4122 1632.8099 2 1632.8141 -0.0042 0 105.8 1.20E-10 K VNQIGSVTESLQACK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4955.4955.2.dta 6 1 IPI00465248.5 Isoform alpha-enolase of Alpha-enolase 360 47481 12 12 10 10 5380 6004 1 1 1 718.6957 2153.0652 3 2153.0641 0.0011 1 22.58 0.0076 R EIFDSRGNPTVEVDLFTSK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6769.6769.3.dta 6 1 IPI00465248.5 Isoform alpha-enolase of Alpha-enolase 360 47481 12 12 10 10 5973 8186 1 1 1 1177.0829 2352.1512 2 2352.1519 -0.0007 0 53.81 9.00E-06 R SGETEDTFIADLVVGLCTGQIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9458.9458.2.dta 6 1 IPI00465248.5 Isoform alpha-enolase of Alpha-enolase 360 47481 12 12 10 10 5974 8181 1 1 1 785.0585 2352.1538 3 2352.1519 0.0018 0 29.43 0.0069 R SGETEDTFIADLVVGLCTGQIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9451.9451.3.dta 6 1 IPI00465248.5 Isoform alpha-enolase of Alpha-enolase 360 47481 12 12 10 10 7303 6502 1 1 1 915.1305 2742.3697 3 2742.3712 -0.0015 1 20.84 0.011 K DATNVGDEGGFAPNILENKEGLELLK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7405.7405.3.dta 6 1 IPI00465248.5 Isoform alpha-enolase of Alpha-enolase 360 47481 12 12 10 10 7927 7170 1 1 1 995.8015 2984.3825 3 2984.3869 -0.0043 1 58.72 3.10E-06 K SFIKDYPVVSIEDPFDQDDWGAWQK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.8215.8215.3.dta 6 IPI00759806.1 Isoform MBP-1 of Alpha-enolase 292 37247 10 10 8 8 491 3498 1 0 1 403.73 805.4455 2 805.4446 0.0009 0 27.05 0.032 K YNQLLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3795.3795.2.dta 6 IPI00759806.1 Isoform MBP-1 of Alpha-enolase 292 37247 10 10 8 8 1591 3953 1 0 1 358.183 1071.5271 3 1071.5237 0.0035 1 14.11 0.047 R SGKYDLDFK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4290.4290.3.dta 6 IPI00759806.1 Isoform MBP-1 of Alpha-enolase 292 37247 10 10 8 8 1889 3212 1 0 1 572.311 1142.6074 2 1142.6084 -0.001 0 38.83 0.00088 R IGAEVYHNLK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3452.3452.2.dta 6 IPI00759806.1 Isoform MBP-1 of Alpha-enolase 292 37247 10 10 8 8 1890 3195 1 0 1 381.8766 1142.6081 3 1142.6084 -0.0003 0 43.15 0.00034 R IGAEVYHNLK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3434.3434.3.dta 6 IPI00759806.1 Isoform MBP-1 of Alpha-enolase 292 37247 10 10 8 8 3023 5899 1 0 1 713.3666 1424.7186 2 1424.7187 -0.0001 0 63.29 1.20E-06 R YISPDQLADLYK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6632.6632.2.dta 6 IPI00759806.1 Isoform MBP-1 of Alpha-enolase 292 37247 10 10 8 8 3785 4544 1 0 1 817.4122 1632.8099 2 1632.8141 -0.0042 0 105.8 1.20E-10 K VNQIGSVTESLQACK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4955.4955.2.dta 6 IPI00759806.1 Isoform MBP-1 of Alpha-enolase 292 37247 10 10 8 8 5973 8186 1 0 1 1177.0829 2352.1512 2 2352.1519 -0.0007 0 53.81 9.00E-06 R SGETEDTFIADLVVGLCTGQIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9458.9458.2.dta 6 IPI00759806.1 Isoform MBP-1 of Alpha-enolase 292 37247 10 10 8 8 5974 8181 1 0 1 785.0585 2352.1538 3 2352.1519 0.0018 0 29.43 0.0069 R SGETEDTFIADLVVGLCTGQIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9451.9451.3.dta 6 IPI00759806.1 Isoform MBP-1 of Alpha-enolase 292 37247 10 10 8 8 7303 6502 1 0 1 915.1305 2742.3697 3 2742.3712 -0.0015 1 20.84 0.011 K DATNVGDEGGFAPNILENKEGLELLK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7405.7405.3.dta 6 IPI00759806.1 Isoform MBP-1 of Alpha-enolase 292 37247 10 10 8 8 7927 7170 1 0 1 995.8015 2984.3825 3 2984.3869 -0.0043 1 58.72 3.10E-06 K SFIKDYPVVSIEDPFDQDDWGAWQK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.8215.8215.3.dta 6 IPI00013769.1 "Alpha-enolase, lung specific" 197 49845 5 5 4 4 491 3498 1 0 1 403.73 805.4455 2 805.4446 0.0009 0 27.05 0.032 K YNQLLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3795.3795.2.dta 6 IPI00013769.1 "Alpha-enolase, lung specific" 197 49845 5 5 4 4 1889 3212 1 0 1 572.311 1142.6074 2 1142.6084 -0.001 0 38.83 0.00088 R IGAEVYHNLK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3452.3452.2.dta 6 IPI00013769.1 "Alpha-enolase, lung specific" 197 49845 5 5 4 4 1890 3195 1 0 1 381.8766 1142.6081 3 1142.6084 -0.0003 0 43.15 0.00034 R IGAEVYHNLK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3434.3434.3.dta 6 IPI00013769.1 "Alpha-enolase, lung specific" 197 49845 5 5 4 4 3023 5899 1 0 1 713.3666 1424.7186 2 1424.7187 -0.0001 0 63.29 1.20E-06 R YISPDQLADLYK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6632.6632.2.dta 6 IPI00013769.1 "Alpha-enolase, lung specific" 197 49845 5 5 4 4 3785 4544 1 0 1 817.4122 1632.8099 2 1632.8141 -0.0042 0 105.8 1.20E-10 K VNQIGSVTESLQACK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4955.4955.2.dta 6 IPI00218474.5 Beta-enolase 152 47299 3 3 2 2 3785 4544 1 0 1 817.4122 1632.8099 2 1632.8141 -0.0042 0 105.8 1.20E-10 K VNQIGSVTESIQACK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4955.4955.2.dta 6 IPI00218474.5 Beta-enolase 152 47299 3 3 2 2 5973 8186 1 0 1 1177.0829 2352.1512 2 2352.1519 -0.0007 0 53.81 9.00E-06 R SGETEDTFIADLVVGLCTGQIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9458.9458.2.dta 6 IPI00218474.5 Beta-enolase 152 47299 3 3 2 2 5974 8181 1 0 1 785.0585 2352.1538 3 2352.1519 0.0018 0 29.43 0.0069 R SGETEDTFIADLVVGLCTGQIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9451.9451.3.dta 6 IPI00216171.3 Gamma-enolase 95 47581 3 3 2 2 2956 5600 2 0 1 703.8616 1405.7086 2 1405.7089 -0.0003 0 53.09 0.00011 R GNPTVEVDLYTAK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6237.6237.2.dta 6 IPI00216171.3 Gamma-enolase 95 47581 3 3 2 2 5973 8186 1 0 1 1177.0829 2352.1512 2 2352.1519 -0.0007 0 53.81 9.00E-06 R SGETEDTFIADLVVGLCTGQIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9458.9458.2.dta 6 IPI00216171.3 Gamma-enolase 95 47581 3 3 2 2 5974 8181 1 0 1 785.0585 2352.1538 3 2352.1519 0.0018 0 29.43 0.0069 R SGETEDTFIADLVVGLCTGQIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9451.9451.3.dta 7 1 IPI00000875.6 Elongation factor 1-gamma 299 50429 14 14 12 12 242 3131 1 1 1 358.2209 714.4272 2 714.4276 -0.0004 0 36.08 0.0042 R AVLGEVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3364.3364.2.dta 7 1 IPI00000875.6 Elongation factor 1-gamma 299 50429 14 14 12 12 346 4240 1 1 1 381.7113 761.4081 2 761.4072 0.0009 0 29.01 0.03 R TPEFLR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4607.4607.2.dta 7 1 IPI00000875.6 Elongation factor 1-gamma 299 50429 14 14 12 12 554 4274 1 1 1 411.2298 820.4451 2 820.4443 0.0008 0 33.91 0.0035 R TFLVGER V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4643.4643.2.dta 7 1 IPI00000875.6 Elongation factor 1-gamma 299 50429 14 14 12 12 1056 1620 1 1 1 474.761 947.5075 2 947.5076 -0.0001 1 31.09 0.0041 K KFAETQPK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1651.1651.2.dta 7 1 IPI00000875.6 Elongation factor 1-gamma 299 50429 14 14 12 12 1170 4319 1 1 1 488.2668 974.5191 2 974.5185 0.0006 0 23.55 0.034 K QVLEPSFR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4693.4693.2.dta 7 1 IPI00000875.6 Elongation factor 1-gamma 299 50429 14 14 12 12 1769 7189 1 1 1 559.845 1117.6754 2 1117.6747 0.0007 0 47.69 4.70E-05 R ILGLLDAYLK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.8238.8238.2.dta 7 1 IPI00000875.6 Elongation factor 1-gamma 299 50429 14 14 12 12 1793 3490 1 1 1 375.2138 1122.6197 3 1122.6186 0.0011 1 37.77 0.0015 K AKDPFAHLPK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3785.3785.3.dta 7 1 IPI00000875.6 Elongation factor 1-gamma 299 50429 14 14 12 12 2291 5185 1 1 1 621.3292 1240.6439 2 1240.6452 -0.0013 1 32.29 0.00094 K STFVLDEFKR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5700.5700.2.dta 7 1 IPI00000875.6 Elongation factor 1-gamma 299 50429 14 14 12 12 2292 5181 1 1 1 414.5555 1240.6445 3 1240.6452 -0.0007 1 35.98 0.0011 K STFVLDEFKR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5696.5696.3.dta 7 1 IPI00000875.6 Elongation factor 1-gamma 299 50429 14 14 12 12 2725 4204 1 1 1 674.3717 1346.7289 2 1346.7306 -0.0018 0 78.13 9.00E-08 K ALIAAQYSGAQVR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4568.4568.2.dta 7 1 IPI00000875.6 Elongation factor 1-gamma 299 50429 14 14 12 12 3114 3952 1 1 1 722.8696 1443.7246 2 1443.7205 0.004 0 63.04 1.60E-06 K LDPGSEETQTLVR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4289.4289.2.dta 7 1 IPI00000875.6 Elongation factor 1-gamma 299 50429 14 14 12 12 3501 3483 1 1 1 524.9478 1571.8214 3 1571.8155 0.0059 1 36.58 0.0039 R KLDPGSEETQTLVR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3777.3777.3.dta 7 1 IPI00000875.6 Elongation factor 1-gamma 299 50429 14 14 12 12 3502 3482 1 1 1 786.9182 1571.8219 2 1571.8155 0.0064 1 44.85 6.90E-05 R KLDPGSEETQTLVR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3776.3776.2.dta 7 1 IPI00000875.6 Elongation factor 1-gamma 299 50429 14 14 12 12 8154 7904 1 1 1 1066.8158 3197.4256 3 3197.4288 -0.0032 0 34.12 0.0016 K VPAFEGDDGFCVFESNAIAYYVSNEELR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9121.9121.3.dta 7 IPI00738381.2 similar to Elongation factor 1-gamma 141 50612 8 8 7 7 554 4274 1 0 1 411.2298 820.4451 2 820.4443 0.0008 0 33.91 0.0035 R TFLVGER V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4643.4643.2.dta 7 IPI00738381.2 similar to Elongation factor 1-gamma 141 50612 8 8 7 7 1056 1620 1 0 1 474.761 947.5075 2 947.5076 -0.0001 1 31.09 0.0041 K KFAETQPK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1651.1651.2.dta 7 IPI00738381.2 similar to Elongation factor 1-gamma 141 50612 8 8 7 7 1170 4319 1 0 1 488.2668 974.5191 2 974.5185 0.0006 0 23.55 0.034 K QVLEPSFR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4693.4693.2.dta 7 IPI00738381.2 similar to Elongation factor 1-gamma 141 50612 8 8 7 7 1769 7189 1 0 1 559.845 1117.6754 2 1117.6747 0.0007 0 47.69 4.70E-05 R ILGLLDAYLK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.8238.8238.2.dta 7 IPI00738381.2 similar to Elongation factor 1-gamma 141 50612 8 8 7 7 1793 3490 1 0 1 375.2138 1122.6197 3 1122.6186 0.0011 1 37.77 0.0015 K AKDPFAHLPK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3785.3785.3.dta 7 IPI00738381.2 similar to Elongation factor 1-gamma 141 50612 8 8 7 7 2291 5185 1 0 1 621.3292 1240.6439 2 1240.6452 -0.0013 1 32.29 0.00094 K STFVLDEFKR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5700.5700.2.dta 7 IPI00738381.2 similar to Elongation factor 1-gamma 141 50612 8 8 7 7 2292 5181 1 0 1 414.5555 1240.6445 3 1240.6452 -0.0007 1 35.98 0.0011 K STFVLDEFKR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5696.5696.3.dta 7 IPI00738381.2 similar to Elongation factor 1-gamma 141 50612 8 8 7 7 8154 7904 1 0 1 1066.8158 3197.4256 3 3197.4288 -0.0032 0 34.12 0.0016 K VPAFEGDDGFCVFESNAIAYYVSNEELR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9121.9121.3.dta 7 IPI00744181.1 "Glutathione S-transferase, N-terminal domain containing protein" 38 36806 1 1 1 1 1793 3490 1 0 1 375.2138 1122.6197 3 1122.6186 0.0011 1 37.77 0.0015 K AKDPFAHLPK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3785.3785.3.dta 8 1 IPI00396485.3 Elongation factor 1-alpha 1 299 50451 10 10 8 8 421 1289 1 1 1 393.7214 785.4283 2 785.4283 0 1 35.88 0.0031 K KLEDGPK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1291.1291.2.dta 8 1 IPI00396485.3 Elongation factor 1-alpha 1 299 50451 10 10 8 8 749 3770 1 1 1 435.7735 869.5324 2 869.5334 -0.0011 0 36 0.0015 K QLIVGVNK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4094.4094.2.dta 8 1 IPI00396485.3 Elongation factor 1-alpha 1 299 50451 10 10 8 8 1171 4583 1 1 1 488.2791 974.5436 2 974.5437 -0.0001 0 50.64 0.00013 R LPLQDVYK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4999.4999.2.dta 8 1 IPI00396485.3 Elongation factor 1-alpha 1 299 50451 10 10 8 8 1398 4184 1 1 1 513.3084 1024.6023 2 1024.603 -0.0007 0 69.48 7.20E-07 K IGGIGTVPVGR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4546.4546.2.dta 8 1 IPI00396485.3 Elongation factor 1-alpha 1 299 50451 10 10 8 8 1773 2763 1 1 1 374.2052 1119.5938 3 1119.5924 0.0014 0 29.34 0.011 K STTTGHLIYK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2929.2929.3.dta 8 1 IPI00396485.3 Elongation factor 1-alpha 1 299 50451 10 10 8 8 2590 5311 1 1 1 657.8747 1313.7348 2 1313.7343 0.0005 0 45.76 5.10E-05 R EHALLAYTLGVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5848.5848.2.dta 8 1 IPI00396485.3 Elongation factor 1-alpha 1 299 50451 10 10 8 8 2591 5312 1 1 1 438.9189 1313.735 3 1313.7343 0.0007 0 47.39 0.0002 R EHALLAYTLGVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5849.5849.3.dta 8 1 IPI00396485.3 Elongation factor 1-alpha 1 299 50451 10 10 8 8 3607 4307 1 1 1 530.2981 1587.8725 3 1587.8733 -0.0009 0 66.69 5.60E-07 K THINIVVIGHVDSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4680.4680.3.dta 8 1 IPI00396485.3 Elongation factor 1-alpha 1 299 50451 10 10 8 8 7808 8551 1 1 1 970.4828 2908.4267 3 2908.431 -0.0043 0 54.07 2.90E-05 K NMITGTSQADCAVLIVAAGVGEFEAGISK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9926.9926.3.dta 8 1 IPI00396485.3 Elongation factor 1-alpha 1 299 50451 10 10 8 8 7838 8341 1 1 1 975.8157 2924.4254 3 2924.426 -0.0006 0 47.98 7.80E-05 K NMITGTSQADCAVLIVAAGVGEFEAGISK N Oxidation (M) 0.01000000000000000000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9645.9645.3.dta 8 IPI00014424.1 Elongation factor 1-alpha 2 286 50780 9 9 7 7 749 3770 1 0 1 435.7735 869.5324 2 869.5334 -0.0011 0 36 0.0015 K QLIVGVNK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4094.4094.2.dta 8 IPI00014424.1 Elongation factor 1-alpha 2 286 50780 9 9 7 7 1171 4583 1 0 1 488.2791 974.5436 2 974.5437 -0.0001 0 50.64 0.00013 R LPLQDVYK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4999.4999.2.dta 8 IPI00014424.1 Elongation factor 1-alpha 2 286 50780 9 9 7 7 1398 4184 1 0 1 513.3084 1024.6023 2 1024.603 -0.0007 0 69.48 7.20E-07 K IGGIGTVPVGR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4546.4546.2.dta 8 IPI00014424.1 Elongation factor 1-alpha 2 286 50780 9 9 7 7 1773 2763 1 0 1 374.2052 1119.5938 3 1119.5924 0.0014 0 29.34 0.011 K STTTGHLIYK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2929.2929.3.dta 8 IPI00014424.1 Elongation factor 1-alpha 2 286 50780 9 9 7 7 2590 5311 1 0 1 657.8747 1313.7348 2 1313.7343 0.0005 0 45.76 5.10E-05 R EHALLAYTLGVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5848.5848.2.dta 8 IPI00014424.1 Elongation factor 1-alpha 2 286 50780 9 9 7 7 2591 5312 1 0 1 438.9189 1313.735 3 1313.7343 0.0007 0 47.39 0.0002 R EHALLAYTLGVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5849.5849.3.dta 8 IPI00014424.1 Elongation factor 1-alpha 2 286 50780 9 9 7 7 3607 4307 1 0 1 530.2981 1587.8725 3 1587.8733 -0.0009 0 66.69 5.60E-07 K THINIVVIGHVDSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4680.4680.3.dta 8 IPI00014424.1 Elongation factor 1-alpha 2 286 50780 9 9 7 7 7808 8551 1 0 1 970.4828 2908.4267 3 2908.431 -0.0043 0 54.07 2.90E-05 K NMITGTSQADCAVLIVAAGVGEFEAGISK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9926.9926.3.dta 8 IPI00014424.1 Elongation factor 1-alpha 2 286 50780 9 9 7 7 7838 8341 1 0 1 975.8157 2924.4254 3 2924.426 -0.0006 0 47.98 7.80E-05 K NMITGTSQADCAVLIVAAGVGEFEAGISK N Oxidation (M) 0.01000000000000000000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9645.9645.3.dta 8 IPI00556204.1 Eukaryotic translation elongation factor 1 alpha 2 variant (Fragment) 229 37116 7 7 5 5 749 3770 1 0 1 435.7735 869.5324 2 869.5334 -0.0011 0 36 0.0015 K QLIVGVNK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4094.4094.2.dta 8 IPI00556204.1 Eukaryotic translation elongation factor 1 alpha 2 variant (Fragment) 229 37116 7 7 5 5 1171 4583 1 0 1 488.2791 974.5436 2 974.5437 -0.0001 0 50.64 0.00013 R LPLQDVYK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4999.4999.2.dta 8 IPI00556204.1 Eukaryotic translation elongation factor 1 alpha 2 variant (Fragment) 229 37116 7 7 5 5 1398 4184 1 0 1 513.3084 1024.6023 2 1024.603 -0.0007 0 69.48 7.20E-07 K IGGIGTVPVGR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4546.4546.2.dta 8 IPI00556204.1 Eukaryotic translation elongation factor 1 alpha 2 variant (Fragment) 229 37116 7 7 5 5 2590 5311 1 0 1 657.8747 1313.7348 2 1313.7343 0.0005 0 45.76 5.10E-05 R EHALLAYTLGVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5848.5848.2.dta 8 IPI00556204.1 Eukaryotic translation elongation factor 1 alpha 2 variant (Fragment) 229 37116 7 7 5 5 2591 5312 1 0 1 438.9189 1313.735 3 1313.7343 0.0007 0 47.39 0.0002 R EHALLAYTLGVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5849.5849.3.dta 8 IPI00556204.1 Eukaryotic translation elongation factor 1 alpha 2 variant (Fragment) 229 37116 7 7 5 5 7808 8551 1 0 1 970.4828 2908.4267 3 2908.431 -0.0043 0 54.07 2.90E-05 K NMITGTSQADCAVLIVAAGVGEFEAGISK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9926.9926.3.dta 8 IPI00556204.1 Eukaryotic translation elongation factor 1 alpha 2 variant (Fragment) 229 37116 7 7 5 5 7838 8341 1 0 1 975.8157 2924.4254 3 2924.426 -0.0006 0 47.98 7.80E-05 K NMITGTSQADCAVLIVAAGVGEFEAGISK N Oxidation (M) 0.01000000000000000000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9645.9645.3.dta 8 IPI00793363.1 42 kDa protein 224 42081 7 7 6 6 749 3770 1 0 1 435.7735 869.5324 2 869.5334 -0.0011 0 36 0.0015 K QLIVGVNK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4094.4094.2.dta 8 IPI00793363.1 42 kDa protein 224 42081 7 7 6 6 1171 4583 1 0 1 488.2791 974.5436 2 974.5437 -0.0001 0 50.64 0.00013 R LPLQDVYK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4999.4999.2.dta 8 IPI00793363.1 42 kDa protein 224 42081 7 7 6 6 1398 4184 1 0 1 513.3084 1024.6023 2 1024.603 -0.0007 0 69.48 7.20E-07 K IGGIGTVPVGR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4546.4546.2.dta 8 IPI00793363.1 42 kDa protein 224 42081 7 7 6 6 1773 2763 1 0 1 374.2052 1119.5938 3 1119.5924 0.0014 0 29.34 0.011 K STTTGHLIYK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2929.2929.3.dta 8 IPI00793363.1 42 kDa protein 224 42081 7 7 6 6 2590 5311 1 0 1 657.8747 1313.7348 2 1313.7343 0.0005 0 45.76 5.10E-05 R EHALLAYTLGVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5848.5848.2.dta 8 IPI00793363.1 42 kDa protein 224 42081 7 7 6 6 2591 5312 1 0 1 438.9189 1313.735 3 1313.7343 0.0007 0 47.39 0.0002 R EHALLAYTLGVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5849.5849.3.dta 8 IPI00793363.1 42 kDa protein 224 42081 7 7 6 6 3607 4307 1 0 1 530.2981 1587.8725 3 1587.8733 -0.0009 0 66.69 5.60E-07 K THINIVVIGHVDSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4680.4680.3.dta 8 IPI00180730.1 Similar to Elongation factor 1-alpha 1 188 50464 7 7 6 6 421 1289 1 0 1 393.7214 785.4283 2 785.4283 0 1 35.88 0.0031 K KLEDGPK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1291.1291.2.dta 8 IPI00180730.1 Similar to Elongation factor 1-alpha 1 188 50464 7 7 6 6 749 3770 1 0 1 435.7735 869.5324 2 869.5334 -0.0011 0 36 0.0015 K QLIVGVNK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4094.4094.2.dta 8 IPI00180730.1 Similar to Elongation factor 1-alpha 1 188 50464 7 7 6 6 1171 4583 1 0 1 488.2791 974.5436 2 974.5437 -0.0001 0 50.64 0.00013 R LPLQDVYK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4999.4999.2.dta 8 IPI00180730.1 Similar to Elongation factor 1-alpha 1 188 50464 7 7 6 6 1773 2763 1 0 1 374.2052 1119.5938 3 1119.5924 0.0014 0 29.34 0.011 K STTTGHLIYK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2929.2929.3.dta 8 IPI00180730.1 Similar to Elongation factor 1-alpha 1 188 50464 7 7 6 6 2590 5311 1 0 1 657.8747 1313.7348 2 1313.7343 0.0005 0 45.76 5.10E-05 R EHALLAYTLGVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5848.5848.2.dta 8 IPI00180730.1 Similar to Elongation factor 1-alpha 1 188 50464 7 7 6 6 2591 5312 1 0 1 438.9189 1313.735 3 1313.7343 0.0007 0 47.39 0.0002 R EHALLAYTLGVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5849.5849.3.dta 8 IPI00180730.1 Similar to Elongation factor 1-alpha 1 188 50464 7 7 6 6 3607 4307 1 0 1 530.2981 1587.8725 3 1587.8733 -0.0009 0 66.69 5.60E-07 K THINIVVIGHVDSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4680.4680.3.dta 8 IPI00641459.2 Eukaryotic translation elongation factor 1 alpha 1 139 16040 4 4 3 3 1773 2763 1 0 1 374.2052 1119.5938 3 1119.5924 0.0014 0 29.34 0.011 K STTTGHLIYK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2929.2929.3.dta 8 IPI00641459.2 Eukaryotic translation elongation factor 1 alpha 1 139 16040 4 4 3 3 3607 4307 1 0 1 530.2981 1587.8725 3 1587.8733 -0.0009 0 66.69 5.60E-07 K THINIVVIGHVDSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4680.4680.3.dta 8 IPI00641459.2 Eukaryotic translation elongation factor 1 alpha 1 139 16040 4 4 3 3 7808 8551 1 0 1 970.4828 2908.4267 3 2908.431 -0.0043 0 54.07 2.90E-05 K NMITGTSQADCAVLIVAAGVGEFEAGISK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9926.9926.3.dta 8 IPI00641459.2 Eukaryotic translation elongation factor 1 alpha 1 139 16040 4 4 3 3 7838 8341 1 0 1 975.8157 2924.4254 3 2924.426 -0.0006 0 47.98 7.80E-05 K NMITGTSQADCAVLIVAAGVGEFEAGISK N Oxidation (M) 0.01000000000000000000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9645.9645.3.dta 8 IPI00025447.7 EEF1A1 protein 111 33449 3 3 3 3 421 1289 1 0 1 393.7214 785.4283 2 785.4283 0 1 35.88 0.0031 K KLEDGPK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1291.1291.2.dta 8 IPI00025447.7 EEF1A1 protein 111 33449 3 3 3 3 1171 4583 1 0 1 488.2791 974.5436 2 974.5437 -0.0001 0 50.64 0.00013 R LPLQDVYK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4999.4999.2.dta 8 IPI00025447.7 EEF1A1 protein 111 33449 3 3 3 3 1398 4184 1 0 1 513.3084 1024.6023 2 1024.603 -0.0007 0 69.48 7.20E-07 K IGGIGTVPVGR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4546.4546.2.dta 8 IPI00431441.1 EEF1A1 protein 77 7639 2 2 2 2 1773 2763 1 0 1 374.2052 1119.5938 3 1119.5924 0.0014 0 29.34 0.011 K STTTGHLIYK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2929.2929.3.dta 8 IPI00431441.1 EEF1A1 protein 77 7639 2 2 2 2 3607 4307 1 0 1 530.2981 1587.8725 3 1587.8733 -0.0009 0 66.69 5.60E-07 K THINIVVIGHVDSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4680.4680.3.dta 8 IPI00382804.1 EEF1A protein (Fragment) 69 24352 1 1 1 1 1398 4184 1 0 1 513.3084 1024.6023 2 1024.603 -0.0007 0 69.48 7.20E-07 K IGGIGTVPVGR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4546.4546.2.dta 8 IPI00455434.1 28 kDa protein 63 28270 2 2 2 2 421 1289 1 0 1 393.7214 785.4283 2 785.4283 0 1 35.88 0.0031 K KLEDGPK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1291.1291.2.dta 8 IPI00455434.1 28 kDa protein 63 28270 2 2 2 2 1171 4583 1 0 1 488.2791 974.5436 2 974.5437 -0.0001 0 50.64 0.00013 R LPLQDVYK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4999.4999.2.dta 9 1 IPI00025491.1 Eukaryotic initiation factor 4A-I 241 46353 6 6 6 6 1097 2553 1 1 1 479.2717 956.5288 2 956.5291 -0.0003 0 43.03 0.0007 R ELAQQIQK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2689.2689.2.dta 9 1 IPI00025491.1 Eukaryotic initiation factor 4A-I 241 46353 6 6 6 6 1369 4115 1 1 0 509.7817 1017.5489 2 1017.5495 -0.0006 1 31.54 0.0052 R KVDWLTEK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4470.4470.2.dta 9 1 IPI00025491.1 Eukaryotic initiation factor 4A-I 241 46353 6 6 6 6 1758 5891 1 1 1 557.8447 1113.6748 2 1113.6758 -0.001 0 63.9 2.60E-06 R VLITTDLLAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6623.6623.2.dta 9 1 IPI00025491.1 Eukaryotic initiation factor 4A-I 241 46353 6 6 6 6 2908 3863 1 1 1 697.8477 1393.6809 2 1393.6838 -0.0029 0 104.99 3.20E-10 K GYDVIAQAQSGTGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4195.4195.2.dta 9 1 IPI00025491.1 Eukaryotic initiation factor 4A-I 241 46353 6 6 6 6 3451 6923 1 1 1 778.3604 1554.7062 2 1554.7058 0.0004 0 82.92 1.70E-08 K MFVLDEADEMLSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7912.7912.2.dta 9 1 IPI00025491.1 Eukaryotic initiation factor 4A-I 241 46353 6 6 6 6 3699 4920 1 1 1 540.2955 1617.8646 3 1617.8661 -0.0015 0 14.43 0.044 K LQMEAPHIIVGTPGR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5394.5394.3.dta 9 2 IPI00009328.4 Probable ATP-dependent RNA helicase DDX48 189 47126 5 5 4 4 1369 4115 1 0 0 509.7817 1017.5489 2 1017.5495 -0.0006 1 31.54 0.0052 R KVDWLTEK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4470.4470.2.dta 9 2 IPI00009328.4 Probable ATP-dependent RNA helicase DDX48 189 47126 5 5 4 4 2039 2154 1 0 1 595.8032 1189.5919 2 1189.5939 -0.002 0 81.23 1.70E-07 R DVIAQSQSGTGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2253.2253.2.dta 9 2 IPI00009328.4 Probable ATP-dependent RNA helicase DDX48 189 47126 5 5 4 4 2944 1836 1 0 1 468.5785 1402.7136 3 1402.7165 -0.0028 1 47.86 6.40E-05 K GRDVIAQSQSGTGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1891.1891.3.dta 9 2 IPI00009328.4 Probable ATP-dependent RNA helicase DDX48 189 47126 5 5 4 4 2945 1834 1 0 1 702.3655 1402.7164 2 1402.7165 -0.0001 1 75.39 2.00E-07 K GRDVIAQSQSGTGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1889.1889.2.dta 9 2 IPI00009328.4 Probable ATP-dependent RNA helicase DDX48 189 47126 5 5 4 4 3198 3235 1 0 1 490.5878 1468.7417 3 1468.7423 -0.0006 0 36.36 0.00084 K LDYGQHVVAGTPGR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3479.3479.3.dta 9 IPI00328328.3 Isoform 1 of Eukaryotic initiation factor 4A-II 241 46601 5 5 5 5 1097 2553 1 0 1 479.2717 956.5288 2 956.5291 -0.0003 0 43.03 0.0007 R ELAQQIQK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2689.2689.2.dta 9 IPI00328328.3 Isoform 1 of Eukaryotic initiation factor 4A-II 241 46601 5 5 5 5 1369 4115 1 0 0 509.7817 1017.5489 2 1017.5495 -0.0006 1 31.54 0.0052 R KVDWLTEK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4470.4470.2.dta 9 IPI00328328.3 Isoform 1 of Eukaryotic initiation factor 4A-II 241 46601 5 5 5 5 1758 5891 1 0 1 557.8447 1113.6748 2 1113.6758 -0.001 0 63.9 2.60E-06 R VLITTDLLAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6623.6623.2.dta 9 IPI00328328.3 Isoform 1 of Eukaryotic initiation factor 4A-II 241 46601 5 5 5 5 2908 3863 1 0 1 697.8477 1393.6809 2 1393.6838 -0.0029 0 104.99 3.20E-10 K GYDVIAQAQSGTGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4195.4195.2.dta 9 IPI00328328.3 Isoform 1 of Eukaryotic initiation factor 4A-II 241 46601 5 5 5 5 3451 6923 1 0 1 778.3604 1554.7062 2 1554.7058 0.0004 0 82.92 1.70E-08 K MFVLDEADEMLSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7912.7912.2.dta 9 IPI00555602.1 CD68 antigen variant (Fragment) 198 42846 5 5 5 5 1097 2553 1 0 1 479.2717 956.5288 2 956.5291 -0.0003 0 43.03 0.0007 R ELAQQIQK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2689.2689.2.dta 9 IPI00555602.1 CD68 antigen variant (Fragment) 198 42846 5 5 5 5 1369 4115 1 0 0 509.7817 1017.5489 2 1017.5495 -0.0006 1 31.54 0.0052 R KVDWLTEK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4470.4470.2.dta 9 IPI00555602.1 CD68 antigen variant (Fragment) 198 42846 5 5 5 5 2908 3863 1 0 1 697.8477 1393.6809 2 1393.6838 -0.0029 0 104.99 3.20E-10 K GYDVIAQAQSGTGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4195.4195.2.dta 9 IPI00555602.1 CD68 antigen variant (Fragment) 198 42846 5 5 5 5 3451 6923 1 0 1 778.3604 1554.7062 2 1554.7058 0.0004 0 82.92 1.70E-08 K MFVLDEADEMLSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7912.7912.2.dta 9 IPI00555602.1 CD68 antigen variant (Fragment) 198 42846 5 5 5 5 3699 4920 1 0 1 540.2955 1617.8646 3 1617.8661 -0.0015 0 14.43 0.044 K LQMEAPHIIVGTPGR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5394.5394.3.dta 9 IPI00790077.1 25 kDa protein 188 24740 3 3 3 3 1097 2553 1 0 1 479.2717 956.5288 2 956.5291 -0.0003 0 43.03 0.0007 R ELAQQIQK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2689.2689.2.dta 9 IPI00790077.1 25 kDa protein 188 24740 3 3 3 3 2908 3863 1 0 1 697.8477 1393.6809 2 1393.6838 -0.0029 0 104.99 3.20E-10 K GYDVIAQAQSGTGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4195.4195.2.dta 9 IPI00790077.1 25 kDa protein 188 24740 3 3 3 3 3451 6923 1 0 1 778.3604 1554.7062 2 1554.7058 0.0004 0 82.92 1.70E-08 K MFVLDEADEMLSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7912.7912.2.dta 9 IPI00386604.1 Hypothetical protein (Fragment) 158 51913 5 5 5 5 1097 2553 1 0 1 479.2717 956.5288 2 956.5291 -0.0003 0 43.03 0.0007 R ELAQQIQK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2689.2689.2.dta 9 IPI00386604.1 Hypothetical protein (Fragment) 158 51913 5 5 5 5 1369 4115 1 0 0 509.7817 1017.5489 2 1017.5495 -0.0006 1 31.54 0.0052 R KVDWLTEK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4470.4470.2.dta 9 IPI00386604.1 Hypothetical protein (Fragment) 158 51913 5 5 5 5 1758 5891 1 0 1 557.8447 1113.6748 2 1113.6758 -0.001 0 63.9 2.60E-06 R VLITTDLLAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6623.6623.2.dta 9 IPI00386604.1 Hypothetical protein (Fragment) 158 51913 5 5 5 5 3451 6923 1 0 1 778.3604 1554.7062 2 1554.7058 0.0004 0 82.92 1.70E-08 K MFVLDEADEMLSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7912.7912.2.dta 9 IPI00386604.1 Hypothetical protein (Fragment) 158 51913 5 5 5 5 3699 4920 1 0 1 540.2955 1617.8646 3 1617.8661 -0.0015 0 14.43 0.044 K LQMEAPHIIVGTPGR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5394.5394.3.dta 9 IPI00030296.6 BM-010 138 36301 3 3 3 3 1369 4115 1 0 0 509.7817 1017.5489 2 1017.5495 -0.0006 1 31.54 0.0052 R KVDWLTEK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4470.4470.2.dta 9 IPI00030296.6 BM-010 138 36301 3 3 3 3 1758 5891 1 0 1 557.8447 1113.6748 2 1113.6758 -0.001 0 63.9 2.60E-06 R VLITTDLLAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6623.6623.2.dta 9 IPI00030296.6 BM-010 138 36301 3 3 3 3 3451 6923 1 0 1 778.3604 1554.7062 2 1554.7058 0.0004 0 82.92 1.70E-08 K MFVLDEADEMLSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7912.7912.2.dta 9 IPI00792676.1 14 kDa protein 125 14612 2 2 2 2 1097 2553 1 0 1 479.2717 956.5288 2 956.5291 -0.0003 0 43.03 0.0007 R ELAQQIQK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2689.2689.2.dta 9 IPI00792676.1 14 kDa protein 125 14612 2 2 2 2 2908 3863 1 0 1 697.8477 1393.6809 2 1393.6838 -0.0029 0 104.99 3.20E-10 K GYDVIAQAQSGTGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4195.4195.2.dta 9 IPI00163147.6 46 kDa protein 94 45900 3 3 3 3 1097 2553 1 0 1 479.2717 956.5288 2 956.5291 -0.0003 0 43.03 0.0007 R ELAQQIQK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2689.2689.2.dta 9 IPI00163147.6 46 kDa protein 94 45900 3 3 3 3 1369 4115 1 0 0 509.7817 1017.5489 2 1017.5495 -0.0006 1 31.54 0.0052 R KVDWLTEK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4470.4470.2.dta 9 IPI00163147.6 46 kDa protein 94 45900 3 3 3 3 1758 5891 1 0 1 557.8447 1113.6748 2 1113.6758 -0.001 0 63.9 2.60E-06 R VLITTDLLAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6623.6623.2.dta 9 IPI00793220.1 18 kDa protein 83 17876 1 1 1 1 3451 6923 1 0 1 778.3604 1554.7062 2 1554.7058 0.0004 0 82.92 1.70E-08 K MFVLDEADEMLSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7912.7912.2.dta 9 IPI00790597.1 6 kDa protein 64 6359 1 1 1 1 1758 5891 1 0 1 557.8447 1113.6748 2 1113.6758 -0.001 0 63.9 2.60E-06 R VLITTDLLAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6623.6623.2.dta 9 IPI00794607.1 21 kDa protein 32 21019 1 1 1 1 1369 4115 1 0 0 509.7817 1017.5489 2 1017.5495 -0.0006 1 31.54 0.0052 R KVDWLTEK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4470.4470.2.dta 10 1 IPI00013881.6 Heterogeneous nuclear ribonucleoprotein H 223 49484 5 5 5 5 1091 2071 1 1 1 478.7674 955.5203 2 955.5199 0.0004 0 32.38 0.0067 K IQNGAQGIR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2149.2149.2.dta 10 1 IPI00013881.6 Heterogeneous nuclear ribonucleoprotein H 223 49484 5 5 5 5 1681 3580 1 1 0 364.8643 1091.5712 3 1091.5724 -0.0011 0 21.92 0.0088 R VHIEIGPDGR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3885.3885.3.dta 10 1 IPI00013881.6 Heterogeneous nuclear ribonucleoprotein H 223 49484 5 5 5 5 3301 4914 1 1 1 752.8437 1503.6729 2 1503.6776 -0.0047 0 83.62 1.40E-08 R GLPWSCSADEVQR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5385.5385.2.dta 10 1 IPI00013881.6 Heterogeneous nuclear ribonucleoprotein H 223 49484 5 5 5 5 4629 6260 1 1 1 921.4495 1840.8845 2 1840.8843 0.0002 0 76.2 7.20E-08 R STGEAFVQFASQEIAEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7080.7080.2.dta 10 1 IPI00013881.6 Heterogeneous nuclear ribonucleoprotein H 223 49484 5 5 5 5 5107 7343 1 1 0 998.9913 1995.9681 2 1995.969 -0.0009 0 81.34 2.40E-08 R ATENDIYNFFSPLNPVR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.8436.8436.2.dta 10 2 IPI00003881.5 Heterogeneous nuclear ribonucleoprotein F 184 45985 6 6 5 5 186 3893 1 0 1 346.7212 691.4278 2 691.4268 0.001 0 18.66 0.042 R YIGIVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4227.4227.2.dta 10 2 IPI00003881.5 Heterogeneous nuclear ribonucleoprotein F 184 45985 6 6 5 5 468 4752 1 0 1 399.7235 797.4324 2 797.4323 0.0001 0 25.78 0.03 R YIEVFK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5196.5196.2.dta 10 2 IPI00003881.5 Heterogeneous nuclear ribonucleoprotein F 184 45985 6 6 5 5 1681 3580 1 0 0 364.8643 1091.5712 3 1091.5724 -0.0011 0 21.92 0.0088 R VHIEIGPDGR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3885.3885.3.dta 10 2 IPI00003881.5 Heterogeneous nuclear ribonucleoprotein F 184 45985 6 6 5 5 4757 6963 1 0 1 934.4746 1866.9347 2 1866.9363 -0.0017 0 79.2 1.40E-07 K ITGEAFVQFASQELAEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7964.7964.2.dta 10 2 IPI00003881.5 Heterogeneous nuclear ribonucleoprotein F 184 45985 6 6 5 5 4758 6959 1 0 1 623.3199 1866.938 3 1866.9363 0.0017 0 54.88 2.70E-05 K ITGEAFVQFASQELAEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7959.7959.3.dta 10 2 IPI00003881.5 Heterogeneous nuclear ribonucleoprotein F 184 45985 6 6 5 5 5107 7343 1 0 0 998.9913 1995.9681 2 1995.969 -0.0009 0 81.34 2.40E-08 K ATENDIYNFFSPLNPVR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.8436.8436.2.dta 10 IPI00026230.1 Heterogeneous nuclear ribonucleoprotein H~ 83 49517 2 2 2 2 1681 3580 1 0 0 364.8643 1091.5712 3 1091.5724 -0.0011 0 21.92 0.0088 R VHIEIGPDGR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3885.3885.3.dta 10 IPI00026230.1 Heterogeneous nuclear ribonucleoprotein H~ 83 49517 2 2 2 2 4629 6260 1 0 1 921.4495 1840.8845 2 1840.8843 0.0002 0 76.2 7.20E-08 R STGEAFVQFASQEIAEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7080.7080.2.dta 11 1 IPI00168728.1 FLJ00385 protein (Fragment) 216 57272 14 14 2 2 594 4469 1 1 1 418.2208 834.427 2 834.4269 0.0001 0 43.58 0.0013 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4870.4870.2.dta 11 1 IPI00168728.1 FLJ00385 protein (Fragment) 216 57272 14 14 2 2 595 4324 1 1 1 418.2209 834.4273 2 834.4269 0.0004 0 41.08 0.0024 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4699.4699.2.dta 11 1 IPI00168728.1 FLJ00385 protein (Fragment) 216 57272 14 14 2 2 596 4912 1 1 1 418.2209 834.4273 2 834.4269 0.0004 0 40.59 0.0027 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5383.5383.2.dta 11 1 IPI00168728.1 FLJ00385 protein (Fragment) 216 57272 14 14 2 2 597 4180 1 1 1 418.2209 834.4273 2 834.4269 0.0004 0 35.86 0.0079 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4542.4542.2.dta 11 1 IPI00168728.1 FLJ00385 protein (Fragment) 216 57272 14 14 2 2 599 4635 1 1 1 418.2211 834.4277 2 834.4269 0.0008 0 31.74 0.02 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5062.5062.2.dta 11 1 IPI00168728.1 FLJ00385 protein (Fragment) 216 57272 14 14 2 2 600 4039 1 1 1 418.2219 834.4292 2 834.4269 0.0023 0 50.02 0.00026 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4386.4386.2.dta 11 1 IPI00168728.1 FLJ00385 protein (Fragment) 216 57272 14 14 2 2 686 3529 1 1 1 426.2171 850.4197 2 850.4218 -0.0022 0 38.59 0.0026 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3830.3830.2.dta 11 1 IPI00168728.1 FLJ00385 protein (Fragment) 216 57272 14 14 2 2 687 3827 1 1 1 426.2175 850.4204 2 850.4218 -0.0014 0 47.59 0.00033 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4155.4155.2.dta 11 1 IPI00168728.1 FLJ00385 protein (Fragment) 216 57272 14 14 2 2 691 1025 1 1 1 426.218 850.4214 2 850.4218 -0.0004 0 29.34 0.031 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.11428.11428.2.dta 11 1 IPI00168728.1 FLJ00385 protein (Fragment) 216 57272 14 14 2 2 693 3702 1 1 1 426.2181 850.4217 2 850.4218 -0.0002 0 38.31 0.0039 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4018.4018.2.dta 11 1 IPI00168728.1 FLJ00385 protein (Fragment) 216 57272 14 14 2 2 695 8039 1 1 1 426.2183 850.422 2 850.4218 0.0001 0 32.95 0.013 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9284.9284.2.dta 11 1 IPI00168728.1 FLJ00385 protein (Fragment) 216 57272 14 14 2 2 696 1112 1 1 1 426.2183 850.4221 2 850.4218 0.0002 0 27.55 0.047 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.11540.11540.2.dta 11 1 IPI00168728.1 FLJ00385 protein (Fragment) 216 57272 14 14 2 2 2407 4474 1 1 1 634.3831 1266.7517 2 1266.7547 -0.003 1 40.39 0.00038 K ALPAPIEKTISK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4875.4875.2.dta 11 1 IPI00168728.1 FLJ00385 protein (Fragment) 216 57272 14 14 2 2 2408 4088 1 1 1 634.3837 1266.7528 2 1266.7547 -0.0019 1 50.82 3.50E-05 K ALPAPIEKTISK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4441.4441.2.dta 11 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 164 46716 12 12 1 1 594 4469 1 0 1 418.2208 834.427 2 834.4269 0.0001 0 43.58 0.0013 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4870.4870.2.dta 11 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 164 46716 12 12 1 1 595 4324 1 0 1 418.2209 834.4273 2 834.4269 0.0004 0 41.08 0.0024 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4699.4699.2.dta 11 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 164 46716 12 12 1 1 596 4912 1 0 1 418.2209 834.4273 2 834.4269 0.0004 0 40.59 0.0027 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5383.5383.2.dta 11 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 164 46716 12 12 1 1 597 4180 1 0 1 418.2209 834.4273 2 834.4269 0.0004 0 35.86 0.0079 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4542.4542.2.dta 11 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 164 46716 12 12 1 1 599 4635 1 0 1 418.2211 834.4277 2 834.4269 0.0008 0 31.74 0.02 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5062.5062.2.dta 11 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 164 46716 12 12 1 1 600 4039 1 0 1 418.2219 834.4292 2 834.4269 0.0023 0 50.02 0.00026 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4386.4386.2.dta 11 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 164 46716 12 12 1 1 686 3529 1 0 1 426.2171 850.4197 2 850.4218 -0.0022 0 38.59 0.0026 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3830.3830.2.dta 11 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 164 46716 12 12 1 1 687 3827 1 0 1 426.2175 850.4204 2 850.4218 -0.0014 0 47.59 0.00033 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4155.4155.2.dta 11 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 164 46716 12 12 1 1 691 1025 1 0 1 426.218 850.4214 2 850.4218 -0.0004 0 29.34 0.031 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.11428.11428.2.dta 11 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 164 46716 12 12 1 1 693 3702 1 0 1 426.2181 850.4217 2 850.4218 -0.0002 0 38.31 0.0039 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4018.4018.2.dta 11 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 164 46716 12 12 1 1 695 8039 1 0 1 426.2183 850.422 2 850.4218 0.0001 0 32.95 0.013 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9284.9284.2.dta 11 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 164 46716 12 12 1 1 696 1112 1 0 1 426.2183 850.4221 2 850.4218 0.0002 0 27.55 0.047 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.11540.11540.2.dta 12 1 IPI00180675.4 Tubulin alpha-3 chain 198 50788 9 9 7 7 406 3121 1 1 1 391.2081 780.4016 2 780.4018 -0.0002 0 25.9 0.048 R LSVDYGK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3350.3350.2.dta 12 1 IPI00180675.4 Tubulin alpha-3 chain 198 50788 9 9 7 7 1352 4497 1 1 1 508.2925 1014.5705 2 1014.5709 -0.0004 0 58.67 1.40E-05 K DVNAAIATIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4901.4901.2.dta 12 1 IPI00180675.4 Tubulin alpha-3 chain 198 50788 9 9 7 7 4217 6603 1 1 1 851.4554 1700.8963 2 1700.8985 -0.0022 0 62.15 1.50E-06 R AVFVDLEPTVIDEVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7524.7524.2.dta 12 1 IPI00180675.4 Tubulin alpha-3 chain 198 50788 9 9 7 7 4218 6607 1 1 1 567.9738 1700.8996 3 1700.8985 0.0011 0 28.83 0.002 R AVFVDLEPTVIDEVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7528.7528.3.dta 12 1 IPI00180675.4 Tubulin alpha-3 chain 198 50788 9 9 7 7 4293 4263 1 1 1 573.632 1717.874 3 1717.8747 -0.0007 0 31.19 0.0037 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4631.4631.3.dta 12 1 IPI00180675.4 Tubulin alpha-3 chain 198 50788 9 9 7 7 4405 5972 1 1 1 586.3262 1755.9569 3 1755.9559 0.0009 0 22.03 0.037 R IHFPLATYAPVISAEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6720.6720.3.dta 12 1 IPI00180675.4 Tubulin alpha-3 chain 198 50788 9 9 7 7 4568 5280 1 1 1 912.9969 1823.9792 2 1823.9782 0.0011 0 52.75 2.00E-05 K VGINYQPPTVVPGGDLAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5812.5812.2.dta 12 1 IPI00180675.4 Tubulin alpha-3 chain 198 50788 9 9 7 7 6246 4922 1 1 1 805.7395 2414.1967 3 2414.1978 -0.0012 1 42.01 0.00012 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5397.5397.3.dta 12 1 IPI00180675.4 Tubulin alpha-3 chain 198 50788 9 9 7 7 6247 4918 1 1 1 604.5576 2414.2011 4 2414.1978 0.0033 1 19.87 0.014 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5390.5390.4.dta 12 IPI00166768.2 TUBA6 protein 183 37681 7 7 5 5 1352 4497 1 0 1 508.2925 1014.5705 2 1014.5709 -0.0004 0 58.67 1.40E-05 K DVNAAIATIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4901.4901.2.dta 12 IPI00166768.2 TUBA6 protein 183 37681 7 7 5 5 4217 6603 1 0 1 851.4554 1700.8963 2 1700.8985 -0.0022 0 62.15 1.50E-06 R AVFVDLEPTVIDEVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7524.7524.2.dta 12 IPI00166768.2 TUBA6 protein 183 37681 7 7 5 5 4218 6607 1 0 1 567.9738 1700.8996 3 1700.8985 0.0011 0 28.83 0.002 R AVFVDLEPTVIDEVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7528.7528.3.dta 12 IPI00166768.2 TUBA6 protein 183 37681 7 7 5 5 4405 5972 1 0 1 586.3262 1755.9569 3 1755.9559 0.0009 0 22.03 0.037 R IHFPLATYAPVISAEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6720.6720.3.dta 12 IPI00166768.2 TUBA6 protein 183 37681 7 7 5 5 4568 5280 1 0 1 912.9969 1823.9792 2 1823.9782 0.0011 0 52.75 2.00E-05 K VGINYQPPTVVPGGDLAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5812.5812.2.dta 12 IPI00166768.2 TUBA6 protein 183 37681 7 7 5 5 6246 4922 1 0 1 805.7395 2414.1967 3 2414.1978 -0.0012 1 42.01 0.00012 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5397.5397.3.dta 12 IPI00166768.2 TUBA6 protein 183 37681 7 7 5 5 6247 4918 1 0 1 604.5576 2414.2011 4 2414.1978 0.0033 1 19.87 0.014 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5390.5390.4.dta 12 IPI00179709.4 Isoform 1 of Tubulin alpha-2 chain 138 50612 7 7 6 6 406 3121 1 0 1 391.2081 780.4016 2 780.4018 -0.0002 0 25.9 0.048 R LSVDYGK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3350.3350.2.dta 12 IPI00179709.4 Isoform 1 of Tubulin alpha-2 chain 138 50612 7 7 6 6 1352 4497 1 0 1 508.2925 1014.5705 2 1014.5709 -0.0004 0 58.67 1.40E-05 K DVNAAIATIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4901.4901.2.dta 12 IPI00179709.4 Isoform 1 of Tubulin alpha-2 chain 138 50612 7 7 6 6 4293 4263 1 0 1 573.632 1717.874 3 1717.8747 -0.0007 0 31.19 0.0037 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4631.4631.3.dta 12 IPI00179709.4 Isoform 1 of Tubulin alpha-2 chain 138 50612 7 7 6 6 4405 5972 1 0 1 586.3262 1755.9569 3 1755.9559 0.0009 0 22.03 0.037 R IHFPLATYAPVISAEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6720.6720.3.dta 12 IPI00179709.4 Isoform 1 of Tubulin alpha-2 chain 138 50612 7 7 6 6 4568 5280 1 0 1 912.9969 1823.9792 2 1823.9782 0.0011 0 52.75 2.00E-05 K VGINYQPPTVVPGGDLAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5812.5812.2.dta 12 IPI00179709.4 Isoform 1 of Tubulin alpha-2 chain 138 50612 7 7 6 6 6246 4922 1 0 1 805.7395 2414.1967 3 2414.1978 -0.0012 1 42.01 0.00012 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5397.5397.3.dta 12 IPI00179709.4 Isoform 1 of Tubulin alpha-2 chain 138 50612 7 7 6 6 6247 4918 1 0 1 604.5576 2414.2011 4 2414.1978 0.0033 1 19.87 0.014 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5390.5390.4.dta 12 IPI00478908.3 29 kDa protein 127 28716 7 7 5 5 406 3121 1 0 1 391.2081 780.4016 2 780.4018 -0.0002 0 25.9 0.048 R LSVDYGK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3350.3350.2.dta 12 IPI00478908.3 29 kDa protein 127 28716 7 7 5 5 4217 6603 1 0 1 851.4554 1700.8963 2 1700.8985 -0.0022 0 62.15 1.50E-06 R AVFVDLEPTVIDEVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7524.7524.2.dta 12 IPI00478908.3 29 kDa protein 127 28716 7 7 5 5 4218 6607 1 0 1 567.9738 1700.8996 3 1700.8985 0.0011 0 28.83 0.002 R AVFVDLEPTVIDEVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7528.7528.3.dta 12 IPI00478908.3 29 kDa protein 127 28716 7 7 5 5 4293 4263 1 0 1 573.632 1717.874 3 1717.8747 -0.0007 0 31.19 0.0037 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4631.4631.3.dta 12 IPI00478908.3 29 kDa protein 127 28716 7 7 5 5 4405 5972 1 0 1 586.3262 1755.9569 3 1755.9559 0.0009 0 22.03 0.037 R IHFPLATYAPVISAEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6720.6720.3.dta 12 IPI00478908.3 29 kDa protein 127 28716 7 7 5 5 6246 4922 1 0 1 805.7395 2414.1967 3 2414.1978 -0.0012 1 42.01 0.00012 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5397.5397.3.dta 12 IPI00478908.3 29 kDa protein 127 28716 7 7 5 5 6247 4918 1 0 1 604.5576 2414.2011 4 2414.1978 0.0033 1 19.87 0.014 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5390.5390.4.dta 12 IPI00795002.1 19 kDa protein 112 19479 5 5 3 3 406 3121 1 0 1 391.2081 780.4016 2 780.4018 -0.0002 0 25.9 0.048 R LSVDYGK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3350.3350.2.dta 12 IPI00795002.1 19 kDa protein 112 19479 5 5 3 3 4217 6603 1 0 1 851.4554 1700.8963 2 1700.8985 -0.0022 0 62.15 1.50E-06 R AVFVDLEPTVIDEVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7524.7524.2.dta 12 IPI00795002.1 19 kDa protein 112 19479 5 5 3 3 4218 6607 1 0 1 567.9738 1700.8996 3 1700.8985 0.0011 0 28.83 0.002 R AVFVDLEPTVIDEVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7528.7528.3.dta 12 IPI00795002.1 19 kDa protein 112 19479 5 5 3 3 6246 4922 1 0 1 805.7395 2414.1967 3 2414.1978 -0.0012 1 42.01 0.00012 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5397.5397.3.dta 12 IPI00795002.1 19 kDa protein 112 19479 5 5 3 3 6247 4918 1 0 1 604.5576 2414.2011 4 2414.1978 0.0033 1 19.87 0.014 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5390.5390.4.dta 12 IPI00410402.2 Similar to alpha tubulin 105 50568 4 4 4 4 1352 4497 1 0 1 508.2925 1014.5705 2 1014.5709 -0.0004 0 58.67 1.40E-05 K DVNAAIATIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4901.4901.2.dta 12 IPI00410402.2 Similar to alpha tubulin 105 50568 4 4 4 4 4293 4263 1 0 1 573.632 1717.874 3 1717.8747 -0.0007 0 31.19 0.0037 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4631.4631.3.dta 12 IPI00410402.2 Similar to alpha tubulin 105 50568 4 4 4 4 4405 5972 1 0 1 586.3262 1755.9569 3 1755.9559 0.0009 0 22.03 0.037 R IHFPLATYAPVISAEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6720.6720.3.dta 12 IPI00410402.2 Similar to alpha tubulin 105 50568 4 4 4 4 4568 5280 1 0 1 912.9969 1823.9792 2 1823.9782 0.0011 0 52.75 2.00E-05 K VGINYQPPTVVPGGDLAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5812.5812.2.dta 12 IPI00007750.1 Tubulin alpha-1 chain 101 50634 6 6 5 5 406 3121 1 0 1 391.2081 780.4016 2 780.4018 -0.0002 0 25.9 0.048 R LSVDYGK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3350.3350.2.dta 12 IPI00007750.1 Tubulin alpha-1 chain 101 50634 6 6 5 5 4293 4263 1 0 1 573.632 1717.874 3 1717.8747 -0.0007 0 31.19 0.0037 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4631.4631.3.dta 12 IPI00007750.1 Tubulin alpha-1 chain 101 50634 6 6 5 5 4405 5972 1 0 1 586.3262 1755.9569 3 1755.9559 0.0009 0 22.03 0.037 R IHFPLATYAPVISAEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6720.6720.3.dta 12 IPI00007750.1 Tubulin alpha-1 chain 101 50634 6 6 5 5 4568 5280 1 0 1 912.9969 1823.9792 2 1823.9782 0.0011 0 52.75 2.00E-05 K VGINYQPPTVVPGGDLAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5812.5812.2.dta 12 IPI00007750.1 Tubulin alpha-1 chain 101 50634 6 6 5 5 6246 4922 1 0 1 805.7395 2414.1967 3 2414.1978 -0.0012 1 42.01 0.00012 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5397.5397.3.dta 12 IPI00007750.1 Tubulin alpha-1 chain 101 50634 6 6 5 5 6247 4918 1 0 1 604.5576 2414.2011 4 2414.1978 0.0033 1 19.87 0.014 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5390.5390.4.dta 12 IPI00646909.2 Tubulin alpha-8 chain 96 50746 4 4 3 3 4293 4263 1 0 1 573.632 1717.874 3 1717.8747 -0.0007 0 31.19 0.0037 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4631.4631.3.dta 12 IPI00646909.2 Tubulin alpha-8 chain 96 50746 4 4 3 3 4568 5280 1 0 1 912.9969 1823.9792 2 1823.9782 0.0011 0 52.75 2.00E-05 K VGINYQPPTVVPGGDLAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5812.5812.2.dta 12 IPI00646909.2 Tubulin alpha-8 chain 96 50746 4 4 3 3 6246 4922 1 0 1 805.7395 2414.1967 3 2414.1978 -0.0012 1 42.01 0.00012 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5397.5397.3.dta 12 IPI00646909.2 Tubulin alpha-8 chain 96 50746 4 4 3 3 6247 4918 1 0 1 604.5576 2414.2011 4 2414.1978 0.0033 1 19.87 0.014 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5390.5390.4.dta 12 IPI00784332.1 Similar to Tubulin alpha-2 chain 91 17148 2 2 2 2 1352 4497 1 0 1 508.2925 1014.5705 2 1014.5709 -0.0004 0 58.67 1.40E-05 K DVNAAIATIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4901.4901.2.dta 12 IPI00784332.1 Similar to Tubulin alpha-2 chain 91 17148 2 2 2 2 4568 5280 1 0 1 912.9969 1823.9792 2 1823.9782 0.0011 0 52.75 2.00E-05 K VGINYQPPTVVPGGDLAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5812.5812.2.dta 12 IPI00414274.3 similar to Tubulin alpha-3 chain 73 23560 4 4 4 4 406 3121 1 0 1 391.2081 780.4016 2 780.4018 -0.0002 0 25.9 0.048 R LSVDYGK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3350.3350.2.dta 12 IPI00414274.3 similar to Tubulin alpha-3 chain 73 23560 4 4 4 4 1352 4497 1 0 1 508.2925 1014.5705 2 1014.5709 -0.0004 0 58.67 1.40E-05 K DVNAAIATIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4901.4901.2.dta 12 IPI00414274.3 similar to Tubulin alpha-3 chain 73 23560 4 4 4 4 4293 4263 1 0 1 573.632 1717.874 3 1717.8747 -0.0007 0 31.19 0.0037 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4631.4631.3.dta 12 IPI00414274.3 similar to Tubulin alpha-3 chain 73 23560 4 4 4 4 4405 5972 1 0 1 586.3262 1755.9569 3 1755.9559 0.0009 0 22.03 0.037 R IHFPLATYAPVISAEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6720.6720.3.dta 12 IPI00335314.3 30 kDa protein 64 30008 4 4 3 3 406 3121 1 0 1 391.2081 780.4016 2 780.4018 -0.0002 0 25.9 0.048 R LSVDYGK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3350.3350.2.dta 12 IPI00335314.3 30 kDa protein 64 30008 4 4 3 3 4293 4263 1 0 1 573.632 1717.874 3 1717.8747 -0.0007 0 31.19 0.0037 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4631.4631.3.dta 12 IPI00335314.3 30 kDa protein 64 30008 4 4 3 3 6246 4922 1 0 1 805.7395 2414.1967 3 2414.1978 -0.0012 1 42.01 0.00012 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5397.5397.3.dta 12 IPI00335314.3 30 kDa protein 64 30008 4 4 3 3 6247 4918 1 0 1 604.5576 2414.2011 4 2414.1978 0.0033 1 19.87 0.014 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5390.5390.4.dta 12 IPI00794009.1 22 kDa protein 52 21949 3 3 2 2 406 3121 1 0 1 391.2081 780.4016 2 780.4018 -0.0002 0 25.9 0.048 R LSVDYGK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3350.3350.2.dta 12 IPI00794009.1 22 kDa protein 52 21949 3 3 2 2 6246 4922 1 0 1 805.7395 2414.1967 3 2414.1978 -0.0012 1 42.01 0.00012 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5397.5397.3.dta 12 IPI00794009.1 22 kDa protein 52 21949 3 3 2 2 6247 4918 1 0 1 604.5576 2414.2011 4 2414.1978 0.0033 1 19.87 0.014 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5390.5390.4.dta 12 IPI00017454.3 Tubulin alpha-4 chain 31 27757 1 1 1 1 4293 4263 1 0 1 573.632 1717.874 3 1717.8747 -0.0007 0 31.19 0.0037 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4631.4631.3.dta 12 IPI00062209.5 Alpha tubulin-like 26 16843 1 1 1 1 406 3121 1 0 1 391.2081 780.4016 2 780.4018 -0.0002 0 25.9 0.048 R LSVDYGK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3350.3350.2.dta 13 1 IPI00216592.2 Isoform C1 of Heterogeneous nuclear ribonucleoproteins C1/C2 195 32375 5 5 5 5 842 1595 1 1 1 450.2419 898.4692 2 898.4695 -0.0003 0 30.5 0.0024 K IVGCSVHK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1624.1624.2.dta 13 1 IPI00216592.2 Isoform C1 of Heterogeneous nuclear ribonucleoproteins C1/C2 195 32375 5 5 5 5 1035 3250 1 1 1 472.2906 942.5667 2 942.5651 0.0017 0 25.01 0.006 R VPPPPPIAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3505.3505.2.dta 13 1 IPI00216592.2 Isoform C1 of Heterogeneous nuclear ribonucleoproteins C1/C2 195 32375 5 5 5 5 1237 4950 1 1 1 498.2558 994.4971 2 994.4971 0 0 53.39 1.90E-05 K SDVEAIFSK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5431.5431.2.dta 13 1 IPI00216592.2 Isoform C1 of Heterogeneous nuclear ribonucleoproteins C1/C2 195 32375 5 5 5 5 2601 6143 1 1 1 658.9011 1315.7876 2 1315.7864 0.0012 0 69.19 3.70E-07 R VFIGNLNTLVVK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6938.6938.2.dta 13 1 IPI00216592.2 Isoform C1 of Heterogeneous nuclear ribonucleoproteins C1/C2 195 32375 5 5 5 5 2650 5849 1 1 1 665.3326 1328.6507 2 1328.6513 -0.0006 0 86.47 9.10E-09 K GFAFVQYVNER N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6563.6563.2.dta 13 IPI00736458.1 similar to heterogeneous nuclear ribonucleoprotein C isoform b isoform 2 127 26507 4 4 4 4 842 1595 1 0 1 450.2419 898.4692 2 898.4695 -0.0003 0 30.5 0.0024 K IVGCSVHK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1624.1624.2.dta 13 IPI00736458.1 similar to heterogeneous nuclear ribonucleoprotein C isoform b isoform 2 127 26507 4 4 4 4 1035 3250 1 0 1 472.2906 942.5667 2 942.5651 0.0017 0 25.01 0.006 R VPPPPPIAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3505.3505.2.dta 13 IPI00736458.1 similar to heterogeneous nuclear ribonucleoprotein C isoform b isoform 2 127 26507 4 4 4 4 1237 4950 1 0 1 498.2558 994.4971 2 994.4971 0 0 53.39 1.90E-05 K SDVEAIFSK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5431.5431.2.dta 13 IPI00736458.1 similar to heterogeneous nuclear ribonucleoprotein C isoform b isoform 2 127 26507 4 4 4 4 2601 6143 1 0 1 658.9011 1315.7876 2 1315.7864 0.0012 0 69.19 3.70E-07 R VFIGNLNTLVVK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6938.6938.2.dta 13 IPI00027569.1 Heterogeneous nuclear ribonucleoprotein C-like 1 105 32180 2 2 2 2 1237 4950 1 0 1 498.2558 994.4971 2 994.4971 0 0 53.39 1.90E-05 K SDVEAIFSK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5431.5431.2.dta 13 IPI00027569.1 Heterogeneous nuclear ribonucleoprotein C-like 1 105 32180 2 2 2 2 2601 6143 1 0 1 658.9011 1315.7876 2 1315.7864 0.0012 0 69.19 3.70E-07 R VFIGNLNTLVVK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6938.6938.2.dta 13 IPI00759822.1 Isoform 3 of Heterogeneous nuclear ribonucleoproteins C1/C2 78 25215 2 2 2 2 1035 3250 1 0 1 472.2906 942.5667 2 942.5651 0.0017 0 25.01 0.006 R VPPPPPIAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3505.3505.2.dta 13 IPI00759822.1 Isoform 3 of Heterogeneous nuclear ribonucleoproteins C1/C2 78 25215 2 2 2 2 2601 6143 1 0 1 658.9011 1315.7876 2 1315.7864 0.0012 0 69.19 3.70E-07 R VFIGNLNTLVVK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6938.6938.2.dta 13 IPI00411624.2 11 kDa protein 69 11368 1 1 1 1 2601 6143 1 0 1 658.9011 1315.7876 2 1315.7864 0.0012 0 69.19 3.70E-07 R VFIGNLNTLVVK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6938.6938.2.dta 13 IPI00166137.5 RALY-like protein isoform 1 30 32425 1 1 1 1 842 1595 1 0 1 450.2419 898.4692 2 898.4695 -0.0003 0 30.5 0.0024 K IVGCSVHK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1624.1624.2.dta 14 1 IPI00011654.2 Tubulin beta chain 176 50095 7 7 5 5 1616 2080 1 1 1 539.2697 1076.5248 2 1076.525 -0.0003 1 22.1 0.03 K IREEYPDR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2159.2159.2.dta 14 1 IPI00011654.2 Tubulin beta chain 176 50095 7 7 5 5 2529 3825 1 1 1 651.3211 1300.6277 2 1300.6299 -0.0022 0 56.49 8.00E-06 R ISVYYNEATGGK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4153.4153.2.dta 14 1 IPI00011654.2 Tubulin beta chain 176 50095 7 7 5 5 3118 3998 1 1 1 723.8464 1445.6783 2 1445.682 -0.0037 0 63.38 6.10E-06 K EVDEQMLNVQNK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4340.4340.2.dta 14 1 IPI00011654.2 Tubulin beta chain 176 50095 7 7 5 5 5281 6575 1 1 1 696.3635 2086.0686 3 2086.0695 -0.0009 1 64.73 4.10E-06 K GHYTEGAELVDSVLDVVRK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7493.7493.3.dta 14 1 IPI00011654.2 Tubulin beta chain 176 50095 7 7 5 5 5282 6595 1 1 1 522.5245 2086.069 4 2086.0695 -0.0005 1 29.78 0.0034 K GHYTEGAELVDSVLDVVRK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7513.7513.4.dta 14 1 IPI00011654.2 Tubulin beta chain 176 50095 7 7 5 5 5283 6580 1 1 1 522.5248 2086.07 4 2086.0695 0.0005 1 40.09 0.001 K GHYTEGAELVDSVLDVVRK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7498.7498.4.dta 14 1 IPI00011654.2 Tubulin beta chain 176 50095 7 7 5 5 8077 5772 1 1 1 776.3569 3101.3984 4 3101.4003 -0.0019 0 19.16 0.022 K FWEVISDEHGIDPTGTYHGDSDLQLDR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6467.6467.4.dta 14 IPI00007752.1 Tubulin beta-2C chain 134 50255 5 5 3 3 1616 2080 1 0 1 539.2697 1076.5248 2 1076.525 -0.0003 1 22.1 0.03 K IREEYPDR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2159.2159.2.dta 14 IPI00007752.1 Tubulin beta-2C chain 134 50255 5 5 3 3 3118 3998 1 0 1 723.8464 1445.6783 2 1445.682 -0.0037 0 63.38 6.10E-06 K EVDEQMLNVQNK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4340.4340.2.dta 14 IPI00007752.1 Tubulin beta-2C chain 134 50255 5 5 3 3 5281 6575 1 0 1 696.3635 2086.0686 3 2086.0695 -0.0009 1 64.73 4.10E-06 K GHYTEGAELVDSVLDVVRK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7493.7493.3.dta 14 IPI00007752.1 Tubulin beta-2C chain 134 50255 5 5 3 3 5282 6595 1 0 1 522.5245 2086.069 4 2086.0695 -0.0005 1 29.78 0.0034 K GHYTEGAELVDSVLDVVRK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7513.7513.4.dta 14 IPI00007752.1 Tubulin beta-2C chain 134 50255 5 5 3 3 5283 6580 1 0 1 522.5248 2086.07 4 2086.0695 0.0005 1 40.09 0.001 K GHYTEGAELVDSVLDVVRK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7498.7498.4.dta 14 IPI00646779.2 TUBB6 protein 94 50514 4 4 2 2 1616 2080 1 0 1 539.2697 1076.5248 2 1076.525 -0.0003 1 22.1 0.03 K IREEYPDR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2159.2159.2.dta 14 IPI00646779.2 TUBB6 protein 94 50514 4 4 2 2 5281 6575 1 0 1 696.3635 2086.0686 3 2086.0695 -0.0009 1 64.73 4.10E-06 K GHYTEGAELVDSVLDVVRK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7493.7493.3.dta 14 IPI00646779.2 TUBB6 protein 94 50514 4 4 2 2 5282 6595 1 0 1 522.5245 2086.069 4 2086.0695 -0.0005 1 29.78 0.0034 K GHYTEGAELVDSVLDVVRK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7513.7513.4.dta 14 IPI00646779.2 TUBB6 protein 94 50514 4 4 2 2 5283 6580 1 0 1 522.5248 2086.07 4 2086.0695 0.0005 1 40.09 0.001 K GHYTEGAELVDSVLDVVRK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7498.7498.4.dta 14 IPI00013683.2 Tubulin beta-3 chain 92 50856 3 3 1 1 5281 6575 1 0 1 696.3635 2086.0686 3 2086.0695 -0.0009 1 64.73 4.10E-06 K GHYTEGAELVDSVLDVVRK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7493.7493.3.dta 14 IPI00013683.2 Tubulin beta-3 chain 92 50856 3 3 1 1 5282 6595 1 0 1 522.5245 2086.069 4 2086.0695 -0.0005 1 29.78 0.0034 K GHYTEGAELVDSVLDVVRK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7513.7513.4.dta 14 IPI00013683.2 Tubulin beta-3 chain 92 50856 3 3 1 1 5283 6580 1 0 1 522.5248 2086.07 4 2086.0695 0.0005 1 40.09 0.001 K GHYTEGAELVDSVLDVVRK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7498.7498.4.dta 14 IPI00398982.1 "similar to tubulin, beta 5" 63 12210 1 1 1 1 3118 3998 1 0 1 723.8464 1445.6783 2 1445.682 -0.0037 0 63.38 6.10E-06 K EVDEQMLNVQNK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4340.4340.2.dta 14 IPI00006510.1 Tubulin beta-1 chain 22 50865 1 1 1 1 1616 2080 1 0 1 539.2697 1076.5248 2 1076.525 -0.0003 1 22.1 0.03 K IREEYPDR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2159.2159.2.dta 15 1 IPI00012066.2 poly(rC)-binding protein 2 isoform b 141 38597 2 2 2 2 2476 2981 1 1 0 644.7989 1287.5833 2 1287.5877 -0.0044 0 80.69 7.40E-08 R INISEGNCPER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3175.3175.2.dta 15 1 IPI00012066.2 poly(rC)-binding protein 2 isoform b 141 38597 2 2 2 2 3032 4685 1 1 1 714.8962 1427.7779 2 1427.7806 -0.0027 0 79.58 3.50E-08 R LVVPASQCGSLIGK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5118.5118.2.dta 15 2 IPI00016610.2 Poly(rC)-binding protein 1 125 37987 3 3 3 3 203 1572 1 0 1 350.7093 699.4041 2 699.4028 0.0014 0 44.51 0.00038 K LNQVAR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1599.1599.2.dta 15 2 IPI00016610.2 Poly(rC)-binding protein 1 125 37987 3 3 3 3 1341 3078 1 0 1 507.7697 1013.5248 2 1013.5254 -0.0006 0 46.74 0.00035 R QGANINEIR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3298.3298.2.dta 15 2 IPI00016610.2 Poly(rC)-binding protein 1 125 37987 3 3 3 3 2476 2981 1 0 0 644.7989 1287.5833 2 1287.5877 -0.0044 0 80.69 7.40E-08 R INISEGNCPER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3175.3175.2.dta 16 1 IPI00169383.3 Phosphoglycerate kinase 1 141 44985 7 7 7 7 510 2045 1 1 1 405.2114 808.4082 2 808.4079 0.0003 0 42.2 0.001 K YAEAVTR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2118.2118.2.dta 16 1 IPI00169383.3 Phosphoglycerate kinase 1 141 44985 7 7 7 7 796 4378 1 1 1 442.7293 883.4441 2 883.4439 0.0001 0 27.56 0.023 K ELNYFAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4756.4756.2.dta 16 1 IPI00169383.3 Phosphoglycerate kinase 1 141 44985 7 7 7 7 1475 4363 1 1 1 348.8819 1043.6238 3 1043.6226 0.0011 1 18.41 0.048 K LTLDKLDVK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4741.4741.3.dta 16 1 IPI00169383.3 Phosphoglycerate kinase 1 141 44985 7 7 7 7 1706 6792 1 1 1 549.314 1096.6134 2 1096.6128 0.0006 0 42.8 9.70E-05 K VLPGVDALSNI - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7748.7748.2.dta 16 1 IPI00169383.3 Phosphoglycerate kinase 1 141 44985 7 7 7 7 1715 1415 1 1 1 551.2726 1100.5307 2 1100.5323 -0.0015 0 24.62 0.0087 K NNQITNNQR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1428.1428.2.dta 16 1 IPI00169383.3 Phosphoglycerate kinase 1 141 44985 7 7 7 7 3789 4800 1 1 1 545.6024 1633.7854 3 1633.7849 0.0005 0 57.1 1.20E-05 K LGDVYVNDAFGTAHR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5248.5248.3.dta 16 1 IPI00169383.3 Phosphoglycerate kinase 1 141 44985 7 7 7 7 4444 6493 1 1 1 590.3367 1767.9884 3 1767.9883 0.0001 0 42.8 9.70E-05 K ALESPERPFLAILGGAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7395.7395.3.dta 16 IPI00219568.4 "Phosphoglycerate kinase, testis specific" 57 45166 1 1 1 1 3789 4800 1 0 1 545.6024 1633.7854 3 1633.7849 0.0005 0 57.1 1.20E-05 K LGDVYVNDAFGTAHR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5248.5248.3.dta 17 1 IPI00465439.5 Fructose-bisphosphate aldolase A 140 39851 4 4 4 4 1686 1757 1 1 1 547.2853 1092.5561 2 1092.5563 -0.0002 1 64.7 6.70E-06 K AAQEEYVKR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1805.1805.2.dta 17 1 IPI00465439.5 Fructose-bisphosphate aldolase A 140 39851 4 4 4 4 1831 3106 1 1 1 566.7924 1131.5703 2 1131.5706 -0.0003 0 46.63 0.00016 R ALANSLACQGK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3332.3332.2.dta 17 1 IPI00465439.5 Fructose-bisphosphate aldolase A 140 39851 4 4 4 4 2664 4099 1 1 1 666.8526 1331.6906 2 1331.6932 -0.0026 0 68.9 3.50E-07 K GILAADESTGSIAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4453.4453.2.dta 17 1 IPI00465439.5 Fructose-bisphosphate aldolase A 140 39851 4 4 4 4 2701 4259 1 1 1 448.242 1341.7043 3 1341.7041 0.0002 0 20.02 0.034 K ADDGRPFPQVIK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4627.4627.3.dta 17 IPI00791070.1 23 kDa protein 71 23062 2 2 2 2 2664 4099 1 0 1 666.8526 1331.6906 2 1331.6932 -0.0026 0 68.9 3.50E-07 K GILAADESTGSIAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4453.4453.2.dta 17 IPI00791070.1 23 kDa protein 71 23062 2 2 2 2 2701 4259 1 0 1 448.242 1341.7043 3 1341.7041 0.0002 0 20.02 0.034 K ADDGRPFPQVIK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4627.4627.3.dta 17 IPI00789118.1 Protein 65 23121 1 1 1 1 1686 1757 1 0 1 547.2853 1092.5561 2 1092.5563 -0.0002 1 64.7 6.70E-06 K AAQEEYVKR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1805.1805.2.dta 17 IPI00797597.1 18 kDa protein 20 17953 1 1 1 1 2701 4259 1 0 1 448.242 1341.7043 3 1341.7041 0.0002 0 20.02 0.034 K ADDGRPFPQVIK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4627.4627.3.dta 18 1 IPI00028888.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein D0 137 38581 6 6 6 6 903 6993 1 1 1 457.7607 913.5068 2 913.5062 0.0006 0 34.92 0.00082 R GFGFVLFK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.8003.8003.2.dta 18 1 IPI00028888.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein D0 137 38581 6 6 6 6 918 2120 1 1 1 459.246 916.4775 2 916.4767 0.0008 0 34.81 0.01 K YHNVGLSK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2216.2216.2.dta 18 1 IPI00028888.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein D0 137 38581 6 6 6 6 1957 4346 1 1 1 584.2897 1166.5648 2 1166.5642 0.0006 0 43.48 9.40E-05 K FGEVVDCTLK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4722.4722.2.dta 18 1 IPI00028888.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein D0 137 38581 6 6 6 6 3263 4931 1 1 1 744.8812 1487.7479 2 1487.7508 -0.0029 0 73.35 8.70E-07 K IFVGGLSPDTPEEK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5408.5408.2.dta 18 1 IPI00028888.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein D0 137 38581 6 6 6 6 3427 2049 1 1 1 514.9143 1541.7211 3 1541.7222 -0.0011 1 17.71 0.022 R HSEAATAQREEWK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2122.2122.3.dta 18 1 IPI00028888.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein D0 137 38581 6 6 6 6 4407 4847 1 1 1 586.6531 1756.9376 3 1756.9359 0.0016 1 26.49 0.0033 K IFVGGLSPDTPEEKIR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5312.5312.3.dta 18 2 IPI00334587.1 Isoform 2 of Heterogeneous nuclear ribonucleoprotein A/B 126 36059 4 4 4 4 1394 542 1 0 1 512.7799 1023.5453 2 1023.5461 -0.0009 1 42.53 0.00084 K VLDQKEHR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1074.1074.2.dta 18 2 IPI00334587.1 Isoform 2 of Heterogeneous nuclear ribonucleoprotein A/B 126 36059 4 4 4 4 1957 4346 1 0 1 584.2897 1166.5648 2 1166.5642 0.0006 0 43.48 9.40E-05 K FGEVVDCTIK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4722.4722.2.dta 18 2 IPI00334587.1 Isoform 2 of Heterogeneous nuclear ribonucleoprotein A/B 126 36059 4 4 4 4 3295 2398 1 0 1 750.3467 1498.6788 2 1498.6801 -0.0013 0 51.65 6.80E-05 K EVYQQQQYGSGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2521.2521.2.dta 18 2 IPI00334587.1 Isoform 2 of Heterogeneous nuclear ribonucleoprotein A/B 126 36059 4 4 4 4 3300 5025 1 0 1 752.3871 1502.7597 2 1502.7617 -0.0019 0 52.41 5.00E-05 K IFVGGLNPEATEEK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5515.5515.2.dta 18 IPI00220683.1 Isoform 2 of Heterogeneous nuclear ribonucleoprotein D0 134 36420 5 5 5 5 903 6993 1 0 1 457.7607 913.5068 2 913.5062 0.0006 0 34.92 0.00082 R GFGFVLFK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.8003.8003.2.dta 18 IPI00220683.1 Isoform 2 of Heterogeneous nuclear ribonucleoprotein D0 134 36420 5 5 5 5 918 2120 1 0 1 459.246 916.4775 2 916.4767 0.0008 0 34.81 0.01 K YHNVGLSK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2216.2216.2.dta 18 IPI00220683.1 Isoform 2 of Heterogeneous nuclear ribonucleoprotein D0 134 36420 5 5 5 5 1957 4346 1 0 1 584.2897 1166.5648 2 1166.5642 0.0006 0 43.48 9.40E-05 K FGEVVDCTLK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4722.4722.2.dta 18 IPI00220683.1 Isoform 2 of Heterogeneous nuclear ribonucleoprotein D0 134 36420 5 5 5 5 3263 4931 1 0 1 744.8812 1487.7479 2 1487.7508 -0.0029 0 73.35 8.70E-07 K IFVGGLSPDTPEEK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5408.5408.2.dta 18 IPI00220683.1 Isoform 2 of Heterogeneous nuclear ribonucleoprotein D0 134 36420 5 5 5 5 4407 4847 1 0 1 586.6531 1756.9376 3 1756.9359 0.0016 1 26.49 0.0033 K IFVGGLSPDTPEEKIR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5312.5312.3.dta 18 IPI00106509.2 Isoform 4 of Heterogeneous nuclear ribonucleoprotein A/B 96 31328 3 3 3 3 1394 542 1 0 1 512.7799 1023.5453 2 1023.5461 -0.0009 1 42.53 0.00084 K VLDQKEHR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1074.1074.2.dta 18 IPI00106509.2 Isoform 4 of Heterogeneous nuclear ribonucleoprotein A/B 96 31328 3 3 3 3 1957 4346 1 0 1 584.2897 1166.5648 2 1166.5642 0.0006 0 43.48 9.40E-05 K FGEVVDCTIK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4722.4722.2.dta 18 IPI00106509.2 Isoform 4 of Heterogeneous nuclear ribonucleoprotein A/B 96 31328 3 3 3 3 3295 2398 1 0 1 750.3467 1498.6788 2 1498.6801 -0.0013 0 51.65 6.80E-05 K EVYQQQQYGSGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2521.2521.2.dta 18 IPI00011274.2 heterogeneous nuclear ribonucleoprotein D-like 62 46580 2 2 2 2 903 6993 1 0 1 457.7607 913.5068 2 913.5062 0.0006 0 34.92 0.00082 R GFGFVLFK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.8003.8003.2.dta 18 IPI00011274.2 heterogeneous nuclear ribonucleoprotein D-like 62 46580 2 2 2 2 1957 4346 1 0 1 584.2897 1166.5648 2 1166.5642 0.0006 0 43.48 9.40E-05 R FGEVVDCTIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4722.4722.2.dta 19 1 IPI00398958.3 similar to 40S ribosomal protein SA 123 32951 4 4 3 3 901 4257 1 1 1 456.7793 911.5441 2 911.544 0.0001 0 41.17 0.00038 R LLVVTDPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4625.4625.2.dta 19 1 IPI00398958.3 similar to 40S ribosomal protein SA 123 32951 4 4 3 3 2151 3542 1 1 1 602.3269 1202.6393 2 1202.6408 -0.0015 0 60.12 6.80E-06 K FAAATGATPIAGR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3844.3844.2.dta 19 1 IPI00398958.3 similar to 40S ribosomal protein SA 123 32951 4 4 3 3 7942 6349 1 1 1 999.4949 2995.4628 3 2995.4709 -0.0081 0 34.44 0.0027 R ADHQPLTEASYVNLPTIALCNTDSPLR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7214.7214.3.dta 19 1 IPI00398958.3 similar to 40S ribosomal protein SA 123 32951 4 4 3 3 7943 6343 1 1 1 999.4974 2995.4705 3 2995.4709 -0.0004 0 43.84 7.70E-05 R ADHQPLTEASYVNLPTIALCNTDSPLR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7205.7205.3.dta 19 IPI00790580.1 16 kDa protein 81 16106 2 2 2 2 901 4257 1 0 1 456.7793 911.5441 2 911.544 0.0001 0 41.17 0.00038 R LLVVTDPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4625.4625.2.dta 19 IPI00790580.1 16 kDa protein 81 16106 2 2 2 2 2151 3542 1 0 1 602.3269 1202.6393 2 1202.6408 -0.0015 0 60.12 6.80E-06 K FAAATGATPIAGR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3844.3844.2.dta 19 IPI00411639.1 Laminin receptor-like protein LAMRL5 60 33089 1 1 1 1 2151 3542 1 0 1 602.3269 1202.6393 2 1202.6408 -0.0015 0 60.12 6.80E-06 K FAAATGATPIAGR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3844.3844.2.dta 19 IPI00399036.1 similar to 40S ribosomal protein SA (p40) (34/67 kDa laminin receptor) (Colon carcinoma laminin-binding protein) (NEM/1CHD4) (Multidrug resistance-associated protein MGr1-Ag) isoform 1 41 33028 1 1 1 1 901 4257 1 0 1 456.7793 911.5441 2 911.544 0.0001 0 41.17 0.00038 R LLVVTDPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4625.4625.2.dta 20 1 IPI00550069.3 Ribonuclease inhibitor 113 51766 2 2 2 2 1908 3399 1 1 1 575.263 1148.5114 2 1148.5132 -0.0017 0 60.76 8.00E-06 R LDDCGLTEAR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3681.3681.2.dta 20 1 IPI00550069.3 Ribonuclease inhibitor 113 51766 2 2 2 2 2164 5459 1 1 1 605.3508 1208.6871 2 1208.6877 -0.0006 0 72.76 2.30E-07 R VNPALAELNLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6042.6042.2.dta 21 1 IPI00011200.5 D-3-phosphoglycerate dehydrogenase 99 57356 2 2 2 2 1202 7609 1 1 1 493.805 985.5955 2 985.596 -0.0005 0 47.8 0.00016 R DLPLLLFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.8770.8770.2.dta 21 1 IPI00011200.5 D-3-phosphoglycerate dehydrogenase 99 57356 2 2 2 2 3261 4189 1 1 1 744.8667 1487.7188 2 1487.7216 -0.0028 0 74.34 5.20E-07 R AGTGVDNVDLEAATR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4551.4551.2.dta 22 1 IPI00021187.4 Isoform 1 of RuvB-like 1 90 50538 4 4 4 4 247 2207 1 1 0 359.6873 717.36 2 717.3592 0.0008 0 31.51 0.031 R GNCVIR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2309.2309.2.dta 22 1 IPI00021187.4 Isoform 1 of RuvB-like 1 90 50538 4 4 4 4 1540 4496 1 1 1 530.2874 1058.5603 2 1058.5608 -0.0005 0 49.79 0.00014 K GLGLDESGLAK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4900.4900.2.dta 22 1 IPI00021187.4 Isoform 1 of RuvB-like 1 90 50538 4 4 4 4 2526 2728 1 1 1 650.8345 1299.6545 2 1299.6531 0.0014 0 49.1 2.50E-05 K QAASGLVGQENAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2883.2883.2.dta 22 1 IPI00021187.4 Isoform 1 of RuvB-like 1 90 50538 4 4 4 4 5865 5926 1 1 1 775.3957 2323.1652 3 2323.1655 -0.0003 0 24.25 0.011 R AQTEGINISEEALNHLGEIGTK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6667.6667.3.dta 22 IPI00788942.1 Isoform 2 of RuvB-like 1 84 42499 3 3 3 3 247 2207 1 0 0 359.6873 717.36 2 717.3592 0.0008 0 31.51 0.031 R GNCVIR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2309.2309.2.dta 22 IPI00788942.1 Isoform 2 of RuvB-like 1 84 42499 3 3 3 3 1540 4496 1 0 1 530.2874 1058.5603 2 1058.5608 -0.0005 0 49.79 0.00014 K GLGLDESGLAK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4900.4900.2.dta 22 IPI00788942.1 Isoform 2 of RuvB-like 1 84 42499 3 3 3 3 2526 2728 1 0 1 650.8345 1299.6545 2 1299.6531 0.0014 0 49.1 2.50E-05 K QAASGLVGQENAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2883.2883.2.dta 22 IPI00798367.1 17 kDa protein 33 17238 2 2 2 2 247 2207 1 0 0 359.6873 717.36 2 717.3592 0.0008 0 31.51 0.031 R GNCVIR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2309.2309.2.dta 22 IPI00798367.1 17 kDa protein 33 17238 2 2 2 2 5865 5926 1 0 1 775.3957 2323.1652 3 2323.1655 -0.0003 0 24.25 0.011 R AQTEGINISEEALNHLGEIGTK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6667.6667.3.dta 23 1 IPI00163187.10 Fascin 89 55123 5 5 5 5 1048 2194 1 1 1 473.7508 945.487 2 945.488 -0.001 0 41.04 0.0011 K VTGTLDANR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2295.2295.2.dta 23 1 IPI00163187.10 Fascin 89 55123 5 5 5 5 1425 2794 1 1 1 344.8276 1031.4609 3 1031.4607 0.0002 0 18.93 0.039 R GEHGFIGCR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2966.2966.3.dta 23 1 IPI00163187.10 Fascin 89 55123 5 5 5 5 2040 3625 1 1 1 595.824 1189.6334 2 1189.6343 -0.0009 0 30.62 0.0025 R YLAPSGPSGTLK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3934.3934.2.dta 23 1 IPI00163187.10 Fascin 89 55123 5 5 5 5 3680 2591 1 1 1 537.9189 1610.7348 3 1610.7359 -0.001 1 29.23 0.002 R YLAADKDGNVTCER E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2733.2733.3.dta 23 1 IPI00163187.10 Fascin 89 55123 5 5 5 5 7076 6655 1 1 1 892.4521 2674.3344 3 2674.3384 -0.004 1 39.89 0.00018 K VGKDELFALEQSCAQVVLQAANER N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7581.7581.3.dta 24 1 IPI00410693.3 Isoform 1 of Plasminogen activator inhibitor 1 RNA-binding protein 82 44995 2 2 2 2 2343 1653 1 1 1 628.3223 1254.6301 2 1254.6317 -0.0015 0 28.82 0.002 R RPDQQLQGEGK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1686.1686.2.dta 24 1 IPI00410693.3 Isoform 1 of Plasminogen activator inhibitor 1 RNA-binding protein 82 44995 2 2 2 2 3169 1456 1 1 1 730.8582 1459.7018 2 1459.7015 0.0003 0 68.82 3.50E-07 K SAAQAAAQTNSNAAGK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1473.1473.2.dta 25 1 IPI00297779.7 T-complex protein 1 subunit beta 80 57794 2 2 2 2 2654 4340 1 1 1 665.8317 1329.6489 2 1329.6524 -0.0035 0 78.98 3.90E-08 R GATQQILDEAER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4716.4716.2.dta 25 1 IPI00297779.7 T-complex protein 1 subunit beta 80 57794 2 2 2 2 5301 6216 1 1 1 699.7126 2096.1161 3 2096.1154 0.0007 0 16.98 0.026 R LALVTGGEIASTFDHPELVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7028.7028.3.dta 26 1 IPI00021405.3 Isoform A of Lamin-A/C 79 74380 6 6 5 5 1157 1900 1 1 1 486.7588 971.503 2 971.5036 -0.0006 0 24.36 0.03 R LSPSPTSQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1961.1961.2.dta 26 1 IPI00021405.3 Isoform A of Lamin-A/C 79 74380 6 6 5 5 1412 4935 1 1 1 514.79 1027.5654 2 1027.5662 -0.0008 0 64.41 6.10E-06 R LADALQELR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5411.5411.2.dta 26 1 IPI00021405.3 Isoform A of Lamin-A/C 79 74380 6 6 5 5 2034 3975 1 1 1 396.5512 1186.6317 3 1186.6306 0.0011 1 23.32 0.017 K LRDLEDSLAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4314.4314.3.dta 26 1 IPI00021405.3 Isoform A of Lamin-A/C 79 74380 6 6 5 5 3297 1574 1 1 1 501.579 1501.7151 3 1501.7161 -0.001 1 15.64 0.041 R AQHEDQVEQYKK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1601.1601.3.dta 26 1 IPI00021405.3 Isoform A of Lamin-A/C 79 74380 6 6 5 5 3340 8034 1 1 1 506.909 1517.7053 3 1517.707 -0.0018 0 23.03 0.024 R ASSHSSQTQGGGSVTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.928.928.3.dta 26 1 IPI00021405.3 Isoform A of Lamin-A/C 79 74380 6 6 5 5 3341 8052 1 1 1 759.8607 1517.7069 2 1517.707 -0.0001 0 21.97 0.0087 R ASSHSSQTQGGGSVTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.930.930.2.dta 27 1 IPI00031420.3 UDP-glucose 6-dehydrogenase 78 55674 2 2 2 2 1603 4823 1 1 1 537.8072 1073.5998 2 1073.5981 0.0017 0 77.5 3.80E-07 K LAANAFLAQR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5280.5280.2.dta 27 1 IPI00031420.3 UDP-glucose 6-dehydrogenase 78 55674 2 2 2 2 5429 8257 1 1 1 734.394 2200.1601 3 2200.1562 0.004 0 23.67 0.024 K DVLNLVYLCEALNLPEVAR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9543.9543.3.dta 28 1 IPI00025815.1 TAR DNA-binding protein 43 76 45053 1 1 1 1 4319 4456 1 1 1 863.8859 1725.7573 2 1725.7608 -0.0035 0 75.65 1.80E-07 R FGGNPGGFGNQGGFGNSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4852.4852.2.dta 29 1 IPI00179452.1 Isoform 1 of Protein CBFA2T2 73 67889 2 2 2 2 1438 4500 1 1 1 518.277 1034.5394 2 1034.5396 -0.0002 0 58.48 3.30E-05 K AFEVIATER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4904.4904.2.dta 29 1 IPI00179452.1 Isoform 1 of Protein CBFA2T2 73 67889 2 2 2 2 2633 2032 1 1 1 663.2822 1324.5498 2 1324.55 -0.0002 0 36.4 0.00088 K ASETCSGCNIAR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2104.2104.2.dta 30 1 IPI00328550.3 Thrombospondin-4 precursor 71 108482 2 2 2 2 1397 4037 1 1 1 513.3035 1024.5924 2 1024.5917 0.0007 0 59.05 5.90E-06 R AVAEPGIQLK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4383.4383.2.dta 30 1 IPI00328550.3 Thrombospondin-4 precursor 71 108482 2 2 2 2 1519 2561 1 1 1 528.2048 1054.395 2 1054.3961 -0.0011 0 28.35 0.0015 R CDSNPCFR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2699.2699.2.dta 30 IPI00028030.3 Cartilage oligomeric matrix protein precursor 59 85402 1 1 1 1 1397 4037 1 0 1 513.3035 1024.5924 2 1024.5917 0.0007 0 59.05 5.90E-06 R AVAEPGIQLK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4383.4383.2.dta 31 1 IPI00012007.6 Adenosylhomocysteinase 71 48255 3 3 3 3 797 5010 1 1 1 442.7817 883.5488 2 883.5491 -0.0003 0 47.63 9.30E-05 R IILLAEGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5499.5499.2.dta 31 1 IPI00012007.6 Adenosylhomocysteinase 71 48255 3 3 3 3 1716 3941 1 1 1 551.7793 1101.544 2 1101.5454 -0.0014 0 21.81 0.038 K WLNENAVEK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4277.4277.2.dta 31 1 IPI00012007.6 Adenosylhomocysteinase 71 48255 3 3 3 3 2863 3246 1 1 1 460.9214 1379.7425 3 1379.7408 0.0017 1 37.88 0.00028 K KLDEAVAEAHLGK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3500.3500.3.dta 32 1 IPI00186290.6 Elongation factor 2 70 96246 2 2 2 2 5437 8294 1 1 1 735.3762 2203.1068 3 2203.1048 0.002 0 35.98 0.00042 K STAISLFYELSENDLNFIK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9587.9587.3.dta 32 1 IPI00186290.6 Elongation factor 2 70 96246 2 2 2 2 5458 7522 1 1 1 740.7235 2219.1487 3 2219.1474 0.0014 0 49.85 2.10E-05 R ALLELQLEPEELYQTFQR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.8668.8668.3.dta 33 1 IPI00061178.1 "RNA binding motif protein, X-linked-like 1" 69 42173 2 2 2 2 1988 2445 1 1 1 589.2399 1176.4652 2 1176.4683 -0.0031 0 40.09 0.00012 R DSYESYGNSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2572.2572.2.dta 33 1 IPI00061178.1 "RNA binding motif protein, X-linked-like 1" 69 42173 2 2 2 2 4842 5854 1 1 1 633.9789 1898.915 3 1898.9163 -0.0013 1 43.07 0.0001 R GFAFVTFESPADAKDAAR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6572.6572.3.dta 33 IPI00643486.1 "RNA binding motif protein, X-linked-like 1" 43 16840 1 1 1 1 4842 5854 1 0 1 633.9789 1898.915 3 1898.9163 -0.0013 1 43.07 0.0001 R GFAFVTFESPADAKDAAR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6572.6572.3.dta 33 IPI00816796.1 "CDNA FLJ38696 fis, clone KIDNE2001931, highly similar to HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN G" 40 40822 1 1 1 1 1988 2445 1 0 1 589.2399 1176.4652 2 1176.4683 -0.0031 0 40.09 0.00012 R DSYESYGNSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2572.2572.2.dta 34 1 IPI00440493.2 "ATP synthase subunit alpha, mitochondrial precursor" 68 59828 2 2 2 2 433 13 1 1 1 395.2139 788.4133 2 788.4141 -0.0008 0 44.16 0.00074 R VGSAAQTR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1002.1002.2.dta 34 1 IPI00440493.2 "ATP synthase subunit alpha, mitochondrial precursor" 68 59828 2 2 2 2 5920 8091 1 1 1 780.0611 2337.1615 3 2337.1601 0.0014 0 43.35 8.90E-05 R EVAAFAQFGSDLDAATQQLLSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9343.9343.3.dta 34 IPI00791358.1 14 kDa protein 43 14606 1 1 1 1 5920 8091 1 0 1 780.0611 2337.1615 3 2337.1601 0.0014 0 43.35 8.90E-05 R EVAAFAQFGSDLDAATQQLLSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9343.9343.3.dta 35 1 IPI00334775.6 85 kDa protein 59 85104 3 3 3 3 277 4101 1 1 0 365.7269 729.4392 2 729.4385 0.0008 0 41.22 0.0019 R LSELLR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4455.4455.2.dta 35 1 IPI00334775.6 85 kDa protein 59 85104 3 3 3 3 577 5973 1 1 1 415.268 828.5215 2 828.5221 -0.0006 0 40.11 0.00075 R ALLFIPR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6723.6723.2.dta 35 1 IPI00334775.6 85 kDa protein 59 85104 3 3 3 3 5163 4377 1 1 1 672.3516 2014.033 3 2014.0371 -0.004 1 18.96 0.02 K VILHLKEDQTEYLEER R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4755.4755.3.dta 35 IPI00382470.3 Heat shock protein HSP 90-alpha 2 40 98670 2 2 2 2 277 4101 1 0 0 365.7269 729.4392 2 729.4385 0.0008 0 41.22 0.0019 K LSELLR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4455.4455.2.dta 35 IPI00382470.3 Heat shock protein HSP 90-alpha 2 40 98670 2 2 2 2 5163 4377 1 0 1 672.3516 2014.033 3 2014.0371 -0.004 1 18.96 0.02 K VILHLKEDQTEYLEER R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4755.4755.3.dta 36 1 IPI00032406.1 DnaJ homolog subfamily A member 2 58 46344 1 1 1 1 2678 2651 1 1 1 669.2985 1336.5825 2 1336.5864 -0.0039 0 58.06 3.60E-06 K NVLCSACSGQGGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2798.2798.2.dta 37 1 IPI00021435.3 26S protease regulatory subunit 7 55 49002 1 1 1 1 4441 7621 1 1 1 884.4423 1766.87 2 1766.8662 0.0038 0 55.25 6.60E-06 K ACLIFFDEIDAIGGAR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.8783.8783.2.dta 38 1 IPI00183526.5 NCL protein 54 51667 2 2 2 2 2050 1368 1 1 1 596.8113 1191.6081 2 1191.6095 -0.0014 1 41.38 0.0014 R IVTDRETGSSK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1377.1377.2.dta 38 1 IPI00183526.5 NCL protein 54 51667 2 2 2 2 6509 7724 1 1 1 834.4268 2500.2584 3 2500.2584 0 0 31.88 0.001 K TLVLSNLSYSATEETLQEVFEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.8911.8911.3.dta 39 1 IPI00299000.5 Proliferation-associated protein 2G4 53 44101 1 1 1 1 1193 4864 1 1 1 492.7428 983.471 2 983.4712 -0.0003 0 52.6 7.30E-05 R AFFSEVER R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5330.5330.2.dta 40 1 IPI00291510.3 Inosine-5~-monophosphate dehydrogenase 2 50 56226 1 1 1 1 1927 2254 1 1 1 579.8078 1157.601 2 1157.6041 -0.003 0 50.32 3.40E-05 K VAQGVSGAVQDK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2360.2360.2.dta 41 1 IPI00304596.3 Non-POU domain-containing octamer-binding protein 47 54311 2 2 2 2 800 3419 1 1 0 443.7534 885.4922 2 885.492 0.0002 0 34.62 0.006 R AVVIVDDR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3702.3702.2.dta 41 1 IPI00304596.3 Non-POU domain-containing octamer-binding protein 47 54311 2 2 2 2 1653 8239 1 1 1 543.7744 1085.5343 2 1085.5366 -0.0023 1 34.47 0.0014 K NQQFHKER E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.952.952.2.dta 41 2 IPI00010740.1 "Isoform Long of Splicing factor, proline- and glutamine-rich" 32 76216 2 2 2 2 800 3419 1 0 0 443.7534 885.4922 2 885.492 0.0002 0 34.62 0.006 R AVVIVDDR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3702.3702.2.dta 41 2 IPI00010740.1 "Isoform Long of Splicing factor, proline- and glutamine-rich" 32 76216 2 2 2 2 6952 8030 1 0 1 880.4383 2638.2931 3 2638.2915 0.0016 0 16.94 0.031 R NLSPYVSNELLEEAFSQFGPIER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9275.9275.3.dta 41 IPI00645966.1 24 kDa protein 35 23715 1 1 1 1 800 3419 1 0 0 443.7534 885.4922 2 885.492 0.0002 0 34.62 0.006 R AVVIVDDR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3702.3702.2.dta 42 1 IPI00185374.4 26S proteasome non-ATPase regulatory subunit 12 46 53270 1 1 1 1 3332 7550 1 1 1 757.9376 1513.8606 2 1513.8603 0.0003 0 46.06 0.00019 R LQEVIETLLSLEK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.8698.8698.2.dta 43 1 IPI00550746.4 Nuclear migration protein nudC 46 38276 2 2 2 2 974 834 1 1 1 465.2559 928.4972 2 928.4978 -0.0006 1 16.13 0.033 K KINPENSK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1119.1119.2.dta 43 1 IPI00550746.4 Nuclear migration protein nudC 46 38276 2 2 2 2 2144 2998 1 1 1 601.8165 1201.6184 2 1201.619 -0.0006 0 48.4 0.00015 R LVSSDPEINTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3194.3194.2.dta 44 1 IPI00021885.1 Isoform 1 of Fibrinogen alpha chain precursor 45 95656 1 1 1 1 404 2809 1 1 1 391.1971 780.3796 2 780.3766 0.003 0 44.55 0.00061 R GADYSLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2986.2986.2.dta 45 1 IPI00030320.4 Probable ATP-dependent RNA helicase DDX6 44 54781 2 2 2 2 2246 6759 1 1 1 616.356 1230.6974 2 1230.6972 0.0002 0 40.84 0.00016 K SGAYLIPLLER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7707.7707.2.dta 45 1 IPI00030320.4 Probable ATP-dependent RNA helicase DDX6 44 54781 2 2 2 2 5094 4150 1 1 1 664.6463 1990.9171 3 1990.916 0.0011 0 17.51 0.023 K SLYVAEYHSEPVEDEKP - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4507.4507.3.dta 46 1 IPI00303476.1 "ATP synthase subunit beta, mitochondrial precursor" 43 56525 1 1 1 1 3163 7924 1 1 1 729.4241 1456.8337 2 1456.8323 0.0014 0 42.69 9.90E-05 K TVLIMELINNVAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9142.9142.2.dta 47 1 IPI00033025.8 Isoform 1 of Septin-7 43 51062 2 2 1 1 1600 1899 1 1 1 537.78 1073.5455 2 1073.5465 -0.001 0 30.05 0.0056 R ILEQQNSSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1960.1960.2.dta 47 1 IPI00033025.8 Isoform 1 of Septin-7 43 51062 2 2 1 1 1601 1913 1 1 1 537.7803 1073.5461 2 1073.5465 -0.0004 0 34.47 0.0047 R ILEQQNSSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1975.1975.2.dta 48 1 IPI00031461.1 Rab GDP dissociation inhibitor beta 41 51087 2 2 2 2 5371 8069 1 1 1 717.7006 2150.08 3 2150.0797 0.0004 0 36.35 0.0027 K FDLGQDVIDFTGHALALYR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9319.9319.3.dta 48 1 IPI00031461.1 Rab GDP dissociation inhibitor beta 41 51087 2 2 2 2 6147 8201 1 1 1 795.4174 2383.2304 3 2383.2345 -0.004 1 22.84 0.0079 K IYKVPSTEAEALASSLMGLFEK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9474.9474.3.dta 48 IPI00010154.3 Rab GDP dissociation inhibitor alpha 36 51177 1 1 1 1 5371 8069 1 0 1 717.7006 2150.08 3 2150.0797 0.0004 0 36.35 0.0027 K FDLGQDVIDFTGHALALYR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9319.9319.3.dta 48 IPI00513829.1 GDP dissociation inhibitor 2 23 16866 1 1 1 1 6147 8201 1 0 1 795.4174 2383.2304 3 2383.2345 -0.004 1 22.84 0.0079 K IYKVPSTEAEALASSLMGLFEK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9474.9474.3.dta 49 1 IPI00297452.5 TRK-fused gene/anaplastic large cell lymphoma kinase extra long form 40 89413 1 1 1 1 678 2451 1 1 1 425.7297 849.4449 2 849.4444 0.0006 0 39.94 0.0011 K TSSISDLK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2579.2579.2.dta 50 1 IPI00024714.1 Isoform 1 of Regulator of G-protein signaling 12 38 157800 1 1 1 1 206 2358 1 1 1 351.1935 700.3724 2 700.3755 -0.0032 0 38.3 0.003 R SSVPPSK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2476.2476.2.dta 51 1 IPI00643920.2 Transketolase 37 68519 2 2 2 2 1181 2361 1 1 1 489.7896 977.5647 2 977.5658 -0.0011 0 21.57 0.0095 K HQPTAIIAK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2479.2479.2.dta 51 1 IPI00643920.2 Transketolase 37 68519 2 2 2 2 5182 8436 1 1 1 675.0102 2022.0088 3 2022.0091 -0.0004 0 29.56 0.0017 K NMAEQIIQEIYSQIQSK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9769.9769.3.dta 52 1 IPI00033034.1 Alpha-ketoglutarate dehydrogenase complex dihydrolipoyl succinyltransferase 37 48961 1 1 1 1 2053 1708 1 1 1 596.8374 1191.6603 2 1191.6611 -0.0009 0 36.87 0.00035 K AKPAEAPAAAAPK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1746.1746.2.dta 53 1 IPI00375441.2 Isoform 1 of Far upstream element-binding protein 1 36 67690 1 1 1 1 992 1303 1 1 1 467.2408 932.4671 2 932.4675 -0.0005 0 36.35 0.0048 K SISQQSGAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1306.1306.2.dta 54 1 IPI00290791.1 Isoform A of Caspase-10 precursor 36 59597 2 2 1 1 946 1411 1 1 1 308.8469 923.5189 3 923.515 0.0039 1 26.07 0.027 R MLKFLEK T Oxidation (M) 0.1000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1424.1424.3.dta 54 1 IPI00290791.1 Isoform A of Caspase-10 precursor 36 59597 2 2 1 1 949 1418 1 0 1 462.7679 923.5213 2 923.515 0.0063 1 33.68 0.0059 R MLKFLEK T Oxidation (M) 0.1000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1431.1431.2.dta 55 1 IPI00216106.3 Isoform 3 of Putative GTP-binding protein 9 36 31649 1 1 1 1 3489 8048 1 1 1 784.9733 1567.9321 2 1567.9338 -0.0017 0 36.08 0.00073 K IPAFLNVVDIAGLVK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9294.9294.2.dta 56 1 IPI00012535.1 DnaJ homolog subfamily A member 1 35 45581 2 2 2 2 2209 1783 1 1 1 611.7416 1221.4687 2 1221.4689 -0.0002 0 31.69 0.00068 K GAVECCPNCR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1835.1835.2.dta 56 1 IPI00012535.1 DnaJ homolog subfamily A member 1 35 45581 2 2 2 2 2327 1927 1 1 1 625.7837 1249.5528 2 1249.5543 -0.0015 1 17.15 0.025 K NVICDKCEGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1990.1990.2.dta 57 1 IPI00007068.1 actin-related protein 3-beta isoform 1 34 48090 1 1 1 1 2963 201 1 1 1 705.3934 1408.7723 2 1408.7714 0.0009 0 34.07 0.0011 R DITYFIQQLLR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.10281.10281.2.dta 58 1 IPI00549822.3 Isoform 5 of Obscurin 33 479836 2 2 2 2 550 2603 1 1 1 410.7416 819.4687 2 819.4702 -0.0015 0 20.32 0.035 R TSATLTVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2746.2746.2.dta 58 1 IPI00549822.3 Isoform 5 of Obscurin 33 479836 2 2 2 2 784 3439 1 1 1 439.7447 877.4748 2 877.4691 0.0057 0 33.29 0.005 R TSAMLTVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3724.3724.2.dta 59 1 IPI00332362.6 Protein FAM86B1 32 13596 1 1 1 1 933 3377 1 1 1 461.747 921.4795 2 921.4767 0.0028 0 31.99 0.0036 K SSGGSVTLSK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3655.3655.2.dta 60 1 IPI00028307.3 "CDNA: FLJ22346 fis, clone HRC06158" 32 142631 1 1 1 1 760 2427 1 1 1 436.7632 871.5119 2 871.5127 -0.0008 1 31.98 0.012 K KLQENLK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2553.2553.2.dta 61 1 IPI00220644.8 Isoform M1 of Pyruvate kinase isozymes M1/M2 32 58538 1 1 1 1 4692 8536 1 1 1 620.6381 1858.8925 3 1858.8924 0.0001 0 31.88 0.001 K FGVEQDVDMVFASFIR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9900.9900.3.dta 62 1 IPI00009104.7 RuvB-like 2 31 51296 1 1 1 1 2617 3292 1 1 1 660.8158 1319.617 2 1319.618 -0.001 0 31.14 0.0044 K FVQCPDGELQK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3559.3559.2.dta 63 1 IPI00396378.3 Isoform B1 of Heterogeneous nuclear ribonucleoproteins A2/B1 31 37464 1 1 1 1 2848 3870 1 1 1 689.3172 1376.6198 2 1376.6222 -0.0023 0 30.98 0.0014 R GGGGNFGPGPGSNFR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4202.4202.2.dta 64 1 IPI00010720.1 T-complex protein 1 subunit epsilon 31 60089 1 1 1 1 4353 7862 1 1 1 869.9781 1737.9417 2 1737.9414 0.0004 0 30.96 0.0012 R WVGGPEIELIAIATGGR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9074.9074.2.dta 65 1 IPI00386208.1 Gastric-associated differentially-expressed protein YA61P 31 14858 1 1 1 1 3003 3917 1 1 1 710.8751 1419.7356 2 1419.7358 -0.0002 0 30.6 0.0013 R AAAYNIVPSSTGAAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4253.4253.2.dta 66 1 IPI00827581.1 Variable immnoglobulin anti-estradiol heavy chain (Fragment) 30 14027 1 1 1 1 900 5005 1 1 1 456.7233 911.4321 2 911.4323 -0.0002 0 30.32 0.0094 R YAMSWVR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5493.5493.2.dta 67 1 IPI00384734.1 Butyrophilin 29 82036 1 1 1 1 486 3199 1 1 1 403.215 804.4155 2 804.4164 -0.0008 0 29.46 0.032 K EMIGLSR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3438.3438.2.dta 68 1 IPI00647650.3 Eukaryotic translation initiation factor 3 subunit 3 29 41726 1 1 1 1 4403 982 1 1 1 585.9499 1754.8278 3 1754.8282 -0.0004 1 28.94 0.0019 R KEGTGSTATSSSSTAGAAGK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1138.1138.3.dta 69 1 IPI00745628.1 hypothetical protein 28 38367 1 1 1 1 2588 3833 1 1 1 657.8073 1313.6 2 1313.5921 0.0078 0 28.04 0.015 K GMEEIYNLSSR K Oxidation (M) 0.01000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4161.4161.2.dta 70 1 IPI00290460.3 Eukaryotic translation initiation factor 3 subunit 4 28 35874 1 1 1 1 1423 1496 1 1 1 516.2642 1030.5138 2 1030.5155 -0.0018 1 27.79 0.045 R RADDNATIR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1517.1517.2.dta 71 1 IPI00062206.1 DDX39 protein 28 35528 1 1 1 1 879 4939 1 1 1 453.7375 905.4604 2 905.4607 -0.0003 0 27.77 0.033 R DVQEIFR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5419.5419.2.dta 72 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 27 71082 1 1 1 1 4138 3228 1 1 1 564.5804 1690.7195 3 1690.7183 0.0012 0 27.38 0.0075 K STAGDTHLGGEDFDNR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3472.3472.3.dta 73 1 IPI00159072.3 ROD1 regulator of differentiation 1 27 57071 1 1 1 1 392 3243 1 1 1 387.7397 773.4649 2 773.4647 0.0003 0 27.2 0.033 K LTSLNVK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3492.3492.2.dta 74 1 IPI00018522.3 Isoform 1 of Protein arginine N-methyltransferase 1 27 42029 1 1 1 1 4317 4421 1 1 1 575.6019 1723.7838 3 1723.7842 -0.0004 0 26.95 0.024 R TGFSTSPESPYTHWK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4812.4812.3.dta 75 1 IPI00177381.7 hypothetical protein LOC57703 27 105972 1 1 1 1 475 2482 1 1 1 400.7346 799.4546 2 799.4552 -0.0006 0 26.61 0.038 K LTQVSPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2612.2612.2.dta 76 1 IPI00827931.1 HRV Fab 025-VH (Fragment) 26 13017 1 1 1 1 452 2060 1 1 1 397.7295 793.4444 2 793.4446 -0.0003 1 26.3 0.023 K GRFTVSK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2137.2137.2.dta 77 1 IPI00107357.6 Isoform 2 of Cleft lip and palate transmembrane protein 1 26 79791 1 1 1 1 976 4426 1 1 1 465.7477 929.4808 2 929.4753 0.0055 0 26.01 0.024 R LATVHMSR M Oxidation (M) 0.00000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4818.4818.2.dta 78 1 IPI00296374.3 Isoform 1 of Zinc finger protein-like 1 25 34833 1 1 1 1 5100 6800 1 1 1 665.9795 1994.9166 3 1994.9131 0.0035 0 25.33 0.0052 R LVCYDLFHWACLNER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7759.7759.3.dta 79 1 IPI00103744.1 Isoform 1 of Polycystic kidney disease 2-like 1 protein 24 92608 1 1 1 1 853 1695 1 1 1 451.7514 901.4883 2 901.4869 0.0014 0 23.99 0.016 R SIVSSPQGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1732.1732.2.dta 80 1 IPI00514533.1 145 kDa nucleolar protein 24 94068 1 1 1 1 1247 1921 1 1 1 498.2852 994.5559 2 994.5521 0.0038 0 23.85 0.041 K KPMIISYK E Oxidation (M) 0.00100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1984.1984.2.dta 81 1 IPI00168235.4 "CDNA FLJ33352 fis, clone BRACE2005087, weakly similar to PRE-MRNA SPLICING HELICASE BRR2" 24 71883 1 1 1 1 1254 3369 1 1 1 498.7498 995.485 2 995.4924 -0.0073 1 23.81 0.042 K KITDYGGDK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3646.3646.2.dta 82 1 IPI00020042.2 Isoform 1 of 26S protease regulatory subunit 6B 24 47451 2 2 1 1 5002 21 1 1 1 972.5184 1943.0223 2 1943.0251 -0.0028 0 19.4 0.015 K ENAPAIIFIDEIDAIATK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.10032.10032.2.dta 82 1 IPI00020042.2 Isoform 1 of 26S protease regulatory subunit 6B 24 47451 2 2 1 1 5003 16 1 1 1 648.6814 1943.0224 3 1943.0251 -0.0028 0 18.23 0.019 K ENAPAIIFIDEIDAIATK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.10023.10023.3.dta 83 1 IPI00008455.1 Isoform 2 of Myosin-VI 23 147324 1 1 1 1 517 1667 1 1 1 405.7508 809.487 2 809.4872 -0.0001 1 22.86 0.026 K SKLAVHR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1702.1702.2.dta 84 1 IPI00427501.1 Isoform 1 of GH3 domain-containing protein precursor 23 58058 1 1 1 1 555 2722 1 1 1 411.747 821.4795 2 821.4759 0.0036 0 22.78 0.042 R NHLPLTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2877.2877.2.dta 85 1 IPI00217223.1 Multifunctional protein ADE2 23 50389 2 2 2 2 1357 2030 1 1 1 508.7589 1015.5032 2 1015.5047 -0.0014 0 27.15 0.048 K DQITAGNAAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2102.2102.2.dta 85 1 IPI00217223.1 Multifunctional protein ADE2 23 50389 2 2 2 2 4374 7771 1 1 1 582.6578 1744.9517 3 1744.9512 0.0005 1 15.11 0.038 K NFEWVAERVELLLK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.8970.8970.3.dta 86 1 IPI00014235.2 Similar to RAB3 GTPase-activating protein 23 112355 2 2 1 1 2114 6877 1 1 1 601.8115 1201.6084 2 1201.6125 -0.0041 0 19.49 0.041 K LSVSNMVHTAK K Oxidation (M) 0.00000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7851.7851.2.dta 86 1 IPI00014235.2 Similar to RAB3 GTPase-activating protein 23 112355 2 2 1 1 2117 1101 1 1 1 601.8116 1201.6087 2 1201.6125 -0.0038 0 20.57 0.025 K LSVSNMVHTAK K Oxidation (M) 0.00000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.11529.11529.2.dta 87 1 IPI00297641.1 "Keratin, type I cuticular Ha8" 22 52054 1 1 1 1 2810 4116 1 0 1 455.9087 1364.7043 3 1364.7048 -0.0005 1 21.96 0.0094 K TRLENEIATYR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4471.4471.3.dta 88 1 IPI00103373.1 Cytoglobin 22 21505 1 1 1 1 2596 4599 1 1 1 658.8313 1315.648 2 1315.6442 0.0039 1 21.77 0.0091 M EKVPGEMEIER R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5017.5017.2.dta 89 1 IPI00176903.2 Isoform 1 of Polymerase I and transcript release factor 22 43450 1 1 1 1 1763 7967 1 1 1 558.7855 1115.5565 2 1115.5571 -0.0006 0 21.57 0.0095 K AHATTSNTVSK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.919.919.2.dta 90 1 IPI00158804.1 "basic, immunoglobulin-like variable motif containing" 21 57479 1 1 1 1 1969 4639 1 1 1 586.3039 1170.5932 2 1170.588 0.0052 0 21.4 0.033 K SPEENLQGAVK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5066.5066.2.dta 91 1 IPI00736788.2 Hypothetical protein DKFZp781G0119 21 78184 1 1 1 1 367 3179 1 1 1 384.2368 766.4591 2 766.4589 0.0003 0 20.74 0.02 R LPAPELK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.3416.3416.2.dta 92 1 IPI00550689.3 UPF0027 protein C22orf28 21 55688 1 1 1 1 5364 8483 1 1 1 716.3773 2146.1099 3 2146.1092 0.0007 1 20.65 0.047 R NLDFQDVLDKLADMGIAIR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9835.9835.3.dta 93 1 IPI00102864.3 Hexokinase-2 20 103739 1 1 1 1 1297 4838 1 1 1 503.2372 1004.4599 2 1004.4662 -0.0063 0 20.27 0.029 K DISDIEGEK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5300.5300.2.dta 94 1 IPI00175647.2 Intraflagellar transport 80 homolog 20 88649 1 1 1 1 1064 1659 1 1 1 317.5151 949.5236 3 949.5233 0.0003 0 19.83 0.032 K NFQVTLTK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1693.1693.3.dta 95 1 IPI00646361.2 KIAA0023 protein 19 216425 1 1 1 1 3020 1245 1 1 1 475.8843 1424.6311 3 1424.6367 -0.0057 1 19.48 0.015 R HARESECPHFR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1244.1244.3.dta 96 1 IPI00012336.2 Isoform 1 of Zinc finger X-chromosomal protein 19 92288 1 1 1 1 8565 6491 1 1 1 1148.5693 3442.6862 3 3442.6948 -0.0086 1 19.28 0.023 R RPDSRQYQTAIIIGPDGHPLTVYPCMICGK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7393.7393.3.dta 97 1 IPI00025792.2 Isoform 1 of Transcription initiation protein SPT3 homolog 19 44619 1 1 1 1 3119 6472 1 1 1 723.9047 1445.7949 2 1445.7952 -0.0003 0 19.01 0.021 R VITPEDLLFLMR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.7367.7367.2.dta 98 1 IPI00394857.1 EF-hand calcium-binding domain-containing protein 5 18 133429 1 1 1 1 2048 2412 1 1 1 397.8761 1190.6064 3 1190.6004 0.006 1 18.28 0.03 R RVSVSEQGSSR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2537.2537.3.dta 99 1 IPI00418790.2 echinoderm microtubule associated protein like 5 18 211631 1 1 1 1 4066 5555 1 1 1 838.4529 1674.8912 2 1674.9015 -0.0102 1 17.62 0.023 K MNPYVPDKLITAGIK H Oxidation (M) 0.100000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.6162.6162.2.dta 100 1 IPI00374686.4 29 kDa protein 18 29372 1 1 1 1 2862 2439 1 1 1 460.9203 1379.7391 3 1379.7409 -0.0018 0 17.51 0.023 R EDSVKPGAHLTVK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.2566.2566.3.dta 101 1 IPI00016570.2 Isoform 3 of Bromodomain-containing protein 8 17 81588 1 1 1 1 4042 4271 1 1 1 557.2973 1668.8701 3 1668.8683 0.0018 1 16.66 0.027 R SGVAEAPVGSKAPSIDGK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4640.4640.3.dta 102 1 IPI00102936.3 Isoform 2 of Signal recognition particle 68 kDa protein 16 67775 1 1 1 1 6084 4634 1 1 1 594.2747 2373.0698 4 2373.0477 0.0221 1 16.29 0.048 - MAAEKQVPGGGGGGGSGGGGGSGGGGSGGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5060.5060.4.dta 103 1 IPI00028611.1 COUP transcription factor 2 16 46454 1 1 1 1 1669 1902 1 1 1 545.7673 1089.52 2 1089.5203 -0.0003 0 16.12 0.031 R SQYPNQPTR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1963.1963.2.dta 104 1 IPI00643049.1 "Family with sequence similarity 46, member A" 16 9830 1 1 1 1 942 80 1 1 1 462.7239 923.4333 2 923.4349 -0.0015 0 16.12 0.046 - GQDSGLGYK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1012.1012.2.dta 105 1 IPI00298949.1 Cyclin G-associated kinase 16 144583 1 1 1 1 4355 6196 1 1 1 580.9667 1739.8782 3 1739.8916 -0.0135 0 15.86 0.044 R WTPVGMADLVAPEQVK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.700.700.3.dta 106 1 IPI00001580.4 Isoform 1 of FYVE and coiled-coil domain-containing protein 1 16 168562 1 1 1 1 5840 4773 1 1 1 773.3917 2317.1533 3 2317.1584 -0.005 1 15.81 0.04 R ANTDTAELGIQVCALTVEKER V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.5219.5219.3.dta 107 1 IPI00018465.1 T-complex protein 1 subunit eta 16 59842 1 1 1 1 7020 8263 1 1 1 886.1388 2655.3946 3 2655.3901 0.0044 1 15.62 0.043 R INALTAASEAACLIVSVDETIKNPR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9550.9550.3.dta 108 1 IPI00219525.10 "6-phosphogluconate dehydrogenase, decarboxylating" 15 53619 1 1 1 1 5774 7853 1 1 1 770.7181 2309.1326 3 2309.1328 -0.0002 1 15.34 0.044 K DAFDRNPELQNLLLDDFFK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9063.9063.3.dta 109 1 IPI00007756.1 Ras-related protein Rab-22A 15 22069 1 1 1 1 2972 1345 1 1 1 471.5883 1411.743 3 1411.7419 0.0011 1 15.11 0.038 R RIPSTDANLPSGGK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1352.1352.3.dta 110 1 IPI00642672.1 Zinc finger protein 57 homolog (Fragment) 15 53238 1 1 1 1 1061 1527 1 1 1 475.7233 949.4321 2 949.4366 -0.0045 0 15.05 0.045 K HGGDQSPPR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1550.1550.2.dta 111 1 IPI00740057.2 similar to Ankyrin repeat domain-containing protein 11 15 212794 1 1 1 1 7387 8579 1 1 1 922.7759 2765.3058 3 2765.331 -0.0252 1 15 0.039 K KGGNVNQPSYAGWTALHEASVGGFYR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.9959.9959.3.dta 112 1 IPI00103142.1 NudC domain-containing protein 2 15 17836 1 1 1 1 1188 1246 1 1 1 491.7203 981.4261 2 981.4226 0.0036 0 14.66 0.042 - MSAPFEER S Oxidation (M) 0.10000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.1245.1245.2.dta 113 1 IPI00413170.7 FAM98C protein 14 29196 1 1 1 1 2185 4535 1 1 1 608.8018 1215.589 2 1215.5918 -0.0028 0 13.95 0.049 R AEVLMGNVPDR G Oxidation (M) 0.00001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-5.4946.4946.2.dta