Header -------------------------------------------------------- Search title orb_160921_AE-MF-2_#5-1.raw Timestamp 2016-09-28T01:29:47Z User lu-31 Email Report URI http://mascot.bioreg.kyushu-u.ac.jp/mascot/cgi/master_results.pl?file=D:/2016/20160928/F073891.dat Peak list data path D:\data\oda\160921_AE-MF-2\orb_160921_AE-MF-2_#5-1.raw Peak list format Mascot generic Search type MIS Mascot version 2.5.1 Database ipi_HUM_NEW Fasta file ipi_HUM_NEW_3.26.fasta Total sequences 67667 Total residues 28462731 Sequences after taxonomy filter 67667 Number of queries 8531 Fixed modifications -------------------------------------------------------- Identifier Name Delta Neutral loss 1 Carbamidomethyl (C) 57.021464 Variable modifications -------------------------------------------------------- Identifier Name Delta Neutral loss(es) 1 Oxidation (M) 15.994915 0 63.998285 Search Parameters -------------------------------------------------------- Taxonomy filter All entries Enzyme Trypsin Maximum Missed Cleavages 1 Fixed modifications Carbamidomethyl (C) Variable modifications Oxidation (M) Peptide Mass Tolerance 10 Peptide Mass Tolerance Units ppm Fragment Mass Tolerance 0.8 Fragment Mass Tolerance Units Da Mass values Monoisotopic Instrument type ESI-TRAP Format parameters -------------------------------------------------------- Significance threshold 0.05 Max. number of hits 0 Min. number of sig. unique sequences 1 Use MudPIT protein scoring 1 Ions score cut-off -1 Include same-set proteins 0 Include sub-set proteins 1 Include unassigned 0 Require bold red 0 Use homology threshold 1 Group protein families 1 Show duplicate peptides 1 Protein hits -------------------------------------------------------- prot_hit_num prot_family_member prot_acc prot_desc prot_score prot_mass prot_matches prot_matches_sig prot_sequences prot_sequences_sig pep_query pep_index pep_rank pep_isbold pep_isunique pep_exp_mz pep_exp_mr pep_exp_z pep_calc_mr pep_delta pep_miss pep_score pep_expect pep_res_before pep_seq pep_res_after pep_var_mod pep_var_mod_pos pep_summed_mod_pos pep_local_mod_pos pep_scan_title 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 21 2186 3 1 1 300.6952 599.3758 2 599.3755 0.0003 0 28 0.046 R LAQLR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2949.2949.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 732 2554 1 1 1 398.2021 794.3896 2 794.3922 -0.0027 0 16.01 0.031 R TEYNLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3350.3350.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 1084 2860 1 1 1 426.7141 851.4137 2 851.4137 0 0 31.59 0.0018 R SALDQYR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3698.3698.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 1128 2816 1 1 1 432.7325 863.4505 2 863.4501 0.0004 0 41.8 0.0017 K FAEQTLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3647.3647.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 1287 4951 1 1 1 447.7286 893.4427 2 893.4429 -0.0002 0 31.22 0.019 R LCFEGLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5963.5963.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 1336 6050 1 1 1 451.2895 900.5644 2 900.5644 0 0 65.92 1.20E-06 R SSIAGLLLK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7062.7062.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 1415 2356 1 1 1 455.7955 909.5764 2 909.576 0.0004 0 36.05 0.00062 K AVVQLKPR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3133.3133.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 1437 4196 1 1 1 458.2663 914.5181 2 914.5185 -0.0004 0 70.76 2.40E-06 K GLLSAEVAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5153.5153.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 1442 5820 1 1 1 458.2741 914.5336 2 914.5338 -0.0002 0 37.42 0.002 K LLLWSQR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6831.6831.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 1606 4133 1 1 1 470.2518 938.4891 2 938.4895 -0.0004 0 26.19 0.025 R LSVYQAMK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5084.5084.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 1725 1784 1 1 1 479.2592 956.5039 2 956.5039 0 0 60.57 1.60E-05 R AQAEQAALR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2514.2514.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 1740 2240 1 1 1 479.7715 957.5284 2 957.5284 0 0 30.67 0.022 R LYVHEAVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3008.3008.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 1822 5985 1 1 1 484.2535 966.4924 2 966.4923 0.0001 0 34.14 0.0073 R SWSLATFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6998.6998.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 1880 4423 1 1 1 488.2584 974.5022 2 974.5033 -0.0011 0 43.98 0.00056 K DLSELGSVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5398.5398.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 2018 5412 1 1 1 497.2899 992.5653 2 992.5655 -0.0002 0 67.44 1.30E-06 R LSYTQLLR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6428.6428.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 2077 3531 1 1 1 500.7657 999.5169 2 999.5172 -0.0002 0 44.08 7.40E-05 R VPLDVACAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4433.4433.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 2094 2686 1 1 1 501.7642 1001.5138 2 1001.5141 -0.0003 0 47.23 3.70E-05 R QAEVELASR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3493.3493.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 2318 2540 1 1 1 515.7978 1029.581 2 1029.5818 -0.0008 1 51.76 0.00012 R LTVDEAVRK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3335.3335.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 2323 2433 1 1 1 516.2909 1030.5672 2 1030.5658 0.0014 0 61.12 2.00E-05 R LLEAAAQSTK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3217.3217.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 2397 4086 1 1 1 521.7981 1041.5816 2 1041.5818 -0.0002 0 68.33 2.00E-06 R LAAEQELIR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5034.5034.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 2433 3217 1 1 1 523.7836 1045.5527 2 1045.5556 -0.0029 0 40.55 0.00016 R VPVDVAYQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4092.4092.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 2521 1187 1 1 1 353.8647 1058.5724 3 1058.572 0.0004 1 40.37 0.001 R LKAEATEAAR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1867.1867.3.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 2570 920 1 1 1 533.7855 1065.5564 2 1065.5567 -0.0003 0 33.85 0.0019 R QLAEAHAQAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1578.1578.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 2571 5795 1 1 1 533.8021 1065.5897 2 1065.5892 0.0005 0 36.75 0.00036 K LISLFQAMK K Oxidation (M) 0.000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6807.6807.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 2823 4352 1 1 1 549.7372 1097.4598 2 1097.46 -0.0002 0 37.34 0.00076 K AFCGFEDPR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5321.5321.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 2838 4063 1 1 1 550.7877 1099.5609 2 1099.5622 -0.0013 0 62.24 1.30E-05 R GGAEGELQALR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5009.5009.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 2844 1341 1 1 1 551.2849 1100.5553 2 1100.5574 -0.0021 0 65.16 6.60E-06 R QLAEGTAQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2034.2034.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 2923 1364 1 1 1 557.309 1112.6035 2 1112.605 -0.0015 1 33.49 0.0088 R RAQAEQAALR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2059.2059.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 2971 1592 1 1 1 559.7931 1117.5716 2 1117.5727 -0.0011 1 54.4 6.30E-05 R SAEAELQSKR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2306.2306.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 2972 5378 1 1 1 559.7977 1117.5808 2 1117.5801 0.0007 0 58.22 4.00E-05 K QITMEELVR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6393.6393.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 2979 3248 1 1 1 560.2769 1118.5393 2 1118.539 0.0003 0 47.49 0.00038 R LQLEACETR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4126.4126.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 3001 2986 1 1 1 374.5644 1120.6713 3 1120.6717 -0.0003 1 25.87 0.011 K GLILKDHGIR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3836.3836.3.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 3061 4568 1 1 1 565.3021 1128.5897 2 1128.5887 0.001 0 42.7 0.00076 R NLVDNITGQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5555.5555.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 3079 4108 1 1 1 566.7397 1131.4648 2 1131.4655 -0.0007 0 30.19 0.0025 R GYFSEEMNR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5057.5057.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 3097 3604 1 1 1 567.7937 1133.5729 2 1133.575 -0.0022 0 24.14 0.0083 K QITMEELVR S Oxidation (M) 0.000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4512.4512.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 3165 2144 1 1 1 572.3028 1142.591 2 1142.5931 -0.0021 0 56.11 4.10E-05 R LQAEEVAQQK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2904.2904.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 3166 1636 1 1 1 572.3088 1142.603 2 1142.6044 -0.0014 1 29.2 0.017 K IKELQNAGDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2353.2353.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 3227 4247 1 1 1 576.2821 1150.5497 2 1150.5506 -0.0009 0 34.22 0.0025 R QYDIDDAIAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5208.5208.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 3299 4318 1 1 0 580.7376 1159.4607 2 1159.4604 0.0003 0 48.17 5.10E-05 R GYFDEEMNR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5284.5284.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 3328 2494 1 1 1 582.3062 1162.5978 2 1162.5982 -0.0005 1 52.83 3.20E-05 R AQFEQLKDGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3284.3284.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 3338 5922 1 1 1 582.7986 1163.5826 2 1163.5822 0.0004 0 60.78 2.40E-05 R LTAEDLFEAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6933.6933.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 3390 4821 1 1 1 585.8221 1169.6296 2 1169.6292 0.0004 0 41.86 0.00058 K ELIPTEEALR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5827.5827.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 3399 5396 1 1 1 586.3317 1170.6489 2 1170.6496 -0.0007 0 62.6 1.30E-06 R QVEEEILALK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6412.6412.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 3436 3025 1 1 1 588.2706 1174.5266 2 1174.5288 -0.0023 0 32.05 0.0014 R CVEDPETGLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3879.3879.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 3437 3036 1 1 1 588.2709 1174.5273 2 1174.5288 -0.0015 0 47.73 3.30E-05 R CVEDPETGLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3891.3891.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 3487 3566 1 1 1 592.3065 1182.5985 2 1182.6033 -0.0048 0 39.64 0.00024 R AGLVGPEFHEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4471.4471.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 3489 3551 1 1 1 395.2083 1182.6029 3 1182.6033 -0.0004 0 22.87 0.0072 R AGLVGPEFHEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4455.4455.3.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 3547 5801 1 1 1 595.8416 1189.6687 2 1189.6707 -0.002 0 68.05 1.60E-06 R LLFNDVQTLK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6812.6812.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 3551 2744 1 1 1 397.8759 1190.606 3 1190.6043 0.0017 1 43.81 0.0009 R FRELAEEAAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3557.3557.3.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 3822 2453 1 1 1 407.5635 1219.6686 3 1219.6673 0.0013 1 60.1 9.60E-06 R KGLVGPELHDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3238.3238.3.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 3951 2780 1 1 1 617.8118 1233.609 2 1233.6102 -0.0012 1 27.51 0.044 R RLAEDEAFQR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3601.3601.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 4021 5329 1 1 1 621.7977 1241.5809 2 1241.5829 -0.002 0 37.65 0.00029 K GWLYYEAGQR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6345.6345.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 4024 3425 1 1 1 621.8432 1241.6718 2 1241.6728 -0.0009 0 63.14 2.20E-06 R QVQVALETAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4319.4319.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 4034 5357 1 1 1 622.3354 1242.6563 2 1242.6568 -0.0004 0 42.22 0.0013 R SIQEELQQLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6373.6373.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 4379 6129 1 1 1 642.8615 1283.7085 2 1283.7085 0 0 33.82 0.0016 R SLVPAAELLESR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7140.7140.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 4385 2436 1 1 1 643.3243 1284.6341 2 1284.635 -0.0009 1 58.82 3.10E-06 R AVTGYKDPYSGK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3220.3220.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 4387 2437 1 1 1 429.2207 1284.6404 3 1284.635 0.0054 1 21.34 0.01 R AVTGYKDPYSGK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3221.3221.3.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 4400 4682 1 1 1 643.8451 1285.6756 2 1285.6779 -0.0023 0 48.8 2.70E-05 R WQAVLAQTDVR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5678.5678.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 4486 3332 1 1 1 648.8057 1295.5969 2 1295.5994 -0.0025 0 55.69 6.00E-06 K GGELVYTDSEAR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4218.4218.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 4511 4184 1 1 1 650.3196 1298.6246 2 1298.6255 -0.0009 0 52.57 1.20E-05 R QQGLASYDYVR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5140.5140.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 4528 3168 1 1 1 650.8281 1299.6417 2 1299.6419 -0.0002 0 67.55 5.80E-07 R QLAEEDLAQQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4039.4039.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 4684 4992 1 1 1 660.3444 1318.6742 2 1318.6769 -0.0027 0 49.96 0.00011 K LEQLFQDEVAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6006.6006.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 4695 5168 1 1 1 660.8479 1319.6812 2 1319.6833 -0.0021 1 36.71 0.0046 R RLTAEDLFEAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6184.6184.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 4710 5657 1 1 1 661.8318 1321.649 2 1321.6514 -0.0024 0 65.89 2.10E-06 R SQVEEELFSVR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6670.6670.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 4777 2392 1 1 1 665.8388 1329.6631 2 1329.6636 -0.0006 1 50.05 0.00021 K SLAAEEEAARQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3172.3172.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 4812 6669 1 1 1 667.8875 1333.7605 2 1333.7605 0 0 67.73 1.20E-06 R IISLETYNLLR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7674.7674.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 4903 2933 1 1 1 449.2404 1344.6993 3 1344.6998 -0.0004 1 37.57 0.0021 R SVRDVAEVDTVR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3779.3779.3.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 5021 982 1 1 1 453.5727 1357.6962 3 1357.6949 0.0012 1 54.04 1.80E-05 R LKQSAEEQAQAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1645.1645.3.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 5072 4552 1 1 1 683.3351 1364.6557 2 1364.6572 -0.0014 0 46.77 0.00023 R QEELYSELQAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5537.5537.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 5180 2665 1 1 1 460.9089 1379.7048 3 1379.7092 -0.0044 1 19.78 0.026 K SHRVPLDVACAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3470.3470.3.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 5205 2890 1 1 1 461.9281 1382.7626 3 1382.763 -0.0004 1 16.8 0.027 R QLQLAQEAAQKR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3732.3732.3.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 5352 3419 1 1 1 699.8995 1397.7845 2 1397.7878 -0.0033 1 39.08 0.00022 R LKAEAELLQQQK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4312.4312.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 5387 4317 1 1 1 468.9282 1403.7628 3 1403.762 0.0008 1 40.02 0.00035 K TTVKDLSELGSVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5283.5283.3.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 5429 2867 1 1 1 705.8699 1409.7253 2 1409.7263 -0.001 0 39.41 0.0013 R LAQGHTTVDELAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3706.3706.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 5430 2847 1 1 1 470.9162 1409.7267 3 1409.7263 0.0004 0 58.69 6.30E-06 R LAQGHTTVDELAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3683.3683.3.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 5444 3034 1 1 1 706.8948 1411.775 2 1411.7783 -0.0033 1 44.06 0.00011 R LRLQAEEVAQQK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3888.3888.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 5445 3028 1 1 1 471.5995 1411.7765 3 1411.7783 -0.0017 1 26.05 0.0036 R LRLQAEEVAQQK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3882.3882.3.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 5560 4794 1 1 1 714.8997 1427.7848 2 1427.7871 -0.0024 0 54.8 7.30E-06 K IIITVVEEQEQK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5797.5797.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 5684 1032 1 1 1 722.8597 1443.7049 2 1443.7066 -0.0017 1 39.22 0.00042 R LRAETEQGEQQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1699.1699.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 5733 3592 1 1 1 726.3593 1450.704 2 1450.7052 -0.0012 1 35.54 0.00046 R SGRQYDIDDAIAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4499.4499.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 5790 5070 1 1 1 731.3708 1460.727 2 1460.7293 -0.0023 0 89.26 1.50E-08 R SQVMDEATALQLR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6085.6085.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 5937 4383 1 1 1 739.3669 1476.7192 2 1476.7242 -0.005 0 87.92 3.80E-08 R SQVMDEATALQLR E Oxidation (M) 0.0001000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5354.5354.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 5964 6418 1 1 1 740.885 1479.7555 2 1479.7569 -0.0014 0 63.36 6.60E-06 R TSSEDNLYLAVLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7426.7426.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 6111 4037 1 1 1 755.8538 1509.6931 2 1509.6947 -0.0016 0 59.52 2.60E-06 R YASGSSASLGGPESAVA - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4980.4980.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 6217 6961 1 1 1 764.8727 1527.7308 2 1527.7318 -0.0009 0 32.55 0.0018 R ESADPLGAWLQDAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7962.7962.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 6228 5385 1 1 1 766.4433 1530.872 2 1530.877 -0.0049 0 41.88 0.00012 K VLALPEPSPAAPTLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6401.6401.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 6268 5520 1 1 1 769.9294 1537.8443 2 1537.8464 -0.0021 0 84.9 1.50E-08 R LLDAQLATGGIVDPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6534.6534.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 6371 4200 1 1 1 780.9271 1559.8396 2 1559.842 -0.0024 1 57.81 8.10E-06 R VIDRELYQQLQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5157.5157.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 6407 6261 1 1 1 783.9458 1565.877 2 1565.8777 -0.0006 0 88.22 5.40E-09 R APVPASELLASGVLSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7271.7271.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 6408 6272 1 1 1 522.9664 1565.8775 3 1565.8777 -0.0002 0 61.01 1.90E-06 R APVPASELLASGVLSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7281.7281.3.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 6418 3279 1 1 1 785.4199 1568.8253 2 1568.827 -0.0017 1 64.42 2.90E-06 R LRQLAEEDLAQQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4160.4160.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 6419 3272 1 1 1 523.9492 1568.8258 3 1568.827 -0.0012 1 26.78 0.0069 R LRQLAEEDLAQQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4153.4153.3.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 6424 6327 1 1 1 785.9067 1569.7988 2 1569.7998 -0.001 0 33.57 0.00073 R DDGTGQLLLPLSDAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7336.7336.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 6599 4016 1 1 1 796.9037 1591.7929 2 1591.7954 -0.0024 1 45.85 0.0001 R ARQEELYSELQAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4958.4958.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 6600 4007 1 1 1 531.6054 1591.7944 3 1591.7954 -0.001 1 43.43 0.00084 R ARQEELYSELQAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4948.4948.3.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 6947 6717 1 1 1 827.4272 1652.8399 2 1652.841 -0.001 0 17.49 0.038 R DPYTGQSVSLFQALK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7720.7720.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 6978 3646 1 1 1 554.6022 1660.7847 3 1660.7839 0.0008 1 15.56 0.035 R GCLDEETSRALSAPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4558.4558.3.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 7000 3484 1 1 1 833.9037 1665.7929 2 1665.7958 -0.0029 1 57.02 1.10E-05 R RYASGSSASLGGPESAVA - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4382.4382.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 7165 3986 1 1 1 564.6439 1690.9098 3 1690.9114 -0.0017 1 56.43 3.10E-05 R LREQLQLLEEQHR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4925.4925.3.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 7293 4835 1 1 1 854.9167 1707.8188 2 1707.8203 -0.0015 0 63.67 1.10E-06 R LLDPEDVDVPQPDEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5842.5842.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 7360 5650 1 1 1 576.306 1725.8961 3 1725.901 -0.0049 1 21.31 0.012 R RDDGTGQLLLPLSDAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6664.6664.3.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 7366 6661 1 1 1 864.953 1727.8915 2 1727.895 -0.0036 0 20.83 0.011 R CITDPQTGLCLLPLK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7666.7666.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 7459 3713 1 1 1 877.9326 1753.8507 2 1753.8483 0.0024 0 80.83 2.60E-08 R SSSVGSSSSYPISPAVSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4629.4629.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 7517 6732 1 1 1 886.929 1771.8435 2 1771.8451 -0.0016 0 29.79 0.0016 R DPYSGSTISLFQAMQK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7736.7736.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 7544 3046 1 1 1 595.3104 1782.9093 3 1782.9112 -0.0019 0 34.98 0.0017 R AALAHSEEVTASQVAATK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3903.3903.3.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 7545 3059 1 1 1 595.3109 1782.9107 3 1782.9112 -0.0004 0 54.28 1.80E-05 R AALAHSEEVTASQVAATK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3918.3918.3.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 7546 3067 1 1 1 892.4632 1782.9118 2 1782.9112 0.0007 0 48.59 2.80E-05 R AALAHSEEVTASQVAATK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3926.3926.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 7600 6183 1 1 1 904.9543 1807.8941 2 1807.8952 -0.0011 0 96.26 1.50E-09 K VQSGSESVIQEYVDLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7194.7194.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 7679 6119 1 1 1 917.9491 1833.8836 2 1833.8857 -0.002 0 93.46 1.70E-09 R QTNLENLDQAFSVAER D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7130.7130.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 7680 6123 1 1 1 612.3019 1833.8838 3 1833.8857 -0.0019 0 38.15 0.00081 R QTNLENLDQAFSVAER D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7134.7134.3.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 7862 4771 1 1 1 957.9558 1913.8971 2 1913.9007 -0.0036 1 18.54 0.027 K GGELVYTDSEARDVFEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5773.5773.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 7953 6346 1 1 1 643.015 1926.023 3 1926.0244 -0.0014 0 24.53 0.005 R CRPDQLTGLSLLPLSEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7354.7354.3.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 7996 6656 1 1 1 653.9847 1958.9322 3 1958.9329 -0.0007 0 29.48 0.0041 R CVEDPETGLCLLPLTDK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7661.7661.3.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 7997 6646 1 1 1 980.4736 1958.9327 2 1958.9329 -0.0002 0 44.01 0.00031 R CVEDPETGLCLLPLTDK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7651.7651.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 8047 5584 1 1 1 665.7029 1994.087 3 1994.0909 -0.0039 0 51.19 3.90E-05 K AGVAAPATQVAQVTLQSVQR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6598.6598.3.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 8124 3742 1 1 1 690.6508 2068.9306 3 2068.9338 -0.0031 0 45.72 5.20E-05 K AYSDPSTGEPATYGELQQR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4661.4661.3.dta 1 1 IPI00398779.3 plectin 1 isoform 11 3123 517822 117 117 103 103 8370 3458 1 1 1 819.0482 2454.1228 3 2454.1299 -0.0071 1 39.98 0.0002 R ADAKAYSDPSTGEPATYGELQQR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4354.4354.3.dta 1 2 IPI00010951.1 Epiplakin 551 555149 23 23 21 21 453 1225 1 0 1 365.2345 728.4544 2 728.4544 0 1 34.37 0.01 R LLKAER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1908.1908.2.dta 1 2 IPI00010951.1 Epiplakin 551 555149 23 23 21 21 1648 3411 1 0 1 472.7737 943.5329 2 943.5338 -0.0009 0 32.79 0.01 R EVTLGQVAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4303.4303.2.dta 1 2 IPI00010951.1 Epiplakin 551 555149 23 23 21 21 2015 938 1 0 1 331.8462 992.5167 3 992.5152 0.0016 1 27.19 0.031 R GPREPGPAGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1597.1597.3.dta 1 2 IPI00010951.1 Epiplakin 551 555149 23 23 21 21 2434 4179 1 0 1 523.7849 1045.5552 2 1045.5556 -0.0005 0 42.81 0.00023 R GVVGPELYGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5134.5134.2.dta 1 2 IPI00010951.1 Epiplakin 551 555149 23 23 21 21 3043 5309 1 0 1 563.8143 1125.6141 2 1125.6142 -0.0001 0 30.74 0.0078 R DGLLPTGLGQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6325.6325.2.dta 1 2 IPI00010951.1 Epiplakin 551 555149 23 23 21 21 3121 6248 1 0 1 568.8554 1135.6963 2 1135.6965 -0.0002 0 52.75 5.30E-06 R APGSGLALLPLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7258.7258.2.dta 1 2 IPI00010951.1 Epiplakin 551 555149 23 23 21 21 3140 5850 1 0 1 570.8112 1139.6078 2 1139.6087 -0.001 0 16.97 0.033 K GLIPWEQAAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6861.6861.2.dta 1 2 IPI00010951.1 Epiplakin 551 555149 23 23 21 21 3220 3257 1 0 1 575.7968 1149.5791 2 1149.5778 0.0012 0 51.32 0.00014 R DQVTYQQLR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4135.4135.2.dta 1 2 IPI00010951.1 Epiplakin 551 555149 23 23 21 21 3275 6263 1 0 1 579.2775 1156.5405 2 1156.5409 -0.0004 0 44.56 0.00038 K MSIYQAMWK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7273.7273.2.dta 1 2 IPI00010951.1 Epiplakin 551 555149 23 23 21 21 3299 4318 1 0 0 580.7376 1159.4607 2 1159.4604 0.0003 0 48.17 5.10E-05 R GYFDEEMNR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5284.5284.2.dta 1 2 IPI00010951.1 Epiplakin 551 555149 23 23 21 21 3360 3185 1 0 1 584.2742 1166.5338 2 1166.5356 -0.0018 0 37.44 0.00031 R AAAGYPDPYSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4057.4057.2.dta 1 2 IPI00010951.1 Epiplakin 551 555149 23 23 21 21 4163 3191 1 0 1 630.3141 1258.6137 2 1258.6153 -0.0016 0 73.43 7.80E-07 R ELSEQLGQAER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4064.4064.2.dta 1 2 IPI00010951.1 Epiplakin 551 555149 23 23 21 21 4398 4104 1 0 1 643.8323 1285.6501 2 1285.6514 -0.0013 0 44.95 0.00026 K LSELEPGTGDLR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5053.5053.2.dta 1 2 IPI00010951.1 Epiplakin 551 555149 23 23 21 21 4735 3731 1 0 1 663.3431 1324.6716 2 1324.6735 -0.0019 0 49.74 0.00022 R GSAVHQLSEELR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4649.4649.2.dta 1 2 IPI00010951.1 Epiplakin 551 555149 23 23 21 21 4736 3733 1 0 1 442.5651 1324.6734 3 1324.6735 -0.0001 0 44.25 0.00071 R GSAVHQLSEELR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4651.4651.3.dta 1 2 IPI00010951.1 Epiplakin 551 555149 23 23 21 21 4797 2507 1 0 1 666.8528 1331.6911 2 1331.6932 -0.0021 1 64.98 1.20E-06 R VIEETEERLSK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3299.3299.2.dta 1 2 IPI00010951.1 Epiplakin 551 555149 23 23 21 21 6736 4262 1 0 1 811.4054 1620.7962 2 1620.7995 -0.0032 0 42.43 0.00073 R ELIQEYGAQSGGLEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5224.5224.2.dta 1 2 IPI00010951.1 Epiplakin 551 555149 23 23 21 21 7084 5877 1 0 1 839.4448 1676.875 2 1676.8807 -0.0058 0 28.95 0.0019 R YLEGTSCIAGVLVPAK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6888.6888.2.dta 1 2 IPI00010951.1 Epiplakin 551 555149 23 23 21 21 7552 3167 1 0 1 596.6099 1786.8078 3 1786.8081 -0.0004 0 55.74 2.70E-05 R EGQGEGETQEAAAAAAAAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4038.4038.3.dta 1 2 IPI00010951.1 Epiplakin 551 555149 23 23 21 21 7553 3163 1 0 1 894.4113 1786.808 2 1786.8081 -0.0002 0 90.09 1.30E-08 R EGQGEGETQEAAAAAAAAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4034.4034.2.dta 1 2 IPI00010951.1 Epiplakin 551 555149 23 23 21 21 7983 6175 1 0 1 649.3235 1944.9486 3 1944.9516 -0.003 0 15.43 0.042 R CRPQEDTGWVLFPVNK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7186.7186.3.dta 1 2 IPI00010951.1 Epiplakin 551 555149 23 23 21 21 8046 4946 1 0 1 665.6866 1994.0381 3 1994.0433 -0.0052 0 15.91 0.041 R QVSASELHTSGILGPETLR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5959.5959.3.dta 1 2 IPI00010951.1 Epiplakin 551 555149 23 23 21 21 8175 2762 1 0 1 720.3404 2157.9994 3 2157.9998 -0.0005 1 60.96 4.40E-06 R SQREGQGEGETQEAAAAAAAAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3580.3580.3.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 21 2186 3 0 1 300.6952 599.3758 2 599.3755 0.0003 0 28 0.046 R LAQLR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2949.2949.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 732 2554 1 0 1 398.2021 794.3896 2 794.3922 -0.0027 0 16.01 0.031 R TEYNLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3350.3350.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 1084 2860 1 0 1 426.7141 851.4137 2 851.4137 0 0 31.59 0.0018 R SALDQYR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3698.3698.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 1128 2816 1 0 1 432.7325 863.4505 2 863.4501 0.0004 0 41.8 0.0017 K FAEQTLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3647.3647.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 1287 4951 1 0 1 447.7286 893.4427 2 893.4429 -0.0002 0 31.22 0.019 R LCFEGLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5963.5963.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 1336 6050 1 0 1 451.2895 900.5644 2 900.5644 0 0 65.92 1.20E-06 R SSIAGLLLK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7062.7062.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 1415 2356 1 0 1 455.7955 909.5764 2 909.576 0.0004 0 36.05 0.00062 K AVVQLKPR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3133.3133.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 1437 4196 1 0 1 458.2663 914.5181 2 914.5185 -0.0004 0 70.76 2.40E-06 K GLLSAEVAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5153.5153.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 1442 5820 1 0 1 458.2741 914.5336 2 914.5338 -0.0002 0 37.42 0.002 K LLLWSQR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6831.6831.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 1606 4133 1 0 1 470.2518 938.4891 2 938.4895 -0.0004 0 26.19 0.025 R LSVYQAMK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5084.5084.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 1725 1784 1 0 1 479.2592 956.5039 2 956.5039 0 0 60.57 1.60E-05 R AQAEQAALR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2514.2514.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 1740 2240 1 0 1 479.7715 957.5284 2 957.5284 0 0 30.67 0.022 R LYVHEAVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3008.3008.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 1822 5985 1 0 1 484.2535 966.4924 2 966.4923 0.0001 0 34.14 0.0073 R SWSLATFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6998.6998.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 1880 4423 1 0 1 488.2584 974.5022 2 974.5033 -0.0011 0 43.98 0.00056 K DLSELGSVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5398.5398.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 2018 5412 1 0 1 497.2899 992.5653 2 992.5655 -0.0002 0 67.44 1.30E-06 R LSYTQLLR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6428.6428.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 2077 3531 1 0 1 500.7657 999.5169 2 999.5172 -0.0002 0 44.08 7.40E-05 R VPLDVACAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4433.4433.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 2094 2686 1 0 1 501.7642 1001.5138 2 1001.5141 -0.0003 0 47.23 3.70E-05 R QAEVELASR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3493.3493.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 2318 2540 1 0 1 515.7978 1029.581 2 1029.5818 -0.0008 1 51.76 0.00012 R LTVDEAVRK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3335.3335.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 2323 2433 1 0 1 516.2909 1030.5672 2 1030.5658 0.0014 0 61.12 2.00E-05 R LLEAAAQSTK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3217.3217.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 2397 4086 1 0 1 521.7981 1041.5816 2 1041.5818 -0.0002 0 68.33 2.00E-06 R LAAEQELIR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5034.5034.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 2433 3217 1 0 1 523.7836 1045.5527 2 1045.5556 -0.0029 0 40.55 0.00016 R VPVDVAYQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4092.4092.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 2521 1187 1 0 1 353.8647 1058.5724 3 1058.572 0.0004 1 40.37 0.001 R LKAEATEAAR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1867.1867.3.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 2570 920 1 0 1 533.7855 1065.5564 2 1065.5567 -0.0003 0 33.85 0.0019 R QLAEAHAQAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1578.1578.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 2571 5795 1 0 1 533.8021 1065.5897 2 1065.5892 0.0005 0 36.75 0.00036 K LISLFQAMK K Oxidation (M) 0.000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6807.6807.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 2823 4352 1 0 1 549.7372 1097.4598 2 1097.46 -0.0002 0 37.34 0.00076 K AFCGFEDPR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5321.5321.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 2838 4063 1 0 1 550.7877 1099.5609 2 1099.5622 -0.0013 0 62.24 1.30E-05 R GGAEGELQALR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5009.5009.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 2844 1341 1 0 1 551.2849 1100.5553 2 1100.5574 -0.0021 0 65.16 6.60E-06 R QLAEGTAQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2034.2034.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 2923 1364 1 0 1 557.309 1112.6035 2 1112.605 -0.0015 1 33.49 0.0088 R RAQAEQAALR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2059.2059.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 2971 1592 1 0 1 559.7931 1117.5716 2 1117.5727 -0.0011 1 54.4 6.30E-05 R SAEAELQSKR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2306.2306.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 2972 5378 1 0 1 559.7977 1117.5808 2 1117.5801 0.0007 0 58.22 4.00E-05 K QITMEELVR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6393.6393.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 2979 3248 1 0 1 560.2769 1118.5393 2 1118.539 0.0003 0 47.49 0.00038 R LQLEACETR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4126.4126.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 3001 2986 1 0 1 374.5644 1120.6713 3 1120.6717 -0.0003 1 25.87 0.011 K GLILKDHGIR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3836.3836.3.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 3061 4568 1 0 1 565.3021 1128.5897 2 1128.5887 0.001 0 42.7 0.00076 R NLVDNITGQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5555.5555.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 3079 4108 1 0 1 566.7397 1131.4648 2 1131.4655 -0.0007 0 30.19 0.0025 R GYFSEEMNR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5057.5057.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 3097 3604 1 0 1 567.7937 1133.5729 2 1133.575 -0.0022 0 24.14 0.0083 K QITMEELVR S Oxidation (M) 0.000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4512.4512.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 3165 2144 1 0 1 572.3028 1142.591 2 1142.5931 -0.0021 0 56.11 4.10E-05 R LQAEEVAQQK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2904.2904.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 3166 1636 1 0 1 572.3088 1142.603 2 1142.6044 -0.0014 1 29.2 0.017 K IKELQNAGDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2353.2353.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 3227 4247 1 0 1 576.2821 1150.5497 2 1150.5506 -0.0009 0 34.22 0.0025 R QYDIDDAIAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5208.5208.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 3299 4318 1 0 0 580.7376 1159.4607 2 1159.4604 0.0003 0 48.17 5.10E-05 R GYFDEEMNR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5284.5284.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 3328 2494 1 0 1 582.3062 1162.5978 2 1162.5982 -0.0005 1 52.83 3.20E-05 R AQFEQLKDGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3284.3284.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 3338 5922 1 0 1 582.7986 1163.5826 2 1163.5822 0.0004 0 60.78 2.40E-05 R LTAEDLFEAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6933.6933.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 3390 4821 1 0 1 585.8221 1169.6296 2 1169.6292 0.0004 0 41.86 0.00058 K ELIPTEEALR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5827.5827.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 3399 5396 1 0 1 586.3317 1170.6489 2 1170.6496 -0.0007 0 62.6 1.30E-06 R QVEEEILALK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6412.6412.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 3436 3025 1 0 1 588.2706 1174.5266 2 1174.5288 -0.0023 0 32.05 0.0014 R CVEDPETGLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3879.3879.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 3437 3036 1 0 1 588.2709 1174.5273 2 1174.5288 -0.0015 0 47.73 3.30E-05 R CVEDPETGLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3891.3891.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 3487 3566 1 0 1 592.3065 1182.5985 2 1182.6033 -0.0048 0 39.64 0.00024 R AGLVGPEFHEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4471.4471.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 3489 3551 1 0 1 395.2083 1182.6029 3 1182.6033 -0.0004 0 22.87 0.0072 R AGLVGPEFHEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4455.4455.3.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 3547 5801 1 0 1 595.8416 1189.6687 2 1189.6707 -0.002 0 68.05 1.60E-06 R LLFNDVQTLK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6812.6812.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 3551 2744 1 0 1 397.8759 1190.606 3 1190.6043 0.0017 1 43.81 0.0009 R FRELAEEAAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3557.3557.3.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 3822 2453 1 0 1 407.5635 1219.6686 3 1219.6673 0.0013 1 60.1 9.60E-06 R KGLVGPELHDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3238.3238.3.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 3951 2780 1 0 1 617.8118 1233.609 2 1233.6102 -0.0012 1 27.51 0.044 R RLAEDEAFQR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3601.3601.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 4021 5329 1 0 1 621.7977 1241.5809 2 1241.5829 -0.002 0 37.65 0.00029 K GWLYYEAGQR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6345.6345.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 4024 3425 1 0 1 621.8432 1241.6718 2 1241.6728 -0.0009 0 63.14 2.20E-06 R QVQVALETAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4319.4319.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 4034 5357 1 0 1 622.3354 1242.6563 2 1242.6568 -0.0004 0 42.22 0.0013 R SIQEELQQLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6373.6373.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 4379 6129 1 0 1 642.8615 1283.7085 2 1283.7085 0 0 33.82 0.0016 R SLVPAAELLESR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7140.7140.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 4385 2436 1 0 1 643.3243 1284.6341 2 1284.635 -0.0009 1 58.82 3.10E-06 R AVTGYKDPYSGK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3220.3220.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 4387 2437 1 0 1 429.2207 1284.6404 3 1284.635 0.0054 1 21.34 0.01 R AVTGYKDPYSGK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3221.3221.3.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 4400 4682 1 0 1 643.8451 1285.6756 2 1285.6779 -0.0023 0 48.8 2.70E-05 R WQAVLAQTDVR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5678.5678.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 4486 3332 1 0 1 648.8057 1295.5969 2 1295.5994 -0.0025 0 55.69 6.00E-06 K GGELVYTDSEAR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4218.4218.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 4511 4184 1 0 1 650.3196 1298.6246 2 1298.6255 -0.0009 0 52.57 1.20E-05 R QQGLASYDYVR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5140.5140.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 4528 3168 1 0 1 650.8281 1299.6417 2 1299.6419 -0.0002 0 67.55 5.80E-07 R QLAEEDLAQQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4039.4039.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 4684 4992 1 0 1 660.3444 1318.6742 2 1318.6769 -0.0027 0 49.96 0.00011 K LEQLFQDEVAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6006.6006.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 4695 5168 1 0 1 660.8479 1319.6812 2 1319.6833 -0.0021 1 36.71 0.0046 R RLTAEDLFEAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6184.6184.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 4710 5657 1 0 1 661.8318 1321.649 2 1321.6514 -0.0024 0 65.89 2.10E-06 R SQVEEELFSVR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6670.6670.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 4777 2392 1 0 1 665.8388 1329.6631 2 1329.6636 -0.0006 1 50.05 0.00021 K SLAAEEEAARQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3172.3172.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 4812 6669 1 0 1 667.8875 1333.7605 2 1333.7605 0 0 67.73 1.20E-06 R IISLETYNLLR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7674.7674.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 4903 2933 1 0 1 449.2404 1344.6993 3 1344.6998 -0.0004 1 37.57 0.0021 R SVRDVAEVDTVR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3779.3779.3.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 5021 982 1 0 1 453.5727 1357.6962 3 1357.6949 0.0012 1 54.04 1.80E-05 R LKQSAEEQAQAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1645.1645.3.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 5072 4552 1 0 1 683.3351 1364.6557 2 1364.6572 -0.0014 0 46.77 0.00023 R QEELYSELQAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5537.5537.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 5180 2665 1 0 1 460.9089 1379.7048 3 1379.7092 -0.0044 1 19.78 0.026 K SHRVPLDVACAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3470.3470.3.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 5205 2890 1 0 1 461.9281 1382.7626 3 1382.763 -0.0004 1 16.8 0.027 R QLQLAQEAAQKR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3732.3732.3.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 5352 3419 1 0 1 699.8995 1397.7845 2 1397.7878 -0.0033 1 39.08 0.00022 R LKAEAELLQQQK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4312.4312.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 5387 4317 1 0 1 468.9282 1403.7628 3 1403.762 0.0008 1 40.02 0.00035 K TTVKDLSELGSVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5283.5283.3.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 5429 2867 1 0 1 705.8699 1409.7253 2 1409.7263 -0.001 0 39.41 0.0013 R LAQGHTTVDELAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3706.3706.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 5430 2847 1 0 1 470.9162 1409.7267 3 1409.7263 0.0004 0 58.69 6.30E-06 R LAQGHTTVDELAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3683.3683.3.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 5444 3034 1 0 1 706.8948 1411.775 2 1411.7783 -0.0033 1 44.06 0.00011 R LRLQAEEVAQQK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3888.3888.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 5445 3028 1 0 1 471.5995 1411.7765 3 1411.7783 -0.0017 1 26.05 0.0036 R LRLQAEEVAQQK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3882.3882.3.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 5560 4794 1 0 1 714.8997 1427.7848 2 1427.7871 -0.0024 0 54.8 7.30E-06 K IIITVVEEQEQK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5797.5797.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 5684 1032 1 0 1 722.8597 1443.7049 2 1443.7066 -0.0017 1 39.22 0.00042 R LRAETEQGEQQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1699.1699.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 5733 3592 1 0 1 726.3593 1450.704 2 1450.7052 -0.0012 1 35.54 0.00046 R SGRQYDIDDAIAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4499.4499.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 5790 5070 1 0 1 731.3708 1460.727 2 1460.7293 -0.0023 0 89.26 1.50E-08 R SQVMDEATALQLR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6085.6085.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 5937 4383 1 0 1 739.3669 1476.7192 2 1476.7242 -0.005 0 87.92 3.80E-08 R SQVMDEATALQLR E Oxidation (M) 0.0001000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5354.5354.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 6111 4037 1 0 1 755.8538 1509.6931 2 1509.6947 -0.0016 0 59.52 2.60E-06 R YASGSSASLGGPESAVA - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4980.4980.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 6217 6961 1 0 1 764.8727 1527.7308 2 1527.7318 -0.0009 0 32.55 0.0018 R ESADPLGAWLQDAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7962.7962.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 6228 5385 1 0 1 766.4433 1530.872 2 1530.877 -0.0049 0 41.88 0.00012 K VLALPEPSPAAPTLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6401.6401.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 6268 5520 1 0 1 769.9294 1537.8443 2 1537.8464 -0.0021 0 84.9 1.50E-08 R LLDAQLATGGIVDPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6534.6534.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 6371 4200 1 0 1 780.9271 1559.8396 2 1559.842 -0.0024 1 57.81 8.10E-06 R VIDRELYQQLQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5157.5157.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 6407 6261 1 0 1 783.9458 1565.877 2 1565.8777 -0.0006 0 88.22 5.40E-09 R APVPASELLASGVLSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7271.7271.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 6408 6272 1 0 1 522.9664 1565.8775 3 1565.8777 -0.0002 0 61.01 1.90E-06 R APVPASELLASGVLSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7281.7281.3.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 6418 3279 1 0 1 785.4199 1568.8253 2 1568.827 -0.0017 1 64.42 2.90E-06 R LRQLAEEDLAQQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4160.4160.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 6419 3272 1 0 1 523.9492 1568.8258 3 1568.827 -0.0012 1 26.78 0.0069 R LRQLAEEDLAQQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4153.4153.3.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 6424 6327 1 0 1 785.9067 1569.7988 2 1569.7998 -0.001 0 33.57 0.00073 R DDGTGQLLLPLSDAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7336.7336.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 6599 4016 1 0 1 796.9037 1591.7929 2 1591.7954 -0.0024 1 45.85 0.0001 R ARQEELYSELQAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4958.4958.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 6600 4007 1 0 1 531.6054 1591.7944 3 1591.7954 -0.001 1 43.43 0.00084 R ARQEELYSELQAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4948.4948.3.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 6947 6717 1 0 1 827.4272 1652.8399 2 1652.841 -0.001 0 17.49 0.038 R DPYTGQSVSLFQALK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7720.7720.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 6978 3646 1 0 1 554.6022 1660.7847 3 1660.7839 0.0008 1 15.56 0.035 R GCLDEETSRALSAPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4558.4558.3.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 7000 3484 1 0 1 833.9037 1665.7929 2 1665.7958 -0.0029 1 57.02 1.10E-05 R RYASGSSASLGGPESAVA - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4382.4382.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 7165 3986 1 0 1 564.6439 1690.9098 3 1690.9114 -0.0017 1 56.43 3.10E-05 R LREQLQLLEEQHR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4925.4925.3.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 7293 4835 1 0 1 854.9167 1707.8188 2 1707.8203 -0.0015 0 63.67 1.10E-06 R LLDPEDVDVPQPDEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5842.5842.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 7360 5650 1 0 1 576.306 1725.8961 3 1725.901 -0.0049 1 21.31 0.012 R RDDGTGQLLLPLSDAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6664.6664.3.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 7366 6661 1 0 1 864.953 1727.8915 2 1727.895 -0.0036 0 20.83 0.011 R CITDPQTGLCLLPLK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7666.7666.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 7459 3713 1 0 1 877.9326 1753.8507 2 1753.8483 0.0024 0 80.83 2.60E-08 R SSSVGSSSSYPISPAVSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4629.4629.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 7517 6732 1 0 1 886.929 1771.8435 2 1771.8451 -0.0016 0 29.79 0.0016 R DPYSGSTISLFQAMQK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7736.7736.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 7544 3046 1 0 1 595.3104 1782.9093 3 1782.9112 -0.0019 0 34.98 0.0017 R AALAHSEEVTASQVAATK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3903.3903.3.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 7545 3059 1 0 1 595.3109 1782.9107 3 1782.9112 -0.0004 0 54.28 1.80E-05 R AALAHSEEVTASQVAATK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3918.3918.3.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 7546 3067 1 0 1 892.4632 1782.9118 2 1782.9112 0.0007 0 48.59 2.80E-05 R AALAHSEEVTASQVAATK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3926.3926.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 7600 6183 1 0 1 904.9543 1807.8941 2 1807.8952 -0.0011 0 96.26 1.50E-09 K VQSGSESVIQEYVDLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7194.7194.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 7679 6119 1 0 1 917.9491 1833.8836 2 1833.8857 -0.002 0 93.46 1.70E-09 R QTNLENLDQAFSVAER D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7130.7130.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 7680 6123 1 0 1 612.3019 1833.8838 3 1833.8857 -0.0019 0 38.15 0.00081 R QTNLENLDQAFSVAER D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7134.7134.3.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 7862 4771 1 0 1 957.9558 1913.8971 2 1913.9007 -0.0036 1 18.54 0.027 K GGELVYTDSEARDVFEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5773.5773.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 7953 6346 1 0 1 643.015 1926.023 3 1926.0244 -0.0014 0 24.53 0.005 R CRPDQLTGLSLLPLSEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7354.7354.3.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 7996 6656 1 0 1 653.9847 1958.9322 3 1958.9329 -0.0007 0 29.48 0.0041 R CVEDPETGLCLLPLTDK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7661.7661.3.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 7997 6646 1 0 1 980.4736 1958.9327 2 1958.9329 -0.0002 0 44.01 0.00031 R CVEDPETGLCLLPLTDK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7651.7651.2.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 8047 5584 1 0 1 665.7029 1994.087 3 1994.0909 -0.0039 0 51.19 3.90E-05 K AGVAAPATQVAQVTLQSVQR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6598.6598.3.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 8124 3742 1 0 1 690.6508 2068.9306 3 2068.9338 -0.0031 0 45.72 5.20E-05 K AYSDPSTGEPATYGELQQR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4661.4661.3.dta 1 IPI00186711.3 plectin 1 isoform 6 3083 533462 116 116 102 102 8370 3458 1 0 1 819.0482 2454.1228 3 2454.1299 -0.0071 1 39.98 0.0002 R ADAKAYSDPSTGEPATYGELQQR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4354.4354.3.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 21 2186 3 0 1 300.6952 599.3758 2 599.3755 0.0003 0 28 0.046 R LAQLR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2949.2949.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 732 2554 1 0 1 398.2021 794.3896 2 794.3922 -0.0027 0 16.01 0.031 R TEYNLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3350.3350.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 1084 2860 1 0 1 426.7141 851.4137 2 851.4137 0 0 31.59 0.0018 R SALDQYR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3698.3698.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 1128 2816 1 0 1 432.7325 863.4505 2 863.4501 0.0004 0 41.8 0.0017 K FAEQTLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3647.3647.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 1287 4951 1 0 1 447.7286 893.4427 2 893.4429 -0.0002 0 31.22 0.019 R LCFEGLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5963.5963.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 1336 6050 1 0 1 451.2895 900.5644 2 900.5644 0 0 65.92 1.20E-06 R SSIAGLLLK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7062.7062.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 1415 2356 1 0 1 455.7955 909.5764 2 909.576 0.0004 0 36.05 0.00062 K AVVQLKPR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3133.3133.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 1437 4196 1 0 1 458.2663 914.5181 2 914.5185 -0.0004 0 70.76 2.40E-06 K GLLSAEVAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5153.5153.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 1442 5820 1 0 1 458.2741 914.5336 2 914.5338 -0.0002 0 37.42 0.002 K LLLWSQR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6831.6831.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 1606 4133 1 0 1 470.2518 938.4891 2 938.4895 -0.0004 0 26.19 0.025 R LSVYQAMK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5084.5084.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 1725 1784 1 0 1 479.2592 956.5039 2 956.5039 0 0 60.57 1.60E-05 R AQAEQAALR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2514.2514.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 1740 2240 1 0 1 479.7715 957.5284 2 957.5284 0 0 30.67 0.022 R LYVHEAVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3008.3008.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 1822 5985 1 0 1 484.2535 966.4924 2 966.4923 0.0001 0 34.14 0.0073 R SWSLATFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6998.6998.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 1880 4423 1 0 1 488.2584 974.5022 2 974.5033 -0.0011 0 43.98 0.00056 K DLSELGSVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5398.5398.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 2077 3531 1 0 1 500.7657 999.5169 2 999.5172 -0.0002 0 44.08 7.40E-05 R VPLDVACAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4433.4433.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 2094 2686 1 0 1 501.7642 1001.5138 2 1001.5141 -0.0003 0 47.23 3.70E-05 R QAEVELASR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3493.3493.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 2318 2540 1 0 1 515.7978 1029.581 2 1029.5818 -0.0008 1 51.76 0.00012 R LTVDEAVRK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3335.3335.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 2323 2433 1 0 1 516.2909 1030.5672 2 1030.5658 0.0014 0 61.12 2.00E-05 R LLEAAAQSTK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3217.3217.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 2397 4086 1 0 1 521.7981 1041.5816 2 1041.5818 -0.0002 0 68.33 2.00E-06 R LAAEQELIR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5034.5034.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 2433 3217 1 0 1 523.7836 1045.5527 2 1045.5556 -0.0029 0 40.55 0.00016 R VPVDVAYQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4092.4092.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 2521 1187 1 0 1 353.8647 1058.5724 3 1058.572 0.0004 1 40.37 0.001 R LKAEATEAAR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1867.1867.3.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 2570 920 1 0 1 533.7855 1065.5564 2 1065.5567 -0.0003 0 33.85 0.0019 R QLAEAHAQAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1578.1578.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 2571 5795 1 0 1 533.8021 1065.5897 2 1065.5892 0.0005 0 36.75 0.00036 K LISLFQAMK K Oxidation (M) 0.000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6807.6807.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 2823 4352 1 0 1 549.7372 1097.4598 2 1097.46 -0.0002 0 37.34 0.00076 K AFCGFEDPR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5321.5321.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 2838 4063 1 0 1 550.7877 1099.5609 2 1099.5622 -0.0013 0 62.24 1.30E-05 R GGAEGELQALR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5009.5009.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 2844 1341 1 0 1 551.2849 1100.5553 2 1100.5574 -0.0021 0 65.16 6.60E-06 R QLAEGTAQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2034.2034.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 2923 1364 1 0 1 557.309 1112.6035 2 1112.605 -0.0015 1 33.49 0.0088 R RAQAEQAALR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2059.2059.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 2971 1592 1 0 1 559.7931 1117.5716 2 1117.5727 -0.0011 1 54.4 6.30E-05 R SAEAELQSKR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2306.2306.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 2972 5378 1 0 1 559.7977 1117.5808 2 1117.5801 0.0007 0 58.22 4.00E-05 K QITMEELVR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6393.6393.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 2979 3248 1 0 1 560.2769 1118.5393 2 1118.539 0.0003 0 47.49 0.00038 R LQLEACETR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4126.4126.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 3001 2986 1 0 1 374.5644 1120.6713 3 1120.6717 -0.0003 1 25.87 0.011 K GLILKDHGIR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3836.3836.3.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 3061 4568 1 0 1 565.3021 1128.5897 2 1128.5887 0.001 0 42.7 0.00076 R NLVDNITGQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5555.5555.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 3079 4108 1 0 1 566.7397 1131.4648 2 1131.4655 -0.0007 0 30.19 0.0025 R GYFSEEMNR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5057.5057.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 3097 3604 1 0 1 567.7937 1133.5729 2 1133.575 -0.0022 0 24.14 0.0083 K QITMEELVR S Oxidation (M) 0.000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4512.4512.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 3166 1636 1 0 1 572.3088 1142.603 2 1142.6044 -0.0014 1 29.2 0.017 K IKELQNAGDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2353.2353.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 3227 4247 1 0 1 576.2821 1150.5497 2 1150.5506 -0.0009 0 34.22 0.0025 R QYDIDDAIAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5208.5208.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 3299 4318 1 0 0 580.7376 1159.4607 2 1159.4604 0.0003 0 48.17 5.10E-05 R GYFDEEMNR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5284.5284.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 3328 2494 1 0 1 582.3062 1162.5978 2 1162.5982 -0.0005 1 52.83 3.20E-05 R AQFEQLKDGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3284.3284.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 3390 4821 1 0 1 585.8221 1169.6296 2 1169.6292 0.0004 0 41.86 0.00058 K ELIPTEEALR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5827.5827.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 3399 5396 1 0 1 586.3317 1170.6489 2 1170.6496 -0.0007 0 62.6 1.30E-06 R QVEEEILALK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6412.6412.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 3436 3025 1 0 1 588.2706 1174.5266 2 1174.5288 -0.0023 0 32.05 0.0014 R CVEDPETGLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3879.3879.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 3437 3036 1 0 1 588.2709 1174.5273 2 1174.5288 -0.0015 0 47.73 3.30E-05 R CVEDPETGLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3891.3891.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 3487 3566 1 0 1 592.3065 1182.5985 2 1182.6033 -0.0048 0 39.64 0.00024 R AGLVGPEFHEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4471.4471.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 3489 3551 1 0 1 395.2083 1182.6029 3 1182.6033 -0.0004 0 22.87 0.0072 R AGLVGPEFHEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4455.4455.3.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 3547 5801 1 0 1 595.8416 1189.6687 2 1189.6707 -0.002 0 68.05 1.60E-06 R LLFNDVQTLK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6812.6812.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 3551 2744 1 0 1 397.8759 1190.606 3 1190.6043 0.0017 1 43.81 0.0009 R FRELAEEAAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3557.3557.3.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 3822 2453 1 0 1 407.5635 1219.6686 3 1219.6673 0.0013 1 60.1 9.60E-06 R KGLVGPELHDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3238.3238.3.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 3951 2780 1 0 1 617.8118 1233.609 2 1233.6102 -0.0012 1 27.51 0.044 R RLAEDEAFQR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3601.3601.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 4021 5329 1 0 1 621.7977 1241.5809 2 1241.5829 -0.002 0 37.65 0.00029 K GWLYYEAGQR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6345.6345.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 4024 3425 1 0 1 621.8432 1241.6718 2 1241.6728 -0.0009 0 63.14 2.20E-06 R QVQVALETAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4319.4319.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 4034 5357 1 0 1 622.3354 1242.6563 2 1242.6568 -0.0004 0 42.22 0.0013 R SIQEELQQLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6373.6373.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 4379 6129 1 0 1 642.8615 1283.7085 2 1283.7085 0 0 33.82 0.0016 R SLVPAAELLESR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7140.7140.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 4385 2436 1 0 1 643.3243 1284.6341 2 1284.635 -0.0009 1 58.82 3.10E-06 R AVTGYKDPYSGK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3220.3220.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 4387 2437 1 0 1 429.2207 1284.6404 3 1284.635 0.0054 1 21.34 0.01 R AVTGYKDPYSGK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3221.3221.3.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 4400 4682 1 0 1 643.8451 1285.6756 2 1285.6779 -0.0023 0 48.8 2.70E-05 R WQAVLAQTDVR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5678.5678.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 4486 3332 1 0 1 648.8057 1295.5969 2 1295.5994 -0.0025 0 55.69 6.00E-06 K GGELVYTDSEAR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4218.4218.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 4511 4184 1 0 1 650.3196 1298.6246 2 1298.6255 -0.0009 0 52.57 1.20E-05 R QQGLASYDYVR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5140.5140.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 4528 3168 1 0 1 650.8281 1299.6417 2 1299.6419 -0.0002 0 67.55 5.80E-07 R QLAEEDLAQQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4039.4039.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 4684 4992 1 0 1 660.3444 1318.6742 2 1318.6769 -0.0027 0 49.96 0.00011 K LEQLFQDEVAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6006.6006.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 4710 5657 1 0 1 661.8318 1321.649 2 1321.6514 -0.0024 0 65.89 2.10E-06 R SQVEEELFSVR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6670.6670.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 4777 2392 1 0 1 665.8388 1329.6631 2 1329.6636 -0.0006 1 50.05 0.00021 K SLAAEEEAARQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3172.3172.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 4812 6669 1 0 1 667.8875 1333.7605 2 1333.7605 0 0 67.73 1.20E-06 R IISLETYNLLR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7674.7674.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 4903 2933 1 0 1 449.2404 1344.6993 3 1344.6998 -0.0004 1 37.57 0.0021 R SVRDVAEVDTVR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3779.3779.3.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 5021 982 1 0 1 453.5727 1357.6962 3 1357.6949 0.0012 1 54.04 1.80E-05 R LKQSAEEQAQAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1645.1645.3.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 5180 2665 1 0 1 460.9089 1379.7048 3 1379.7092 -0.0044 1 19.78 0.026 K SHRVPLDVACAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3470.3470.3.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 5205 2890 1 0 1 461.9281 1382.7626 3 1382.763 -0.0004 1 16.8 0.027 R QLQLAQEAAQKR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3732.3732.3.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 5352 3419 1 0 1 699.8995 1397.7845 2 1397.7878 -0.0033 1 39.08 0.00022 R LKAEAELLQQQK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4312.4312.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 5387 4317 1 0 1 468.9282 1403.7628 3 1403.762 0.0008 1 40.02 0.00035 K TTVKDLSELGSVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5283.5283.3.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 5429 2867 1 0 1 705.8699 1409.7253 2 1409.7263 -0.001 0 39.41 0.0013 R LAQGHTTVDELAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3706.3706.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 5430 2847 1 0 1 470.9162 1409.7267 3 1409.7263 0.0004 0 58.69 6.30E-06 R LAQGHTTVDELAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3683.3683.3.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 5560 4794 1 0 1 714.8997 1427.7848 2 1427.7871 -0.0024 0 54.8 7.30E-06 K IIITVVEEQEQK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5797.5797.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 5684 1032 1 0 1 722.8597 1443.7049 2 1443.7066 -0.0017 1 39.22 0.00042 R LRAETEQGEQQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1699.1699.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 5733 3592 1 0 1 726.3593 1450.704 2 1450.7052 -0.0012 1 35.54 0.00046 R SGRQYDIDDAIAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4499.4499.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 5790 5070 1 0 1 731.3708 1460.727 2 1460.7293 -0.0023 0 89.26 1.50E-08 R SQVMDEATALQLR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6085.6085.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 5937 4383 1 0 1 739.3669 1476.7192 2 1476.7242 -0.005 0 87.92 3.80E-08 R SQVMDEATALQLR E Oxidation (M) 0.0001000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5354.5354.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 6111 4037 1 0 1 755.8538 1509.6931 2 1509.6947 -0.0016 0 59.52 2.60E-06 R YASGSSASLGGPESAVA - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4980.4980.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 6217 6961 1 0 1 764.8727 1527.7308 2 1527.7318 -0.0009 0 32.55 0.0018 R ESADPLGAWLQDAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7962.7962.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 6228 5385 1 0 1 766.4433 1530.872 2 1530.877 -0.0049 0 41.88 0.00012 K VLALPEPSPAAPTLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6401.6401.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 6268 5520 1 0 1 769.9294 1537.8443 2 1537.8464 -0.0021 0 84.9 1.50E-08 R LLDAQLATGGIVDPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6534.6534.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 6371 4200 1 0 1 780.9271 1559.8396 2 1559.842 -0.0024 1 57.81 8.10E-06 R VIDRELYQQLQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5157.5157.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 6418 3279 1 0 1 785.4199 1568.8253 2 1568.827 -0.0017 1 64.42 2.90E-06 R LRQLAEEDLAQQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4160.4160.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 6419 3272 1 0 1 523.9492 1568.8258 3 1568.827 -0.0012 1 26.78 0.0069 R LRQLAEEDLAQQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4153.4153.3.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 6947 6717 1 0 1 827.4272 1652.8399 2 1652.841 -0.001 0 17.49 0.038 R DPYTGQSVSLFQALK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7720.7720.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 7000 3484 1 0 1 833.9037 1665.7929 2 1665.7958 -0.0029 1 57.02 1.10E-05 R RYASGSSASLGGPESAVA - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4382.4382.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 7165 3986 1 0 1 564.6439 1690.9098 3 1690.9114 -0.0017 1 56.43 3.10E-05 R LREQLQLLEEQHR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4925.4925.3.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 7293 4835 1 0 1 854.9167 1707.8188 2 1707.8203 -0.0015 0 63.67 1.10E-06 R LLDPEDVDVPQPDEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5842.5842.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 7366 6661 1 0 1 864.953 1727.8915 2 1727.895 -0.0036 0 20.83 0.011 R CITDPQTGLCLLPLK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7666.7666.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 7459 3713 1 0 1 877.9326 1753.8507 2 1753.8483 0.0024 0 80.83 2.60E-08 R SSSVGSSSSYPISPAVSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4629.4629.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 7544 3046 1 0 1 595.3104 1782.9093 3 1782.9112 -0.0019 0 34.98 0.0017 R AALAHSEEVTASQVAATK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3903.3903.3.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 7545 3059 1 0 1 595.3109 1782.9107 3 1782.9112 -0.0004 0 54.28 1.80E-05 R AALAHSEEVTASQVAATK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3918.3918.3.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 7546 3067 1 0 1 892.4632 1782.9118 2 1782.9112 0.0007 0 48.59 2.80E-05 R AALAHSEEVTASQVAATK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3926.3926.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 7600 6183 1 0 1 904.9543 1807.8941 2 1807.8952 -0.0011 0 96.26 1.50E-09 K VQSGSESVIQEYVDLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7194.7194.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 7679 6119 1 0 1 917.9491 1833.8836 2 1833.8857 -0.002 0 93.46 1.70E-09 R QTNLENLDQAFSVAER D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7130.7130.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 7680 6123 1 0 1 612.3019 1833.8838 3 1833.8857 -0.0019 0 38.15 0.00081 R QTNLENLDQAFSVAER D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7134.7134.3.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 7862 4771 1 0 1 957.9558 1913.8971 2 1913.9007 -0.0036 1 18.54 0.027 K GGELVYTDSEARDVFEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5773.5773.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 7953 6346 1 0 1 643.015 1926.023 3 1926.0244 -0.0014 0 24.53 0.005 R CRPDQLTGLSLLPLSEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7354.7354.3.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 7996 6656 1 0 1 653.9847 1958.9322 3 1958.9329 -0.0007 0 29.48 0.0041 R CVEDPETGLCLLPLTDK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7661.7661.3.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 7997 6646 1 0 1 980.4736 1958.9327 2 1958.9329 -0.0002 0 44.01 0.00031 R CVEDPETGLCLLPLTDK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7651.7651.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 8047 5584 1 0 1 665.7029 1994.087 3 1994.0909 -0.0039 0 51.19 3.90E-05 K AGVAAPATQVAQVTLQSVQR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6598.6598.3.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 8124 3742 1 0 1 690.6508 2068.9306 3 2068.9338 -0.0031 0 45.72 5.20E-05 K AYSDPSTGEPATYGELQQR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4661.4661.3.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 2695 533408 101 101 90 90 8370 3458 1 0 1 819.0482 2454.1228 3 2454.1299 -0.0071 1 39.98 0.0002 R ADAKAYSDPSTGEPATYGELQQR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4354.4354.3.dta 1 IPI00740690.1 similar to Plectin-1 337 144727 12 12 11 11 732 2554 1 0 1 398.2021 794.3896 2 794.3922 -0.0027 0 16.01 0.031 R TEYNLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3350.3350.2.dta 1 IPI00740690.1 similar to Plectin-1 337 144727 12 12 11 11 1415 2356 1 0 1 455.7955 909.5764 2 909.576 0.0004 0 36.05 0.00062 K AVVQLKPR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3133.3133.2.dta 1 IPI00740690.1 similar to Plectin-1 337 144727 12 12 11 11 1442 5820 1 0 1 458.2741 914.5336 2 914.5338 -0.0002 0 37.42 0.002 K LLLWSQR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6831.6831.2.dta 1 IPI00740690.1 similar to Plectin-1 337 144727 12 12 11 11 1822 5985 1 0 1 484.2535 966.4924 2 966.4923 0.0001 0 34.14 0.0073 R SWSLATFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6998.6998.2.dta 1 IPI00740690.1 similar to Plectin-1 337 144727 12 12 11 11 2979 3248 1 0 1 560.2769 1118.5393 2 1118.539 0.0003 0 47.49 0.00038 R LQLEACETR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4126.4126.2.dta 1 IPI00740690.1 similar to Plectin-1 337 144727 12 12 11 11 3166 1636 1 0 1 572.3088 1142.603 2 1142.6044 -0.0014 1 29.2 0.017 K IKELQNAGDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2353.2353.2.dta 1 IPI00740690.1 similar to Plectin-1 337 144727 12 12 11 11 3547 5801 1 0 1 595.8416 1189.6687 2 1189.6707 -0.002 0 68.05 1.60E-06 R LLFNDVQTLK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6812.6812.2.dta 1 IPI00740690.1 similar to Plectin-1 337 144727 12 12 11 11 6228 5385 1 0 1 766.4433 1530.872 2 1530.877 -0.0049 0 41.88 0.00012 K VLALPEPSPAAPTLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6401.6401.2.dta 1 IPI00740690.1 similar to Plectin-1 337 144727 12 12 11 11 7293 4835 1 0 1 854.9167 1707.8188 2 1707.8203 -0.0015 0 63.67 1.10E-06 R LLDPEDVDVPQPDEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5842.5842.2.dta 1 IPI00740690.1 similar to Plectin-1 337 144727 12 12 11 11 7679 6119 1 0 1 917.9491 1833.8836 2 1833.8857 -0.002 0 93.46 1.70E-09 R QTNLENLDQAFSVAER D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7130.7130.2.dta 1 IPI00740690.1 similar to Plectin-1 337 144727 12 12 11 11 7680 6123 1 0 1 612.3019 1833.8838 3 1833.8857 -0.0019 0 38.15 0.00081 R QTNLENLDQAFSVAER D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7134.7134.3.dta 1 IPI00740690.1 similar to Plectin-1 337 144727 12 12 11 11 8047 5584 1 0 1 665.7029 1994.087 3 1994.0909 -0.0039 0 51.19 3.90E-05 K AGVAAPATQVAQVTLQSVQR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6598.6598.3.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 255 1569 2 1 1 337.2038 672.393 2 672.3919 0.0012 0 31.03 0.05 K LQASVR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2281.2281.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 300 2893 1 1 1 344.7219 687.4292 2 687.4279 0.0013 0 31.25 0.01 K LVLTSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3736.3736.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 382 4389 2 1 1 353.7103 705.406 2 705.4061 -0.0001 0 23.45 0.037 R FLEIGK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5361.5361.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 628 924 1 1 1 386.7137 771.4129 2 771.4127 0.0002 0 38.32 0.0019 R TPEAVQK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1582.1582.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 826 767 1 1 1 406.7042 811.3938 2 811.3937 0.0001 0 30.55 0.013 K SHQGLDR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1412.1412.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 833 703 1 1 1 407.7033 813.392 2 813.3916 0.0004 0 42.5 0.00066 R CLATHGR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1343.1343.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 835 3898 1 1 1 407.7474 813.4803 2 813.4782 0.0021 0 34.94 0.0025 R VMGLVPAK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4830.4830.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 893 3367 1 1 1 414.7505 827.4865 2 827.4865 0.0001 0 36.31 0.0036 K LLEQGLR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4256.4256.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 1047 4499 1 1 1 423.7454 845.4762 2 845.4759 0.0003 0 48.64 0.00025 K AGLYGLPR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5480.5480.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 1126 5201 1 1 1 432.7251 863.4357 2 863.4357 0 0 43.83 0.0011 R GMGLSLMR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6219.6219.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 1225 1727 1 1 1 439.2533 876.4921 2 876.493 -0.0008 1 23.87 0.042 K RAYLQAR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2452.2452.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 1230 5068 1 1 1 440.2091 878.4036 2 878.4035 0.0001 0 39.2 0.0017 R DGAWGAFR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6083.6083.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 1305 3000 1 1 1 449.2552 896.4958 2 896.4967 -0.001 0 21.42 0.024 K LSPDAIPGK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3852.3852.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 1390 3609 1 1 1 454.2264 906.4383 2 906.4382 0.0002 0 37.67 0.0036 R WVCSSLR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4518.4518.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 1392 1559 1 1 1 454.2295 906.4445 2 906.4447 -0.0002 0 65.22 5.70E-06 R AAEQYTPK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2270.2270.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 1468 3850 1 1 1 461.2434 920.4722 2 920.4716 0.0006 0 28.42 0.036 R QELSFAAR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4778.4778.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 1721 3464 1 1 1 478.7676 955.5207 2 955.5239 -0.0032 0 43.75 0.00019 K HGLYLPTR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4361.4361.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 1731 4242 1 1 1 479.2897 956.5649 2 956.5655 -0.0006 0 75.38 4.40E-07 K GLVQALQTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5203.5203.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 2026 1025 2 1 1 332.2105 993.6096 3 993.6083 0.0013 1 18.23 0.043 K VIREPKPR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1691.1691.3.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 2044 6367 1 1 1 498.3286 994.6426 2 994.6426 0 0 64.36 4.40E-07 R VLEALLPLK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7375.7375.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 2370 3665 1 1 1 519.7646 1037.5147 2 1037.5142 0.0006 0 47.96 0.00024 K YSGTLNLDR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4579.4579.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 2373 5671 1 1 1 519.8323 1037.6501 2 1037.6485 0.0017 0 34.74 0.00059 R GTPLISPLIK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6685.6685.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 2585 2489 1 1 1 535.2673 1068.5201 2 1068.52 0.0001 0 76.62 6.50E-08 R DPSQQELPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3279.3279.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 2737 4365 1 1 1 543.313 1084.6114 2 1084.6128 -0.0014 0 18.6 0.018 R QEPLLIGSTK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5335.5335.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 2951 6156 1 1 1 558.337 1114.6594 2 1114.6598 -0.0004 0 66.51 1.20E-06 R SEGVVAVLLTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7168.7168.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 3118 2805 1 1 1 379.5489 1135.6247 3 1135.6237 0.001 1 37.18 0.0029 R QKLYTLQDK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3634.3634.3.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 3167 895 1 1 1 572.309 1142.6034 2 1142.6044 -0.001 1 31.41 0.018 R ASGRTPEAVQK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1551.1551.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 3546 3906 1 1 1 595.8242 1189.6339 2 1189.6343 -0.0004 0 46.63 0.00034 R SDEAVKPFGLK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4839.4839.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 3558 4091 1 1 1 596.788 1191.5614 2 1191.5628 -0.0014 0 25.64 0.018 R LGMLSPEGTCK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5039.5039.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 3579 2371 1 1 1 597.8271 1193.6396 2 1193.6404 -0.0008 1 61.23 9.60E-06 R VFTTVGSAEKR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3150.3150.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 3580 2364 1 1 1 398.888 1193.6422 3 1193.6404 0.0017 1 22.67 0.036 R VFTTVGSAEKR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3142.3142.3.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 3728 2824 1 1 1 604.7863 1207.558 2 1207.5577 0.0003 0 56.55 1.30E-05 R LGMLSPEGTCK A Oxidation (M) 0.00100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3657.3657.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 3755 1478 1 1 1 606.7922 1211.5699 2 1211.5717 -0.0018 0 19.92 0.037 K QAHTMDPQLR L Oxidation (M) 0.0000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2182.2182.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 3904 2783 1 1 1 616.2617 1230.5088 2 1230.5088 0 0 67.96 6.60E-07 K AFDTAGNGYCR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3607.3607.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 4041 5284 1 1 1 622.384 1242.7535 2 1242.7547 -0.0012 1 54.15 9.20E-06 R SEGVVAVLLTKK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6300.6300.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 4042 5280 1 1 1 415.259 1242.7553 3 1242.7547 0.0005 1 38.29 0.00036 R SEGVVAVLLTKK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6297.6297.3.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 4104 5529 1 1 1 626.3113 1250.608 2 1250.6084 -0.0004 0 70 2.10E-06 R FDASFFGVHPK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6543.6543.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 4105 5528 1 1 1 417.877 1250.6091 3 1250.6084 0.0007 0 46.55 0.00044 R FDASFFGVHPK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6542.6542.3.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 4229 4631 1 1 1 632.3731 1262.7317 2 1262.7347 -0.003 0 60.82 2.00E-06 R LQVVDQPLPVR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5623.5623.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 4444 4269 1 1 1 645.7904 1289.5663 2 1289.5677 -0.0014 0 40.55 0.00047 K VYQWDDPDPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5232.5232.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 4507 3658 1 1 1 649.8389 1297.6632 2 1297.6626 0.0006 0 87.99 1.30E-08 K VGDPQELNGITR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4571.4571.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 4550 4688 1 1 1 651.8394 1301.6643 2 1301.6649 -0.0006 0 67.44 4.20E-06 R AALQEELQLCK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5685.5685.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 4784 2738 1 1 1 665.8639 1329.7132 2 1329.7153 -0.0021 0 22.17 0.0083 R VTAIHIDPATHR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3550.3550.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 4786 2730 1 1 1 444.2458 1329.7155 3 1329.7153 0.0002 0 34.71 0.00056 R VTAIHIDPATHR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3541.3541.3.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 4847 4022 1 1 1 670.3629 1338.7112 2 1338.7143 -0.0032 0 59.98 5.00E-06 R QQEQQVPILEK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4964.4964.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 4955 6456 1 1 1 675.8275 1349.6404 2 1349.6438 -0.0035 0 57.42 7.70E-06 K SFYGSTLFLCR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7462.7462.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 4959 7668 1 1 1 676.3533 1350.692 2 1350.6932 -0.0012 0 51.02 0.00013 R DNLEFFLAGIGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8686.8686.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 4971 5572 1 1 1 676.8708 1351.727 2 1351.7282 -0.0012 0 55.63 2.60E-05 K MVVPGLDGAQIPR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6586.6586.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 5097 4752 1 1 1 684.8676 1367.7207 2 1367.7231 -0.0025 0 46.93 5.10E-05 K MVVPGLDGAQIPR D Oxidation (M) 0.1000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5754.5754.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 5230 6078 1 1 1 693.8766 1385.7386 2 1385.7402 -0.0016 0 87.24 4.30E-08 K GVDLVLNSLAEEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7090.7090.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 5245 2997 1 1 1 694.8204 1387.6263 2 1387.6289 -0.0026 0 62.18 1.50E-06 K ADEASELACPTPK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3848.3848.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 5416 5617 1 1 1 703.8795 1405.7445 2 1405.7388 0.0057 0 17.05 0.025 K VLQGDLVMNVYR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6630.6630.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 5423 5220 1 1 1 704.8658 1407.7171 2 1407.718 -0.0009 0 54.36 2.30E-05 R LSIPTYGLQCTR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6237.6237.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 5514 1755 1 1 1 474.8918 1421.6537 3 1421.6544 -0.0007 0 30.59 0.0014 R CPPGVVPACHNSK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2482.2482.3.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 5519 4776 1 1 1 711.8737 1421.7328 2 1421.7337 -0.0009 0 83.74 1.40E-08 K VLQGDLVMNVYR D Oxidation (M) 0.000000010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5779.5779.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 5537 5687 1 1 1 713.8894 1425.7643 2 1425.765 -0.0007 0 59.76 1.30E-05 R SLLVNPEGPTLMR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6700.6700.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 5671 4876 1 1 1 721.8857 1441.7569 2 1441.7599 -0.003 0 48.04 0.00012 R SLLVNPEGPTLMR L Oxidation (M) 0.0000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5885.5885.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 5847 5086 1 1 1 735.3541 1468.6937 2 1468.6947 -0.001 0 74.2 2.10E-07 R FPQLDSTSFANSR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6102.6102.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 6041 3434 1 1 1 748.4142 1494.8139 2 1494.8154 -0.0015 1 35.08 0.00051 R RQQEQQVPILEK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4328.4328.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 6042 3426 1 1 1 499.2789 1494.815 3 1494.8154 -0.0004 1 40.81 0.00023 R RQQEQQVPILEK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4320.4320.3.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 6307 5172 1 1 1 774.8726 1547.7306 2 1547.7323 -0.0018 0 92.91 7.90E-09 K ACLDTAVENMPSLK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6188.6188.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 6393 3828 1 1 1 782.8706 1563.7267 2 1563.7273 -0.0006 0 70.45 2.70E-07 K ACLDTAVENMPSLK M Oxidation (M) 0.00000000010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4754.4754.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 6664 4089 1 1 1 807.4148 1612.815 2 1612.8169 -0.0018 0 74.34 2.10E-07 K EDGLAQQQTQLNLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5037.5037.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 6747 6110 1 1 1 811.9711 1621.9277 2 1621.9291 -0.0014 0 77.84 5.10E-08 K VVVQVLAEEPEAVLK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7121.7121.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 6854 4531 1 1 1 546.2565 1635.7478 3 1635.7464 0.0014 0 63.45 1.80E-06 K CTVFHGAQVEDAFR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5515.5515.3.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 6926 4228 1 1 1 550.9463 1649.817 3 1649.8195 -0.0025 0 29.43 0.0069 K SNMGHPEPASGLAALAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5187.5187.3.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 7001 3998 1 1 1 556.2783 1665.8129 3 1665.8144 -0.0015 0 25.04 0.0059 K SNMGHPEPASGLAALAK V Oxidation (M) 0.00100000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4938.4938.3.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 7140 5373 1 1 1 843.4454 1684.8763 2 1684.8784 -0.0021 0 34.52 0.0016 K GILADEDSSRPVWLK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6389.6389.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 7296 5432 1 1 1 856.3912 1710.7679 2 1710.7706 -0.0026 0 66.28 6.10E-07 R DPETLVGYSMVGCQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6447.6447.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 7369 5891 1 1 1 865.3954 1728.7763 2 1728.7777 -0.0014 0 66.23 9.60E-07 K WTSQDSLLGMEFSGR D Oxidation (M) 0.000000000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6901.6901.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 7463 4286 1 1 1 879.4812 1756.9479 2 1756.9505 -0.0027 1 60.51 2.10E-06 R ALCATRQEPLLIGSTK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5250.5250.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 7464 4266 1 1 1 586.6569 1756.9489 3 1756.9505 -0.0016 1 34.58 0.00057 R ALCATRQEPLLIGSTK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5229.5229.3.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 7519 3993 1 1 1 887.3829 1772.7513 2 1772.7536 -0.0023 0 99.53 4.20E-10 R GNAGQSNYGFANSAMER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4933.4933.2.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 7780 4256 1 1 1 623.9337 1868.7793 3 1868.7822 -0.0029 0 40.69 0.00029 K FCFTPHTEEGCLSER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5218.5218.3.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 7842 4629 1 1 1 635.6846 1904.0319 3 1904.0367 -0.0048 1 44.49 6.70E-05 K LYTLQDKAQVADVVVSR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5621.5621.3.dta 2 1 IPI00645907.3 fatty acid synthase 2180 275877 76 76 64 64 8188 6131 1 1 1 730.0386 2187.0941 3 2187.0961 -0.002 0 40.01 0.00039 R RPTPQDSPIFLPVDDTSFR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7142.7142.3.dta 2 2 IPI00002894.2 DNA polymerase delta catalytic subunit 78 125035 2 2 2 2 893 3367 1 0 1 414.7505 827.4865 2 827.4865 0.0001 0 36.31 0.0036 R LLEQGIR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4256.4256.2.dta 2 2 IPI00002894.2 DNA polymerase delta catalytic subunit 78 125035 2 2 2 2 3553 5440 1 0 1 596.3217 1190.6288 2 1190.6295 -0.0008 0 64.9 3.20E-06 K LGLTEDQFIR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6456.6456.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 255 1569 2 0 1 337.2038 672.393 2 672.3919 0.0012 0 31.03 0.05 K LQASVR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2281.2281.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 300 2893 1 0 1 344.7219 687.4292 2 687.4279 0.0013 0 31.25 0.01 K LVLTSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3736.3736.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 382 4389 2 0 1 353.7103 705.406 2 705.4061 -0.0001 0 23.45 0.037 R FLEIGK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5361.5361.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 628 924 1 0 1 386.7137 771.4129 2 771.4127 0.0002 0 38.32 0.0019 R TPEAVQK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1582.1582.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 826 767 1 0 1 406.7042 811.3938 2 811.3937 0.0001 0 30.55 0.013 K SHQGLDR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1412.1412.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 833 703 1 0 1 407.7033 813.392 2 813.3916 0.0004 0 42.5 0.00066 R CLATHGR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1343.1343.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 835 3898 1 0 1 407.7474 813.4803 2 813.4782 0.0021 0 34.94 0.0025 R VMGLVPAK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4830.4830.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 893 3367 1 0 1 414.7505 827.4865 2 827.4865 0.0001 0 36.31 0.0036 K LLEQGLR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4256.4256.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 1047 4499 1 0 1 423.7454 845.4762 2 845.4759 0.0003 0 48.64 0.00025 K AGLYGLPR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5480.5480.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 1126 5201 1 0 1 432.7251 863.4357 2 863.4357 0 0 43.83 0.0011 R GMGLSLMR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6219.6219.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 1225 1727 1 0 1 439.2533 876.4921 2 876.493 -0.0008 1 23.87 0.042 K RAYLQAR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2452.2452.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 1230 5068 1 0 1 440.2091 878.4036 2 878.4035 0.0001 0 39.2 0.0017 R DGAWGAFR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6083.6083.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 1305 3000 1 0 1 449.2552 896.4958 2 896.4967 -0.001 0 21.42 0.024 K LSPDAIPGK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3852.3852.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 1390 3609 1 0 1 454.2264 906.4383 2 906.4382 0.0002 0 37.67 0.0036 R WVCSSLR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4518.4518.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 1392 1559 1 0 1 454.2295 906.4445 2 906.4447 -0.0002 0 65.22 5.70E-06 R AAEQYTPK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2270.2270.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 1468 3850 1 0 1 461.2434 920.4722 2 920.4716 0.0006 0 28.42 0.036 R QELSFAAR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4778.4778.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 1721 3464 1 0 1 478.7676 955.5207 2 955.5239 -0.0032 0 43.75 0.00019 K HGLYLPTR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4361.4361.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 2026 1025 2 0 1 332.2105 993.6096 3 993.6083 0.0013 1 18.23 0.043 K VIREPKPR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1691.1691.3.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 2044 6367 1 0 1 498.3286 994.6426 2 994.6426 0 0 64.36 4.40E-07 R VLEALLPLK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7375.7375.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 2370 3665 1 0 1 519.7646 1037.5147 2 1037.5142 0.0006 0 47.96 0.00024 K YSGTLNLDR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4579.4579.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 2373 5671 1 0 1 519.8323 1037.6501 2 1037.6485 0.0017 0 34.74 0.00059 R GTPLISPLIK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6685.6685.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 2585 2489 1 0 1 535.2673 1068.5201 2 1068.52 0.0001 0 76.62 6.50E-08 R DPSQQELPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3279.3279.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 2737 4365 1 0 1 543.313 1084.6114 2 1084.6128 -0.0014 0 18.6 0.018 R QEPLLIGSTK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5335.5335.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 2951 6156 1 0 1 558.337 1114.6594 2 1114.6598 -0.0004 0 66.51 1.20E-06 R SEGVVAVLLTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7168.7168.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 3118 2805 1 0 1 379.5489 1135.6247 3 1135.6237 0.001 1 37.18 0.0029 R QKLYTLQDK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3634.3634.3.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 3167 895 1 0 1 572.309 1142.6034 2 1142.6044 -0.001 1 31.41 0.018 R ASGRTPEAVQK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1551.1551.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 3546 3906 1 0 1 595.8242 1189.6339 2 1189.6343 -0.0004 0 46.63 0.00034 R SDEAVKPFGLK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4839.4839.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 3558 4091 1 0 1 596.788 1191.5614 2 1191.5628 -0.0014 0 25.64 0.018 R LGMLSPEGTCK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5039.5039.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 3579 2371 1 0 1 597.8271 1193.6396 2 1193.6404 -0.0008 1 61.23 9.60E-06 R VFTTVGSAEKR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3150.3150.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 3580 2364 1 0 1 398.888 1193.6422 3 1193.6404 0.0017 1 22.67 0.036 R VFTTVGSAEKR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3142.3142.3.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 3728 2824 1 0 1 604.7863 1207.558 2 1207.5577 0.0003 0 56.55 1.30E-05 R LGMLSPEGTCK A Oxidation (M) 0.00100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3657.3657.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 3755 1478 1 0 1 606.7922 1211.5699 2 1211.5717 -0.0018 0 19.92 0.037 K QAHTMDPQLR L Oxidation (M) 0.0000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2182.2182.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 3904 2783 1 0 1 616.2617 1230.5088 2 1230.5088 0 0 67.96 6.60E-07 K AFDTAGNGYCR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3607.3607.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 4041 5284 1 0 1 622.384 1242.7535 2 1242.7547 -0.0012 1 54.15 9.20E-06 R SEGVVAVLLTKK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6300.6300.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 4042 5280 1 0 1 415.259 1242.7553 3 1242.7547 0.0005 1 38.29 0.00036 R SEGVVAVLLTKK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6297.6297.3.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 4104 5529 1 0 1 626.3113 1250.608 2 1250.6084 -0.0004 0 70 2.10E-06 R FDASFFGVHPK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6543.6543.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 4105 5528 1 0 1 417.877 1250.6091 3 1250.6084 0.0007 0 46.55 0.00044 R FDASFFGVHPK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6542.6542.3.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 4229 4631 1 0 1 632.3731 1262.7317 2 1262.7347 -0.003 0 60.82 2.00E-06 R LQVVDQPLPVR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5623.5623.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 4444 4269 1 0 1 645.7904 1289.5663 2 1289.5677 -0.0014 0 40.55 0.00047 K VYQWDDPDPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5232.5232.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 4507 3658 1 0 1 649.8389 1297.6632 2 1297.6626 0.0006 0 87.99 1.30E-08 K VGDPQELNGITR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4571.4571.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 4550 4688 1 0 1 651.8394 1301.6643 2 1301.6649 -0.0006 0 67.44 4.20E-06 R AALQEELQLCK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5685.5685.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 4784 2738 1 0 1 665.8639 1329.7132 2 1329.7153 -0.0021 0 22.17 0.0083 R VTAIHIDPATHR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3550.3550.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 4786 2730 1 0 1 444.2458 1329.7155 3 1329.7153 0.0002 0 34.71 0.00056 R VTAIHIDPATHR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3541.3541.3.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 4847 4022 1 0 1 670.3629 1338.7112 2 1338.7143 -0.0032 0 59.98 5.00E-06 R QQEQQVPILEK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4964.4964.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 4955 6456 1 0 1 675.8275 1349.6404 2 1349.6438 -0.0035 0 57.42 7.70E-06 K SFYGSTLFLCR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7462.7462.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 4959 7668 1 0 1 676.3533 1350.692 2 1350.6932 -0.0012 0 51.02 0.00013 R DNLEFFLAGIGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8686.8686.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 4971 5572 1 0 1 676.8708 1351.727 2 1351.7282 -0.0012 0 55.63 2.60E-05 K MVVPGLDGAQIPR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6586.6586.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 5097 4752 1 0 1 684.8676 1367.7207 2 1367.7231 -0.0025 0 46.93 5.10E-05 K MVVPGLDGAQIPR D Oxidation (M) 0.1000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5754.5754.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 5230 6078 1 0 1 693.8766 1385.7386 2 1385.7402 -0.0016 0 87.24 4.30E-08 K GVDLVLNSLAEEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7090.7090.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 5245 2997 1 0 1 694.8204 1387.6263 2 1387.6289 -0.0026 0 62.18 1.50E-06 K ADEASELACPTPK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3848.3848.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 5416 5617 1 0 1 703.8795 1405.7445 2 1405.7388 0.0057 0 17.05 0.025 K VLQGDLVMNVYR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6630.6630.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 5423 5220 1 0 1 704.8658 1407.7171 2 1407.718 -0.0009 0 54.36 2.30E-05 R LSIPTYGLQCTR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6237.6237.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 5514 1755 1 0 1 474.8918 1421.6537 3 1421.6544 -0.0007 0 30.59 0.0014 R CPPGVVPACHNSK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2482.2482.3.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 5519 4776 1 0 1 711.8737 1421.7328 2 1421.7337 -0.0009 0 83.74 1.40E-08 K VLQGDLVMNVYR D Oxidation (M) 0.000000010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5779.5779.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 5537 5687 1 0 1 713.8894 1425.7643 2 1425.765 -0.0007 0 59.76 1.30E-05 R SLLVNPEGPTLMR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6700.6700.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 5671 4876 1 0 1 721.8857 1441.7569 2 1441.7599 -0.003 0 48.04 0.00012 R SLLVNPEGPTLMR L Oxidation (M) 0.0000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5885.5885.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 5847 5086 1 0 1 735.3541 1468.6937 2 1468.6947 -0.001 0 74.2 2.10E-07 R FPQLDSTSFANSR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6102.6102.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 6041 3434 1 0 1 748.4142 1494.8139 2 1494.8154 -0.0015 1 35.08 0.00051 R RQQEQQVPILEK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4328.4328.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 6042 3426 1 0 1 499.2789 1494.815 3 1494.8154 -0.0004 1 40.81 0.00023 R RQQEQQVPILEK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4320.4320.3.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 6307 5172 1 0 1 774.8726 1547.7306 2 1547.7323 -0.0018 0 92.91 7.90E-09 K ACLDTAVENMPSLK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6188.6188.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 6393 3828 1 0 1 782.8706 1563.7267 2 1563.7273 -0.0006 0 70.45 2.70E-07 K ACLDTAVENMPSLK M Oxidation (M) 0.00000000010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4754.4754.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 6664 4089 1 0 1 807.4148 1612.815 2 1612.8169 -0.0018 0 74.34 2.10E-07 K EDGLAQQQTQLNLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5037.5037.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 6747 6110 1 0 1 811.9711 1621.9277 2 1621.9291 -0.0014 0 77.84 5.10E-08 K VVVQVLAEEPEAVLK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7121.7121.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 6854 4531 1 0 1 546.2565 1635.7478 3 1635.7464 0.0014 0 63.45 1.80E-06 K CTVFHGAQVEDAFR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5515.5515.3.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 6926 4228 1 0 1 550.9463 1649.817 3 1649.8195 -0.0025 0 29.43 0.0069 K SNMGHPEPASGLAALAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5187.5187.3.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 7001 3998 1 0 1 556.2783 1665.8129 3 1665.8144 -0.0015 0 25.04 0.0059 K SNMGHPEPASGLAALAK V Oxidation (M) 0.00100000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4938.4938.3.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 7140 5373 1 0 1 843.4454 1684.8763 2 1684.8784 -0.0021 0 34.52 0.0016 K GILADEDSSRPVWLK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6389.6389.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 7296 5432 1 0 1 856.3912 1710.7679 2 1710.7706 -0.0026 0 66.28 6.10E-07 R DPETLVGYSMVGCQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6447.6447.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 7369 5891 1 0 1 865.3954 1728.7763 2 1728.7777 -0.0014 0 66.23 9.60E-07 K WTSQDSLLGMEFSGR D Oxidation (M) 0.000000000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6901.6901.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 7463 4286 1 0 1 879.4812 1756.9479 2 1756.9505 -0.0027 1 60.51 2.10E-06 R ALCATRQEPLLIGSTK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5250.5250.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 7464 4266 1 0 1 586.6569 1756.9489 3 1756.9505 -0.0016 1 34.58 0.00057 R ALCATRQEPLLIGSTK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5229.5229.3.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 7519 3993 1 0 1 887.3829 1772.7513 2 1772.7536 -0.0023 0 99.53 4.20E-10 R GNAGQSNYGFANSAMER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4933.4933.2.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 7780 4256 1 0 1 623.9337 1868.7793 3 1868.7822 -0.0029 0 40.69 0.00029 K FCFTPHTEEGCLSER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5218.5218.3.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 7842 4629 1 0 1 635.6846 1904.0319 3 1904.0367 -0.0048 1 44.49 6.70E-05 K LYTLQDKAQVADVVVSR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5621.5621.3.dta 2 IPI00026781.2 Fatty acid synthase 2129 275850 75 75 63 63 8188 6131 1 0 1 730.0386 2187.0941 3 2187.0961 -0.002 0 40.01 0.00039 R RPTPQDSPIFLPVDDTSFR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7142.7142.3.dta 2 IPI00793768.1 Protein 1220 133622 39 39 33 33 255 1569 2 0 1 337.2038 672.393 2 672.3919 0.0012 0 31.03 0.05 K LQASVR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2281.2281.2.dta 2 IPI00793768.1 Protein 1220 133622 39 39 33 33 382 4389 2 0 1 353.7103 705.406 2 705.4061 -0.0001 0 23.45 0.037 R FLEIGK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5361.5361.2.dta 2 IPI00793768.1 Protein 1220 133622 39 39 33 33 826 767 1 0 1 406.7042 811.3938 2 811.3937 0.0001 0 30.55 0.013 K SHQGLDR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1412.1412.2.dta 2 IPI00793768.1 Protein 1220 133622 39 39 33 33 833 703 1 0 1 407.7033 813.392 2 813.3916 0.0004 0 42.5 0.00066 R CLATHGR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1343.1343.2.dta 2 IPI00793768.1 Protein 1220 133622 39 39 33 33 835 3898 1 0 1 407.7474 813.4803 2 813.4782 0.0021 0 34.94 0.0025 R VMGLVPAK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4830.4830.2.dta 2 IPI00793768.1 Protein 1220 133622 39 39 33 33 1225 1727 1 0 1 439.2533 876.4921 2 876.493 -0.0008 1 23.87 0.042 K RAYLQAR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2452.2452.2.dta 2 IPI00793768.1 Protein 1220 133622 39 39 33 33 1230 5068 1 0 1 440.2091 878.4036 2 878.4035 0.0001 0 39.2 0.0017 R DGAWGAFR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6083.6083.2.dta 2 IPI00793768.1 Protein 1220 133622 39 39 33 33 1305 3000 1 0 1 449.2552 896.4958 2 896.4967 -0.001 0 21.42 0.024 K LSPDAIPGK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3852.3852.2.dta 2 IPI00793768.1 Protein 1220 133622 39 39 33 33 1390 3609 1 0 1 454.2264 906.4383 2 906.4382 0.0002 0 37.67 0.0036 R WVCSSLR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4518.4518.2.dta 2 IPI00793768.1 Protein 1220 133622 39 39 33 33 1392 1559 1 0 1 454.2295 906.4445 2 906.4447 -0.0002 0 65.22 5.70E-06 R AAEQYTPK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2270.2270.2.dta 2 IPI00793768.1 Protein 1220 133622 39 39 33 33 1468 3850 1 0 1 461.2434 920.4722 2 920.4716 0.0006 0 28.42 0.036 R QELSFAAR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4778.4778.2.dta 2 IPI00793768.1 Protein 1220 133622 39 39 33 33 1731 4242 1 0 1 479.2897 956.5649 2 956.5655 -0.0006 0 75.38 4.40E-07 K GLVQALQTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5203.5203.2.dta 2 IPI00793768.1 Protein 1220 133622 39 39 33 33 2044 6367 1 0 1 498.3286 994.6426 2 994.6426 0 0 64.36 4.40E-07 R VLEALLPLK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7375.7375.2.dta 2 IPI00793768.1 Protein 1220 133622 39 39 33 33 2585 2489 1 0 1 535.2673 1068.5201 2 1068.52 0.0001 0 76.62 6.50E-08 R DPSQQELPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3279.3279.2.dta 2 IPI00793768.1 Protein 1220 133622 39 39 33 33 3579 2371 1 0 1 597.8271 1193.6396 2 1193.6404 -0.0008 1 61.23 9.60E-06 R VFTTVGSAEKR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3150.3150.2.dta 2 IPI00793768.1 Protein 1220 133622 39 39 33 33 3580 2364 1 0 1 398.888 1193.6422 3 1193.6404 0.0017 1 22.67 0.036 R VFTTVGSAEKR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3142.3142.3.dta 2 IPI00793768.1 Protein 1220 133622 39 39 33 33 4550 4688 1 0 1 651.8394 1301.6643 2 1301.6649 -0.0006 0 67.44 4.20E-06 R AALQEELQLCK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5685.5685.2.dta 2 IPI00793768.1 Protein 1220 133622 39 39 33 33 4847 4022 1 0 1 670.3629 1338.7112 2 1338.7143 -0.0032 0 59.98 5.00E-06 R QQEQQVPILEK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4964.4964.2.dta 2 IPI00793768.1 Protein 1220 133622 39 39 33 33 4955 6456 1 0 1 675.8275 1349.6404 2 1349.6438 -0.0035 0 57.42 7.70E-06 K SFYGSTLFLCR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7462.7462.2.dta 2 IPI00793768.1 Protein 1220 133622 39 39 33 33 4971 5572 1 0 1 676.8708 1351.727 2 1351.7282 -0.0012 0 55.63 2.60E-05 K MVVPGLDGAQIPR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6586.6586.2.dta 2 IPI00793768.1 Protein 1220 133622 39 39 33 33 5097 4752 1 0 1 684.8676 1367.7207 2 1367.7231 -0.0025 0 46.93 5.10E-05 K MVVPGLDGAQIPR D Oxidation (M) 0.1000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5754.5754.2.dta 2 IPI00793768.1 Protein 1220 133622 39 39 33 33 5230 6078 1 0 1 693.8766 1385.7386 2 1385.7402 -0.0016 0 87.24 4.30E-08 K GVDLVLNSLAEEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7090.7090.2.dta 2 IPI00793768.1 Protein 1220 133622 39 39 33 33 5245 2997 1 0 1 694.8204 1387.6263 2 1387.6289 -0.0026 0 62.18 1.50E-06 K ADEASELACPTPK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3848.3848.2.dta 2 IPI00793768.1 Protein 1220 133622 39 39 33 33 5416 5617 1 0 1 703.8795 1405.7445 2 1405.7388 0.0057 0 17.05 0.025 K VLQGDLVMNVYR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6630.6630.2.dta 2 IPI00793768.1 Protein 1220 133622 39 39 33 33 5423 5220 1 0 1 704.8658 1407.7171 2 1407.718 -0.0009 0 54.36 2.30E-05 R LSIPTYGLQCTR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6237.6237.2.dta 2 IPI00793768.1 Protein 1220 133622 39 39 33 33 5519 4776 1 0 1 711.8737 1421.7328 2 1421.7337 -0.0009 0 83.74 1.40E-08 K VLQGDLVMNVYR D Oxidation (M) 0.000000010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5779.5779.2.dta 2 IPI00793768.1 Protein 1220 133622 39 39 33 33 5537 5687 1 0 1 713.8894 1425.7643 2 1425.765 -0.0007 0 59.76 1.30E-05 R SLLVNPEGPTLMR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6700.6700.2.dta 2 IPI00793768.1 Protein 1220 133622 39 39 33 33 5671 4876 1 0 1 721.8857 1441.7569 2 1441.7599 -0.003 0 48.04 0.00012 R SLLVNPEGPTLMR L Oxidation (M) 0.0000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5885.5885.2.dta 2 IPI00793768.1 Protein 1220 133622 39 39 33 33 5847 5086 1 0 1 735.3541 1468.6937 2 1468.6947 -0.001 0 74.2 2.10E-07 R FPQLDSTSFANSR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6102.6102.2.dta 2 IPI00793768.1 Protein 1220 133622 39 39 33 33 6041 3434 1 0 1 748.4142 1494.8139 2 1494.8154 -0.0015 1 35.08 0.00051 R RQQEQQVPILEK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4328.4328.2.dta 2 IPI00793768.1 Protein 1220 133622 39 39 33 33 6042 3426 1 0 1 499.2789 1494.815 3 1494.8154 -0.0004 1 40.81 0.00023 R RQQEQQVPILEK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4320.4320.3.dta 2 IPI00793768.1 Protein 1220 133622 39 39 33 33 6307 5172 1 0 1 774.8726 1547.7306 2 1547.7323 -0.0018 0 92.91 7.90E-09 K ACLDTAVENMPSLK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6188.6188.2.dta 2 IPI00793768.1 Protein 1220 133622 39 39 33 33 6393 3828 1 0 1 782.8706 1563.7267 2 1563.7273 -0.0006 0 70.45 2.70E-07 K ACLDTAVENMPSLK M Oxidation (M) 0.00000000010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4754.4754.2.dta 2 IPI00793768.1 Protein 1220 133622 39 39 33 33 6664 4089 1 0 1 807.4148 1612.815 2 1612.8169 -0.0018 0 74.34 2.10E-07 K EDGLAQQQTQLNLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5037.5037.2.dta 2 IPI00793768.1 Protein 1220 133622 39 39 33 33 6854 4531 1 0 1 546.2565 1635.7478 3 1635.7464 0.0014 0 63.45 1.80E-06 K CTVFHGAQVEDAFR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5515.5515.3.dta 2 IPI00793768.1 Protein 1220 133622 39 39 33 33 7140 5373 1 0 1 843.4454 1684.8763 2 1684.8784 -0.0021 0 34.52 0.0016 K GILADEDSSRPVWLK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6389.6389.2.dta 2 IPI00793768.1 Protein 1220 133622 39 39 33 33 7369 5891 1 0 1 865.3954 1728.7763 2 1728.7777 -0.0014 0 66.23 9.60E-07 K WTSQDSLLGMEFSGR D Oxidation (M) 0.000000000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6901.6901.2.dta 2 IPI00793768.1 Protein 1220 133622 39 39 33 33 7780 4256 1 0 1 623.9337 1868.7793 3 1868.7822 -0.0029 0 40.69 0.00029 K FCFTPHTEEGCLSER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5218.5218.3.dta 2 IPI00793768.1 Protein 1220 133622 39 39 33 33 8188 6131 1 0 1 730.0386 2187.0941 3 2187.0961 -0.002 0 40.01 0.00039 R RPTPQDSPIFLPVDDTSFR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7142.7142.3.dta 2 IPI00795589.1 73 kDa protein 492 73882 13 13 12 12 300 2893 1 0 1 344.7219 687.4292 2 687.4279 0.0013 0 31.25 0.01 K LVLTSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3736.3736.2.dta 2 IPI00795589.1 73 kDa protein 492 73882 13 13 12 12 826 767 1 0 1 406.7042 811.3938 2 811.3937 0.0001 0 30.55 0.013 K SHQGLDR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1412.1412.2.dta 2 IPI00795589.1 73 kDa protein 492 73882 13 13 12 12 1392 1559 1 0 1 454.2295 906.4445 2 906.4447 -0.0002 0 65.22 5.70E-06 R AAEQYTPK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2270.2270.2.dta 2 IPI00795589.1 73 kDa protein 492 73882 13 13 12 12 1468 3850 1 0 1 461.2434 920.4722 2 920.4716 0.0006 0 28.42 0.036 R QELSFAAR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4778.4778.2.dta 2 IPI00795589.1 73 kDa protein 492 73882 13 13 12 12 2044 6367 1 0 1 498.3286 994.6426 2 994.6426 0 0 64.36 4.40E-07 R VLEALLPLK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7375.7375.2.dta 2 IPI00795589.1 73 kDa protein 492 73882 13 13 12 12 2370 3665 1 0 1 519.7646 1037.5147 2 1037.5142 0.0006 0 47.96 0.00024 K YSGTLNLDR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4579.4579.2.dta 2 IPI00795589.1 73 kDa protein 492 73882 13 13 12 12 5245 2997 1 0 1 694.8204 1387.6263 2 1387.6289 -0.0026 0 62.18 1.50E-06 K ADEASELACPTPK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3848.3848.2.dta 2 IPI00795589.1 73 kDa protein 492 73882 13 13 12 12 5423 5220 1 0 1 704.8658 1407.7171 2 1407.718 -0.0009 0 54.36 2.30E-05 R LSIPTYGLQCTR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6237.6237.2.dta 2 IPI00795589.1 73 kDa protein 492 73882 13 13 12 12 5537 5687 1 0 1 713.8894 1425.7643 2 1425.765 -0.0007 0 59.76 1.30E-05 R SLLVNPEGPTLMR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6700.6700.2.dta 2 IPI00795589.1 73 kDa protein 492 73882 13 13 12 12 5671 4876 1 0 1 721.8857 1441.7569 2 1441.7599 -0.003 0 48.04 0.00012 R SLLVNPEGPTLMR L Oxidation (M) 0.0000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5885.5885.2.dta 2 IPI00795589.1 73 kDa protein 492 73882 13 13 12 12 6664 4089 1 0 1 807.4148 1612.815 2 1612.8169 -0.0018 0 74.34 2.10E-07 K EDGLAQQQTQLNLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5037.5037.2.dta 2 IPI00795589.1 73 kDa protein 492 73882 13 13 12 12 6747 6110 1 0 1 811.9711 1621.9277 2 1621.9291 -0.0014 0 77.84 5.10E-08 K VVVQVLAEEPEAVLK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7121.7121.2.dta 2 IPI00795589.1 73 kDa protein 492 73882 13 13 12 12 7519 3993 1 0 1 887.3829 1772.7513 2 1772.7536 -0.0023 0 99.53 4.20E-10 R GNAGQSNYGFANSAMER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4933.4933.2.dta 2 IPI00792768.1 27 kDa protein 223 27705 8 8 7 7 255 1569 2 0 1 337.2038 672.393 2 672.3919 0.0012 0 31.03 0.05 K LQASVR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2281.2281.2.dta 2 IPI00792768.1 27 kDa protein 223 27705 8 8 7 7 833 703 1 0 1 407.7033 813.392 2 813.3916 0.0004 0 42.5 0.00066 R CLATHGR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1343.1343.2.dta 2 IPI00792768.1 27 kDa protein 223 27705 8 8 7 7 1225 1727 1 0 1 439.2533 876.4921 2 876.493 -0.0008 1 23.87 0.042 K RAYLQAR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2452.2452.2.dta 2 IPI00792768.1 27 kDa protein 223 27705 8 8 7 7 2370 3665 1 0 1 519.7646 1037.5147 2 1037.5142 0.0006 0 47.96 0.00024 K YSGTLNLDR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4579.4579.2.dta 2 IPI00792768.1 27 kDa protein 223 27705 8 8 7 7 3579 2371 1 0 1 597.8271 1193.6396 2 1193.6404 -0.0008 1 61.23 9.60E-06 R VFTTVGSAEKR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3150.3150.2.dta 2 IPI00792768.1 27 kDa protein 223 27705 8 8 7 7 3580 2364 1 0 1 398.888 1193.6422 3 1193.6404 0.0017 1 22.67 0.036 R VFTTVGSAEKR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3142.3142.3.dta 2 IPI00792768.1 27 kDa protein 223 27705 8 8 7 7 5230 6078 1 0 1 693.8766 1385.7386 2 1385.7402 -0.0016 0 87.24 4.30E-08 K GVDLVLNSLAEEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7090.7090.2.dta 2 IPI00792768.1 27 kDa protein 223 27705 8 8 7 7 5847 5086 1 0 1 735.3541 1468.6937 2 1468.6947 -0.001 0 74.2 2.10E-07 R FPQLDSTSFANSR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6102.6102.2.dta 2 IPI00795588.1 Protein 122 25373 4 4 4 4 826 767 1 0 1 406.7042 811.3938 2 811.3937 0.0001 0 30.55 0.013 K SHQGLDR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1412.1412.2.dta 2 IPI00795588.1 Protein 122 25373 4 4 4 4 1392 1559 1 0 1 454.2295 906.4445 2 906.4447 -0.0002 0 65.22 5.70E-06 R AAEQYTPK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2270.2270.2.dta 2 IPI00795588.1 Protein 122 25373 4 4 4 4 1468 3850 1 0 1 461.2434 920.4722 2 920.4716 0.0006 0 28.42 0.036 R QELSFAAR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4778.4778.2.dta 2 IPI00795588.1 Protein 122 25373 4 4 4 4 2044 6367 1 0 1 498.3286 994.6426 2 994.6426 0 0 64.36 4.40E-07 R VLEALLPLK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7375.7375.2.dta 2 IPI00292181.4 Mitogen-activated protein kinase kinase kinase 12 31 94130 1 1 1 1 3167 895 1 0 1 572.309 1142.6034 2 1142.6084 -0.005 1 31.41 0.018 R FHGEEVAVKK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1551.1551.2.dta 3 1 IPI00302592.2 "filamin A, alpha" 1352 282581 49 49 44 44 547 1738 1 1 0 378.7053 755.396 2 755.3926 0.0034 0 58.02 2.20E-05 R AGGPGLER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2464.2464.2.dta 3 1 IPI00302592.2 "filamin A, alpha" 1352 282581 49 49 44 44 681 1767 1 1 1 393.7086 785.4026 2 785.4032 -0.0006 0 39.58 0.0016 K AEGPGLSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2495.2495.2.dta 3 1 IPI00302592.2 "filamin A, alpha" 1352 282581 49 49 44 44 715 2108 1 1 1 395.7269 789.4392 2 789.4385 0.0007 0 30.08 0.0078 K VYGPGVAK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2865.2865.2.dta 3 1 IPI00302592.2 "filamin A, alpha" 1352 282581 49 49 44 44 931 527 1 1 1 418.2485 834.4825 2 834.4824 0 1 36.48 0.00038 K HGGKAPLR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1152.1152.2.dta 3 1 IPI00302592.2 "filamin A, alpha" 1352 282581 49 49 44 44 1212 1878 1 1 1 438.2059 874.3973 2 874.3967 0.0006 0 53.07 6.50E-05 K CSGPGLER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2616.2616.2.dta 3 1 IPI00302592.2 "filamin A, alpha" 1352 282581 49 49 44 44 1249 3487 1 1 1 441.7737 881.5329 2 881.5334 -0.0005 0 37.45 0.00073 K AGVAPLQVK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4386.4386.2.dta 3 1 IPI00302592.2 "filamin A, alpha" 1352 282581 49 49 44 44 1591 1666 1 1 1 313.1715 936.4926 3 936.4916 0.001 1 21.36 0.03 R VKETADFK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2386.2386.3.dta 3 1 IPI00302592.2 "filamin A, alpha" 1352 282581 49 49 44 44 1848 5502 1 1 0 486.2873 970.56 2 970.56 0.0001 0 48.43 0.00024 R LLGWIQNK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6517.6517.2.dta 3 1 IPI00302592.2 "filamin A, alpha" 1352 282581 49 49 44 44 2134 2394 1 1 0 504.2671 1006.5196 2 1006.5196 0 0 46.93 0.00018 K IQQNTFTR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3175.3175.2.dta 3 1 IPI00302592.2 "filamin A, alpha" 1352 282581 49 49 44 44 2177 1664 1 1 1 507.2904 1012.5662 2 1012.5665 -0.0003 1 40.22 0.0011 K VKAEGPGLSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2384.2384.2.dta 3 1 IPI00302592.2 "filamin A, alpha" 1352 282581 49 49 44 44 2178 1663 1 1 1 338.5299 1012.568 3 1012.5665 0.0015 1 37.42 0.0029 K VKAEGPGLSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2383.2383.3.dta 3 1 IPI00302592.2 "filamin A, alpha" 1352 282581 49 49 44 44 2310 2692 1 1 1 515.729 1029.4435 2 1029.4437 -0.0003 0 48.69 5.10E-05 K SSFTVDCSK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3500.3500.2.dta 3 1 IPI00302592.2 "filamin A, alpha" 1352 282581 49 49 44 44 2676 971 1 1 1 540.2826 1078.5506 2 1078.552 -0.0013 0 60.09 2.30E-06 R VNVGAGSHPNK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1633.1633.2.dta 3 1 IPI00302592.2 "filamin A, alpha" 1352 282581 49 49 44 44 2717 4814 1 1 1 542.2715 1082.5284 2 1082.5284 0 0 42.41 0.00028 K SPFEVYVDK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5819.5819.2.dta 3 1 IPI00302592.2 "filamin A, alpha" 1352 282581 49 49 44 44 2739 6103 1 1 1 543.3162 1084.6178 2 1084.6168 0.001 0 29.44 0.021 R LYSVSYLLK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7115.7115.2.dta 3 1 IPI00302592.2 "filamin A, alpha" 1352 282581 49 49 44 44 2760 3958 1 1 1 544.7857 1087.5569 2 1087.5583 -0.0015 0 64.96 7.30E-06 R TPCEEILVK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4895.4895.2.dta 3 1 IPI00302592.2 "filamin A, alpha" 1352 282581 49 49 44 44 2879 5152 1 1 1 554.306 1106.5975 2 1106.5972 0.0003 0 47.02 0.00015 K LDVQFSGLTK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6169.6169.2.dta 3 1 IPI00302592.2 "filamin A, alpha" 1352 282581 49 49 44 44 2885 2731 1 1 1 554.7906 1107.5666 2 1107.5673 -0.0006 1 34.23 0.0069 K RAEFTVETR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3542.3542.2.dta 3 1 IPI00302592.2 "filamin A, alpha" 1352 282581 49 49 44 44 2888 1611 1 1 1 554.8085 1107.6024 2 1107.6037 -0.0013 0 41.81 0.00023 R ALTQTGGPHVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2326.2326.2.dta 3 1 IPI00302592.2 "filamin A, alpha" 1352 282581 49 49 44 44 2889 1617 1 1 1 370.2094 1107.6063 3 1107.6037 0.0026 0 18.31 0.019 R ALTQTGGPHVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2333.2333.3.dta 3 1 IPI00302592.2 "filamin A, alpha" 1352 282581 49 49 44 44 3232 3633 1 1 1 576.3182 1150.6218 2 1150.6234 -0.0016 1 62.48 7.70E-06 K DKGEYTLVVK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4544.4544.2.dta 3 1 IPI00302592.2 "filamin A, alpha" 1352 282581 49 49 44 44 4392 6113 1 1 1 643.3661 1284.7176 2 1284.719 -0.0014 0 35.09 0.0041 K LPQLPITNFSR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7124.7124.2.dta 3 1 IPI00302592.2 "filamin A, alpha" 1352 282581 49 49 44 44 4447 3913 1 1 1 645.8265 1289.6385 2 1289.6404 -0.0019 0 29.88 0.0023 K YGGQPVPNFPSK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4846.4846.2.dta 3 1 IPI00302592.2 "filamin A, alpha" 1352 282581 49 49 44 44 5069 3310 1 1 1 682.8568 1363.6991 2 1363.6984 0.0007 1 51.95 3.30E-05 K VDVGKDQEFTVK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4194.4194.2.dta 3 1 IPI00302592.2 "filamin A, alpha" 1352 282581 49 49 44 44 5358 5475 1 1 1 700.827 1399.6394 2 1399.6408 -0.0014 0 45.94 0.0003 K YGGDEIPFSPYR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6490.6490.2.dta 3 1 IPI00302592.2 "filamin A, alpha" 1352 282581 49 49 44 44 5458 5344 1 1 1 708.3771 1414.7397 2 1414.7416 -0.0019 0 73.7 1.20E-07 R IANLQTDLSDGLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6360.6360.2.dta 3 1 IPI00302592.2 "filamin A, alpha" 1352 282581 49 49 44 44 5466 3936 1 1 1 709.4031 1416.7916 2 1416.7936 -0.002 1 54.56 3.20E-05 R RLTVSSLQESGLK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4871.4871.2.dta 3 1 IPI00302592.2 "filamin A, alpha" 1352 282581 49 49 44 44 5467 3932 1 1 1 473.2717 1416.7934 3 1416.7936 -0.0003 1 26.2 0.0038 R RLTVSSLQESGLK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4867.4867.3.dta 3 1 IPI00302592.2 "filamin A, alpha" 1352 282581 49 49 44 44 5564 3523 1 1 1 715.362 1428.7094 2 1428.711 -0.0015 0 66.15 1.40E-06 K AFGPGLQGGSAGSPAR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4425.4425.2.dta 3 1 IPI00302592.2 "filamin A, alpha" 1352 282581 49 49 44 44 5587 4054 1 1 1 717.3575 1432.7005 2 1432.702 -0.0015 0 43.04 0.00075 R AYGPGIEPTGNMVK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4999.4999.2.dta 3 1 IPI00302592.2 "filamin A, alpha" 1352 282581 49 49 44 44 5598 4255 1 1 1 717.863 1433.7115 2 1433.7151 -0.0035 0 72.83 1.10E-06 R ANLPQSFQVDTSK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5217.5217.2.dta 3 1 IPI00302592.2 "filamin A, alpha" 1352 282581 49 49 44 44 5667 1716 1 1 1 721.8523 1441.69 2 1441.691 -0.0009 0 78.58 2.20E-07 R AGQSAAGAAPGGGVDTR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2440.2440.2.dta 3 1 IPI00302592.2 "filamin A, alpha" 1352 282581 49 49 44 44 5714 3271 1 1 1 725.3557 1448.6968 2 1448.697 -0.0002 0 28.63 0.0061 R AYGPGIEPTGNMVK K Oxidation (M) 0.00000000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4152.4152.2.dta 3 1 IPI00302592.2 "filamin A, alpha" 1352 282581 49 49 44 44 6055 5141 1 1 1 750.8799 1499.7453 2 1499.7467 -0.0014 0 104.58 6.20E-10 K DAGEGGLSLAIEGPSK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6158.6158.2.dta 3 1 IPI00302592.2 "filamin A, alpha" 1352 282581 49 49 44 44 6233 6602 1 1 1 767.3892 1532.7638 2 1532.7623 0.0014 0 39.23 0.00032 R AEAGVPAEFSIWTR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7608.7608.2.dta 3 1 IPI00302592.2 "filamin A, alpha" 1352 282581 49 49 44 44 6235 5967 1 1 1 767.4108 1532.807 2 1532.8086 -0.0016 0 52.57 9.70E-05 K SPFSVAVSPSLDLSK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6978.6978.2.dta 3 1 IPI00302592.2 "filamin A, alpha" 1352 282581 49 49 44 44 6422 4400 1 1 1 785.9059 1569.7973 2 1569.7998 -0.0025 0 74.4 3.20E-07 R GAGTGGLGLAVEGPSEAK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5373.5373.2.dta 3 1 IPI00302592.2 "filamin A, alpha" 1352 282581 49 49 44 44 6631 3596 1 1 1 534.9269 1601.759 3 1601.7587 0.0003 0 30.5 0.0019 K YNEQHVPGSPFTAR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4504.4504.3.dta 3 1 IPI00302592.2 "filamin A, alpha" 1352 282581 49 49 44 44 6798 1196 1 1 1 545.6248 1633.8524 3 1633.8536 -0.0012 0 44.49 0.00012 R VHGPGIQSGTTNKPNK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1877.1877.3.dta 3 1 IPI00302592.2 "filamin A, alpha" 1352 282581 49 49 44 44 6906 3694 1 1 1 549.6298 1645.8676 3 1645.8675 0.0001 0 32.61 0.00087 K TGVAVNKPAEFTVDAK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4609.4609.3.dta 3 1 IPI00302592.2 "filamin A, alpha" 1352 282581 49 49 44 44 6940 3281 1 1 1 826.9371 1651.8596 2 1651.8529 0.0067 0 71.4 1.40E-06 K VTAQGPGLEPSGNIANK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4163.4163.2.dta 3 1 IPI00302592.2 "filamin A, alpha" 1352 282581 49 49 44 44 7250 3440 1 1 1 566.9761 1697.9066 3 1697.9101 -0.0035 0 16.58 0.028 R TGVELGKPTHFTVNAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4335.4335.3.dta 3 1 IPI00302592.2 "filamin A, alpha" 1352 282581 49 49 44 44 7462 4197 1 1 1 586.2838 1755.8294 3 1755.8315 -0.0021 1 33.5 0.00072 K SPFEVYVDKSQGDASK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5154.5154.3.dta 3 1 IPI00302592.2 "filamin A, alpha" 1352 282581 49 49 44 44 7549 4779 1 1 1 892.9448 1783.8751 2 1783.8775 -0.0024 0 103.7 7.30E-10 R VQVQDNEGCPVEALVK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5782.5782.2.dta 3 1 IPI00302592.2 "filamin A, alpha" 1352 282581 49 49 44 44 7561 1441 1 1 1 895.4175 1788.8204 2 1788.8213 -0.0009 0 46.73 4.10E-05 K ATCAPQHGAPGPGPADASK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2142.2142.2.dta 3 1 IPI00302592.2 "filamin A, alpha" 1352 282581 49 49 44 44 7609 3326 1 1 1 907.9812 1813.9479 2 1813.9534 -0.0056 1 51.45 1.50E-05 K VAQPTITDNKDGTVTVR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4211.4211.2.dta 3 1 IPI00302592.2 "filamin A, alpha" 1352 282581 49 49 44 44 7965 5407 1 1 1 969.5117 1937.0088 2 1937.0106 -0.0018 0 39.64 0.00019 K DAGEGLLAVQITDPEGKPK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6422.6422.2.dta 3 1 IPI00302592.2 "filamin A, alpha" 1352 282581 49 49 44 44 7966 5386 1 1 1 646.6777 1937.0112 3 1937.0106 0.0006 0 35.22 0.0022 K DAGEGLLAVQITDPEGKPK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6402.6402.3.dta 3 1 IPI00302592.2 "filamin A, alpha" 1352 282581 49 49 44 44 8113 3394 1 1 1 686.6487 2056.9242 3 2056.9272 -0.003 0 47.61 3.40E-05 K THEAEIVEGENHTYCIR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4285.4285.3.dta 3 2 IPI00289334.1 Isoform 1 of Filamin-B 728 280188 28 28 26 26 547 1738 1 0 0 378.7053 755.396 2 755.3926 0.0034 0 58.02 2.20E-05 R AGGPGLER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2464.2464.2.dta 3 2 IPI00289334.1 Isoform 1 of Filamin-B 728 280188 28 28 26 26 700 4526 1 0 1 394.2317 786.4488 2 786.4487 0.0001 0 34.13 0.0075 K GLEELVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5509.5509.2.dta 3 2 IPI00289334.1 Isoform 1 of Filamin-B 728 280188 28 28 26 26 923 2594 1 0 1 417.721 833.4275 2 833.4283 -0.0008 0 31.29 0.016 R AYGPGLEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3393.3393.2.dta 3 2 IPI00289334.1 Isoform 1 of Filamin-B 728 280188 28 28 26 26 1111 3166 1 0 1 430.7355 859.4565 2 859.4552 0.0012 0 35.1 0.0013 K VFGPGVER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4037.4037.2.dta 3 2 IPI00289334.1 Isoform 1 of Filamin-B 728 280188 28 28 26 26 1306 1902 1 0 1 449.261 896.5074 2 896.508 -0.0006 0 34.61 0.0021 R VQAQGPGLK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2642.2642.2.dta 3 2 IPI00289334.1 Isoform 1 of Filamin-B 728 280188 28 28 26 26 1848 5502 1 0 0 486.2873 970.56 2 970.56 0.0001 0 48.43 0.00024 R LLGWIQNK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6517.6517.2.dta 3 2 IPI00289334.1 Isoform 1 of Filamin-B 728 280188 28 28 26 26 1931 3261 1 0 1 492.2858 982.557 2 982.556 0.0011 0 52.52 2.20E-05 K IAGPGLGSGVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4141.4141.2.dta 3 2 IPI00289334.1 Isoform 1 of Filamin-B 728 280188 28 28 26 26 1946 1500 1 0 1 493.2873 984.5601 2 984.5604 -0.0003 1 18.14 0.023 K VKAEGPGLSK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2206.2206.2.dta 3 2 IPI00289334.1 Isoform 1 of Filamin-B 728 280188 28 28 26 26 2134 2394 1 0 0 504.2671 1006.5196 2 1006.5196 0 0 46.93 0.00018 K IQQNTFTR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3175.3175.2.dta 3 2 IPI00289334.1 Isoform 1 of Filamin-B 728 280188 28 28 26 26 2887 5553 1 0 1 554.8055 1107.5965 2 1107.5965 0.0001 0 44.75 0.00061 K IFFAGDTIPK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6568.6568.2.dta 3 2 IPI00289334.1 Isoform 1 of Filamin-B 728 280188 28 28 26 26 3181 3960 1 0 1 382.229 1143.6651 3 1143.6652 -0.0001 1 23.24 0.016 R IKVFGPGIEGK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4897.4897.3.dta 3 2 IPI00289334.1 Isoform 1 of Filamin-B 728 280188 28 28 26 26 3481 929 1 0 1 591.8092 1181.6039 2 1181.604 -0.0002 1 18.09 0.02 R VKVDPSHDASK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1587.1587.2.dta 3 2 IPI00289334.1 Isoform 1 of Filamin-B 728 280188 28 28 26 26 3482 917 1 0 1 394.8754 1181.6044 3 1181.604 0.0003 1 21.58 0.031 R VKVDPSHDASK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1574.1574.3.dta 3 2 IPI00289334.1 Isoform 1 of Filamin-B 728 280188 28 28 26 26 3636 2051 1 0 1 600.8307 1199.6469 2 1199.651 -0.0041 1 49.51 0.00017 R VKVEPAVDTSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2803.2803.2.dta 3 2 IPI00289334.1 Isoform 1 of Filamin-B 728 280188 28 28 26 26 3697 1746 1 0 1 602.2922 1202.5699 2 1202.5714 -0.0015 0 79.21 9.10E-08 K VAVTEGCQPSR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2473.2473.2.dta 3 2 IPI00289334.1 Isoform 1 of Filamin-B 728 280188 28 28 26 26 3744 3987 1 0 1 605.8192 1209.6239 2 1209.6241 -0.0003 0 66.76 2.10E-06 R VLQSFTVDSSK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4926.4926.2.dta 3 2 IPI00289334.1 Isoform 1 of Filamin-B 728 280188 28 28 26 26 4869 4719 1 0 1 448.2351 1341.6836 3 1341.683 0.0006 0 15.01 0.039 K YGGELVPHFPAR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5718.5718.3.dta 3 2 IPI00289334.1 Isoform 1 of Filamin-B 728 280188 28 28 26 26 4875 3228 1 0 1 672.3096 1342.6046 2 1342.6075 -0.0029 0 35.84 0.0025 R SSTETCYSAIPK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4104.4104.2.dta 3 2 IPI00289334.1 Isoform 1 of Filamin-B 728 280188 28 28 26 26 5773 6684 1 0 1 730.8389 1459.6632 2 1459.6653 -0.0022 0 57.01 4.50E-06 R TFEMSDFIVDTR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7689.7689.2.dta 3 2 IPI00289334.1 Isoform 1 of Filamin-B 728 280188 28 28 26 26 6148 6565 1 0 1 760.3804 1518.7462 2 1518.7467 -0.0005 0 39.71 0.00051 R GEAGVPAEFSIWTR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7571.7571.2.dta 3 2 IPI00289334.1 Isoform 1 of Filamin-B 728 280188 28 28 26 26 6377 6278 1 0 1 781.4217 1560.8288 2 1560.83 -0.0012 0 47.1 3.80E-05 K VLFASQEIPASPFR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7288.7288.2.dta 3 2 IPI00289334.1 Isoform 1 of Filamin-B 728 280188 28 28 26 26 6771 5312 1 0 1 814.9274 1627.8403 2 1627.8417 -0.0014 0 73.9 2.10E-07 R GAGIGGLGITVEGPSESK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6328.6328.2.dta 3 2 IPI00289334.1 Isoform 1 of Filamin-B 728 280188 28 28 26 26 7347 4980 1 0 1 574.9761 1721.9066 3 1721.9101 -0.0035 0 18.34 0.019 K EAFTNKPNVFTVVTR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5993.5993.3.dta 3 2 IPI00289334.1 Isoform 1 of Filamin-B 728 280188 28 28 26 26 7490 6200 1 0 1 882.4341 1762.8537 2 1762.856 -0.0023 0 80.02 1.80E-07 K SGCIVNNLAEFTVDPK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7210.7210.2.dta 3 2 IPI00289334.1 Isoform 1 of Filamin-B 728 280188 28 28 26 26 7839 4743 1 0 1 952.9407 1903.8668 2 1903.8669 -0.0001 0 57.73 3.90E-06 K SPFVVQVGEACNPNACR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5744.5744.2.dta 3 2 IPI00289334.1 Isoform 1 of Filamin-B 728 280188 28 28 26 26 8104 5811 1 0 1 682.6946 2045.0621 3 2045.0641 -0.002 0 51.59 2.20E-05 R LVSPGSANETSSILVESVTR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6822.6822.3.dta 3 2 IPI00289334.1 Isoform 1 of Filamin-B 728 280188 28 28 26 26 8105 5809 1 0 1 1023.5386 2045.0627 2 2045.0641 -0.0013 0 95.03 1.20E-09 R LVSPGSANETSSILVESVTR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6820.6820.2.dta 3 2 IPI00289334.1 Isoform 1 of Filamin-B 728 280188 28 28 26 26 8154 4654 1 0 1 709.0455 2124.1146 3 2124.1175 -0.0029 1 22.58 0.0076 R DAGEGLLAVQITDQEGKPKR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5648.5648.3.dta 3 IPI00382698.1 Isoform 4 of Filamin-B 548 232499 23 23 22 22 700 4526 1 0 1 394.2317 786.4488 2 786.4487 0.0001 0 34.13 0.0075 K GLEELVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5509.5509.2.dta 3 IPI00382698.1 Isoform 4 of Filamin-B 548 232499 23 23 22 22 923 2594 1 0 1 417.721 833.4275 2 833.4283 -0.0008 0 31.29 0.016 R AYGPGLEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3393.3393.2.dta 3 IPI00382698.1 Isoform 4 of Filamin-B 548 232499 23 23 22 22 1111 3166 1 0 1 430.7355 859.4565 2 859.4552 0.0012 0 35.1 0.0013 K VFGPGVER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4037.4037.2.dta 3 IPI00382698.1 Isoform 4 of Filamin-B 548 232499 23 23 22 22 1306 1902 1 0 1 449.261 896.5074 2 896.508 -0.0006 0 34.61 0.0021 R VQAQGPGLK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2642.2642.2.dta 3 IPI00382698.1 Isoform 4 of Filamin-B 548 232499 23 23 22 22 1848 5502 1 0 0 486.2873 970.56 2 970.56 0.0001 0 48.43 0.00024 R LLGWIQNK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6517.6517.2.dta 3 IPI00382698.1 Isoform 4 of Filamin-B 548 232499 23 23 22 22 1931 3261 1 0 1 492.2858 982.557 2 982.556 0.0011 0 52.52 2.20E-05 K IAGPGLGSGVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4141.4141.2.dta 3 IPI00382698.1 Isoform 4 of Filamin-B 548 232499 23 23 22 22 1946 1500 1 0 1 493.2873 984.5601 2 984.5604 -0.0003 1 18.14 0.023 K VKAEGPGLSK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2206.2206.2.dta 3 IPI00382698.1 Isoform 4 of Filamin-B 548 232499 23 23 22 22 2134 2394 1 0 0 504.2671 1006.5196 2 1006.5196 0 0 46.93 0.00018 K IQQNTFTR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3175.3175.2.dta 3 IPI00382698.1 Isoform 4 of Filamin-B 548 232499 23 23 22 22 2887 5553 1 0 1 554.8055 1107.5965 2 1107.5965 0.0001 0 44.75 0.00061 K IFFAGDTIPK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6568.6568.2.dta 3 IPI00382698.1 Isoform 4 of Filamin-B 548 232499 23 23 22 22 3181 3960 1 0 1 382.229 1143.6651 3 1143.6652 -0.0001 1 23.24 0.016 R IKVFGPGIEGK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4897.4897.3.dta 3 IPI00382698.1 Isoform 4 of Filamin-B 548 232499 23 23 22 22 3481 929 1 0 1 591.8092 1181.6039 2 1181.604 -0.0002 1 18.09 0.02 R VKVDPSHDASK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1587.1587.2.dta 3 IPI00382698.1 Isoform 4 of Filamin-B 548 232499 23 23 22 22 3482 917 1 0 1 394.8754 1181.6044 3 1181.604 0.0003 1 21.58 0.031 R VKVDPSHDASK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1574.1574.3.dta 3 IPI00382698.1 Isoform 4 of Filamin-B 548 232499 23 23 22 22 3636 2051 1 0 1 600.8307 1199.6469 2 1199.651 -0.0041 1 49.51 0.00017 R VKVEPAVDTSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2803.2803.2.dta 3 IPI00382698.1 Isoform 4 of Filamin-B 548 232499 23 23 22 22 3697 1746 1 0 1 602.2922 1202.5699 2 1202.5714 -0.0015 0 79.21 9.10E-08 K VAVTEGCQPSR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2473.2473.2.dta 3 IPI00382698.1 Isoform 4 of Filamin-B 548 232499 23 23 22 22 3744 3987 1 0 1 605.8192 1209.6239 2 1209.6241 -0.0003 0 66.76 2.10E-06 R VLQSFTVDSSK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4926.4926.2.dta 3 IPI00382698.1 Isoform 4 of Filamin-B 548 232499 23 23 22 22 4869 4719 1 0 1 448.2351 1341.6836 3 1341.683 0.0006 0 15.01 0.039 K YGGELVPHFPAR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5718.5718.3.dta 3 IPI00382698.1 Isoform 4 of Filamin-B 548 232499 23 23 22 22 5773 6684 1 0 1 730.8389 1459.6632 2 1459.6653 -0.0022 0 57.01 4.50E-06 R TFEMSDFIVDTR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7689.7689.2.dta 3 IPI00382698.1 Isoform 4 of Filamin-B 548 232499 23 23 22 22 6377 6278 1 0 1 781.4217 1560.8288 2 1560.83 -0.0012 0 47.1 3.80E-05 K VLFASQEIPASPFR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7288.7288.2.dta 3 IPI00382698.1 Isoform 4 of Filamin-B 548 232499 23 23 22 22 6771 5312 1 0 1 814.9274 1627.8403 2 1627.8417 -0.0014 0 73.9 2.10E-07 R GAGIGGLGITVEGPSESK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6328.6328.2.dta 3 IPI00382698.1 Isoform 4 of Filamin-B 548 232499 23 23 22 22 7347 4980 1 0 1 574.9761 1721.9066 3 1721.9101 -0.0035 0 18.34 0.019 K EAFTNKPNVFTVVTR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5993.5993.3.dta 3 IPI00382698.1 Isoform 4 of Filamin-B 548 232499 23 23 22 22 7490 6200 1 0 1 882.4341 1762.8537 2 1762.856 -0.0023 0 80.02 1.80E-07 K SGCIVNNLAEFTVDPK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7210.7210.2.dta 3 IPI00382698.1 Isoform 4 of Filamin-B 548 232499 23 23 22 22 7839 4743 1 0 1 952.9407 1903.8668 2 1903.8669 -0.0001 0 57.73 3.90E-06 K SPFVVQVGEACNPNACR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5744.5744.2.dta 3 IPI00382698.1 Isoform 4 of Filamin-B 548 232499 23 23 22 22 8154 4654 1 0 1 709.0455 2124.1146 3 2124.1175 -0.0029 1 22.58 0.0076 R DAGEGLLAVQITDQEGKPKR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5648.5648.3.dta 3 IPI00552416.3 "Filamin A, alpha" 183 52192 6 6 5 5 1249 3487 1 0 1 441.7737 881.5329 2 881.5334 -0.0005 0 37.45 0.00073 K AGVAPLQVK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4386.4386.2.dta 3 IPI00552416.3 "Filamin A, alpha" 183 52192 6 6 5 5 5358 5475 1 0 1 700.827 1399.6394 2 1399.6408 -0.0014 0 45.94 0.0003 K YGGDEIPFSPYR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6490.6490.2.dta 3 IPI00552416.3 "Filamin A, alpha" 183 52192 6 6 5 5 5598 4255 1 0 1 717.863 1433.7115 2 1433.7151 -0.0035 0 72.83 1.10E-06 R ANLPQSFQVDTSK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5217.5217.2.dta 3 IPI00552416.3 "Filamin A, alpha" 183 52192 6 6 5 5 7609 3326 1 0 1 907.9812 1813.9479 2 1813.9534 -0.0056 1 51.45 1.50E-05 K VAQPTITDNKDGTVTVR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4211.4211.2.dta 3 IPI00552416.3 "Filamin A, alpha" 183 52192 6 6 5 5 7965 5407 1 0 1 969.5117 1937.0088 2 1937.0106 -0.0018 0 39.64 0.00019 K DAGEGLLAVQITDPEGKPK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6422.6422.2.dta 3 IPI00552416.3 "Filamin A, alpha" 183 52192 6 6 5 5 7966 5386 1 0 1 646.6777 1937.0112 3 1937.0106 0.0006 0 35.22 0.0022 K DAGEGLLAVQITDPEGKPK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6402.6402.3.dta 3 IPI00553169.3 "Filamin A, alpha" 165 28176 6 6 5 5 681 1767 1 0 1 393.7086 785.4026 2 785.4032 -0.0006 0 39.58 0.0016 K AEGPGLSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2495.2495.2.dta 3 IPI00553169.3 "Filamin A, alpha" 165 28176 6 6 5 5 715 2108 1 0 1 395.7269 789.4392 2 789.4385 0.0007 0 30.08 0.0078 K VYGPGVAK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2865.2865.2.dta 3 IPI00553169.3 "Filamin A, alpha" 165 28176 6 6 5 5 2177 1664 1 0 1 507.2904 1012.5662 2 1012.5665 -0.0003 1 40.22 0.0011 K VKAEGPGLSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2384.2384.2.dta 3 IPI00553169.3 "Filamin A, alpha" 165 28176 6 6 5 5 2178 1663 1 0 1 338.5299 1012.568 3 1012.5665 0.0015 1 37.42 0.0029 K VKAEGPGLSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2383.2383.3.dta 3 IPI00553169.3 "Filamin A, alpha" 165 28176 6 6 5 5 2676 971 1 0 1 540.2826 1078.5506 2 1078.552 -0.0013 0 60.09 2.30E-06 R VNVGAGSHPNK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1633.1633.2.dta 3 IPI00553169.3 "Filamin A, alpha" 165 28176 6 6 5 5 5564 3523 1 0 1 715.362 1428.7094 2 1428.711 -0.0015 0 66.15 1.40E-06 K AFGPGLQGGSAGSPAR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4425.4425.2.dta 3 IPI00798140.1 111 kDa protein 123 112109 4 4 4 4 547 1738 1 0 0 378.7053 755.396 2 755.3926 0.0034 0 58.02 2.20E-05 R AGGPGLER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2464.2464.2.dta 3 IPI00798140.1 111 kDa protein 123 112109 4 4 4 4 5773 6684 1 0 1 730.8389 1459.6632 2 1459.6653 -0.0022 0 57.01 4.50E-06 R TFEMSDFIVDTR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7689.7689.2.dta 3 IPI00798140.1 111 kDa protein 123 112109 4 4 4 4 6148 6565 1 0 1 760.3804 1518.7462 2 1518.7467 -0.0005 0 39.71 0.00051 R GEAGVPAEFSIWTR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7571.7571.2.dta 3 IPI00798140.1 111 kDa protein 123 112109 4 4 4 4 8154 4654 1 0 1 709.0455 2124.1146 3 2124.1175 -0.0029 1 22.58 0.0076 R DAGEGLLAVQITDQEGKPKR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5648.5648.3.dta 3 IPI00552858.2 "Filamin A, alpha" 108 36523 3 3 3 3 547 1738 1 0 0 378.7053 755.396 2 755.3926 0.0034 0 58.02 2.20E-05 R AGGPGLER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2464.2464.2.dta 3 IPI00552858.2 "Filamin A, alpha" 108 36523 3 3 3 3 6233 6602 1 0 1 767.3892 1532.7638 2 1532.7623 0.0014 0 39.23 0.00032 R AEAGVPAEFSIWTR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7608.7608.2.dta 3 IPI00552858.2 "Filamin A, alpha" 108 36523 3 3 3 3 8113 3394 1 0 1 686.6487 2056.9242 3 2056.9272 -0.003 0 47.61 3.40E-05 K THEAEIVEGENHTYCIR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4285.4285.3.dta 3 IPI00178352.4 Isoform 1 of Filamin-C 72 293678 2 2 2 2 1848 5502 1 0 0 486.2873 970.56 2 970.56 0.0001 0 48.43 0.00024 R LLGWIQNK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6517.6517.2.dta 3 IPI00178352.4 Isoform 1 of Filamin-C 72 293678 2 2 2 2 2134 2394 1 0 0 504.2671 1006.5196 2 1006.5196 0 0 46.93 0.00018 K IQQNTFTR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3175.3175.2.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 20 2839 1 1 0 300.6949 599.3752 2 599.3755 -0.0003 0 34.71 0.0097 R ALQLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3674.3674.2.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 71 3078 1 1 0 309.1848 616.355 2 616.3544 0.0005 0 34.1 0.022 R TDLLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3939.3939.2.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 174 2940 1 1 0 324.6802 647.3459 2 647.3425 0.0034 0 37.71 0.0058 R CSLLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3787.3787.2.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 332 1006 1 1 1 349.2033 696.392 2 696.3919 0.0001 0 25.81 0.021 K HVSLNK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1671.1671.2.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 647 4847 1 1 1 389.229 776.4435 2 776.4432 0.0003 0 32.78 0.0071 R AFLGELK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5855.5855.2.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 649 3857 1 1 1 389.2355 776.4565 2 776.4545 0.002 0 26.4 0.022 K LLQTFR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4785.4785.2.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 766 5038 1 1 1 401.2021 800.3896 2 800.3891 0.0005 0 26.3 0.027 R CFFLSK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6053.6053.2.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 916 5259 1 1 1 416.7682 831.5218 2 831.5218 0 0 24.53 0.0095 K VFLALAAK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6276.6276.2.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 1101 5121 1 1 1 429.2474 856.4802 2 856.4807 -0.0005 0 34.49 0.0095 R SPNLWLK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6136.6136.2.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 1315 5450 1 1 1 450.2475 898.4805 2 898.48 0.0005 0 25.1 0.047 K SIELFYK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6466.6466.2.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 1370 3815 1 1 1 453.2453 904.476 2 904.4767 -0.0006 0 40.31 0.0026 K LLQDFNR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4740.4740.2.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 1458 2636 1 1 1 459.7576 917.5006 2 917.5004 0.0002 0 49.73 4.30E-05 R LAAVVSACK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3439.3439.2.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 1502 3393 1 1 1 463.7336 925.4527 2 925.4545 -0.0018 0 35.48 0.00047 K YFEGVSPK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4284.4284.2.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 1503 8191 1 1 1 463.7434 925.4722 2 925.473 -0.0008 1 34.22 0.0058 R GSKDHNIR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.943.943.2.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 1505 4411 1 1 1 463.7636 925.5127 2 925.5134 -0.0006 0 19.28 0.022 R WPVAGQIR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5385.5385.2.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 1539 6751 1 1 1 465.2961 928.5777 2 928.5779 -0.0003 0 30.45 0.0045 K MAVLALLAK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7755.7755.2.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 1563 3673 1 1 1 467.2611 932.5077 2 932.508 -0.0002 0 22.28 0.0085 R YAVPSAGLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4587.4587.2.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 1615 3139 1 1 1 470.7402 939.4659 2 939.4662 -0.0003 0 38.5 0.00037 R TETVTSFR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4008.4008.2.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 1676 1495 1 1 1 474.7408 947.4671 2 947.4672 -0.0001 0 54.82 8.20E-05 R TQEGSLSAR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2201.2201.2.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 1722 5392 1 1 1 478.7924 955.5703 2 955.5702 0.0002 0 53.56 2.20E-05 R LLEEALLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6408.6408.2.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 2147 6727 1 1 1 505.2891 1008.5637 2 1008.5644 -0.0007 0 24.29 0.038 R EIFNFVLK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7731.7731.2.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 2148 1983 1 1 1 505.7272 1009.4399 2 1009.44 -0.0001 0 61.77 4.30E-06 K CFGTGAAGNR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2729.2729.2.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 2170 5334 1 1 1 506.8005 1011.5865 2 1011.5865 -0.0001 0 23.34 0.036 K FVPLLPGNR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6350.6350.2.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 2257 5420 1 1 1 512.2805 1022.5465 2 1022.547 -0.0006 0 29.3 0.023 K VCLDIIYK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6435.6435.2.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 2258 7732 1 1 1 512.2875 1022.5604 2 1022.5621 -0.0017 1 32.86 0.0011 R ANQKHQGLK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.876.876.2.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 2463 4737 1 1 1 526.2753 1050.536 2 1050.5346 0.0014 0 37.14 0.0014 R SIGEYDVLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5738.5738.2.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 2472 4784 1 1 1 526.7848 1051.555 2 1051.555 0 0 58.34 5.80E-06 R GIFTSEIGTK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5788.5788.2.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 2583 5022 1 1 1 535.2606 1068.5067 2 1068.5063 0.0004 0 38.41 0.0018 R GYGLFAGPCK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6036.6036.2.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 2618 1762 1 1 1 537.2504 1072.4862 2 1072.4859 0.0003 0 19.54 0.034 K NTCTSVYTK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2490.2490.2.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 3111 4248 1 1 1 568.3083 1134.6021 2 1134.6033 -0.0012 0 56.33 3.20E-05 R HGDLPDIQIK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5209.5209.2.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 3147 2935 1 1 1 380.8987 1139.6743 3 1139.6736 0.0007 0 24.24 0.0068 R ICSKPVVLPK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3781.3781.3.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 3270 3935 1 1 1 578.7953 1155.5761 2 1155.5772 -0.001 0 41.42 0.00013 R LGLPGDEVDNK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4870.4870.2.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 3443 4005 1 1 1 588.3168 1174.619 2 1174.6194 -0.0004 0 94.02 1.10E-08 R VTELALTASDR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4946.4946.2.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 3445 2815 1 1 1 588.7872 1175.5598 2 1175.5605 -0.0007 0 69.82 1.80E-06 R LACDVDQVTR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3646.3646.2.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 3709 5797 1 1 1 603.3707 1204.7268 2 1204.7292 -0.0024 0 25.44 0.0083 K LGNPIVPLNIR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6809.6809.2.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 3810 5946 1 1 1 609.8582 1217.7019 2 1217.7019 -0.0001 0 54.01 9.50E-06 R LLALNSLYSPK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6958.6958.2.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 4000 6700 1 1 1 620.3233 1238.6321 2 1238.6329 -0.0008 0 25.22 0.0043 K GLSSLLCNFTK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7704.7704.2.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 4475 5145 1 1 1 647.3428 1292.6711 2 1292.6725 -0.0013 0 61.69 1.60E-05 R DQNILLGTTYR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6161.6161.2.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 4529 5126 1 1 1 434.2254 1299.6544 3 1299.6533 0.0011 1 20.69 0.043 R CFFLSKIEEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6142.6142.3.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 4533 4451 1 1 1 650.862 1299.7094 2 1299.7146 -0.0052 0 83.87 7.50E-08 K QITQSALLAEAR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5429.5429.2.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 4687 4945 1 1 1 660.8165 1319.6185 2 1319.6214 -0.0028 0 40.57 0.00047 R QCLPSLDLSCK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5958.5958.2.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 4712 6332 1 1 1 661.8421 1321.6697 2 1321.67 -0.0003 0 50.13 2.00E-05 R MSTSPEAFLALR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7340.7340.2.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 4744 2799 1 1 1 442.9216 1325.7431 3 1325.7415 0.0015 1 19.65 0.042 K QGNLSSQVPLKR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3627.3627.3.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 4838 5953 1 1 1 669.8392 1337.6638 2 1337.6649 -0.0011 0 43.58 0.00077 R MSTSPEAFLALR S Oxidation (M) 0.100000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6964.6964.2.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 5203 3660 1 1 1 692.3774 1382.7402 2 1382.7405 -0.0003 1 48.38 2.90E-05 R LGLPGDEVDNKVK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4573.4573.2.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 5264 4441 1 1 1 695.8322 1389.6499 2 1389.6524 -0.0026 0 38.83 0.00091 R NELEIPGQYDGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5417.5417.2.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 5265 4493 1 1 1 695.8328 1389.6511 2 1389.6524 -0.0013 0 26.17 0.0035 R NELEIPGQYDGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5474.5474.2.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 5329 4146 1 1 1 698.8503 1395.6861 2 1395.6882 -0.002 0 68.72 1.20E-06 K LNESTFDTQITK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5099.5099.2.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 5572 5806 1 1 1 715.8665 1429.7185 2 1429.7201 -0.0016 0 59.97 2.40E-06 K GGSWIQEINVAEK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6818.6818.2.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 5703 4887 1 1 1 724.873 1447.7314 2 1447.7341 -0.0027 0 79.65 2.40E-07 R SQGCSEQVLTVLK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5897.5897.2.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 5838 3286 1 1 1 734.3598 1466.7051 2 1466.7001 0.0049 0 60.95 1.90E-06 R SLGPPQGEEDSVPR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4168.4168.2.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 6142 7563 1 1 1 759.3975 1516.7805 2 1516.7807 -0.0002 0 20.16 0.013 K NILEESLCELVAK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8567.8567.2.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 6513 5290 1 1 1 787.9035 1573.7925 2 1573.7947 -0.0023 0 52.4 4.40E-05 K NLSSNEAISLEEIR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6306.6306.2.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 6592 4130 1 1 1 531.2788 1590.8146 3 1590.8154 -0.0008 1 15.24 0.037 R LLNTWTNRYPDAK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5081.5081.3.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 6752 5743 1 1 1 812.8866 1623.7586 2 1623.7603 -0.0016 0 55.05 2.30E-05 R YNFPVEVEVPMER K Oxidation (M) 0.0000000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6755.6755.2.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 7505 6010 1 1 1 884.9523 1767.8901 2 1767.889 0.0011 0 85.31 1.30E-08 K TVSLLDENNVSSYLSK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7021.7021.2.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 7610 6829 1 1 1 908.0145 1814.0145 2 1814.0149 -0.0004 0 43.88 0.00013 R TVGALQVLGTEAQSSLLK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7832.7832.2.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 7918 3317 1 1 1 639.9717 1916.8932 3 1916.8977 -0.0045 0 47.84 0.00021 R ATQQQHDFTLTQTADGR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4202.4202.3.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 7919 3335 1 1 1 959.455 1916.8955 2 1916.8977 -0.0022 0 39.7 0.00019 R ATQQQHDFTLTQTADGR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4221.4221.2.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 8107 4084 1 1 1 683.0003 2045.9791 3 2045.984 -0.005 0 57.73 4.10E-06 K INQVFHGSCITEGNELTK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5031.5031.3.dta 4 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 1345 473749 61 61 58 58 8145 4746 1 1 1 703.346 2107.0162 3 2107.0181 -0.002 1 42.74 0.00011 K TSALSDETKNNWEVSALSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5747.5747.3.dta 4 IPI00786995.1 "similar to protein kinase, DNA-activated, catalytic polypeptide" 1279 470127 60 60 57 57 20 2839 1 0 0 300.6949 599.3752 2 599.3755 -0.0003 0 34.71 0.0097 R ALQLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3674.3674.2.dta 4 IPI00786995.1 "similar to protein kinase, DNA-activated, catalytic polypeptide" 1279 470127 60 60 57 57 71 3078 1 0 0 309.1848 616.355 2 616.3544 0.0005 0 34.1 0.022 R TDLLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3939.3939.2.dta 4 IPI00786995.1 "similar to protein kinase, DNA-activated, catalytic polypeptide" 1279 470127 60 60 57 57 174 2940 1 0 0 324.6802 647.3459 2 647.3425 0.0034 0 37.71 0.0058 R CSLLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3787.3787.2.dta 4 IPI00786995.1 "similar to protein kinase, DNA-activated, catalytic polypeptide" 1279 470127 60 60 57 57 332 1006 1 0 1 349.2033 696.392 2 696.3919 0.0001 0 25.81 0.021 K HVSLNK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1671.1671.2.dta 4 IPI00786995.1 "similar to protein kinase, DNA-activated, catalytic polypeptide" 1279 470127 60 60 57 57 647 4847 1 0 1 389.229 776.4435 2 776.4432 0.0003 0 32.78 0.0071 R AFLGELK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5855.5855.2.dta 4 IPI00786995.1 "similar to protein kinase, DNA-activated, catalytic polypeptide" 1279 470127 60 60 57 57 649 3857 1 0 1 389.2355 776.4565 2 776.4545 0.002 0 26.4 0.022 K LLQTFR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4785.4785.2.dta 4 IPI00786995.1 "similar to protein kinase, DNA-activated, catalytic polypeptide" 1279 470127 60 60 57 57 766 5038 1 0 1 401.2021 800.3896 2 800.3891 0.0005 0 26.3 0.027 R CFFLSK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6053.6053.2.dta 4 IPI00786995.1 "similar to protein kinase, DNA-activated, catalytic polypeptide" 1279 470127 60 60 57 57 916 5259 1 0 1 416.7682 831.5218 2 831.5218 0 0 24.53 0.0095 K VFLALAAK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6276.6276.2.dta 4 IPI00786995.1 "similar to protein kinase, DNA-activated, catalytic polypeptide" 1279 470127 60 60 57 57 1101 5121 1 0 1 429.2474 856.4802 2 856.4807 -0.0005 0 34.49 0.0095 R SPNLWLK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6136.6136.2.dta 4 IPI00786995.1 "similar to protein kinase, DNA-activated, catalytic polypeptide" 1279 470127 60 60 57 57 1315 5450 1 0 1 450.2475 898.4805 2 898.48 0.0005 0 25.1 0.047 K SIELFYK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6466.6466.2.dta 4 IPI00786995.1 "similar to protein kinase, DNA-activated, catalytic polypeptide" 1279 470127 60 60 57 57 1370 3815 1 0 1 453.2453 904.476 2 904.4767 -0.0006 0 40.31 0.0026 K LLQDFNR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4740.4740.2.dta 4 IPI00786995.1 "similar to protein kinase, DNA-activated, catalytic polypeptide" 1279 470127 60 60 57 57 1458 2636 1 0 1 459.7576 917.5006 2 917.5004 0.0002 0 49.73 4.30E-05 R LAAVVSACK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3439.3439.2.dta 4 IPI00786995.1 "similar to protein kinase, DNA-activated, catalytic polypeptide" 1279 470127 60 60 57 57 1502 3393 1 0 1 463.7336 925.4527 2 925.4545 -0.0018 0 35.48 0.00047 K YFEGVSPK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4284.4284.2.dta 4 IPI00786995.1 "similar to protein kinase, DNA-activated, catalytic polypeptide" 1279 470127 60 60 57 57 1503 8191 1 0 1 463.7434 925.4722 2 925.473 -0.0008 1 34.22 0.0058 R GSKDHNIR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.943.943.2.dta 4 IPI00786995.1 "similar to protein kinase, DNA-activated, catalytic polypeptide" 1279 470127 60 60 57 57 1505 4411 1 0 1 463.7636 925.5127 2 925.5134 -0.0006 0 19.28 0.022 R WPVAGQIR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5385.5385.2.dta 4 IPI00786995.1 "similar to protein kinase, DNA-activated, catalytic polypeptide" 1279 470127 60 60 57 57 1539 6751 1 0 1 465.2961 928.5777 2 928.5779 -0.0003 0 30.45 0.0045 K MAVLALLAK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7755.7755.2.dta 4 IPI00786995.1 "similar to protein kinase, DNA-activated, catalytic polypeptide" 1279 470127 60 60 57 57 1563 3673 1 0 1 467.2611 932.5077 2 932.508 -0.0002 0 22.28 0.0085 R YAVPSAGLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4587.4587.2.dta 4 IPI00786995.1 "similar to protein kinase, DNA-activated, catalytic polypeptide" 1279 470127 60 60 57 57 1615 3139 1 0 1 470.7402 939.4659 2 939.4662 -0.0003 0 38.5 0.00037 R TETVTSFR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4008.4008.2.dta 4 IPI00786995.1 "similar to protein kinase, DNA-activated, catalytic polypeptide" 1279 470127 60 60 57 57 1676 1495 1 0 1 474.7408 947.4671 2 947.4672 -0.0001 0 54.82 8.20E-05 R TQEGSLSAR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2201.2201.2.dta 4 IPI00786995.1 "similar to protein kinase, DNA-activated, catalytic polypeptide" 1279 470127 60 60 57 57 1722 5392 1 0 1 478.7924 955.5703 2 955.5702 0.0002 0 53.56 2.20E-05 R LLEEALLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6408.6408.2.dta 4 IPI00786995.1 "similar to protein kinase, DNA-activated, catalytic polypeptide" 1279 470127 60 60 57 57 2147 6727 1 0 1 505.2891 1008.5637 2 1008.5644 -0.0007 0 24.29 0.038 R EIFNFVLK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7731.7731.2.dta 4 IPI00786995.1 "similar to protein kinase, DNA-activated, catalytic polypeptide" 1279 470127 60 60 57 57 2148 1983 1 0 1 505.7272 1009.4399 2 1009.44 -0.0001 0 61.77 4.30E-06 K CFGTGAAGNR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2729.2729.2.dta 4 IPI00786995.1 "similar to protein kinase, DNA-activated, catalytic polypeptide" 1279 470127 60 60 57 57 2170 5334 1 0 1 506.8005 1011.5865 2 1011.5865 -0.0001 0 23.34 0.036 K FVPLLPGNR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6350.6350.2.dta 4 IPI00786995.1 "similar to protein kinase, DNA-activated, catalytic polypeptide" 1279 470127 60 60 57 57 2257 5420 1 0 1 512.2805 1022.5465 2 1022.547 -0.0006 0 29.3 0.023 K VCLDIIYK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6435.6435.2.dta 4 IPI00786995.1 "similar to protein kinase, DNA-activated, catalytic polypeptide" 1279 470127 60 60 57 57 2258 7732 1 0 1 512.2875 1022.5604 2 1022.5621 -0.0017 1 32.86 0.0011 R ANQKHQGLK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.876.876.2.dta 4 IPI00786995.1 "similar to protein kinase, DNA-activated, catalytic polypeptide" 1279 470127 60 60 57 57 2463 4737 1 0 1 526.2753 1050.536 2 1050.5346 0.0014 0 37.14 0.0014 R SIGEYDVLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5738.5738.2.dta 4 IPI00786995.1 "similar to protein kinase, DNA-activated, catalytic polypeptide" 1279 470127 60 60 57 57 2472 4784 1 0 1 526.7848 1051.555 2 1051.555 0 0 58.34 5.80E-06 R GIFTSEIGTK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5788.5788.2.dta 4 IPI00786995.1 "similar to protein kinase, DNA-activated, catalytic polypeptide" 1279 470127 60 60 57 57 2583 5022 1 0 1 535.2606 1068.5067 2 1068.5063 0.0004 0 38.41 0.0018 R GYGLFAGPCK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6036.6036.2.dta 4 IPI00786995.1 "similar to protein kinase, DNA-activated, catalytic polypeptide" 1279 470127 60 60 57 57 2618 1762 1 0 1 537.2504 1072.4862 2 1072.4859 0.0003 0 19.54 0.034 K NTCTSVYTK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2490.2490.2.dta 4 IPI00786995.1 "similar to protein kinase, DNA-activated, catalytic polypeptide" 1279 470127 60 60 57 57 3111 4248 1 0 1 568.3083 1134.6021 2 1134.6033 -0.0012 0 56.33 3.20E-05 R HGDLPDIQIK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5209.5209.2.dta 4 IPI00786995.1 "similar to protein kinase, DNA-activated, catalytic polypeptide" 1279 470127 60 60 57 57 3147 2935 1 0 1 380.8987 1139.6743 3 1139.6736 0.0007 0 24.24 0.0068 R ICSKPVVLPK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3781.3781.3.dta 4 IPI00786995.1 "similar to protein kinase, DNA-activated, catalytic polypeptide" 1279 470127 60 60 57 57 3270 3935 1 0 1 578.7953 1155.5761 2 1155.5772 -0.001 0 41.42 0.00013 R LGLPGDEVDNK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4870.4870.2.dta 4 IPI00786995.1 "similar to protein kinase, DNA-activated, catalytic polypeptide" 1279 470127 60 60 57 57 3443 4005 1 0 1 588.3168 1174.619 2 1174.6194 -0.0004 0 94.02 1.10E-08 R VTELALTASDR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4946.4946.2.dta 4 IPI00786995.1 "similar to protein kinase, DNA-activated, catalytic polypeptide" 1279 470127 60 60 57 57 3445 2815 1 0 1 588.7872 1175.5598 2 1175.5605 -0.0007 0 69.82 1.80E-06 R LACDVDQVTR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3646.3646.2.dta 4 IPI00786995.1 "similar to protein kinase, DNA-activated, catalytic polypeptide" 1279 470127 60 60 57 57 3709 5797 1 0 1 603.3707 1204.7268 2 1204.7292 -0.0024 0 25.44 0.0083 K LGNPIVPLNIR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6809.6809.2.dta 4 IPI00786995.1 "similar to protein kinase, DNA-activated, catalytic polypeptide" 1279 470127 60 60 57 57 3810 5946 1 0 1 609.8582 1217.7019 2 1217.7019 -0.0001 0 54.01 9.50E-06 R LLALNSLYSPK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6958.6958.2.dta 4 IPI00786995.1 "similar to protein kinase, DNA-activated, catalytic polypeptide" 1279 470127 60 60 57 57 4000 6700 1 0 1 620.3233 1238.6321 2 1238.6329 -0.0008 0 25.22 0.0043 K GLSSLLCNFTK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7704.7704.2.dta 4 IPI00786995.1 "similar to protein kinase, DNA-activated, catalytic polypeptide" 1279 470127 60 60 57 57 4475 5145 1 0 1 647.3428 1292.6711 2 1292.6725 -0.0013 0 61.69 1.60E-05 R DQNILLGTTYR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6161.6161.2.dta 4 IPI00786995.1 "similar to protein kinase, DNA-activated, catalytic polypeptide" 1279 470127 60 60 57 57 4529 5126 1 0 1 434.2254 1299.6544 3 1299.6533 0.0011 1 20.69 0.043 R CFFLSKIEEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6142.6142.3.dta 4 IPI00786995.1 "similar to protein kinase, DNA-activated, catalytic polypeptide" 1279 470127 60 60 57 57 4533 4451 1 0 1 650.862 1299.7094 2 1299.7146 -0.0052 0 83.87 7.50E-08 K QITQSALLAEAR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5429.5429.2.dta 4 IPI00786995.1 "similar to protein kinase, DNA-activated, catalytic polypeptide" 1279 470127 60 60 57 57 4687 4945 1 0 1 660.8165 1319.6185 2 1319.6214 -0.0028 0 40.57 0.00047 R QCLPSLDLSCK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5958.5958.2.dta 4 IPI00786995.1 "similar to protein kinase, DNA-activated, catalytic polypeptide" 1279 470127 60 60 57 57 4712 6332 1 0 1 661.8421 1321.6697 2 1321.67 -0.0003 0 50.13 2.00E-05 R MSTSPEAFLALR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7340.7340.2.dta 4 IPI00786995.1 "similar to protein kinase, DNA-activated, catalytic polypeptide" 1279 470127 60 60 57 57 4744 2799 1 0 1 442.9216 1325.7431 3 1325.7415 0.0015 1 19.65 0.042 K QGNLSSQVPLKR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3627.3627.3.dta 4 IPI00786995.1 "similar to protein kinase, DNA-activated, catalytic polypeptide" 1279 470127 60 60 57 57 4838 5953 1 0 1 669.8392 1337.6638 2 1337.6649 -0.0011 0 43.58 0.00077 R MSTSPEAFLALR S Oxidation (M) 0.100000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6964.6964.2.dta 4 IPI00786995.1 "similar to protein kinase, DNA-activated, catalytic polypeptide" 1279 470127 60 60 57 57 5203 3660 1 0 1 692.3774 1382.7402 2 1382.7405 -0.0003 1 48.38 2.90E-05 R LGLPGDEVDNKVK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4573.4573.2.dta 4 IPI00786995.1 "similar to protein kinase, DNA-activated, catalytic polypeptide" 1279 470127 60 60 57 57 5264 4441 1 0 1 695.8322 1389.6499 2 1389.6524 -0.0026 0 38.83 0.00091 R NELEIPGQYDGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5417.5417.2.dta 4 IPI00786995.1 "similar to protein kinase, DNA-activated, catalytic polypeptide" 1279 470127 60 60 57 57 5265 4493 1 0 1 695.8328 1389.6511 2 1389.6524 -0.0013 0 26.17 0.0035 R NELEIPGQYDGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5474.5474.2.dta 4 IPI00786995.1 "similar to protein kinase, DNA-activated, catalytic polypeptide" 1279 470127 60 60 57 57 5329 4146 1 0 1 698.8503 1395.6861 2 1395.6882 -0.002 0 68.72 1.20E-06 K LNESTFDTQITK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5099.5099.2.dta 4 IPI00786995.1 "similar to protein kinase, DNA-activated, catalytic polypeptide" 1279 470127 60 60 57 57 5572 5806 1 0 1 715.8665 1429.7185 2 1429.7201 -0.0016 0 59.97 2.40E-06 K GGSWIQEINVAEK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6818.6818.2.dta 4 IPI00786995.1 "similar to protein kinase, DNA-activated, catalytic polypeptide" 1279 470127 60 60 57 57 5703 4887 1 0 1 724.873 1447.7314 2 1447.7341 -0.0027 0 79.65 2.40E-07 R SQGCSEQVLTVLK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5897.5897.2.dta 4 IPI00786995.1 "similar to protein kinase, DNA-activated, catalytic polypeptide" 1279 470127 60 60 57 57 5838 3286 1 0 1 734.3598 1466.7051 2 1466.7001 0.0049 0 60.95 1.90E-06 R SLGPPQGEEDSVPR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4168.4168.2.dta 4 IPI00786995.1 "similar to protein kinase, DNA-activated, catalytic polypeptide" 1279 470127 60 60 57 57 6142 7563 1 0 1 759.3975 1516.7805 2 1516.7807 -0.0002 0 20.16 0.013 K NILEESLCELVAK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8567.8567.2.dta 4 IPI00786995.1 "similar to protein kinase, DNA-activated, catalytic polypeptide" 1279 470127 60 60 57 57 6513 5290 1 0 1 787.9035 1573.7925 2 1573.7947 -0.0023 0 52.4 4.40E-05 K NLSSNEAISLEEIR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6306.6306.2.dta 4 IPI00786995.1 "similar to protein kinase, DNA-activated, catalytic polypeptide" 1279 470127 60 60 57 57 6592 4130 1 0 1 531.2788 1590.8146 3 1590.8154 -0.0008 1 15.24 0.037 R LLNTWTNRYPDAK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5081.5081.3.dta 4 IPI00786995.1 "similar to protein kinase, DNA-activated, catalytic polypeptide" 1279 470127 60 60 57 57 6752 5743 1 0 1 812.8866 1623.7586 2 1623.7603 -0.0016 0 55.05 2.30E-05 R YNFPVEVEVPMER K Oxidation (M) 0.0000000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6755.6755.2.dta 4 IPI00786995.1 "similar to protein kinase, DNA-activated, catalytic polypeptide" 1279 470127 60 60 57 57 7610 6829 1 0 1 908.0145 1814.0145 2 1814.0149 -0.0004 0 43.88 0.00013 R TVGALQVLGTEAQSSLLK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7832.7832.2.dta 4 IPI00786995.1 "similar to protein kinase, DNA-activated, catalytic polypeptide" 1279 470127 60 60 57 57 7918 3317 1 0 1 639.9717 1916.8932 3 1916.8977 -0.0045 0 47.84 0.00021 R ATQQQHDFTLTQTADGR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4202.4202.3.dta 4 IPI00786995.1 "similar to protein kinase, DNA-activated, catalytic polypeptide" 1279 470127 60 60 57 57 7919 3335 1 0 1 959.455 1916.8955 2 1916.8977 -0.0022 0 39.7 0.00019 R ATQQQHDFTLTQTADGR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4221.4221.2.dta 4 IPI00786995.1 "similar to protein kinase, DNA-activated, catalytic polypeptide" 1279 470127 60 60 57 57 8107 4084 1 0 1 683.0003 2045.9791 3 2045.984 -0.005 0 57.73 4.10E-06 K INQVFHGSCITEGNELTK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5031.5031.3.dta 4 IPI00786995.1 "similar to protein kinase, DNA-activated, catalytic polypeptide" 1279 470127 60 60 57 57 8145 4746 1 0 1 703.346 2107.0162 3 2107.0181 -0.002 1 42.74 0.00011 K TSALSDETKNNWEVSALSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5747.5747.3.dta 5 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1133 53671 42 42 29 29 850 375 1 1 0 410.211 818.4075 2 818.4068 0.0007 1 38.4 0.0053 R AKQDMAR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1056.1056.2.dta 5 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1133 53671 42 42 29 29 884 4556 1 1 0 414.2192 826.4238 2 826.4225 0.0013 0 39.7 0.0021 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5542.5542.2.dta 5 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1133 53671 42 42 29 29 1559 2179 1 1 0 466.7379 931.4612 2 931.461 0.0001 0 46.91 9.20E-05 K LLEGEESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2942.2942.2.dta 5 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1133 53671 42 42 29 29 1899 2412 1 1 1 490.2294 978.4442 2 978.444 0.0002 0 42.81 0.00015 K TEISEMNR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3194.3194.2.dta 5 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1133 53671 42 42 29 29 2081 4129 1 1 1 500.7875 999.5605 2 999.56 0.0005 0 43.21 0.00062 R LQAEIEGLK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5080.5080.2.dta 5 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1133 53671 42 42 29 29 2105 698 1 1 1 502.2741 1002.5337 2 1002.5345 -0.0009 1 28.14 0.04 R TQEKEQIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1337.1337.2.dta 5 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1133 53671 42 42 29 29 2316 5028 1 1 1 515.7875 1029.5605 2 1029.5607 -0.0002 0 38.89 0.0028 K WSLLQQQK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6042.6042.2.dta 5 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1133 53671 42 42 29 29 2526 1867 1 1 0 530.7849 1059.5552 2 1059.556 -0.0008 1 38.94 0.004 R KLLEGEESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2604.2604.2.dta 5 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1133 53671 42 42 29 29 2568 1519 1 1 0 533.7617 1065.5089 2 1065.509 -0.0002 1 33.51 0.0014 K YEDEINKR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2227.2227.2.dta 5 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1133 53671 42 42 29 29 2701 1619 1 1 1 541.285 1080.5555 2 1080.5564 -0.0009 1 49.4 0.00013 K SYKVSTSGPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2335.2335.2.dta 5 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1133 53671 42 42 29 29 2703 1618 1 1 1 361.1937 1080.5593 3 1080.5564 0.003 1 38.77 0.00094 K SYKVSTSGPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2334.2334.3.dta 5 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1133 53671 42 42 29 29 2714 4502 1 1 0 541.8033 1081.592 2 1081.592 0 1 43.15 0.00066 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5483.5483.2.dta 5 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1133 53671 42 42 29 29 2752 1541 1 1 0 544.3087 1086.6028 2 1086.6033 -0.0005 1 21.59 0.046 K EQIKTLNNK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2250.2250.2.dta 5 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1133 53671 42 42 29 29 3063 2194 1 1 1 565.3135 1128.6124 2 1128.6138 -0.0014 1 42.68 0.001 R GELAIKDANAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2958.2958.2.dta 5 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1133 53671 42 42 29 29 3125 4088 1 1 1 569.2927 1136.5709 2 1136.5713 -0.0004 0 60.95 1.80E-05 K YEELQSLAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5036.5036.2.dta 5 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1133 53671 42 42 29 29 3241 4204 1 1 0 577.2809 1152.5472 2 1152.5485 -0.0013 0 39.37 0.00068 R EYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5161.5161.2.dta 5 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1133 53671 42 42 29 29 3380 3652 1 1 1 585.2789 1168.5433 2 1168.5434 -0.0001 0 29.02 0.003 R AEAESMYQIK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4564.4564.2.dta 5 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1133 53671 42 42 29 29 3425 3668 1 1 1 587.322 1172.6295 2 1172.6289 0.0006 0 51.24 5.30E-05 K LVSESSDVLPK - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4582.4582.2.dta 5 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1133 53671 42 42 29 29 3642 2197 1 1 1 601.3302 1200.6458 2 1200.6462 -0.0004 1 42.15 0.0014 R RQLETLGQEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2961.2961.2.dta 5 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1133 53671 42 42 29 29 3730 1970 1 1 1 403.5356 1207.585 3 1207.5867 -0.0016 1 32.94 0.00081 R TKTEISEMNR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2715.2715.3.dta 5 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1133 53671 42 42 29 29 3731 1975 1 1 1 604.7999 1207.5852 2 1207.5867 -0.0015 1 63.32 3.50E-06 R TKTEISEMNR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2721.2721.2.dta 5 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1133 53671 42 42 29 29 3845 1075 1 1 1 612.7976 1223.5807 2 1223.5816 -0.0009 1 49.24 4.50E-05 R TKTEISEMNR N Oxidation (M) 0.0000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1746.1746.2.dta 5 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1133 53671 42 42 29 29 4692 6676 1 1 1 660.8392 1319.6638 2 1319.6642 -0.0005 0 82.35 1.10E-07 R SLDMDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7680.7680.2.dta 5 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1133 53671 42 42 29 29 4821 5123 1 1 1 668.8362 1335.6579 2 1335.6592 -0.0012 0 72.81 1.10E-06 R SLDMDSIIAEVK A Oxidation (M) 0.000100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6139.6139.2.dta 5 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1133 53671 42 42 29 29 4864 3296 1 1 1 671.3766 1340.7387 2 1340.7412 -0.0024 1 69.75 1.30E-06 R LQAEIEGLKGQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4179.4179.2.dta 5 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1133 53671 42 42 29 29 4866 3306 1 1 1 447.9211 1340.7414 3 1340.7412 0.0002 1 28 0.021 R LQAEIEGLKGQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4190.4190.3.dta 5 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1133 53671 42 42 29 29 4885 5313 1 1 1 672.8412 1343.6679 2 1343.6681 -0.0001 0 78.78 1.10E-07 R ASLEAAIADAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6329.6329.2.dta 5 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1133 53671 42 42 29 29 4887 5318 1 1 1 448.8968 1343.6684 3 1343.6681 0.0004 0 64.59 6.10E-06 R ASLEAAIADAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6334.6334.3.dta 5 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1133 53671 42 42 29 29 4967 6025 1 1 1 676.8416 1351.6686 2 1351.6693 -0.0008 0 64.81 3.40E-06 R TEMENEFVLIK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7038.7038.2.dta 5 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1133 53671 42 42 29 29 5094 5470 1 1 1 684.8392 1367.6638 2 1367.6642 -0.0005 0 59.17 1.50E-05 R TEMENEFVLIK K Oxidation (M) 0.00100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6485.6485.2.dta 5 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1133 53671 42 42 29 29 5340 4906 1 1 0 699.3737 1396.7328 2 1396.735 -0.0023 1 60.63 5.30E-06 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5916.5916.2.dta 5 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1133 53671 42 42 29 29 5341 4895 1 1 0 466.5853 1396.734 3 1396.735 -0.0011 1 36.65 0.001 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5906.5906.3.dta 5 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1133 53671 42 42 29 29 5476 6839 1 1 1 710.377 1418.7395 2 1418.7405 -0.001 0 59.72 8.50E-06 R LEGLTDEINFLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7842.7842.2.dta 5 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1133 53671 42 42 29 29 5865 3773 1 1 1 737.3923 1472.77 2 1472.7722 -0.0022 1 62.83 1.00E-05 R DGKLVSESSDVLPK - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4694.4694.2.dta 5 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1133 53671 42 42 29 29 5867 3778 1 1 1 491.9313 1472.7721 3 1472.7722 -0.0001 1 47.76 0.00032 R DGKLVSESSDVLPK - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4700.4700.3.dta 5 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1133 53671 42 42 29 29 5965 4932 1 1 1 740.8871 1479.7597 2 1479.7643 -0.0045 1 73.82 1.70E-07 R TEMENEFVLIKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5944.5944.2.dta 5 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1133 53671 42 42 29 29 5966 4923 1 1 1 494.2617 1479.7633 3 1479.7643 -0.001 1 16.85 0.026 R TEMENEFVLIKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5934.5934.3.dta 5 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1133 53671 42 42 29 29 6044 4340 1 1 1 499.5934 1495.7585 3 1495.7592 -0.0007 1 47.04 6.70E-05 R TEMENEFVLIKK D Oxidation (M) 0.001000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5308.5308.3.dta 5 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1133 53671 42 42 29 29 6319 4549 1 1 1 775.9029 1549.7912 2 1549.7922 -0.001 1 46.93 0.00011 R QLREYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5534.5534.2.dta 5 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1133 53671 42 42 29 29 6320 4545 1 1 1 517.6049 1549.7929 3 1549.7922 0.0007 1 37.35 0.00066 R QLREYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5530.5530.3.dta 5 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1133 53671 42 42 29 29 7579 4355 1 1 1 899.4188 1796.8231 2 1796.825 -0.0019 1 52.55 2.40E-05 K DVDEAYMNKVELESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5324.5324.2.dta 5 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1133 53671 42 42 29 29 7580 4344 1 1 1 599.9485 1796.8236 3 1796.825 -0.0014 1 47.6 3.40E-05 K DVDEAYMNKVELESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5312.5312.3.dta 5 2 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 26 26 367 2147 1 0 0 352.6953 703.376 2 703.3752 0.0008 0 32.5 0.017 R LDSELK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2907.2907.2.dta 5 2 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 26 26 915 3702 1 0 1 416.7506 831.4867 2 831.4814 0.0053 0 34.8 0.0029 K SISISVAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4618.4618.2.dta 5 2 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 26 26 1656 1112 1 0 1 473.2535 944.4925 2 944.4927 -0.0002 1 46.1 0.00057 R GENALKDAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1786.1786.2.dta 5 2 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 26 26 2064 2802 1 0 1 500.2267 998.4388 2 998.4379 0.0009 0 47.28 0.00011 K DVDGAYMTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3631.3631.2.dta 5 2 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 26 26 2069 5645 1 0 1 500.2519 998.4892 2 998.4893 -0.0002 1 31.21 0.0012 R HGDSVRNSK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.666.666.2.dta 5 2 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 26 26 2336 3087 1 0 1 517.2621 1032.5096 2 1032.5087 0.0009 0 45.18 0.00018 R TLLEGEESR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3949.3949.2.dta 5 2 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 26 26 2568 1519 1 0 0 533.7617 1065.5089 2 1065.509 -0.0002 1 33.51 0.0014 K YEDEINKR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2227.2227.2.dta 5 2 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 26 26 2785 979 1 0 1 546.7537 1091.4928 2 1091.4956 -0.0028 0 115.66 3.30E-11 R GSGGGSSGGSIGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1642.1642.2.dta 5 2 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 26 26 2786 1115 1 0 1 546.7548 1091.4951 2 1091.4956 -0.0005 0 77.9 2.00E-07 R GSGGGSSGGSIGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1789.1789.2.dta 5 2 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 26 26 3036 2657 1 0 1 563.2712 1124.5279 2 1124.5349 -0.007 0 65.23 2.60E-06 K AEAESLYQSK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3462.3462.2.dta 5 2 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 26 26 3440 1022 1 0 1 588.3013 1174.588 2 1174.5942 -0.0062 1 54.82 7.30E-05 R VDQLKSDQSR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1688.1688.2.dta 5 2 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 26 26 4238 4395 1 0 1 633.3214 1264.6283 2 1264.6299 -0.0016 0 55.89 3.00E-05 R TNAENEFVTIK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5367.5367.2.dta 5 2 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 26 26 4343 2687 1 0 1 426.549 1276.6252 3 1276.6259 -0.0007 1 41.04 0.0021 K SDQSRLDSELK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3494.3494.3.dta 5 2 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 26 26 4525 4588 1 0 1 650.7676 1299.5207 2 1299.5224 -0.0016 0 61.8 2.10E-06 K NMQDMVEDYR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5576.5576.2.dta 5 2 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 26 26 4555 3474 1 0 1 651.853 1301.6915 2 1301.6939 -0.0024 1 45.09 0.00067 R NSKIEISELNR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4372.4372.2.dta 5 2 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 26 26 4556 3470 1 0 1 434.9048 1301.6927 3 1301.6939 -0.0012 1 47.26 0.00045 R NSKIEISELNR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4367.4367.3.dta 5 2 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 26 26 4557 7292 1 0 1 651.8604 1301.7062 2 1301.7078 -0.0017 0 63.5 5.00E-06 R SLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8290.8290.2.dta 5 2 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 26 26 4852 2202 1 0 1 670.8375 1339.6604 2 1339.6619 -0.0015 1 68.92 2.10E-06 K SKAEAESLYQSK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2967.2967.2.dta 5 2 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 26 26 5293 3438 1 0 1 697.3683 1392.7221 2 1392.7249 -0.0027 1 63.1 6.70E-06 R TNAENEFVTIKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4333.4333.2.dta 5 2 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 26 26 5922 5785 1 0 1 738.3773 1474.74 2 1474.7416 -0.0016 0 48.62 2.80E-05 K WELLQQVDTSTR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6797.6797.2.dta 5 2 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 26 26 5923 5921 1 0 1 738.3781 1474.7416 2 1474.7416 -0.0001 0 54.79 4.20E-05 K WELLQQVDTSTR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6932.6932.2.dta 5 2 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 26 26 5924 3891 1 0 0 738.3968 1474.7791 2 1474.778 0.0012 0 75.71 5.20E-07 R FLEQQNQVLQTK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4822.4822.2.dta 5 2 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 26 26 6188 4601 1 0 1 762.3944 1522.7743 2 1522.7813 -0.0071 1 27.46 0.036 R LLRDYQELMNTK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5590.5590.2.dta 5 2 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 26 26 6193 4594 1 0 1 508.601 1522.7812 3 1522.7813 -0.0001 1 41.32 0.00013 R LLRDYQELMNTK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5583.5583.3.dta 5 2 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 26 26 7324 4520 1 0 1 858.9282 1715.8418 2 1715.8438 -0.002 0 101.78 2.90E-10 K QISNLQQSISDAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5503.5503.2.dta 5 2 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 26 26 7325 4527 1 0 1 572.9549 1715.8429 3 1715.8438 -0.001 0 56.09 2.00E-05 K QISNLQQSISDAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5510.5510.3.dta 5 2 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 26 26 7496 4112 1 0 1 883.3701 1764.7256 2 1764.7275 -0.0019 0 111.26 1.80E-11 R FSSCGGGGGSFGAGGGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5062.5062.2.dta 5 2 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 26 26 8077 3354 1 0 1 673.2958 2016.8657 3 2016.8768 -0.0111 1 29.13 0.0033 R LDSELKNMQDMVEDYR N 2 Oxidation (M) 0.0000000100100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4242.4242.3.dta 5 2 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 26 26 8127 851 1 0 1 693.9761 2078.9064 3 2078.9075 -0.0011 1 40.77 0.00037 R GGSGGGGGGSSGGRGSGGGSSGGSIGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1503.1503.3.dta 5 2 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 26 26 8321 2168 1 0 1 795.3215 2382.9428 3 2382.9447 -0.0019 0 75.99 2.50E-08 R GGGGGGYGSGGSSYGSGGGSYGSGGGGGGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2930.2930.3.dta 5 2 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 26 26 8322 7972 1 0 1 795.323 2382.9472 3 2382.9447 0.0025 0 14.1 0.039 R GGGGGGYGSGGSSYGSGGGSYGSGGGGGGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.9066.9066.3.dta 5 2 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 26 26 8509 2481 1 0 1 1104.774 3311.3003 3 3311.3009 -0.0006 0 13.5 0.045 R GSYGSGGSSYGSGGGSYGSGGGGGGHGSYGSGSSSGGYR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3269.3269.3.dta 5 3 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1033 66110 29 29 24 24 653 1615 1 0 1 390.1937 778.3729 2 778.3722 0.0007 0 43.28 0.00026 K AAFGGSGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2331.2331.2.dta 5 3 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1033 66110 29 29 24 24 884 4556 1 0 0 414.2192 826.4238 2 826.4225 0.0013 0 39.7 0.0021 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5542.5542.2.dta 5 3 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1033 66110 29 29 24 24 2023 2089 1 0 1 497.7875 993.5605 2 993.5607 -0.0003 0 48.99 8.90E-05 R LQGEIAHVK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2844.2844.2.dta 5 3 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1033 66110 29 29 24 24 2024 2085 1 0 1 332.1945 993.5616 3 993.5607 0.0009 0 27.01 0.0082 R LQGEIAHVK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2840.2840.3.dta 5 3 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1033 66110 29 29 24 24 2568 1519 1 0 0 533.7617 1065.5089 2 1065.509 -0.0002 1 33.51 0.0014 K YEDEINKR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2227.2227.2.dta 5 3 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1033 66110 29 29 24 24 2714 4502 1 0 0 541.8033 1081.592 2 1081.592 0 1 43.15 0.00066 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5483.5483.2.dta 5 3 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1033 66110 29 29 24 24 2752 1541 1 0 0 544.3087 1086.6028 2 1086.6033 -0.0005 1 21.59 0.046 R EQIKTLNNK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2250.2250.2.dta 5 3 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1033 66110 29 29 24 24 3019 1475 1 0 1 561.8347 1121.6548 2 1121.6557 -0.0009 1 28.13 0.0075 R LQGEIAHVKK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2179.2179.2.dta 5 3 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1033 66110 29 29 24 24 3020 1459 1 0 1 374.8931 1121.6575 3 1121.6557 0.0018 1 18.49 0.018 R LQGEIAHVKK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2162.2162.3.dta 5 3 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1033 66110 29 29 24 24 3076 3461 1 0 1 566.2578 1130.501 2 1130.5026 -0.0017 0 54.79 7.30E-06 R STSSFSCLSR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4358.4358.2.dta 5 3 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1033 66110 29 29 24 24 3084 2028 1 0 0 567.2836 1132.5526 2 1132.5546 -0.002 1 55.5 1.80E-05 R KLLEGEECR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2778.2778.2.dta 5 3 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1033 66110 29 29 24 24 3085 2033 1 0 0 378.5258 1132.5554 3 1132.5546 0.0008 1 29.43 0.0043 R KLLEGEECR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2783.2783.3.dta 5 3 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1033 66110 29 29 24 24 3608 1662 1 0 1 599.2782 1196.5418 2 1196.5422 -0.0004 0 88.13 1.70E-08 K GGSISGGGYGSGGGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2382.2382.2.dta 5 3 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1033 66110 29 29 24 24 3735 4525 1 0 1 604.8118 1207.609 2 1207.6085 0.0005 0 51.59 0.00018 R TAAENDFVTLK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5508.5508.2.dta 5 3 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1033 66110 29 29 24 24 4124 2810 1 0 1 627.8078 1253.601 2 1253.6001 0.001 0 89.24 2.10E-08 R GFSSGSAVVSGGSR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3639.3639.2.dta 5 3 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1033 66110 29 29 24 24 4402 2789 1 0 1 644.3088 1286.603 2 1286.6037 -0.0007 1 49.16 6.50E-05 R RSTSSFSCLSR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3613.3613.2.dta 5 3 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1033 66110 29 29 24 24 4403 2784 1 0 1 429.8757 1286.6053 3 1286.6037 0.0015 1 31.62 0.0012 R RSTSSFSCLSR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3608.3608.3.dta 5 3 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1033 66110 29 29 24 24 4686 2923 1 0 1 660.7966 1319.5787 2 1319.5756 0.0031 0 90.5 3.30E-09 R HGGGGGGFGGGGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3768.3768.2.dta 5 3 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1033 66110 29 29 24 24 4766 4032 1 0 1 665.3225 1328.6305 2 1328.632 -0.0016 0 74.86 1.90E-07 K NVQDAIADAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4975.4975.2.dta 5 3 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1033 66110 29 29 24 24 4773 7278 1 0 0 665.3659 1328.7173 2 1328.7187 -0.0015 0 60.5 1.90E-05 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8277.8277.2.dta 5 3 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1033 66110 29 29 24 24 4825 3552 1 0 1 668.8584 1335.7022 2 1335.7034 -0.0012 1 71.52 1.10E-06 R TAAENDFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4456.4456.2.dta 5 3 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1033 66110 29 29 24 24 5280 1903 1 0 1 464.5645 1390.6715 3 1390.6728 -0.0013 1 43.88 0.00082 R SKEEAEALYHSK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2643.2643.3.dta 5 3 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1033 66110 29 29 24 24 5340 4906 1 0 0 699.3737 1396.7328 2 1396.735 -0.0023 1 60.63 5.30E-06 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5916.5916.2.dta 5 3 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1033 66110 29 29 24 24 5341 4895 1 0 0 466.5853 1396.734 3 1396.735 -0.0011 1 36.65 0.001 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5906.5906.3.dta 5 3 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1033 66110 29 29 24 24 5782 7152 1 0 1 730.9027 1459.7909 2 1459.7922 -0.0014 0 35.53 0.00047 K VDLLNQEIEFLK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8152.8152.2.dta 5 3 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1033 66110 29 29 24 24 5924 3891 1 0 0 738.3968 1474.7791 2 1474.778 0.0012 0 75.71 5.20E-07 R FLEQQNQVLQTK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4822.4822.2.dta 5 3 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1033 66110 29 29 24 24 6577 1209 1 0 1 794.8452 1587.6758 2 1587.6761 -0.0004 0 90.67 3.90E-09 R GGSSSGGGYGSGGGGSSSVK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1891.1891.2.dta 5 3 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1033 66110 29 29 24 24 7407 1614 1 0 1 870.8564 1739.6983 2 1739.6983 0 0 94.57 3.50E-10 R GSSSGGGYSSGSSSYGSGGR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2330.2330.2.dta 5 3 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1033 66110 29 29 24 24 7413 1808 1 0 1 871.3782 1740.7419 2 1740.7412 0.0007 0 113.56 1.50E-11 R GGSGGGGSISGGGYGSGGGSGGR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2540.2540.2.dta 5 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 696 51443 26 26 21 21 32 1747 1 0 0 302.1898 602.365 2 602.3639 0.0011 0 24.89 0.047 K LLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2474.2474.2.dta 5 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 696 51443 26 26 21 21 51 2241 1 0 0 305.1714 608.3283 2 608.3282 0.0001 0 25.68 0.044 K AYSIR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3009.3009.2.dta 5 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 696 51443 26 26 21 21 850 375 1 0 0 410.211 818.4075 2 818.4068 0.0007 1 38.4 0.0053 R AKQDMAR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1056.1056.2.dta 5 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 696 51443 26 26 21 21 884 4556 1 0 0 414.2192 826.4238 2 826.4225 0.0013 0 39.7 0.0021 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5542.5542.2.dta 5 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 696 51443 26 26 21 21 1559 2179 1 0 0 466.7379 931.4612 2 931.461 0.0001 0 46.91 9.20E-05 K LLEGEESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2942.2942.2.dta 5 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 696 51443 26 26 21 21 2186 2881 1 0 1 507.7642 1013.5138 2 1013.5142 -0.0003 0 43.69 0.00066 R LDADPSLQR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3723.3723.2.dta 5 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 696 51443 26 26 21 21 2426 5095 1 0 1 523.2872 1044.5599 2 1044.5604 -0.0005 0 36.95 0.0013 K WTLLQEQK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6110.6110.2.dta 5 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 696 51443 26 26 21 21 2526 1867 1 0 0 530.7849 1059.5552 2 1059.556 -0.0008 1 38.94 0.004 R KLLEGEESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2604.2604.2.dta 5 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 696 51443 26 26 21 21 2714 4502 1 0 0 541.8033 1081.592 2 1081.592 0 1 43.15 0.00066 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5483.5483.2.dta 5 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 696 51443 26 26 21 21 2861 3451 1 0 1 552.7927 1103.5708 2 1103.5724 -0.0016 0 53.38 0.00012 R SAYGGPVGAGIR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4347.4347.2.dta 5 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 696 51443 26 26 21 21 3510 5076 1 0 1 593.8093 1185.6041 2 1185.5989 0.0052 0 47.64 0.0004 K QEELEAALQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6091.6091.2.dta 5 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 696 51443 26 26 21 21 3821 5067 1 0 1 610.829 1219.6434 2 1219.6448 -0.0014 0 55.65 4.80E-05 R TAAENEFVVLK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6082.6082.2.dta 5 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 696 51443 26 26 21 21 4051 1192 1 0 1 623.3244 1244.6343 2 1244.636 -0.0018 1 48.71 0.00032 R VRQEESEQIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1872.1872.2.dta 5 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 696 51443 26 26 21 21 4303 6985 1 0 1 636.8553 1271.696 2 1271.6973 -0.0013 0 65.95 4.50E-06 R SLDLDGIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7986.7986.2.dta 5 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 696 51443 26 26 21 21 4944 4065 1 0 1 674.8752 1347.7358 2 1347.7398 -0.004 1 42.83 0.00016 R TAAENEFVVLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5011.5011.2.dta 5 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 696 51443 26 26 21 21 4945 4080 1 0 1 674.8752 1347.7358 2 1347.7398 -0.004 1 71 9.40E-07 R TAAENEFVVLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5027.5027.2.dta 5 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 696 51443 26 26 21 21 4946 4053 1 0 1 450.2542 1347.7406 3 1347.7398 0.0008 1 44.64 7.60E-05 R TAAENEFVVLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4998.4998.3.dta 5 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 696 51443 26 26 21 21 5221 3549 1 0 1 693.3716 1384.7286 2 1384.731 -0.0024 1 59.57 3.90E-06 R AKQEELEAALQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4453.4453.2.dta 5 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 696 51443 26 26 21 21 5222 3548 1 0 1 462.5843 1384.7309 3 1384.731 0 1 41.45 0.0018 R AKQEELEAALQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4452.4452.3.dta 5 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 696 51443 26 26 21 21 5340 4906 1 0 0 699.3737 1396.7328 2 1396.735 -0.0023 1 60.63 5.30E-06 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5916.5916.2.dta 5 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 696 51443 26 26 21 21 5341 4895 1 0 0 466.5853 1396.734 3 1396.735 -0.0011 1 36.65 0.001 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5906.5906.3.dta 5 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 696 51443 26 26 21 21 5470 6428 1 0 1 709.8665 1417.7184 2 1417.7201 -0.0018 0 85.43 1.90E-08 K VDALNDEINFLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7435.7435.2.dta 5 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 696 51443 26 26 21 21 5665 2966 1 0 1 721.3906 1440.7666 2 1440.7684 -0.0019 1 77.72 5.20E-08 R LQAEIDNIKNQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3815.3815.2.dta 5 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 696 51443 26 26 21 21 5751 6229 1 0 1 727.4219 1452.8293 2 1452.83 -0.0007 0 57.8 1.00E-05 R EVTINQSLLAPLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7239.7239.2.dta 5 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 696 51443 26 26 21 21 6019 3999 1 0 0 745.9124 1489.8102 2 1489.814 -0.0039 1 40.38 0.00044 R FLEQQNKLLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4939.4939.2.dta 5 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 696 51443 26 26 21 21 6020 3981 1 0 0 497.6119 1489.8138 3 1489.814 -0.0002 1 21.93 0.0088 R FLEQQNKLLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4920.4920.3.dta 5 5 IPI00418471.6 Vimentin 647 53676 27 27 25 25 347 1988 1 0 1 351.2009 700.3872 2 700.3868 0.0004 0 56.36 6.10E-05 R SSVPGVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2735.2735.2.dta 5 5 IPI00418471.6 Vimentin 647 53676 27 27 25 25 1194 1291 1 0 1 436.7096 871.4047 2 871.4035 0.0011 0 16.2 0.033 R SVSSSSYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1980.1980.2.dta 5 5 IPI00418471.6 Vimentin 647 53676 27 27 25 25 1559 2179 1 0 0 466.7379 931.4612 2 931.461 0.0001 0 46.91 9.20E-05 K LLEGEESR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2942.2942.2.dta 5 5 IPI00418471.6 Vimentin 647 53676 27 27 25 25 2253 1714 1 0 1 512.2585 1022.5025 2 1022.5032 -0.0007 0 34.95 0.00094 R QQYESVAAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2438.2438.2.dta 5 5 IPI00418471.6 Vimentin 647 53676 27 27 25 25 2290 955 1 0 1 514.7594 1027.5042 2 1027.5047 -0.0004 1 36.01 0.0021 R SVSSSSYRR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1616.1616.2.dta 5 5 IPI00418471.6 Vimentin 647 53676 27 27 25 25 2523 2004 1 0 1 530.7667 1059.5189 2 1059.5197 -0.0008 0 46.93 4.00E-05 R QVDQLTNDK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2752.2752.2.dta 5 5 IPI00418471.6 Vimentin 647 53676 27 27 25 25 2526 1867 1 0 0 530.7849 1059.5552 2 1059.556 -0.0008 1 38.94 0.004 R KLLEGEESR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2604.2604.2.dta 5 5 IPI00418471.6 Vimentin 647 53676 27 27 25 25 2580 801 1 0 1 534.7569 1067.4992 2 1067.4996 -0.0003 1 27.28 0.03 K QESTEYRR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1449.1449.2.dta 5 5 IPI00418471.6 Vimentin 647 53676 27 27 25 25 2758 2205 1 0 1 544.7698 1087.5251 2 1087.5258 -0.0007 0 73.59 6.00E-07 R QDVDNASLAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2970.2970.2.dta 5 5 IPI00418471.6 Vimentin 647 53676 27 27 25 25 2793 3563 1 0 1 547.2628 1092.5111 2 1092.52 -0.0089 0 62.62 8.80E-06 K FADLSEAANR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4468.4468.2.dta 5 5 IPI00418471.6 Vimentin 647 53676 27 27 25 25 3039 3674 1 0 1 375.8743 1124.601 3 1124.5978 0.0031 1 20.6 0.012 R FANYIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4588.4588.3.dta 5 5 IPI00418471.6 Vimentin 647 53676 27 27 25 25 3385 6634 1 0 1 585.3596 1168.7047 2 1168.7067 -0.002 0 54.88 1.30E-05 K ILLAELEQLK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7639.7639.2.dta 5 5 IPI00418471.6 Vimentin 647 53676 27 27 25 25 3782 1684 1 0 1 608.8171 1215.6196 2 1215.6208 -0.0012 1 37.32 0.0012 R RQVDQLTNDK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2405.2405.2.dta 5 5 IPI00418471.6 Vimentin 647 53676 27 27 25 25 4406 1665 1 0 1 644.3361 1286.6576 2 1286.6579 -0.0003 1 56.19 5.00E-05 R QVDQLTNDKAR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2385.2385.2.dta 5 5 IPI00418471.6 Vimentin 647 53676 27 27 25 25 4407 1657 1 0 1 429.8933 1286.6581 3 1286.6579 0.0002 1 28.8 0.0029 R QVDQLTNDKAR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2376.2376.3.dta 5 5 IPI00418471.6 Vimentin 647 53676 27 27 25 25 4615 4798 1 0 1 655.3063 1308.5981 2 1308.5986 -0.0005 0 55.38 6.40E-06 K NLQEAEEWYK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5802.5802.2.dta 5 5 IPI00418471.6 Vimentin 647 53676 27 27 25 25 5292 2818 1 0 1 465.2401 1392.6983 3 1392.6997 -0.0014 1 25.59 0.0046 R DVRQQYESVAAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3649.3649.3.dta 5 5 IPI00418471.6 Vimentin 647 53676 27 27 25 25 5552 3822 1 0 1 714.8594 1427.7043 2 1427.7045 -0.0002 0 76.07 7.40E-08 R SLYASSPGGVYATR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4748.4748.2.dta 5 5 IPI00418471.6 Vimentin 647 53676 27 27 25 25 6276 5590 1 0 1 770.4577 1538.9009 2 1538.9032 -0.0023 1 20.3 0.028 K ILLAELEQLKGQGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6603.6603.2.dta 5 5 IPI00418471.6 Vimentin 647 53676 27 27 25 25 6576 3455 1 0 1 529.9365 1586.7877 3 1586.79 -0.0022 1 28.62 0.0046 R TNEKVELQELNDR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4351.4351.3.dta 5 5 IPI00418471.6 Vimentin 647 53676 27 27 25 25 6939 5347 1 0 1 551.6031 1651.7874 3 1651.7875 -0.0001 1 20.78 0.012 R LGDLYEEEMRELR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6363.6363.3.dta 5 5 IPI00418471.6 Vimentin 647 53676 27 27 25 25 7148 4978 1 0 1 844.9155 1687.8165 2 1687.8199 -0.0034 1 38.65 0.00024 R VEVERDNLAEDIMR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5991.5991.2.dta 5 5 IPI00418471.6 Vimentin 647 53676 27 27 25 25 7149 4969 1 0 1 563.6132 1687.8178 3 1687.8199 -0.0021 1 43.21 8.90E-05 R VEVERDNLAEDIMR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5983.5983.3.dta 5 5 IPI00418471.6 Vimentin 647 53676 27 27 25 25 7529 3804 1 0 1 592.9587 1775.8542 3 1775.855 -0.0008 1 39.49 0.00057 K FADLSEAANRNNDALR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4728.4728.3.dta 5 5 IPI00418471.6 Vimentin 647 53676 27 27 25 25 7684 2822 1 0 1 918.9027 1835.7909 2 1835.7922 -0.0013 0 59.37 2.70E-06 R DGQVINETSQHHDDLE - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3654.3654.2.dta 5 5 IPI00418471.6 Vimentin 647 53676 27 27 25 25 8315 5099 1 0 1 793.0583 2376.153 3 2376.1591 -0.0061 1 34.06 0.00064 R QVQSLTCEVDALKGTNESLER Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6115.6115.3.dta 5 5 IPI00418471.6 Vimentin 647 53676 27 27 25 25 8347 2791 1 0 1 808.3748 2422.1026 3 2422.0997 0.0029 1 53.76 9.10E-06 K TVETRDGQVINETSQHHDDLE - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3618.3618.3.dta 5 6 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 556 60273 18 18 16 16 884 4556 1 0 0 414.2192 826.4238 2 826.4225 0.0013 0 39.7 0.0021 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5542.5542.2.dta 5 6 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 556 60273 18 18 16 16 1979 696 1 0 0 495.2302 988.4458 2 988.4462 -0.0004 0 38.15 0.00026 K YTTTSSSSR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1335.1335.2.dta 5 6 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 556 60273 18 18 16 16 2208 3774 1 0 0 508.772 1015.5295 2 1015.5298 -0.0004 0 59.37 2.80E-05 R QLDSIVGER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4696.4696.2.dta 5 6 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 556 60273 18 18 16 16 2276 3910 1 0 0 513.7645 1025.5144 2 1025.5142 0.0002 0 52.75 2.00E-05 R SGFSSISVSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4843.4843.2.dta 5 6 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 556 60273 18 18 16 16 2568 1519 1 0 0 533.7617 1065.5089 2 1065.509 -0.0002 1 33.51 0.0014 K YEDEINKR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2227.2227.2.dta 5 6 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 556 60273 18 18 16 16 2714 4502 1 0 0 541.8033 1081.592 2 1081.592 0 1 43.15 0.00066 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5483.5483.2.dta 5 6 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 556 60273 18 18 16 16 2752 1541 1 0 0 544.3087 1086.6028 2 1086.6033 -0.0005 1 21.59 0.046 R EQIKTLNNK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2250.2250.2.dta 5 6 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 556 60273 18 18 16 16 3084 2028 1 0 0 567.2836 1132.5526 2 1132.5546 -0.002 1 55.5 1.80E-05 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2778.2778.2.dta 5 6 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 556 60273 18 18 16 16 3085 2033 1 0 0 378.5258 1132.5554 3 1132.5546 0.0008 1 29.43 0.0043 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2783.2783.3.dta 5 6 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 556 60273 18 18 16 16 3241 4204 1 0 0 577.2809 1152.5472 2 1152.5485 -0.0013 0 39.37 0.00068 K EYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5161.5161.2.dta 5 6 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 556 60273 18 18 16 16 4649 2429 1 0 0 439.2361 1314.6863 3 1314.6891 -0.0028 1 27.33 0.03 R NTKQEIAEINR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3212.3212.3.dta 5 6 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 556 60273 18 18 16 16 4773 7278 1 0 0 665.3659 1328.7173 2 1328.7187 -0.0015 0 60.5 1.90E-05 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8277.8277.2.dta 5 6 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 556 60273 18 18 16 16 5340 4906 1 0 0 699.3737 1396.7328 2 1396.735 -0.0023 1 60.63 5.30E-06 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5916.5916.2.dta 5 6 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 556 60273 18 18 16 16 5341 4895 1 0 0 466.5853 1396.734 3 1396.735 -0.0011 1 36.65 0.001 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5906.5906.3.dta 5 6 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 556 60273 18 18 16 16 5419 6644 1 0 0 704.3592 1406.7038 2 1406.7041 -0.0003 0 78.21 2.70E-07 K ADTLTDEINFLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7649.7649.2.dta 5 6 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 556 60273 18 18 16 16 5524 3331 1 0 0 712.818 1423.6214 2 1423.6263 -0.0049 0 91.64 4.10E-09 R GSGGLGGACGGAGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4217.4217.2.dta 5 6 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 556 60273 18 18 16 16 5697 3901 1 0 1 724.3919 1446.7693 2 1446.7678 0.0014 0 72.84 3.70E-07 R AIGGGLSSVGGGSSTIK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4833.4833.2.dta 5 6 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 556 60273 18 18 16 16 6617 4117 1 0 0 799.8825 1597.7505 2 1597.7519 -0.0014 0 79.66 1.70E-07 R ISIGGGSCAISGGYGSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5067.5067.2.dta 5 7 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 550 60247 18 18 16 16 884 4556 1 0 0 414.2192 826.4238 2 826.4225 0.0013 0 39.7 0.0021 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5542.5542.2.dta 5 7 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 550 60247 18 18 16 16 1979 696 1 0 0 495.2302 988.4458 2 988.4462 -0.0004 0 38.15 0.00026 K YTTTSSSSR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1335.1335.2.dta 5 7 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 550 60247 18 18 16 16 2208 3774 1 0 0 508.772 1015.5295 2 1015.5298 -0.0004 0 59.37 2.80E-05 R QLDSIVGER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4696.4696.2.dta 5 7 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 550 60247 18 18 16 16 2276 3910 1 0 0 513.7645 1025.5144 2 1025.5142 0.0002 0 52.75 2.00E-05 R SGFSSISVSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4843.4843.2.dta 5 7 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 550 60247 18 18 16 16 2568 1519 1 0 0 533.7617 1065.5089 2 1065.509 -0.0002 1 33.51 0.0014 K YEDEINKR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2227.2227.2.dta 5 7 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 550 60247 18 18 16 16 2714 4502 1 0 0 541.8033 1081.592 2 1081.592 0 1 43.15 0.00066 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5483.5483.2.dta 5 7 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 550 60247 18 18 16 16 2752 1541 1 0 0 544.3087 1086.6028 2 1086.6033 -0.0005 1 21.59 0.046 R EQIKTLNNK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2250.2250.2.dta 5 7 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 550 60247 18 18 16 16 3084 2028 1 0 0 567.2836 1132.5526 2 1132.5546 -0.002 1 55.5 1.80E-05 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2778.2778.2.dta 5 7 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 550 60247 18 18 16 16 3085 2033 1 0 0 378.5258 1132.5554 3 1132.5546 0.0008 1 29.43 0.0043 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2783.2783.3.dta 5 7 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 550 60247 18 18 16 16 3241 4204 1 0 0 577.2809 1152.5472 2 1152.5485 -0.0013 0 39.37 0.00068 K EYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5161.5161.2.dta 5 7 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 550 60247 18 18 16 16 4649 2429 1 0 0 439.2361 1314.6863 3 1314.6891 -0.0028 1 27.33 0.03 R NTKQEIAEINR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3212.3212.3.dta 5 7 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 550 60247 18 18 16 16 4773 7278 1 0 0 665.3659 1328.7173 2 1328.7187 -0.0015 0 60.5 1.90E-05 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8277.8277.2.dta 5 7 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 550 60247 18 18 16 16 5340 4906 1 0 0 699.3737 1396.7328 2 1396.735 -0.0023 1 60.63 5.30E-06 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5916.5916.2.dta 5 7 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 550 60247 18 18 16 16 5341 4895 1 0 0 466.5853 1396.734 3 1396.735 -0.0011 1 36.65 0.001 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5906.5906.3.dta 5 7 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 550 60247 18 18 16 16 5419 6644 1 0 0 704.3592 1406.7038 2 1406.7041 -0.0003 0 78.21 2.70E-07 K ADTLTDEINFLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7649.7649.2.dta 5 7 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 550 60247 18 18 16 16 5524 3331 1 0 0 712.818 1423.6214 2 1423.6263 -0.0049 0 91.64 4.10E-09 R GSGGLGGACGGAGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4217.4217.2.dta 5 7 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 550 60247 18 18 16 16 5605 3135 1 0 1 718.3722 1434.7298 2 1434.7315 -0.0016 0 61.85 1.60E-06 R ATGGGLSSVGGGSSTIK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4003.4003.2.dta 5 7 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 550 60247 18 18 16 16 6617 4117 1 0 0 799.8825 1597.7505 2 1597.7519 -0.0014 0 79.66 1.70E-07 R ISIGGGSCAISGGYGSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5067.5067.2.dta 5 8 IPI00009867.2 "Keratin, type II cytoskeletal 5" 475 62637 16 16 14 14 850 375 1 0 0 410.211 818.4075 2 818.4068 0.0007 1 38.4 0.0053 K AKQDMAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1056.1056.2.dta 5 8 IPI00009867.2 "Keratin, type II cytoskeletal 5" 475 62637 16 16 14 14 884 4556 1 0 0 414.2192 826.4238 2 826.4225 0.0013 0 39.7 0.0021 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5542.5542.2.dta 5 8 IPI00009867.2 "Keratin, type II cytoskeletal 5" 475 62637 16 16 14 14 1132 1540 1 0 1 433.1992 864.3839 2 864.3839 0.0001 0 71.8 2.80E-07 R SGGGGGGGFGR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2249.2249.2.dta 5 8 IPI00009867.2 "Keratin, type II cytoskeletal 5" 475 62637 16 16 14 14 2208 3774 1 0 0 508.772 1015.5295 2 1015.5298 -0.0004 0 59.37 2.80E-05 R QLDSIVGER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4696.4696.2.dta 5 8 IPI00009867.2 "Keratin, type II cytoskeletal 5" 475 62637 16 16 14 14 2568 1519 1 0 0 533.7617 1065.5089 2 1065.509 -0.0002 1 33.51 0.0014 K YEDEINKR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2227.2227.2.dta 5 8 IPI00009867.2 "Keratin, type II cytoskeletal 5" 475 62637 16 16 14 14 2714 4502 1 0 0 541.8033 1081.592 2 1081.592 0 1 43.15 0.00066 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5483.5483.2.dta 5 8 IPI00009867.2 "Keratin, type II cytoskeletal 5" 475 62637 16 16 14 14 2752 1541 1 0 0 544.3087 1086.6028 2 1086.6033 -0.0005 1 21.59 0.046 R EQIKTLNNK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2250.2250.2.dta 5 8 IPI00009867.2 "Keratin, type II cytoskeletal 5" 475 62637 16 16 14 14 3084 2028 1 0 0 567.2836 1132.5526 2 1132.5546 -0.002 1 55.5 1.80E-05 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2778.2778.2.dta 5 8 IPI00009867.2 "Keratin, type II cytoskeletal 5" 475 62637 16 16 14 14 3085 2033 1 0 0 378.5258 1132.5554 3 1132.5546 0.0008 1 29.43 0.0043 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2783.2783.3.dta 5 8 IPI00009867.2 "Keratin, type II cytoskeletal 5" 475 62637 16 16 14 14 3572 2438 1 0 1 597.7907 1193.5669 2 1193.5676 -0.0008 0 61.06 5.90E-06 K YEELQQTAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3222.3222.2.dta 5 8 IPI00009867.2 "Keratin, type II cytoskeletal 5" 475 62637 16 16 14 14 4773 7278 1 0 0 665.3659 1328.7173 2 1328.7187 -0.0015 0 60.5 1.90E-05 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8277.8277.2.dta 5 8 IPI00009867.2 "Keratin, type II cytoskeletal 5" 475 62637 16 16 14 14 5340 4906 1 0 0 699.3737 1396.7328 2 1396.735 -0.0023 1 60.63 5.30E-06 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5916.5916.2.dta 5 8 IPI00009867.2 "Keratin, type II cytoskeletal 5" 475 62637 16 16 14 14 5341 4895 1 0 0 466.5853 1396.734 3 1396.735 -0.0011 1 36.65 0.001 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5906.5906.3.dta 5 8 IPI00009867.2 "Keratin, type II cytoskeletal 5" 475 62637 16 16 14 14 5426 3874 1 0 1 705.8436 1409.6726 2 1409.6722 0.0004 0 74.92 1.10E-07 R VSLAGACGVGGYGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4804.4804.2.dta 5 8 IPI00009867.2 "Keratin, type II cytoskeletal 5" 475 62637 16 16 14 14 5428 4058 1 0 1 705.8634 1409.7123 2 1409.7151 -0.0028 0 58.97 3.00E-06 R SFSTASAITPSVSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5003.5003.2.dta 5 8 IPI00009867.2 "Keratin, type II cytoskeletal 5" 475 62637 16 16 14 14 5657 4120 1 0 1 720.3611 1438.7076 2 1438.7053 0.0024 0 43.37 8.60E-05 R GLGVGFGSGGGSSSSVK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5070.5070.2.dta 5 9 IPI00739163.1 "similar to keratin, hair, basic, 3" 281 41633 15 15 12 12 32 1747 1 0 0 302.1898 602.365 2 602.3639 0.0011 0 24.89 0.047 K LLETK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2474.2474.2.dta 5 9 IPI00739163.1 "similar to keratin, hair, basic, 3" 281 41633 15 15 12 12 109 2677 1 0 1 315.1555 628.2965 2 628.2969 -0.0004 0 26.59 0.012 R SFGYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3483.3483.2.dta 5 9 IPI00739163.1 "similar to keratin, hair, basic, 3" 281 41633 15 15 12 12 1828 3710 1 0 1 484.7512 967.4879 2 967.4875 0.0003 0 27.29 0.0047 K LQFYQNR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4626.4626.2.dta 5 9 IPI00739163.1 "similar to keratin, hair, basic, 3" 281 41633 15 15 12 12 1873 2038 1 0 0 487.7608 973.5071 2 973.508 -0.0009 0 46.29 6.30E-05 R LTAEVENAK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2789.2789.2.dta 5 9 IPI00739163.1 "similar to keratin, hair, basic, 3" 281 41633 15 15 12 12 2138 3436 1 0 0 504.753 1007.4915 2 1007.4923 -0.0008 0 38.37 0.0027 K YEEEVALR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4330.4330.2.dta 5 9 IPI00739163.1 "similar to keratin, hair, basic, 3" 281 41633 15 15 12 12 2156 3691 1 0 0 506.232 1010.4494 2 1010.4491 0.0003 0 32.94 0.00081 K DVDCAYLR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4606.4606.2.dta 5 9 IPI00739163.1 "similar to keratin, hair, basic, 3" 281 41633 15 15 12 12 2572 4438 1 0 1 356.2063 1065.5971 3 1065.5971 0 1 24.49 0.018 R FAAFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5414.5414.3.dta 5 9 IPI00739163.1 "similar to keratin, hair, basic, 3" 281 41633 15 15 12 12 2909 3094 1 0 1 556.2547 1110.4948 2 1110.495 -0.0002 0 35.87 0.00047 R CCITAAPYR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3957.3957.2.dta 5 9 IPI00739163.1 "similar to keratin, hair, basic, 3" 281 41633 15 15 12 12 4052 2290 1 0 0 623.3246 1244.6346 2 1244.636 -0.0014 1 46.55 6.50E-05 R TKEEINELNR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3062.3062.2.dta 5 9 IPI00739163.1 "similar to keratin, hair, basic, 3" 281 41633 15 15 12 12 4054 2288 1 0 0 415.8863 1244.637 3 1244.636 0.0009 1 47.08 0.00051 R TKEEINELNR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3060.3060.3.dta 5 9 IPI00739163.1 "similar to keratin, hair, basic, 3" 281 41633 15 15 12 12 4122 3121 1 0 0 418.8672 1253.5798 3 1253.5789 0.001 1 33.55 0.0017 R SRAEAESWYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3987.3987.3.dta 5 9 IPI00739163.1 "similar to keratin, hair, basic, 3" 281 41633 15 15 12 12 4699 3693 1 0 0 440.91 1319.7082 3 1319.7085 -0.0003 1 19.92 0.014 R ATAENEFVALKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4608.4608.3.dta 5 9 IPI00739163.1 "similar to keratin, hair, basic, 3" 281 41633 15 15 12 12 4700 3703 1 0 0 660.8621 1319.7097 2 1319.7085 0.0012 1 73.41 1.40E-07 R ATAENEFVALKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4619.4619.2.dta 5 9 IPI00739163.1 "similar to keratin, hair, basic, 3" 281 41633 15 15 12 12 6019 3999 1 0 0 745.9124 1489.8102 2 1489.814 -0.0039 1 40.38 0.00044 R FLEQQNKLLETK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4939.4939.2.dta 5 9 IPI00739163.1 "similar to keratin, hair, basic, 3" 281 41633 15 15 12 12 6020 3981 1 0 0 497.6119 1489.8138 3 1489.814 -0.0002 1 21.93 0.0088 R FLEQQNKLLETK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4920.4920.3.dta 5 10 IPI00008669.2 38 kDa protein 217 39031 10 10 8 8 32 1747 1 0 0 302.1898 602.365 2 602.3639 0.0011 0 24.89 0.047 K LLETK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2474.2474.2.dta 5 10 IPI00008669.2 38 kDa protein 217 39031 10 10 8 8 1700 4861 1 0 1 476.7533 951.4921 2 951.4926 -0.0005 0 33.14 0.0081 K LQFFQNR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5869.5869.2.dta 5 10 IPI00008669.2 38 kDa protein 217 39031 10 10 8 8 1873 2038 1 0 0 487.7608 973.5071 2 973.508 -0.0009 0 46.29 6.30E-05 R LTAEVENAK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2789.2789.2.dta 5 10 IPI00008669.2 38 kDa protein 217 39031 10 10 8 8 2138 3436 1 0 0 504.753 1007.4915 2 1007.4923 -0.0008 0 38.37 0.0027 K YEEEVALR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4330.4330.2.dta 5 10 IPI00008669.2 38 kDa protein 217 39031 10 10 8 8 2156 3691 1 0 0 506.232 1010.4494 2 1010.4491 0.0003 0 32.94 0.00081 K DVDCAYLR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4606.4606.2.dta 5 10 IPI00008669.2 38 kDa protein 217 39031 10 10 8 8 4052 2290 1 0 0 623.3246 1244.6346 2 1244.636 -0.0014 1 46.55 6.50E-05 R TKEEINELNR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3062.3062.2.dta 5 10 IPI00008669.2 38 kDa protein 217 39031 10 10 8 8 4054 2288 1 0 0 415.8863 1244.637 3 1244.636 0.0009 1 47.08 0.00051 R TKEEINELNR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3060.3060.3.dta 5 10 IPI00008669.2 38 kDa protein 217 39031 10 10 8 8 4122 3121 1 0 0 418.8672 1253.5798 3 1253.5789 0.001 1 33.55 0.0017 R SRAEAESWYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3987.3987.3.dta 5 10 IPI00008669.2 38 kDa protein 217 39031 10 10 8 8 4699 3693 1 0 0 440.91 1319.7082 3 1319.7085 -0.0003 1 19.92 0.014 R ATAENEFVALKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4608.4608.3.dta 5 10 IPI00008669.2 38 kDa protein 217 39031 10 10 8 8 4700 3703 1 0 0 660.8621 1319.7097 2 1319.7085 0.0012 1 73.41 1.40E-07 R ATAENEFVALKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4619.4619.2.dta 5 IPI00793917.1 27 kDa protein 695 26765 23 23 16 16 850 375 1 0 0 410.211 818.4075 2 818.4068 0.0007 1 38.4 0.0053 R AKQDMAR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1056.1056.2.dta 5 IPI00793917.1 27 kDa protein 695 26765 23 23 16 16 1559 2179 1 0 0 466.7379 931.4612 2 931.461 0.0001 0 46.91 9.20E-05 K LLEGEESR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2942.2942.2.dta 5 IPI00793917.1 27 kDa protein 695 26765 23 23 16 16 1899 2412 1 0 1 490.2294 978.4442 2 978.444 0.0002 0 42.81 0.00015 K TEISEMNR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3194.3194.2.dta 5 IPI00793917.1 27 kDa protein 695 26765 23 23 16 16 2081 4129 1 0 1 500.7875 999.5605 2 999.56 0.0005 0 43.21 0.00062 R LQAEIEGLK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5080.5080.2.dta 5 IPI00793917.1 27 kDa protein 695 26765 23 23 16 16 2526 1867 1 0 0 530.7849 1059.5552 2 1059.556 -0.0008 1 38.94 0.004 R KLLEGEESR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2604.2604.2.dta 5 IPI00793917.1 27 kDa protein 695 26765 23 23 16 16 3063 2194 1 0 1 565.3135 1128.6124 2 1128.6138 -0.0014 1 42.68 0.001 R GELAIKDANAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2958.2958.2.dta 5 IPI00793917.1 27 kDa protein 695 26765 23 23 16 16 3125 4088 1 0 1 569.2927 1136.5709 2 1136.5713 -0.0004 0 60.95 1.80E-05 K YEELQSLAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5036.5036.2.dta 5 IPI00793917.1 27 kDa protein 695 26765 23 23 16 16 3241 4204 1 0 0 577.2809 1152.5472 2 1152.5485 -0.0013 0 39.37 0.00068 R EYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5161.5161.2.dta 5 IPI00793917.1 27 kDa protein 695 26765 23 23 16 16 3380 3652 1 0 1 585.2789 1168.5433 2 1168.5434 -0.0001 0 29.02 0.003 R AEAESMYQIK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4564.4564.2.dta 5 IPI00793917.1 27 kDa protein 695 26765 23 23 16 16 3730 1970 1 0 1 403.5356 1207.585 3 1207.5867 -0.0016 1 32.94 0.00081 R TKTEISEMNR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2715.2715.3.dta 5 IPI00793917.1 27 kDa protein 695 26765 23 23 16 16 3731 1975 1 0 1 604.7999 1207.5852 2 1207.5867 -0.0015 1 63.32 3.50E-06 R TKTEISEMNR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2721.2721.2.dta 5 IPI00793917.1 27 kDa protein 695 26765 23 23 16 16 3845 1075 1 0 1 612.7976 1223.5807 2 1223.5816 -0.0009 1 49.24 4.50E-05 R TKTEISEMNR N Oxidation (M) 0.0000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1746.1746.2.dta 5 IPI00793917.1 27 kDa protein 695 26765 23 23 16 16 4692 6676 1 0 1 660.8392 1319.6638 2 1319.6642 -0.0005 0 82.35 1.10E-07 R SLDMDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7680.7680.2.dta 5 IPI00793917.1 27 kDa protein 695 26765 23 23 16 16 4821 5123 1 0 1 668.8362 1335.6579 2 1335.6592 -0.0012 0 72.81 1.10E-06 R SLDMDSIIAEVK A Oxidation (M) 0.000100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6139.6139.2.dta 5 IPI00793917.1 27 kDa protein 695 26765 23 23 16 16 4864 3296 1 0 1 671.3766 1340.7387 2 1340.7412 -0.0024 1 69.75 1.30E-06 R LQAEIEGLKGQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4179.4179.2.dta 5 IPI00793917.1 27 kDa protein 695 26765 23 23 16 16 4866 3306 1 0 1 447.9211 1340.7414 3 1340.7412 0.0002 1 28 0.021 R LQAEIEGLKGQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4190.4190.3.dta 5 IPI00793917.1 27 kDa protein 695 26765 23 23 16 16 4885 5313 1 0 1 672.8412 1343.6679 2 1343.6681 -0.0001 0 78.78 1.10E-07 R ASLEAAIADAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6329.6329.2.dta 5 IPI00793917.1 27 kDa protein 695 26765 23 23 16 16 4887 5318 1 0 1 448.8968 1343.6684 3 1343.6681 0.0004 0 64.59 6.10E-06 R ASLEAAIADAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6334.6334.3.dta 5 IPI00793917.1 27 kDa protein 695 26765 23 23 16 16 5476 6839 1 0 1 710.377 1418.7395 2 1418.7405 -0.001 0 59.72 8.50E-06 R LEGLTDEINFLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7842.7842.2.dta 5 IPI00793917.1 27 kDa protein 695 26765 23 23 16 16 6319 4549 1 0 1 775.9029 1549.7912 2 1549.7922 -0.001 1 46.93 0.00011 R QLREYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5534.5534.2.dta 5 IPI00793917.1 27 kDa protein 695 26765 23 23 16 16 6320 4545 1 0 1 517.6049 1549.7929 3 1549.7922 0.0007 1 37.35 0.00066 R QLREYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5530.5530.3.dta 5 IPI00793917.1 27 kDa protein 695 26765 23 23 16 16 7579 4355 1 0 1 899.4188 1796.8231 2 1796.825 -0.0019 1 52.55 2.40E-05 K DVDEAYMNKVELESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5324.5324.2.dta 5 IPI00793917.1 27 kDa protein 695 26765 23 23 16 16 7580 4344 1 0 1 599.9485 1796.8236 3 1796.825 -0.0014 1 47.6 3.40E-05 K DVDEAYMNKVELESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5312.5312.3.dta 5 IPI00827679.1 50 kDa protein 566 49680 25 25 23 23 347 1988 1 0 1 351.2009 700.3872 2 700.3868 0.0004 0 56.36 6.10E-05 R SSVPGVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2735.2735.2.dta 5 IPI00827679.1 50 kDa protein 566 49680 25 25 23 23 1194 1291 1 0 1 436.7096 871.4047 2 871.4035 0.0011 0 16.2 0.033 R SVSSSSYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1980.1980.2.dta 5 IPI00827679.1 50 kDa protein 566 49680 25 25 23 23 1559 2179 1 0 0 466.7379 931.4612 2 931.461 0.0001 0 46.91 9.20E-05 K LLEGEESR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2942.2942.2.dta 5 IPI00827679.1 50 kDa protein 566 49680 25 25 23 23 2253 1714 1 0 1 512.2585 1022.5025 2 1022.5032 -0.0007 0 34.95 0.00094 R QQYESVAAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2438.2438.2.dta 5 IPI00827679.1 50 kDa protein 566 49680 25 25 23 23 2290 955 1 0 1 514.7594 1027.5042 2 1027.5047 -0.0004 1 36.01 0.0021 R SVSSSSYRR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1616.1616.2.dta 5 IPI00827679.1 50 kDa protein 566 49680 25 25 23 23 2523 2004 1 0 1 530.7667 1059.5189 2 1059.5197 -0.0008 0 46.93 4.00E-05 R QVDQLTNDK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2752.2752.2.dta 5 IPI00827679.1 50 kDa protein 566 49680 25 25 23 23 2526 1867 1 0 0 530.7849 1059.5552 2 1059.556 -0.0008 1 38.94 0.004 R KLLEGEESR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2604.2604.2.dta 5 IPI00827679.1 50 kDa protein 566 49680 25 25 23 23 2580 801 1 0 1 534.7569 1067.4992 2 1067.4996 -0.0003 1 27.28 0.03 K QESTEYRR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1449.1449.2.dta 5 IPI00827679.1 50 kDa protein 566 49680 25 25 23 23 2758 2205 1 0 1 544.7698 1087.5251 2 1087.5258 -0.0007 0 73.59 6.00E-07 R QDVDNASLAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2970.2970.2.dta 5 IPI00827679.1 50 kDa protein 566 49680 25 25 23 23 2793 3563 1 0 1 547.2628 1092.5111 2 1092.52 -0.0089 0 62.62 8.80E-06 K FADLSEAANR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4468.4468.2.dta 5 IPI00827679.1 50 kDa protein 566 49680 25 25 23 23 3039 3674 1 0 1 375.8743 1124.601 3 1124.5978 0.0031 1 20.6 0.012 R FANYIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4588.4588.3.dta 5 IPI00827679.1 50 kDa protein 566 49680 25 25 23 23 3385 6634 1 0 1 585.3596 1168.7047 2 1168.7067 -0.002 0 54.88 1.30E-05 K ILLAELEQLK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7639.7639.2.dta 5 IPI00827679.1 50 kDa protein 566 49680 25 25 23 23 3782 1684 1 0 1 608.8171 1215.6196 2 1215.6208 -0.0012 1 37.32 0.0012 R RQVDQLTNDK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2405.2405.2.dta 5 IPI00827679.1 50 kDa protein 566 49680 25 25 23 23 4406 1665 1 0 1 644.3361 1286.6576 2 1286.6579 -0.0003 1 56.19 5.00E-05 R QVDQLTNDKAR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2385.2385.2.dta 5 IPI00827679.1 50 kDa protein 566 49680 25 25 23 23 4407 1657 1 0 1 429.8933 1286.6581 3 1286.6579 0.0002 1 28.8 0.0029 R QVDQLTNDKAR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2376.2376.3.dta 5 IPI00827679.1 50 kDa protein 566 49680 25 25 23 23 4615 4798 1 0 1 655.3063 1308.5981 2 1308.5986 -0.0005 0 55.38 6.40E-06 K NLQEAEEWYK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5802.5802.2.dta 5 IPI00827679.1 50 kDa protein 566 49680 25 25 23 23 5292 2818 1 0 1 465.2401 1392.6983 3 1392.6997 -0.0014 1 25.59 0.0046 R DVRQQYESVAAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3649.3649.3.dta 5 IPI00827679.1 50 kDa protein 566 49680 25 25 23 23 5552 3822 1 0 1 714.8594 1427.7043 2 1427.7045 -0.0002 0 76.07 7.40E-08 R SLYASSPGGVYATR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4748.4748.2.dta 5 IPI00827679.1 50 kDa protein 566 49680 25 25 23 23 6276 5590 1 0 1 770.4577 1538.9009 2 1538.9032 -0.0023 1 20.3 0.028 K ILLAELEQLKGQGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6603.6603.2.dta 5 IPI00827679.1 50 kDa protein 566 49680 25 25 23 23 6576 3455 1 0 1 529.9365 1586.7877 3 1586.79 -0.0022 1 28.62 0.0046 R TNEKVELQELNDR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4351.4351.3.dta 5 IPI00827679.1 50 kDa protein 566 49680 25 25 23 23 6939 5347 1 0 1 551.6031 1651.7874 3 1651.7875 -0.0001 1 20.78 0.012 R LGDLYEEEMRELR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6363.6363.3.dta 5 IPI00827679.1 50 kDa protein 566 49680 25 25 23 23 7148 4978 1 0 1 844.9155 1687.8165 2 1687.8199 -0.0034 1 38.65 0.00024 R VEVERDNLAEDIMR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5991.5991.2.dta 5 IPI00827679.1 50 kDa protein 566 49680 25 25 23 23 7149 4969 1 0 1 563.6132 1687.8178 3 1687.8199 -0.0021 1 43.21 8.90E-05 R VEVERDNLAEDIMR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5983.5983.3.dta 5 IPI00827679.1 50 kDa protein 566 49680 25 25 23 23 7529 3804 1 0 1 592.9587 1775.8542 3 1775.855 -0.0008 1 39.49 0.00057 K FADLSEAANRNNDALR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4728.4728.3.dta 5 IPI00827679.1 50 kDa protein 566 49680 25 25 23 23 8315 5099 1 0 1 793.0583 2376.153 3 2376.1591 -0.0061 1 34.06 0.00064 R QVQSLTCEVDALKGTNESLER Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6115.6115.3.dta 5 IPI00792642.1 25 kDa protein 545 24809 20 20 14 14 884 4556 1 0 0 414.2192 826.4238 2 826.4225 0.0013 0 39.7 0.0021 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5542.5542.2.dta 5 IPI00792642.1 25 kDa protein 545 24809 20 20 14 14 2105 698 1 0 1 502.2741 1002.5337 2 1002.5345 -0.0009 1 28.14 0.04 R TQEKEQIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1337.1337.2.dta 5 IPI00792642.1 25 kDa protein 545 24809 20 20 14 14 2316 5028 1 0 1 515.7875 1029.5605 2 1029.5607 -0.0002 0 38.89 0.0028 K WSLLQQQK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6042.6042.2.dta 5 IPI00792642.1 25 kDa protein 545 24809 20 20 14 14 2568 1519 1 0 0 533.7617 1065.5089 2 1065.509 -0.0002 1 33.51 0.0014 K YEDEINKR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2227.2227.2.dta 5 IPI00792642.1 25 kDa protein 545 24809 20 20 14 14 2714 4502 1 0 0 541.8033 1081.592 2 1081.592 0 1 43.15 0.00066 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5483.5483.2.dta 5 IPI00792642.1 25 kDa protein 545 24809 20 20 14 14 2752 1541 1 0 0 544.3087 1086.6028 2 1086.6033 -0.0005 1 21.59 0.046 K EQIKTLNNK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2250.2250.2.dta 5 IPI00792642.1 25 kDa protein 545 24809 20 20 14 14 3380 3652 1 0 1 585.2789 1168.5433 2 1168.5434 -0.0001 0 29.02 0.003 R AEAESMYQIK - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4564.4564.2.dta 5 IPI00792642.1 25 kDa protein 545 24809 20 20 14 14 3642 2197 1 0 1 601.3302 1200.6458 2 1200.6462 -0.0004 1 42.15 0.0014 R RQLETLGQEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2961.2961.2.dta 5 IPI00792642.1 25 kDa protein 545 24809 20 20 14 14 4692 6676 1 0 1 660.8392 1319.6638 2 1319.6642 -0.0005 0 82.35 1.10E-07 R SLDMDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7680.7680.2.dta 5 IPI00792642.1 25 kDa protein 545 24809 20 20 14 14 4821 5123 1 0 1 668.8362 1335.6579 2 1335.6592 -0.0012 0 72.81 1.10E-06 R SLDMDSIIAEVK A Oxidation (M) 0.000100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6139.6139.2.dta 5 IPI00792642.1 25 kDa protein 545 24809 20 20 14 14 4967 6025 1 0 1 676.8416 1351.6686 2 1351.6693 -0.0008 0 64.81 3.40E-06 R TEMENEFVLIK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7038.7038.2.dta 5 IPI00792642.1 25 kDa protein 545 24809 20 20 14 14 5094 5470 1 0 1 684.8392 1367.6638 2 1367.6642 -0.0005 0 59.17 1.50E-05 R TEMENEFVLIK K Oxidation (M) 0.00100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6485.6485.2.dta 5 IPI00792642.1 25 kDa protein 545 24809 20 20 14 14 5340 4906 1 0 0 699.3737 1396.7328 2 1396.735 -0.0023 1 60.63 5.30E-06 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5916.5916.2.dta 5 IPI00792642.1 25 kDa protein 545 24809 20 20 14 14 5341 4895 1 0 0 466.5853 1396.734 3 1396.735 -0.0011 1 36.65 0.001 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5906.5906.3.dta 5 IPI00792642.1 25 kDa protein 545 24809 20 20 14 14 5476 6839 1 0 1 710.377 1418.7395 2 1418.7405 -0.001 0 59.72 8.50E-06 R LEGLTDEINFLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7842.7842.2.dta 5 IPI00792642.1 25 kDa protein 545 24809 20 20 14 14 5965 4932 1 0 1 740.8871 1479.7597 2 1479.7643 -0.0045 1 73.82 1.70E-07 R TEMENEFVLIKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5944.5944.2.dta 5 IPI00792642.1 25 kDa protein 545 24809 20 20 14 14 5966 4923 1 0 1 494.2617 1479.7633 3 1479.7643 -0.001 1 16.85 0.026 R TEMENEFVLIKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5934.5934.3.dta 5 IPI00792642.1 25 kDa protein 545 24809 20 20 14 14 6044 4340 1 0 1 499.5934 1495.7585 3 1495.7592 -0.0007 1 47.04 6.70E-05 R TEMENEFVLIKK D Oxidation (M) 0.001000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5308.5308.3.dta 5 IPI00792642.1 25 kDa protein 545 24809 20 20 14 14 7579 4355 1 0 1 899.4188 1796.8231 2 1796.825 -0.0019 1 52.55 2.40E-05 K DVDEAYMNKVELESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5324.5324.2.dta 5 IPI00792642.1 25 kDa protein 545 24809 20 20 14 14 7580 4344 1 0 1 599.9485 1796.8236 3 1796.825 -0.0014 1 47.6 3.40E-05 K DVDEAYMNKVELESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5312.5312.3.dta 5 IPI00816709.1 Keratin 6C 537 60245 17 17 15 15 884 4556 1 0 0 414.2192 826.4238 2 826.4225 0.0013 0 39.7 0.0021 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5542.5542.2.dta 5 IPI00816709.1 Keratin 6C 537 60245 17 17 15 15 1979 696 1 0 0 495.2302 988.4458 2 988.4462 -0.0004 0 38.15 0.00026 K YTTTSSSSR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1335.1335.2.dta 5 IPI00816709.1 Keratin 6C 537 60245 17 17 15 15 2208 3774 1 0 0 508.772 1015.5295 2 1015.5298 -0.0004 0 59.37 2.80E-05 R QLDSIVGER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4696.4696.2.dta 5 IPI00816709.1 Keratin 6C 537 60245 17 17 15 15 2276 3910 1 0 0 513.7645 1025.5144 2 1025.5142 0.0002 0 52.75 2.00E-05 R SGFSSISVSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4843.4843.2.dta 5 IPI00816709.1 Keratin 6C 537 60245 17 17 15 15 2568 1519 1 0 0 533.7617 1065.5089 2 1065.509 -0.0002 1 33.51 0.0014 K YEDEINKR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2227.2227.2.dta 5 IPI00816709.1 Keratin 6C 537 60245 17 17 15 15 2752 1541 1 0 0 544.3087 1086.6028 2 1086.6033 -0.0005 1 21.59 0.046 R EQIKTLNNK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2250.2250.2.dta 5 IPI00816709.1 Keratin 6C 537 60245 17 17 15 15 3084 2028 1 0 0 567.2836 1132.5526 2 1132.5546 -0.002 1 55.5 1.80E-05 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2778.2778.2.dta 5 IPI00816709.1 Keratin 6C 537 60245 17 17 15 15 3085 2033 1 0 0 378.5258 1132.5554 3 1132.5546 0.0008 1 29.43 0.0043 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2783.2783.3.dta 5 IPI00816709.1 Keratin 6C 537 60245 17 17 15 15 3241 4204 1 0 0 577.2809 1152.5472 2 1152.5485 -0.0013 0 39.37 0.00068 K EYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5161.5161.2.dta 5 IPI00816709.1 Keratin 6C 537 60245 17 17 15 15 4649 2429 1 0 0 439.2361 1314.6863 3 1314.6891 -0.0028 1 27.33 0.03 R NTKQEIAEINR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3212.3212.3.dta 5 IPI00816709.1 Keratin 6C 537 60245 17 17 15 15 4773 7278 1 0 0 665.3659 1328.7173 2 1328.7187 -0.0015 0 60.5 1.90E-05 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8277.8277.2.dta 5 IPI00816709.1 Keratin 6C 537 60245 17 17 15 15 5340 4906 1 0 0 699.3737 1396.7328 2 1396.735 -0.0023 1 60.63 5.30E-06 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5916.5916.2.dta 5 IPI00816709.1 Keratin 6C 537 60245 17 17 15 15 5341 4895 1 0 0 466.5853 1396.734 3 1396.735 -0.0011 1 36.65 0.001 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5906.5906.3.dta 5 IPI00816709.1 Keratin 6C 537 60245 17 17 15 15 5419 6644 1 0 0 704.3592 1406.7038 2 1406.7041 -0.0003 0 78.21 2.70E-07 K ADTLTDEINFLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7649.7649.2.dta 5 IPI00816709.1 Keratin 6C 537 60245 17 17 15 15 5524 3331 1 0 0 712.818 1423.6214 2 1423.6263 -0.0049 0 91.64 4.10E-09 R GSGGLGGACGGAGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4217.4217.2.dta 5 IPI00816709.1 Keratin 6C 537 60245 17 17 15 15 5697 3901 1 0 1 724.3919 1446.7693 2 1446.7678 0.0014 0 72.84 3.70E-07 R AIGGGLSSVGGGSSTIK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4833.4833.2.dta 5 IPI00816709.1 Keratin 6C 537 60245 17 17 15 15 6617 4117 1 0 0 799.8825 1597.7505 2 1597.7519 -0.0014 0 79.66 1.70E-07 R ISIGGGSCAISGGYGSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5067.5067.2.dta 5 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 522 60293 17 17 15 15 884 4556 1 0 0 414.2192 826.4238 2 826.4225 0.0013 0 39.7 0.0021 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5542.5542.2.dta 5 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 522 60293 17 17 15 15 1979 696 1 0 0 495.2302 988.4458 2 988.4462 -0.0004 0 38.15 0.00026 K YTTTSSSSR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1335.1335.2.dta 5 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 522 60293 17 17 15 15 2208 3774 1 0 0 508.772 1015.5295 2 1015.5298 -0.0004 0 59.37 2.80E-05 R QLDSIVGER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4696.4696.2.dta 5 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 522 60293 17 17 15 15 2568 1519 1 0 0 533.7617 1065.5089 2 1065.509 -0.0002 1 33.51 0.0014 K YEDEINKR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2227.2227.2.dta 5 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 522 60293 17 17 15 15 2714 4502 1 0 0 541.8033 1081.592 2 1081.592 0 1 43.15 0.00066 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5483.5483.2.dta 5 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 522 60293 17 17 15 15 2752 1541 1 0 0 544.3087 1086.6028 2 1086.6033 -0.0005 1 21.59 0.046 R EQIKTLNNK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2250.2250.2.dta 5 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 522 60293 17 17 15 15 3084 2028 1 0 0 567.2836 1132.5526 2 1132.5546 -0.002 1 55.5 1.80E-05 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2778.2778.2.dta 5 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 522 60293 17 17 15 15 3085 2033 1 0 0 378.5258 1132.5554 3 1132.5546 0.0008 1 29.43 0.0043 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2783.2783.3.dta 5 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 522 60293 17 17 15 15 3241 4204 1 0 0 577.2809 1152.5472 2 1152.5485 -0.0013 0 39.37 0.00068 K EYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5161.5161.2.dta 5 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 522 60293 17 17 15 15 4649 2429 1 0 0 439.2361 1314.6863 3 1314.6891 -0.0028 1 27.33 0.03 R NTKQEIAEINR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3212.3212.3.dta 5 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 522 60293 17 17 15 15 4773 7278 1 0 0 665.3659 1328.7173 2 1328.7187 -0.0015 0 60.5 1.90E-05 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8277.8277.2.dta 5 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 522 60293 17 17 15 15 5340 4906 1 0 0 699.3737 1396.7328 2 1396.735 -0.0023 1 60.63 5.30E-06 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5916.5916.2.dta 5 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 522 60293 17 17 15 15 5341 4895 1 0 0 466.5853 1396.734 3 1396.735 -0.0011 1 36.65 0.001 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5906.5906.3.dta 5 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 522 60293 17 17 15 15 5419 6644 1 0 0 704.3592 1406.7038 2 1406.7041 -0.0003 0 78.21 2.70E-07 K ADTLTDEINFLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7649.7649.2.dta 5 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 522 60293 17 17 15 15 5524 3331 1 0 0 712.818 1423.6214 2 1423.6263 -0.0049 0 91.64 4.10E-09 R GSGGLGGACGGAGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4217.4217.2.dta 5 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 522 60293 17 17 15 15 5697 3901 1 0 1 724.3919 1446.7693 2 1446.7678 0.0014 0 72.84 3.70E-07 R AIGGGLSSVGGGSSTIK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4833.4833.2.dta 5 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 522 60293 17 17 15 15 6617 4117 1 0 0 799.8825 1597.7505 2 1597.7519 -0.0014 0 79.66 1.70E-07 R ISIGGGSCAISGGYGSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5067.5067.2.dta 5 IPI00795725.1 17 kDa protein 513 16798 15 15 10 10 1899 2412 1 0 1 490.2294 978.4442 2 978.444 0.0002 0 42.81 0.00015 K TEISEMNR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3194.3194.2.dta 5 IPI00795725.1 17 kDa protein 513 16798 15 15 10 10 2081 4129 1 0 1 500.7875 999.5605 2 999.56 0.0005 0 43.21 0.00062 R LQAEIEGLK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5080.5080.2.dta 5 IPI00795725.1 17 kDa protein 513 16798 15 15 10 10 3063 2194 1 0 1 565.3135 1128.6124 2 1128.6138 -0.0014 1 42.68 0.001 R GELAIKDANAK - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2958.2958.2.dta 5 IPI00795725.1 17 kDa protein 513 16798 15 15 10 10 3125 4088 1 0 1 569.2927 1136.5709 2 1136.5713 -0.0004 0 60.95 1.80E-05 K YEELQSLAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5036.5036.2.dta 5 IPI00795725.1 17 kDa protein 513 16798 15 15 10 10 3380 3652 1 0 1 585.2789 1168.5433 2 1168.5434 -0.0001 0 29.02 0.003 R AEAESMYQIK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4564.4564.2.dta 5 IPI00795725.1 17 kDa protein 513 16798 15 15 10 10 3730 1970 1 0 1 403.5356 1207.585 3 1207.5867 -0.0016 1 32.94 0.00081 R TKTEISEMNR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2715.2715.3.dta 5 IPI00795725.1 17 kDa protein 513 16798 15 15 10 10 3731 1975 1 0 1 604.7999 1207.5852 2 1207.5867 -0.0015 1 63.32 3.50E-06 R TKTEISEMNR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2721.2721.2.dta 5 IPI00795725.1 17 kDa protein 513 16798 15 15 10 10 3845 1075 1 0 1 612.7976 1223.5807 2 1223.5816 -0.0009 1 49.24 4.50E-05 R TKTEISEMNR N Oxidation (M) 0.0000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1746.1746.2.dta 5 IPI00795725.1 17 kDa protein 513 16798 15 15 10 10 4692 6676 1 0 1 660.8392 1319.6638 2 1319.6642 -0.0005 0 82.35 1.10E-07 R SLDMDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7680.7680.2.dta 5 IPI00795725.1 17 kDa protein 513 16798 15 15 10 10 4821 5123 1 0 1 668.8362 1335.6579 2 1335.6592 -0.0012 0 72.81 1.10E-06 R SLDMDSIIAEVK A Oxidation (M) 0.000100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6139.6139.2.dta 5 IPI00795725.1 17 kDa protein 513 16798 15 15 10 10 4864 3296 1 0 1 671.3766 1340.7387 2 1340.7412 -0.0024 1 69.75 1.30E-06 R LQAEIEGLKGQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4179.4179.2.dta 5 IPI00795725.1 17 kDa protein 513 16798 15 15 10 10 4866 3306 1 0 1 447.9211 1340.7414 3 1340.7412 0.0002 1 28 0.021 R LQAEIEGLKGQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4190.4190.3.dta 5 IPI00795725.1 17 kDa protein 513 16798 15 15 10 10 4885 5313 1 0 1 672.8412 1343.6679 2 1343.6681 -0.0001 0 78.78 1.10E-07 R ASLEAAIADAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6329.6329.2.dta 5 IPI00795725.1 17 kDa protein 513 16798 15 15 10 10 4887 5318 1 0 1 448.8968 1343.6684 3 1343.6681 0.0004 0 64.59 6.10E-06 R ASLEAAIADAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6334.6334.3.dta 5 IPI00795725.1 17 kDa protein 513 16798 15 15 10 10 5476 6839 1 0 1 710.377 1418.7395 2 1418.7405 -0.001 0 59.72 8.50E-06 R LEGLTDEINFLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7842.7842.2.dta 5 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 498 47891 17 17 13 13 850 375 1 0 0 410.211 818.4075 2 818.4068 0.0007 1 38.4 0.0053 R AKQDMAR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1056.1056.2.dta 5 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 498 47891 17 17 13 13 2316 5028 1 0 1 515.7875 1029.5605 2 1029.5607 -0.0002 0 38.89 0.0028 K WSLLQQQK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6042.6042.2.dta 5 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 498 47891 17 17 13 13 2752 1541 1 0 0 544.3087 1086.6028 2 1086.6033 -0.0005 1 21.59 0.046 K EQIKTLNNK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2250.2250.2.dta 5 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 498 47891 17 17 13 13 3063 2194 1 0 1 565.3135 1128.6124 2 1128.6138 -0.0014 1 42.68 0.001 R GELAIKDANAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2958.2958.2.dta 5 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 498 47891 17 17 13 13 3125 4088 1 0 1 569.2927 1136.5709 2 1136.5713 -0.0004 0 60.95 1.80E-05 K YEELQSLAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5036.5036.2.dta 5 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 498 47891 17 17 13 13 3241 4204 1 0 0 577.2809 1152.5472 2 1152.5485 -0.0013 0 39.37 0.00068 R EYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5161.5161.2.dta 5 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 498 47891 17 17 13 13 3380 3652 1 0 1 585.2789 1168.5433 2 1168.5434 -0.0001 0 29.02 0.003 R AEAESMYQIK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4564.4564.2.dta 5 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 498 47891 17 17 13 13 3642 2197 1 0 1 601.3302 1200.6458 2 1200.6462 -0.0004 1 42.15 0.0014 R RQLETLGQEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2961.2961.2.dta 5 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 498 47891 17 17 13 13 4692 6676 1 0 1 660.8392 1319.6638 2 1319.6642 -0.0005 0 82.35 1.10E-07 R SLDMDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7680.7680.2.dta 5 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 498 47891 17 17 13 13 4821 5123 1 0 1 668.8362 1335.6579 2 1335.6592 -0.0012 0 72.81 1.10E-06 R SLDMDSIIAEVK A Oxidation (M) 0.000100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6139.6139.2.dta 5 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 498 47891 17 17 13 13 4885 5313 1 0 1 672.8412 1343.6679 2 1343.6681 -0.0001 0 78.78 1.10E-07 R ASLEAAIADAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6329.6329.2.dta 5 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 498 47891 17 17 13 13 4887 5318 1 0 1 448.8968 1343.6684 3 1343.6681 0.0004 0 64.59 6.10E-06 R ASLEAAIADAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6334.6334.3.dta 5 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 498 47891 17 17 13 13 5476 6839 1 0 1 710.377 1418.7395 2 1418.7405 -0.001 0 59.72 8.50E-06 R LEGLTDEINFLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7842.7842.2.dta 5 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 498 47891 17 17 13 13 6319 4549 1 0 1 775.9029 1549.7912 2 1549.7922 -0.001 1 46.93 0.00011 R QLREYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5534.5534.2.dta 5 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 498 47891 17 17 13 13 6320 4545 1 0 1 517.6049 1549.7929 3 1549.7922 0.0007 1 37.35 0.00066 R QLREYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5530.5530.3.dta 5 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 498 47891 17 17 13 13 7579 4355 1 0 1 899.4188 1796.8231 2 1796.825 -0.0019 1 52.55 2.40E-05 K DVDEAYMNKVELESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5324.5324.2.dta 5 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 498 47891 17 17 13 13 7580 4344 1 0 1 599.9485 1796.8236 3 1796.825 -0.0014 1 47.6 3.40E-05 K DVDEAYMNKVELESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5312.5312.3.dta 5 IPI00787392.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 1" 403 30826 12 12 9 9 850 375 1 0 0 410.211 818.4075 2 818.4068 0.0007 1 38.4 0.0053 R AKQDMAR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1056.1056.2.dta 5 IPI00787392.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 1" 403 30826 12 12 9 9 3063 2194 1 0 1 565.3135 1128.6124 2 1128.6138 -0.0014 1 42.68 0.001 R GELAIKDANAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2958.2958.2.dta 5 IPI00787392.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 1" 403 30826 12 12 9 9 3125 4088 1 0 1 569.2927 1136.5709 2 1136.5713 -0.0004 0 60.95 1.80E-05 K YEELQSLAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5036.5036.2.dta 5 IPI00787392.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 1" 403 30826 12 12 9 9 3241 4204 1 0 0 577.2809 1152.5472 2 1152.5485 -0.0013 0 39.37 0.00068 R EYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5161.5161.2.dta 5 IPI00787392.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 1" 403 30826 12 12 9 9 3380 3652 1 0 1 585.2789 1168.5433 2 1168.5434 -0.0001 0 29.02 0.003 R AEAESMYQIK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4564.4564.2.dta 5 IPI00787392.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 1" 403 30826 12 12 9 9 4692 6676 1 0 1 660.8392 1319.6638 2 1319.6642 -0.0005 0 82.35 1.10E-07 R SLDMDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7680.7680.2.dta 5 IPI00787392.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 1" 403 30826 12 12 9 9 4821 5123 1 0 1 668.8362 1335.6579 2 1335.6592 -0.0012 0 72.81 1.10E-06 R SLDMDSIIAEVK A Oxidation (M) 0.000100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6139.6139.2.dta 5 IPI00787392.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 1" 403 30826 12 12 9 9 4885 5313 1 0 1 672.8412 1343.6679 2 1343.6681 -0.0001 0 78.78 1.10E-07 R ASLEAAIADAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6329.6329.2.dta 5 IPI00787392.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 1" 403 30826 12 12 9 9 4887 5318 1 0 1 448.8968 1343.6684 3 1343.6681 0.0004 0 64.59 6.10E-06 R ASLEAAIADAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6334.6334.3.dta 5 IPI00787392.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 1" 403 30826 12 12 9 9 5476 6839 1 0 1 710.377 1418.7395 2 1418.7405 -0.001 0 59.72 8.50E-06 R LEGLTDEINFLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7842.7842.2.dta 5 IPI00787392.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 1" 403 30826 12 12 9 9 6319 4549 1 0 1 775.9029 1549.7912 2 1549.7922 -0.001 1 46.93 0.00011 R QLREYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5534.5534.2.dta 5 IPI00787392.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 1" 403 30826 12 12 9 9 6320 4545 1 0 1 517.6049 1549.7929 3 1549.7922 0.0007 1 37.35 0.00066 R QLREYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5530.5530.3.dta 5 IPI00791912.1 22 kDa protein 369 22195 16 16 11 11 884 4556 1 0 0 414.2192 826.4238 2 826.4225 0.0013 0 39.7 0.0021 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5542.5542.2.dta 5 IPI00791912.1 22 kDa protein 369 22195 16 16 11 11 2105 698 1 0 1 502.2741 1002.5337 2 1002.5345 -0.0009 1 28.14 0.04 R TQEKEQIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1337.1337.2.dta 5 IPI00791912.1 22 kDa protein 369 22195 16 16 11 11 2316 5028 1 0 1 515.7875 1029.5605 2 1029.5607 -0.0002 0 38.89 0.0028 K WSLLQQQK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6042.6042.2.dta 5 IPI00791912.1 22 kDa protein 369 22195 16 16 11 11 2568 1519 1 0 0 533.7617 1065.5089 2 1065.509 -0.0002 1 33.51 0.0014 K YEDEINKR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2227.2227.2.dta 5 IPI00791912.1 22 kDa protein 369 22195 16 16 11 11 2701 1619 1 0 1 541.285 1080.5555 2 1080.5564 -0.0009 1 49.4 0.00013 K SYKVSTSGPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2335.2335.2.dta 5 IPI00791912.1 22 kDa protein 369 22195 16 16 11 11 2703 1618 1 0 1 361.1937 1080.5593 3 1080.5564 0.003 1 38.77 0.00094 K SYKVSTSGPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2334.2334.3.dta 5 IPI00791912.1 22 kDa protein 369 22195 16 16 11 11 2714 4502 1 0 0 541.8033 1081.592 2 1081.592 0 1 43.15 0.00066 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5483.5483.2.dta 5 IPI00791912.1 22 kDa protein 369 22195 16 16 11 11 2752 1541 1 0 0 544.3087 1086.6028 2 1086.6033 -0.0005 1 21.59 0.046 K EQIKTLNNK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2250.2250.2.dta 5 IPI00791912.1 22 kDa protein 369 22195 16 16 11 11 3642 2197 1 0 1 601.3302 1200.6458 2 1200.6462 -0.0004 1 42.15 0.0014 R RQLETLGQEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2961.2961.2.dta 5 IPI00791912.1 22 kDa protein 369 22195 16 16 11 11 4967 6025 1 0 1 676.8416 1351.6686 2 1351.6693 -0.0008 0 64.81 3.40E-06 R TEMENEFVLIK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7038.7038.2.dta 5 IPI00791912.1 22 kDa protein 369 22195 16 16 11 11 5094 5470 1 0 1 684.8392 1367.6638 2 1367.6642 -0.0005 0 59.17 1.50E-05 R TEMENEFVLIK K Oxidation (M) 0.00100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6485.6485.2.dta 5 IPI00791912.1 22 kDa protein 369 22195 16 16 11 11 5340 4906 1 0 0 699.3737 1396.7328 2 1396.735 -0.0023 1 60.63 5.30E-06 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5916.5916.2.dta 5 IPI00791912.1 22 kDa protein 369 22195 16 16 11 11 5341 4895 1 0 0 466.5853 1396.734 3 1396.735 -0.0011 1 36.65 0.001 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5906.5906.3.dta 5 IPI00791912.1 22 kDa protein 369 22195 16 16 11 11 5965 4932 1 0 1 740.8871 1479.7597 2 1479.7643 -0.0045 1 73.82 1.70E-07 R TEMENEFVLIKK - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5944.5944.2.dta 5 IPI00791912.1 22 kDa protein 369 22195 16 16 11 11 5966 4923 1 0 1 494.2617 1479.7633 3 1479.7643 -0.001 1 16.85 0.026 R TEMENEFVLIKK - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5934.5934.3.dta 5 IPI00791912.1 22 kDa protein 369 22195 16 16 11 11 6044 4340 1 0 1 499.5934 1495.7585 3 1495.7592 -0.0007 1 47.04 6.70E-05 R TEMENEFVLIKK - Oxidation (M) 0.001000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5308.5308.3.dta 5 IPI00793202.1 14 kDa protein 333 14435 11 11 7 7 2316 5028 1 0 1 515.7875 1029.5605 2 1029.5607 -0.0002 0 38.89 0.0028 K WSLLQQQK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6042.6042.2.dta 5 IPI00793202.1 14 kDa protein 333 14435 11 11 7 7 2568 1519 1 0 0 533.7617 1065.5089 2 1065.509 -0.0002 1 33.51 0.0014 K YEDEINKR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2227.2227.2.dta 5 IPI00793202.1 14 kDa protein 333 14435 11 11 7 7 3642 2197 1 0 1 601.3302 1200.6458 2 1200.6462 -0.0004 1 42.15 0.0014 R RQLETLGQEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2961.2961.2.dta 5 IPI00793202.1 14 kDa protein 333 14435 11 11 7 7 4967 6025 1 0 1 676.8416 1351.6686 2 1351.6693 -0.0008 0 64.81 3.40E-06 R TEMENEFVLIK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7038.7038.2.dta 5 IPI00793202.1 14 kDa protein 333 14435 11 11 7 7 5094 5470 1 0 1 684.8392 1367.6638 2 1367.6642 -0.0005 0 59.17 1.50E-05 R TEMENEFVLIK K Oxidation (M) 0.00100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6485.6485.2.dta 5 IPI00793202.1 14 kDa protein 333 14435 11 11 7 7 5476 6839 1 0 1 710.377 1418.7395 2 1418.7405 -0.001 0 59.72 8.50E-06 R LEGLTDEINFLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7842.7842.2.dta 5 IPI00793202.1 14 kDa protein 333 14435 11 11 7 7 5965 4932 1 0 1 740.8871 1479.7597 2 1479.7643 -0.0045 1 73.82 1.70E-07 R TEMENEFVLIKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5944.5944.2.dta 5 IPI00793202.1 14 kDa protein 333 14435 11 11 7 7 5966 4923 1 0 1 494.2617 1479.7633 3 1479.7643 -0.001 1 16.85 0.026 R TEMENEFVLIKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5934.5934.3.dta 5 IPI00793202.1 14 kDa protein 333 14435 11 11 7 7 6044 4340 1 0 1 499.5934 1495.7585 3 1495.7592 -0.0007 1 47.04 6.70E-05 R TEMENEFVLIKK D Oxidation (M) 0.001000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5308.5308.3.dta 5 IPI00793202.1 14 kDa protein 333 14435 11 11 7 7 7579 4355 1 0 1 899.4188 1796.8231 2 1796.825 -0.0019 1 52.55 2.40E-05 K DVDEAYMNKVELESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5324.5324.2.dta 5 IPI00793202.1 14 kDa protein 333 14435 11 11 7 7 7580 4344 1 0 1 599.9485 1796.8236 3 1796.825 -0.0014 1 47.6 3.40E-05 K DVDEAYMNKVELESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5312.5312.3.dta 5 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 302 42557 10 10 9 9 1979 696 1 0 0 495.2302 988.4458 2 988.4462 -0.0004 0 38.15 0.00026 K YTTTSSSSR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1335.1335.2.dta 5 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 302 42557 10 10 9 9 2208 3774 1 0 0 508.772 1015.5295 2 1015.5298 -0.0004 0 59.37 2.80E-05 R QLDSIVGER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4696.4696.2.dta 5 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 302 42557 10 10 9 9 2568 1519 1 0 0 533.7617 1065.5089 2 1065.509 -0.0002 1 33.51 0.0014 K YEDEINKR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2227.2227.2.dta 5 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 302 42557 10 10 9 9 3084 2028 1 0 0 567.2836 1132.5526 2 1132.5546 -0.002 1 55.5 1.80E-05 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2778.2778.2.dta 5 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 302 42557 10 10 9 9 3085 2033 1 0 0 378.5258 1132.5554 3 1132.5546 0.0008 1 29.43 0.0043 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2783.2783.3.dta 5 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 302 42557 10 10 9 9 3241 4204 1 0 0 577.2809 1152.5472 2 1152.5485 -0.0013 0 39.37 0.00068 K EYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5161.5161.2.dta 5 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 302 42557 10 10 9 9 4649 2429 1 0 0 439.2361 1314.6863 3 1314.6891 -0.0028 1 27.33 0.03 R NTKQEIAEINR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3212.3212.3.dta 5 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 302 42557 10 10 9 9 4773 7278 1 0 0 665.3659 1328.7173 2 1328.7187 -0.0015 0 60.5 1.90E-05 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8277.8277.2.dta 5 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 302 42557 10 10 9 9 5419 6644 1 0 0 704.3592 1406.7038 2 1406.7041 -0.0003 0 78.21 2.70E-07 K ADTLTDEINFLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7649.7649.2.dta 5 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 302 42557 10 10 9 9 5697 3901 1 0 1 724.3919 1446.7693 2 1446.7678 0.0014 0 72.84 3.70E-07 R AIGGGLSSVGGGSSTIK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4833.4833.2.dta 5 IPI00017870.1 Keratin-8-like protein 1 294 55459 13 13 10 10 884 4556 1 0 0 414.2192 826.4238 2 826.4225 0.0013 0 39.7 0.0021 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5542.5542.2.dta 5 IPI00017870.1 Keratin-8-like protein 1 294 55459 13 13 10 10 1559 2179 1 0 0 466.7379 931.4612 2 931.461 0.0001 0 46.91 9.20E-05 K LLEGEESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2942.2942.2.dta 5 IPI00017870.1 Keratin-8-like protein 1 294 55459 13 13 10 10 1899 2412 1 0 1 490.2294 978.4442 2 978.444 0.0002 0 42.81 0.00015 K TEISEMNR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3194.3194.2.dta 5 IPI00017870.1 Keratin-8-like protein 1 294 55459 13 13 10 10 2316 5028 1 0 1 515.7875 1029.5605 2 1029.5607 -0.0002 0 38.89 0.0028 K WSLLQQQK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6042.6042.2.dta 5 IPI00017870.1 Keratin-8-like protein 1 294 55459 13 13 10 10 2526 1867 1 0 0 530.7849 1059.5552 2 1059.556 -0.0008 1 38.94 0.004 R KLLEGEESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2604.2604.2.dta 5 IPI00017870.1 Keratin-8-like protein 1 294 55459 13 13 10 10 2752 1541 1 0 0 544.3087 1086.6028 2 1086.6033 -0.0005 1 21.59 0.046 K EQIKTLNNK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2250.2250.2.dta 5 IPI00017870.1 Keratin-8-like protein 1 294 55459 13 13 10 10 3380 3652 1 0 1 585.2789 1168.5433 2 1168.5434 -0.0001 0 29.02 0.003 R AEAESMYQIK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4564.4564.2.dta 5 IPI00017870.1 Keratin-8-like protein 1 294 55459 13 13 10 10 3642 2197 1 0 1 601.3302 1200.6458 2 1200.6462 -0.0004 1 42.15 0.0014 R RQLETLGQEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2961.2961.2.dta 5 IPI00017870.1 Keratin-8-like protein 1 294 55459 13 13 10 10 3730 1970 1 0 1 403.5356 1207.585 3 1207.5867 -0.0016 1 32.94 0.00081 R TKTEISEMNR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2715.2715.3.dta 5 IPI00017870.1 Keratin-8-like protein 1 294 55459 13 13 10 10 3731 1975 1 0 1 604.7999 1207.5852 2 1207.5867 -0.0015 1 63.32 3.50E-06 R TKTEISEMNR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2721.2721.2.dta 5 IPI00017870.1 Keratin-8-like protein 1 294 55459 13 13 10 10 3845 1075 1 0 1 612.7976 1223.5807 2 1223.5816 -0.0009 1 49.24 4.50E-05 R TKTEISEMNR N Oxidation (M) 0.0000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1746.1746.2.dta 5 IPI00017870.1 Keratin-8-like protein 1 294 55459 13 13 10 10 5340 4906 1 0 0 699.3737 1396.7328 2 1396.735 -0.0023 1 60.63 5.30E-06 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5916.5916.2.dta 5 IPI00017870.1 Keratin-8-like protein 1 294 55459 13 13 10 10 5341 4895 1 0 0 466.5853 1396.734 3 1396.735 -0.0011 1 36.65 0.001 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5906.5906.3.dta 5 IPI00032541.1 Keratin type II cuticular Hb5 292 57306 14 14 10 10 32 1747 1 0 0 302.1898 602.365 2 602.3639 0.0011 0 24.89 0.047 K LLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2474.2474.2.dta 5 IPI00032541.1 Keratin type II cuticular Hb5 292 57306 14 14 10 10 109 2677 1 0 1 315.1555 628.2965 2 628.2969 -0.0004 0 26.59 0.012 R SFGYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3483.3483.2.dta 5 IPI00032541.1 Keratin type II cuticular Hb5 292 57306 14 14 10 10 2138 3436 1 0 0 504.753 1007.4915 2 1007.4923 -0.0008 0 38.37 0.0027 K YEEEVALR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4330.4330.2.dta 5 IPI00032541.1 Keratin type II cuticular Hb5 292 57306 14 14 10 10 2156 3691 1 0 0 506.232 1010.4494 2 1010.4491 0.0003 0 32.94 0.00081 K DVDCAYLR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4606.4606.2.dta 5 IPI00032541.1 Keratin type II cuticular Hb5 292 57306 14 14 10 10 2572 4438 1 0 1 356.2063 1065.5971 3 1065.5971 0 1 24.49 0.018 R FAAFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5414.5414.3.dta 5 IPI00032541.1 Keratin type II cuticular Hb5 292 57306 14 14 10 10 3821 5067 1 0 1 610.829 1219.6434 2 1219.6448 -0.0014 0 55.65 4.80E-05 R ATAENEFVVLK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6082.6082.2.dta 5 IPI00032541.1 Keratin type II cuticular Hb5 292 57306 14 14 10 10 4052 2290 1 0 0 623.3246 1244.6346 2 1244.636 -0.0014 1 46.55 6.50E-05 R TKEEINELNR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3062.3062.2.dta 5 IPI00032541.1 Keratin type II cuticular Hb5 292 57306 14 14 10 10 4054 2288 1 0 0 415.8863 1244.637 3 1244.636 0.0009 1 47.08 0.00051 R TKEEINELNR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3060.3060.3.dta 5 IPI00032541.1 Keratin type II cuticular Hb5 292 57306 14 14 10 10 4122 3121 1 0 0 418.8672 1253.5798 3 1253.5789 0.001 1 33.55 0.0017 R SRAEAESWYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3987.3987.3.dta 5 IPI00032541.1 Keratin type II cuticular Hb5 292 57306 14 14 10 10 4944 4065 1 0 1 674.8752 1347.7358 2 1347.7398 -0.004 1 42.83 0.00016 R ATAENEFVVLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5011.5011.2.dta 5 IPI00032541.1 Keratin type II cuticular Hb5 292 57306 14 14 10 10 4945 4080 1 0 1 674.8752 1347.7358 2 1347.7398 -0.004 1 71 9.40E-07 R ATAENEFVVLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5027.5027.2.dta 5 IPI00032541.1 Keratin type II cuticular Hb5 292 57306 14 14 10 10 4946 4053 1 0 1 450.2542 1347.7406 3 1347.7398 0.0008 1 44.64 7.60E-05 R ATAENEFVVLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4998.4998.3.dta 5 IPI00032541.1 Keratin type II cuticular Hb5 292 57306 14 14 10 10 6019 3999 1 0 0 745.9124 1489.8102 2 1489.814 -0.0039 1 40.38 0.00044 R FLEQQNKLLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4939.4939.2.dta 5 IPI00032541.1 Keratin type II cuticular Hb5 292 57306 14 14 10 10 6020 3981 1 0 0 497.6119 1489.8138 3 1489.814 -0.0002 1 21.93 0.0088 R FLEQQNKLLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4920.4920.3.dta 5 IPI00005859.2 Keratin-75 283 59809 12 12 9 9 850 375 1 0 0 410.211 818.4075 2 818.4068 0.0007 1 38.4 0.0053 K AKQDMAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1056.1056.2.dta 5 IPI00005859.2 Keratin-75 283 59809 12 12 9 9 884 4556 1 0 0 414.2192 826.4238 2 826.4225 0.0013 0 39.7 0.0021 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5542.5542.2.dta 5 IPI00005859.2 Keratin-75 283 59809 12 12 9 9 2568 1519 1 0 0 533.7617 1065.5089 2 1065.509 -0.0002 1 33.51 0.0014 R YEDEINKR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2227.2227.2.dta 5 IPI00005859.2 Keratin-75 283 59809 12 12 9 9 2714 4502 1 0 0 541.8033 1081.592 2 1081.592 0 1 43.15 0.00066 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5483.5483.2.dta 5 IPI00005859.2 Keratin-75 283 59809 12 12 9 9 2752 1541 1 0 0 544.3087 1086.6028 2 1086.6033 -0.0005 1 21.59 0.046 R EQIKTLNNK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2250.2250.2.dta 5 IPI00005859.2 Keratin-75 283 59809 12 12 9 9 3084 2028 1 0 0 567.2836 1132.5526 2 1132.5546 -0.002 1 55.5 1.80E-05 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2778.2778.2.dta 5 IPI00005859.2 Keratin-75 283 59809 12 12 9 9 3085 2033 1 0 0 378.5258 1132.5554 3 1132.5546 0.0008 1 29.43 0.0043 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2783.2783.3.dta 5 IPI00005859.2 Keratin-75 283 59809 12 12 9 9 4699 3693 1 0 1 440.91 1319.7082 3 1319.7085 -0.0003 1 19.92 0.014 R TAAENEFVALKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4608.4608.3.dta 5 IPI00005859.2 Keratin-75 283 59809 12 12 9 9 4700 3703 1 0 1 660.8621 1319.7097 2 1319.7085 0.0012 1 73.41 1.40E-07 R TAAENEFVALKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4619.4619.2.dta 5 IPI00005859.2 Keratin-75 283 59809 12 12 9 9 4773 7278 1 0 0 665.3659 1328.7173 2 1328.7187 -0.0015 0 60.5 1.90E-05 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8277.8277.2.dta 5 IPI00005859.2 Keratin-75 283 59809 12 12 9 9 5340 4906 1 0 0 699.3737 1396.7328 2 1396.735 -0.0023 1 60.63 5.30E-06 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5916.5916.2.dta 5 IPI00005859.2 Keratin-75 283 59809 12 12 9 9 5341 4895 1 0 0 466.5853 1396.734 3 1396.735 -0.0011 1 36.65 0.001 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5906.5906.3.dta 5 IPI00182654.5 "Keratin, hair, basic, 1" 267 57059 14 14 11 11 32 1747 1 0 0 302.1898 602.365 2 602.3639 0.0011 0 24.89 0.047 K LLETK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2474.2474.2.dta 5 IPI00182654.5 "Keratin, hair, basic, 1" 267 57059 14 14 11 11 109 2677 1 0 1 315.1555 628.2965 2 628.2969 -0.0004 0 26.59 0.012 R SFGYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3483.3483.2.dta 5 IPI00182654.5 "Keratin, hair, basic, 1" 267 57059 14 14 11 11 1828 3710 1 0 1 484.7512 967.4879 2 967.4875 0.0003 0 27.29 0.0047 K LQFYQNR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4626.4626.2.dta 5 IPI00182654.5 "Keratin, hair, basic, 1" 267 57059 14 14 11 11 1873 2038 1 0 0 487.7608 973.5071 2 973.508 -0.0009 0 46.29 6.30E-05 R LTAEVENAK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2789.2789.2.dta 5 IPI00182654.5 "Keratin, hair, basic, 1" 267 57059 14 14 11 11 2156 3691 1 0 0 506.232 1010.4494 2 1010.4491 0.0003 0 32.94 0.00081 R DVDCAYLR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4606.4606.2.dta 5 IPI00182654.5 "Keratin, hair, basic, 1" 267 57059 14 14 11 11 2572 4438 1 0 1 356.2063 1065.5971 3 1065.5971 0 1 24.49 0.018 R FAAFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5414.5414.3.dta 5 IPI00182654.5 "Keratin, hair, basic, 1" 267 57059 14 14 11 11 2909 3094 1 0 1 556.2547 1110.4948 2 1110.495 -0.0002 0 35.87 0.00047 R CCITAAPYR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3957.3957.2.dta 5 IPI00182654.5 "Keratin, hair, basic, 1" 267 57059 14 14 11 11 4052 2290 1 0 0 623.3246 1244.6346 2 1244.636 -0.0014 1 46.55 6.50E-05 R TKEEINELNR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3062.3062.2.dta 5 IPI00182654.5 "Keratin, hair, basic, 1" 267 57059 14 14 11 11 4054 2288 1 0 0 415.8863 1244.637 3 1244.636 0.0009 1 47.08 0.00051 R TKEEINELNR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3060.3060.3.dta 5 IPI00182654.5 "Keratin, hair, basic, 1" 267 57059 14 14 11 11 4122 3121 1 0 0 418.8672 1253.5798 3 1253.5789 0.001 1 33.55 0.0017 R SRAEAESWYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3987.3987.3.dta 5 IPI00182654.5 "Keratin, hair, basic, 1" 267 57059 14 14 11 11 4699 3693 1 0 0 440.91 1319.7082 3 1319.7085 -0.0003 1 19.92 0.014 R ATAENEFVALKK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4608.4608.3.dta 5 IPI00182654.5 "Keratin, hair, basic, 1" 267 57059 14 14 11 11 4700 3703 1 0 0 660.8621 1319.7097 2 1319.7085 0.0012 1 73.41 1.40E-07 R ATAENEFVALKK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4619.4619.2.dta 5 IPI00182654.5 "Keratin, hair, basic, 1" 267 57059 14 14 11 11 6019 3999 1 0 0 745.9124 1489.8102 2 1489.814 -0.0039 1 40.38 0.00044 R FLEQQNKLLETK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4939.4939.2.dta 5 IPI00182654.5 "Keratin, hair, basic, 1" 267 57059 14 14 11 11 6020 3981 1 0 0 497.6119 1489.8138 3 1489.814 -0.0002 1 21.93 0.0088 R FLEQQNKLLETK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4920.4920.3.dta 5 IPI00297795.3 Keratin type II cuticular Hb3 263 56004 13 13 10 10 32 1747 1 0 0 302.1898 602.365 2 602.3639 0.0011 0 24.89 0.047 K LLETK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2474.2474.2.dta 5 IPI00297795.3 Keratin type II cuticular Hb3 263 56004 13 13 10 10 1873 2038 1 0 0 487.7608 973.5071 2 973.508 -0.0009 0 46.29 6.30E-05 R LTAEVENAK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2789.2789.2.dta 5 IPI00297795.3 Keratin type II cuticular Hb3 263 56004 13 13 10 10 2138 3436 1 0 0 504.753 1007.4915 2 1007.4923 -0.0008 0 38.37 0.0027 K YEEEVALR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4330.4330.2.dta 5 IPI00297795.3 Keratin type II cuticular Hb3 263 56004 13 13 10 10 2156 3691 1 0 0 506.232 1010.4494 2 1010.4491 0.0003 0 32.94 0.00081 K DVDCAYLR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4606.4606.2.dta 5 IPI00297795.3 Keratin type II cuticular Hb3 263 56004 13 13 10 10 2572 4438 1 0 1 356.2063 1065.5971 3 1065.5971 0 1 24.49 0.018 R FAAFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5414.5414.3.dta 5 IPI00297795.3 Keratin type II cuticular Hb3 263 56004 13 13 10 10 2909 3094 1 0 1 556.2547 1110.4948 2 1110.495 -0.0002 0 35.87 0.00047 R CCITAAPYR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3957.3957.2.dta 5 IPI00297795.3 Keratin type II cuticular Hb3 263 56004 13 13 10 10 4052 2290 1 0 0 623.3246 1244.6346 2 1244.636 -0.0014 1 46.55 6.50E-05 R TKEEINELNR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3062.3062.2.dta 5 IPI00297795.3 Keratin type II cuticular Hb3 263 56004 13 13 10 10 4054 2288 1 0 0 415.8863 1244.637 3 1244.636 0.0009 1 47.08 0.00051 R TKEEINELNR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3060.3060.3.dta 5 IPI00297795.3 Keratin type II cuticular Hb3 263 56004 13 13 10 10 4122 3121 1 0 0 418.8672 1253.5798 3 1253.5789 0.001 1 33.55 0.0017 R SRAEAESWYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3987.3987.3.dta 5 IPI00297795.3 Keratin type II cuticular Hb3 263 56004 13 13 10 10 4699 3693 1 0 0 440.91 1319.7082 3 1319.7085 -0.0003 1 19.92 0.014 R ATAENEFVALKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4608.4608.3.dta 5 IPI00297795.3 Keratin type II cuticular Hb3 263 56004 13 13 10 10 4700 3703 1 0 0 660.8621 1319.7097 2 1319.7085 0.0012 1 73.41 1.40E-07 R ATAENEFVALKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4619.4619.2.dta 5 IPI00297795.3 Keratin type II cuticular Hb3 263 56004 13 13 10 10 6019 3999 1 0 0 745.9124 1489.8102 2 1489.814 -0.0039 1 40.38 0.00044 R FLEQQNKLLETK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4939.4939.2.dta 5 IPI00297795.3 Keratin type II cuticular Hb3 263 56004 13 13 10 10 6020 3981 1 0 0 497.6119 1489.8138 3 1489.814 -0.0002 1 21.93 0.0088 R FLEQQNKLLETK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4920.4920.3.dta 5 IPI00182655.7 Keratin type II cuticular Hb6 249 55292 13 13 10 10 32 1747 1 0 0 302.1898 602.365 2 602.3639 0.0011 0 24.89 0.047 K LLETK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2474.2474.2.dta 5 IPI00182655.7 Keratin type II cuticular Hb6 249 55292 13 13 10 10 109 2677 1 0 1 315.1555 628.2965 2 628.2969 -0.0004 0 26.59 0.012 R SFGYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3483.3483.2.dta 5 IPI00182655.7 Keratin type II cuticular Hb6 249 55292 13 13 10 10 1828 3710 1 0 1 484.7512 967.4879 2 967.4875 0.0003 0 27.29 0.0047 K LQFYQNR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4626.4626.2.dta 5 IPI00182655.7 Keratin type II cuticular Hb6 249 55292 13 13 10 10 1873 2038 1 0 0 487.7608 973.5071 2 973.508 -0.0009 0 46.29 6.30E-05 R LTAEVENAK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2789.2789.2.dta 5 IPI00182655.7 Keratin type II cuticular Hb6 249 55292 13 13 10 10 2572 4438 1 0 1 356.2063 1065.5971 3 1065.5971 0 1 24.49 0.018 R FAAFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5414.5414.3.dta 5 IPI00182655.7 Keratin type II cuticular Hb6 249 55292 13 13 10 10 2909 3094 1 0 1 556.2547 1110.4948 2 1110.495 -0.0002 0 35.87 0.00047 R CCITAAPYR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3957.3957.2.dta 5 IPI00182655.7 Keratin type II cuticular Hb6 249 55292 13 13 10 10 4052 2290 1 0 0 623.3246 1244.6346 2 1244.636 -0.0014 1 46.55 6.50E-05 R TKEEINELNR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3062.3062.2.dta 5 IPI00182655.7 Keratin type II cuticular Hb6 249 55292 13 13 10 10 4054 2288 1 0 0 415.8863 1244.637 3 1244.636 0.0009 1 47.08 0.00051 R TKEEINELNR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3060.3060.3.dta 5 IPI00182655.7 Keratin type II cuticular Hb6 249 55292 13 13 10 10 4122 3121 1 0 0 418.8672 1253.5798 3 1253.5789 0.001 1 33.55 0.0017 R SRAEAESWYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3987.3987.3.dta 5 IPI00182655.7 Keratin type II cuticular Hb6 249 55292 13 13 10 10 4699 3693 1 0 0 440.91 1319.7082 3 1319.7085 -0.0003 1 19.92 0.014 R ATAENEFVALKK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4608.4608.3.dta 5 IPI00182655.7 Keratin type II cuticular Hb6 249 55292 13 13 10 10 4700 3703 1 0 0 660.8621 1319.7097 2 1319.7085 0.0012 1 73.41 1.40E-07 R ATAENEFVALKK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4619.4619.2.dta 5 IPI00182655.7 Keratin type II cuticular Hb6 249 55292 13 13 10 10 6019 3999 1 0 0 745.9124 1489.8102 2 1489.814 -0.0039 1 40.38 0.00044 R FLEQQNKLLETK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4939.4939.2.dta 5 IPI00182655.7 Keratin type II cuticular Hb6 249 55292 13 13 10 10 6020 3981 1 0 0 497.6119 1489.8138 3 1489.814 -0.0002 1 21.93 0.0088 R FLEQQNKLLETK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4920.4920.3.dta 5 IPI00748057.2 "Similar to Keratin, type II cytoskeletal 8" 199 11491 6 6 3 3 2568 1519 1 0 0 533.7617 1065.5089 2 1065.509 -0.0002 1 33.51 0.0014 K YEDEINKR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2227.2227.2.dta 5 IPI00748057.2 "Similar to Keratin, type II cytoskeletal 8" 199 11491 6 6 3 3 4967 6025 1 0 1 676.8416 1351.6686 2 1351.6693 -0.0008 0 64.81 3.40E-06 R TEMENEFVLIK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7038.7038.2.dta 5 IPI00748057.2 "Similar to Keratin, type II cytoskeletal 8" 199 11491 6 6 3 3 5094 5470 1 0 1 684.8392 1367.6638 2 1367.6642 -0.0005 0 59.17 1.50E-05 R TEMENEFVLIK K Oxidation (M) 0.00100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6485.6485.2.dta 5 IPI00748057.2 "Similar to Keratin, type II cytoskeletal 8" 199 11491 6 6 3 3 5965 4932 1 0 1 740.8871 1479.7597 2 1479.7643 -0.0045 1 73.82 1.70E-07 R TEMENEFVLIKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5944.5944.2.dta 5 IPI00748057.2 "Similar to Keratin, type II cytoskeletal 8" 199 11491 6 6 3 3 5966 4923 1 0 1 494.2617 1479.7633 3 1479.7643 -0.001 1 16.85 0.026 R TEMENEFVLIKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5934.5934.3.dta 5 IPI00748057.2 "Similar to Keratin, type II cytoskeletal 8" 199 11491 6 6 3 3 6044 4340 1 0 1 499.5934 1495.7585 3 1495.7592 -0.0007 1 47.04 6.70E-05 R TEMENEFVLIKK D Oxidation (M) 0.001000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5308.5308.3.dta 5 IPI00552689.1 Vimentin 197 20138 7 7 7 7 2253 1714 1 0 1 512.2585 1022.5025 2 1022.5032 -0.0007 0 34.95 0.00094 R QQYESVAAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2438.2438.2.dta 5 IPI00552689.1 Vimentin 197 20138 7 7 7 7 2580 801 1 0 1 534.7569 1067.4992 2 1067.4996 -0.0003 1 27.28 0.03 K QESTEYRR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1449.1449.2.dta 5 IPI00552689.1 Vimentin 197 20138 7 7 7 7 2758 2205 1 0 1 544.7698 1087.5251 2 1087.5258 -0.0007 0 73.59 6.00E-07 R QDVDNASLAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2970.2970.2.dta 5 IPI00552689.1 Vimentin 197 20138 7 7 7 7 2793 3563 1 0 1 547.2628 1092.5111 2 1092.52 -0.0089 0 62.62 8.80E-06 K FADLSEAANR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4468.4468.2.dta 5 IPI00552689.1 Vimentin 197 20138 7 7 7 7 4615 4798 1 0 1 655.3063 1308.5981 2 1308.5986 -0.0005 0 55.38 6.40E-06 K NLQEAEEWYK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5802.5802.2.dta 5 IPI00552689.1 Vimentin 197 20138 7 7 7 7 5292 2818 1 0 1 465.2401 1392.6983 3 1392.6997 -0.0014 1 25.59 0.0046 R DVRQQYESVAAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3649.3649.3.dta 5 IPI00552689.1 Vimentin 197 20138 7 7 7 7 7529 3804 1 0 1 592.9587 1775.8542 3 1775.855 -0.0008 1 39.49 0.00057 K FADLSEAANRNNDALR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4728.4728.3.dta 5 IPI00791341.1 20 kDa protein 190 19686 10 10 8 8 884 4556 1 0 0 414.2192 826.4238 2 826.4225 0.0013 0 39.7 0.0021 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5542.5542.2.dta 5 IPI00791341.1 20 kDa protein 190 19686 10 10 8 8 2105 698 1 0 1 502.2741 1002.5337 2 1002.5345 -0.0009 1 28.14 0.04 R TQEKEQIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1337.1337.2.dta 5 IPI00791341.1 20 kDa protein 190 19686 10 10 8 8 2316 5028 1 0 1 515.7875 1029.5605 2 1029.5607 -0.0002 0 38.89 0.0028 K WSLLQQQK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6042.6042.2.dta 5 IPI00791341.1 20 kDa protein 190 19686 10 10 8 8 2701 1619 1 0 1 541.285 1080.5555 2 1080.5564 -0.0009 1 49.4 0.00013 K SYKVSTSGPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2335.2335.2.dta 5 IPI00791341.1 20 kDa protein 190 19686 10 10 8 8 2703 1618 1 0 1 361.1937 1080.5593 3 1080.5564 0.003 1 38.77 0.00094 K SYKVSTSGPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2334.2334.3.dta 5 IPI00791341.1 20 kDa protein 190 19686 10 10 8 8 2714 4502 1 0 0 541.8033 1081.592 2 1081.592 0 1 43.15 0.00066 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5483.5483.2.dta 5 IPI00791341.1 20 kDa protein 190 19686 10 10 8 8 2752 1541 1 0 0 544.3087 1086.6028 2 1086.6033 -0.0005 1 21.59 0.046 K EQIKTLNNK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2250.2250.2.dta 5 IPI00791341.1 20 kDa protein 190 19686 10 10 8 8 3642 2197 1 0 1 601.3302 1200.6458 2 1200.6462 -0.0004 1 42.15 0.0014 R RQLETLGQEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2961.2961.2.dta 5 IPI00791341.1 20 kDa protein 190 19686 10 10 8 8 5340 4906 1 0 0 699.3737 1396.7328 2 1396.735 -0.0023 1 60.63 5.30E-06 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5916.5916.2.dta 5 IPI00791341.1 20 kDa protein 190 19686 10 10 8 8 5341 4895 1 0 0 466.5853 1396.734 3 1396.735 -0.0011 1 36.65 0.001 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5906.5906.3.dta 5 IPI00103481.3 Keratin-72 189 56470 6 6 4 4 884 4556 1 0 0 414.2192 826.4238 2 826.4225 0.0013 0 39.7 0.0021 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5542.5542.2.dta 5 IPI00103481.3 Keratin-72 189 56470 6 6 4 4 2714 4502 1 0 0 541.8033 1081.592 2 1081.592 0 1 43.15 0.00066 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5483.5483.2.dta 5 IPI00103481.3 Keratin-72 189 56470 6 6 4 4 3821 5067 1 0 1 610.829 1219.6434 2 1219.6448 -0.0014 0 55.65 4.80E-05 R TAAENEFVVLK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6082.6082.2.dta 5 IPI00103481.3 Keratin-72 189 56470 6 6 4 4 4944 4065 1 0 1 674.8752 1347.7358 2 1347.7398 -0.004 1 42.83 0.00016 R TAAENEFVVLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5011.5011.2.dta 5 IPI00103481.3 Keratin-72 189 56470 6 6 4 4 4945 4080 1 0 1 674.8752 1347.7358 2 1347.7398 -0.004 1 71 9.40E-07 R TAAENEFVVLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5027.5027.2.dta 5 IPI00103481.3 Keratin-72 189 56470 6 6 4 4 4946 4053 1 0 1 450.2542 1347.7406 3 1347.7398 0.0008 1 44.64 7.60E-05 R TAAENEFVVLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4998.4998.3.dta 5 IPI00008359.1 "Keratin, type II cytoskeletal 2 oral" 176 66400 8 8 6 6 884 4556 1 0 0 414.2192 826.4238 2 826.4225 0.0013 0 39.7 0.0021 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5542.5542.2.dta 5 IPI00008359.1 "Keratin, type II cytoskeletal 2 oral" 176 66400 8 8 6 6 2568 1519 1 0 0 533.7617 1065.5089 2 1065.509 -0.0002 1 33.51 0.0014 K YEDEINKR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2227.2227.2.dta 5 IPI00008359.1 "Keratin, type II cytoskeletal 2 oral" 176 66400 8 8 6 6 2714 4502 1 0 0 541.8033 1081.592 2 1081.592 0 1 43.15 0.00066 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5483.5483.2.dta 5 IPI00008359.1 "Keratin, type II cytoskeletal 2 oral" 176 66400 8 8 6 6 2752 1541 1 0 0 544.3087 1086.6028 2 1086.6033 -0.0005 1 21.59 0.046 R EQIKTLNNK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2250.2250.2.dta 5 IPI00008359.1 "Keratin, type II cytoskeletal 2 oral" 176 66400 8 8 6 6 3084 2028 1 0 0 567.2836 1132.5526 2 1132.5546 -0.002 1 55.5 1.80E-05 R KLLEGEECR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2778.2778.2.dta 5 IPI00008359.1 "Keratin, type II cytoskeletal 2 oral" 176 66400 8 8 6 6 3085 2033 1 0 0 378.5258 1132.5554 3 1132.5546 0.0008 1 29.43 0.0043 R KLLEGEECR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2783.2783.3.dta 5 IPI00008359.1 "Keratin, type II cytoskeletal 2 oral" 176 66400 8 8 6 6 5340 4906 1 0 0 699.3737 1396.7328 2 1396.735 -0.0023 1 60.63 5.30E-06 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5916.5916.2.dta 5 IPI00008359.1 "Keratin, type II cytoskeletal 2 oral" 176 66400 8 8 6 6 5341 4895 1 0 0 466.5853 1396.734 3 1396.735 -0.0011 1 36.65 0.001 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5906.5906.3.dta 5 IPI00300052.1 Keratin type II cuticular Hb4 171 65938 9 9 7 7 32 1747 1 0 0 302.1898 602.365 2 602.3639 0.0011 0 24.89 0.047 K LLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2474.2474.2.dta 5 IPI00300052.1 Keratin type II cuticular Hb4 171 65938 9 9 7 7 884 4556 1 0 0 414.2192 826.4238 2 826.4225 0.0013 0 39.7 0.0021 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5542.5542.2.dta 5 IPI00300052.1 Keratin type II cuticular Hb4 171 65938 9 9 7 7 1559 2179 1 0 0 466.7379 931.4612 2 931.461 0.0001 0 46.91 9.20E-05 R LLEGEESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2942.2942.2.dta 5 IPI00300052.1 Keratin type II cuticular Hb4 171 65938 9 9 7 7 2714 4502 1 0 0 541.8033 1081.592 2 1081.592 0 1 43.15 0.00066 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5483.5483.2.dta 5 IPI00300052.1 Keratin type II cuticular Hb4 171 65938 9 9 7 7 2752 1541 1 0 0 544.3087 1086.6028 2 1086.6033 -0.0005 1 21.59 0.046 K EQIKTLNNK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2250.2250.2.dta 5 IPI00300052.1 Keratin type II cuticular Hb4 171 65938 9 9 7 7 5340 4906 1 0 0 699.3737 1396.7328 2 1396.735 -0.0023 1 60.63 5.30E-06 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5916.5916.2.dta 5 IPI00300052.1 Keratin type II cuticular Hb4 171 65938 9 9 7 7 5341 4895 1 0 0 466.5853 1396.734 3 1396.735 -0.0011 1 36.65 0.001 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5906.5906.3.dta 5 IPI00300052.1 Keratin type II cuticular Hb4 171 65938 9 9 7 7 6019 3999 1 0 0 745.9124 1489.8102 2 1489.814 -0.0039 1 40.38 0.00044 R FLEQQNKLLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4939.4939.2.dta 5 IPI00300052.1 Keratin type II cuticular Hb4 171 65938 9 9 7 7 6020 3981 1 0 0 497.6119 1489.8138 3 1489.814 -0.0002 1 21.93 0.0088 R FLEQQNKLLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4920.4920.3.dta 5 IPI00241841.8 keratin 6L 170 58085 7 7 6 6 884 4556 1 0 0 414.2192 826.4238 2 826.4225 0.0013 0 39.7 0.0021 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5542.5542.2.dta 5 IPI00241841.8 keratin 6L 170 58085 7 7 6 6 2714 4502 1 0 0 541.8033 1081.592 2 1081.592 0 1 43.15 0.00066 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5483.5483.2.dta 5 IPI00241841.8 keratin 6L 170 58085 7 7 6 6 2752 1541 1 0 0 544.3087 1086.6028 2 1086.6033 -0.0005 1 21.59 0.046 R EQIKTLNNK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2250.2250.2.dta 5 IPI00241841.8 keratin 6L 170 58085 7 7 6 6 3125 4088 2 0 1 569.2927 1136.5709 2 1136.5713 -0.0004 0 45.92 0.00056 K YEELQVTAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5036.5036.2.dta 5 IPI00241841.8 keratin 6L 170 58085 7 7 6 6 4773 7278 1 0 0 665.3659 1328.7173 2 1328.7187 -0.0015 0 60.5 1.90E-05 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8277.8277.2.dta 5 IPI00241841.8 keratin 6L 170 58085 7 7 6 6 5340 4906 1 0 0 699.3737 1396.7328 2 1396.735 -0.0023 1 60.63 5.30E-06 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5916.5916.2.dta 5 IPI00241841.8 keratin 6L 170 58085 7 7 6 6 5341 4895 1 0 0 466.5853 1396.734 3 1396.735 -0.0011 1 36.65 0.001 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5906.5906.3.dta 5 IPI00796330.1 18 kDa protein 161 18135 4 4 4 4 2208 3774 1 0 0 508.772 1015.5295 2 1015.5298 -0.0004 0 59.37 2.80E-05 R QLDSIVGER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4696.4696.2.dta 5 IPI00796330.1 18 kDa protein 161 18135 4 4 4 4 2568 1519 1 0 0 533.7617 1065.5089 2 1065.509 -0.0002 1 33.51 0.0014 K YEDEINKR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2227.2227.2.dta 5 IPI00796330.1 18 kDa protein 161 18135 4 4 4 4 4773 7278 1 0 0 665.3659 1328.7173 2 1328.7187 -0.0015 0 60.5 1.90E-05 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8277.8277.2.dta 5 IPI00796330.1 18 kDa protein 161 18135 4 4 4 4 5419 6644 1 0 0 704.3592 1406.7038 2 1406.7041 -0.0003 0 78.21 2.70E-07 K ADTLTDEINFLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7649.7649.2.dta 5 IPI00795197.1 24 kDa protein 154 24107 5 5 4 4 850 375 1 0 0 410.211 818.4075 2 818.4068 0.0007 1 38.4 0.0053 K AKQDMAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1056.1056.2.dta 5 IPI00795197.1 24 kDa protein 154 24107 5 5 4 4 3084 2028 1 0 0 567.2836 1132.5526 2 1132.5546 -0.002 1 55.5 1.80E-05 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2778.2778.2.dta 5 IPI00795197.1 24 kDa protein 154 24107 5 5 4 4 3085 2033 1 0 0 378.5258 1132.5554 3 1132.5546 0.0008 1 29.43 0.0043 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2783.2783.3.dta 5 IPI00795197.1 24 kDa protein 154 24107 5 5 4 4 3572 2438 1 0 1 597.7907 1193.5669 2 1193.5676 -0.0008 0 61.06 5.90E-06 K YEELQQTAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3222.3222.2.dta 5 IPI00795197.1 24 kDa protein 154 24107 5 5 4 4 4773 7278 1 0 0 665.3659 1328.7173 2 1328.7187 -0.0015 0 60.5 1.90E-05 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8277.8277.2.dta 5 IPI00791554.1 17 kDa protein 143 17100 6 6 5 5 51 2241 1 0 0 305.1714 608.3283 2 608.3282 0.0001 0 25.68 0.044 K AYSIR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3009.3009.2.dta 5 IPI00791554.1 17 kDa protein 143 17100 6 6 5 5 1559 2179 1 0 0 466.7379 931.4612 2 931.461 0.0001 0 46.91 9.20E-05 K LLEGEESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2942.2942.2.dta 5 IPI00791554.1 17 kDa protein 143 17100 6 6 5 5 2526 1867 1 0 0 530.7849 1059.5552 2 1059.556 -0.0008 1 38.94 0.004 R KLLEGEESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2604.2604.2.dta 5 IPI00791554.1 17 kDa protein 143 17100 6 6 5 5 3510 5076 1 0 1 593.8093 1185.6041 2 1185.5989 0.0052 0 47.64 0.0004 K QEELEAALQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6091.6091.2.dta 5 IPI00791554.1 17 kDa protein 143 17100 6 6 5 5 5221 3549 1 0 1 693.3716 1384.7286 2 1384.731 -0.0024 1 59.57 3.90E-06 R AKQEELEAALQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4453.4453.2.dta 5 IPI00791554.1 17 kDa protein 143 17100 6 6 5 5 5222 3548 1 0 1 462.5843 1384.7309 3 1384.731 0 1 41.45 0.0018 R AKQEELEAALQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4452.4452.3.dta 5 IPI00290857.2 "Keratin, type II cytoskeletal 3" 137 64636 7 7 6 6 367 2147 1 0 0 352.6953 703.376 2 703.3752 0.0008 0 32.5 0.017 R LDSELK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2907.2907.2.dta 5 IPI00290857.2 "Keratin, type II cytoskeletal 3" 137 64636 7 7 6 6 884 4556 1 0 0 414.2192 826.4238 2 826.4225 0.0013 0 39.7 0.0021 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5542.5542.2.dta 5 IPI00290857.2 "Keratin, type II cytoskeletal 3" 137 64636 7 7 6 6 2568 1519 1 0 0 533.7617 1065.5089 2 1065.509 -0.0002 1 33.51 0.0014 K YEDEINKR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2227.2227.2.dta 5 IPI00290857.2 "Keratin, type II cytoskeletal 3" 137 64636 7 7 6 6 2714 4502 1 0 0 541.8033 1081.592 2 1081.592 0 1 43.15 0.00066 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5483.5483.2.dta 5 IPI00290857.2 "Keratin, type II cytoskeletal 3" 137 64636 7 7 6 6 2752 1541 1 0 0 544.3087 1086.6028 2 1086.6033 -0.0005 1 21.59 0.046 R EQIKTLNNK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2250.2250.2.dta 5 IPI00290857.2 "Keratin, type II cytoskeletal 3" 137 64636 7 7 6 6 5340 4906 1 0 0 699.3737 1396.7328 2 1396.735 -0.0023 1 60.63 5.30E-06 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5916.5916.2.dta 5 IPI00290857.2 "Keratin, type II cytoskeletal 3" 137 64636 7 7 6 6 5341 4895 1 0 0 466.5853 1396.734 3 1396.735 -0.0011 1 36.65 0.001 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5906.5906.3.dta 5 IPI00792167.1 9 kDa protein 128 8852 2 2 2 2 4303 6985 1 0 1 636.8553 1271.696 2 1271.6973 -0.0013 0 65.95 4.50E-06 R SLDLDGIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7986.7986.2.dta 5 IPI00792167.1 9 kDa protein 128 8852 2 2 2 2 5470 6428 1 0 1 709.8665 1417.7184 2 1417.7201 -0.0018 0 85.43 1.90E-08 K VDALNDEINFLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7435.7435.2.dta 5 IPI00376379.3 Keratin 77 124 62050 4 4 4 4 884 4556 1 0 0 414.2192 826.4238 2 826.4225 0.0013 0 39.7 0.0021 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5542.5542.2.dta 5 IPI00376379.3 Keratin 77 124 62050 4 4 4 4 2568 1519 1 0 0 533.7617 1065.5089 2 1065.509 -0.0002 1 33.51 0.0014 K YEDEINKR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2227.2227.2.dta 5 IPI00376379.3 Keratin 77 124 62050 4 4 4 4 2714 4502 1 0 0 541.8033 1081.592 2 1081.592 0 1 43.15 0.00066 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5483.5483.2.dta 5 IPI00376379.3 Keratin 77 124 62050 4 4 4 4 5924 3891 1 0 0 738.3968 1474.7791 2 1474.778 0.0012 0 75.71 5.20E-07 R FLEQQNQVLQTK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4822.4822.2.dta 5 IPI00655639.1 Hypothetical protein (Fragment) 123 12922 2 2 2 2 4303 6985 1 0 1 636.8553 1271.696 2 1271.6973 -0.0013 0 65.95 4.50E-06 R SLDLDGIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7986.7986.2.dta 5 IPI00655639.1 Hypothetical protein (Fragment) 123 12922 2 2 2 2 5665 2966 1 0 1 721.3906 1440.7666 2 1440.7684 -0.0019 1 77.72 5.20E-08 R LQAEIDNIKNQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3815.3815.2.dta 5 IPI00791653.1 8 kDa protein 121 7516 2 2 2 2 653 1615 1 0 1 390.1937 778.3729 2 778.3722 0.0007 0 43.28 0.00026 K AAFGGSGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2331.2331.2.dta 5 IPI00791653.1 8 kDa protein 121 7516 2 2 2 2 7407 1614 1 0 1 870.8564 1739.6983 2 1739.6983 0 0 94.57 3.50E-10 R GSSSGGGYSSGSSSYGSGGR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2330.2330.2.dta 5 IPI00793849.1 Protein 112 22010 3 3 3 3 2568 1519 1 0 0 533.7617 1065.5089 2 1065.509 -0.0002 1 33.51 0.0014 R YEDEINKR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2227.2227.2.dta 5 IPI00793849.1 Protein 112 22010 3 3 3 3 3572 2438 1 0 1 597.7907 1193.5669 2 1193.5676 -0.0008 0 61.06 5.90E-06 K YEELQQTAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3222.3222.2.dta 5 IPI00793849.1 Protein 112 22010 3 3 3 3 4773 7278 1 0 0 665.3659 1328.7173 2 1328.7187 -0.0015 0 60.5 1.90E-05 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8277.8277.2.dta 5 IPI00217437.4 Tau-tubulin kinase 104 185741 4 4 3 3 3063 2194 1 0 1 565.3135 1128.6124 2 1128.6138 -0.0014 1 42.68 0.001 R GELAIKDANAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2958.2958.2.dta 5 IPI00217437.4 Tau-tubulin kinase 104 185741 4 4 3 3 3241 4204 1 0 0 577.2809 1152.5472 2 1152.5485 -0.0013 0 39.37 0.00068 R EYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5161.5161.2.dta 5 IPI00217437.4 Tau-tubulin kinase 104 185741 4 4 3 3 6319 4549 1 0 1 775.9029 1549.7912 2 1549.7922 -0.001 1 46.93 0.00011 R QLREYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5534.5534.2.dta 5 IPI00217437.4 Tau-tubulin kinase 104 185741 4 4 3 3 6320 4545 1 0 1 517.6049 1549.7929 3 1549.7922 0.0007 1 37.35 0.00066 R QLREYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5530.5530.3.dta 5 IPI00174775.2 Keratin 6 irs3 102 59457 4 4 3 3 884 4556 1 0 0 414.2192 826.4238 2 826.4225 0.0013 0 39.7 0.0021 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5542.5542.2.dta 5 IPI00174775.2 Keratin 6 irs3 102 59457 4 4 3 3 2714 4502 1 0 0 541.8033 1081.592 2 1081.592 0 1 43.15 0.00066 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5483.5483.2.dta 5 IPI00174775.2 Keratin 6 irs3 102 59457 4 4 3 3 3084 2028 1 0 0 567.2836 1132.5526 2 1132.5546 -0.002 1 55.5 1.80E-05 R KLLEGEECR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2778.2778.2.dta 5 IPI00174775.2 Keratin 6 irs3 102 59457 4 4 3 3 3085 2033 1 0 0 378.5258 1132.5554 3 1132.5546 0.0008 1 29.43 0.0043 R KLLEGEECR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2783.2783.3.dta 5 IPI00013164.4 Isoform 1 of Peripherin 100 53732 3 3 3 3 1559 2179 1 0 0 466.7379 931.4612 2 931.461 0.0001 0 46.91 9.20E-05 K LLEGEESR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2942.2942.2.dta 5 IPI00013164.4 Isoform 1 of Peripherin 100 53732 3 3 3 3 2526 1867 1 0 0 530.7849 1059.5552 2 1059.556 -0.0008 1 38.94 0.004 R KLLEGEESR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2604.2604.2.dta 5 IPI00013164.4 Isoform 1 of Peripherin 100 53732 3 3 3 3 4615 4798 1 0 1 655.3063 1308.5981 2 1308.5986 -0.0005 0 55.38 6.40E-06 K NLQEAEEWYK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5802.5802.2.dta 5 IPI00738902.1 "similar to keratin, hair, basic, 6" 99 22583 3 3 2 2 1873 2038 1 0 0 487.7608 973.5071 2 973.508 -0.0009 0 46.29 6.30E-05 R LTAEVENAK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2789.2789.2.dta 5 IPI00738902.1 "similar to keratin, hair, basic, 6" 99 22583 3 3 2 2 4052 2290 1 0 0 623.3246 1244.6346 2 1244.636 -0.0014 1 46.55 6.50E-05 R TKEEINELNR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3062.3062.2.dta 5 IPI00738902.1 "similar to keratin, hair, basic, 6" 99 22583 3 3 2 2 4054 2288 1 0 0 415.8863 1244.637 3 1244.636 0.0009 1 47.08 0.00051 R TKEEINELNR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3060.3060.3.dta 5 IPI00794362.1 Protein 98 13787 2 2 2 2 3572 2438 1 0 1 597.7907 1193.5669 2 1193.5676 -0.0008 0 61.06 5.90E-06 K YEELQQTAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3222.3222.2.dta 5 IPI00794362.1 Protein 98 13787 2 2 2 2 4773 7278 1 0 0 665.3659 1328.7173 2 1328.7187 -0.0015 0 60.5 1.90E-05 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8277.8277.2.dta 5 IPI00793572.1 6 kDa protein 85 6322 1 1 1 1 5470 6428 1 0 1 709.8665 1417.7184 2 1417.7201 -0.0018 0 85.43 1.90E-08 K VDALNDEINFLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7435.7435.2.dta 5 IPI00465084.6 Desmin 72 53560 3 3 3 3 1559 2179 1 0 0 466.7379 931.4612 2 931.461 0.0001 0 46.91 9.20E-05 K LLEGEESR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2942.2942.2.dta 5 IPI00465084.6 Desmin 72 53560 3 3 3 3 2526 1867 1 0 0 530.7849 1059.5552 2 1059.556 -0.0008 1 38.94 0.004 R KLLEGEESR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2604.2604.2.dta 5 IPI00465084.6 Desmin 72 53560 3 3 3 3 6576 3455 1 0 1 529.9365 1586.7877 3 1586.79 -0.0022 1 28.62 0.0046 R TNEKVELQELNDR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4351.4351.3.dta 5 IPI00021751.5 Neurofilament triplet H protein 65 112640 2 2 1 1 3084 2028 1 0 0 567.2836 1132.5526 2 1132.5546 -0.002 1 55.5 1.80E-05 R KLLEGEECR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2778.2778.2.dta 5 IPI00021751.5 Neurofilament triplet H protein 65 112640 2 2 1 1 3085 2033 1 0 0 378.5258 1132.5554 3 1132.5546 0.0008 1 29.43 0.0043 R KLLEGEECR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2783.2783.3.dta 5 IPI00794179.1 Desmin 63 32382 2 2 2 2 1559 2179 1 0 0 466.7379 931.4612 2 931.461 0.0001 0 46.91 9.20E-05 K LLEGEESR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2942.2942.2.dta 5 IPI00794179.1 Desmin 63 32382 2 2 2 2 2526 1867 1 0 0 530.7849 1059.5552 2 1059.556 -0.0008 1 38.94 0.004 R KLLEGEESR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2604.2604.2.dta 5 IPI00793778.1 Keratin 60 10027 1 1 1 1 4773 7278 1 0 0 665.3659 1328.7173 2 1328.7187 -0.0015 0 60.5 1.90E-05 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8277.8277.2.dta 5 IPI00061200.3 Keratin-71 58 57769 2 2 2 2 884 4556 1 0 0 414.2192 826.4238 2 826.4225 0.0013 0 39.7 0.0021 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5542.5542.2.dta 5 IPI00061200.3 Keratin-71 58 57769 2 2 2 2 2714 4502 1 0 0 541.8033 1081.592 2 1081.592 0 1 43.15 0.00066 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5483.5483.2.dta 5 IPI00215804.4 "similar to Keratin, type II cytoskeletal 8" 43 23165 1 1 1 1 3063 2194 1 0 1 565.3135 1128.6124 2 1128.6138 -0.0014 1 42.68 0.001 R GELAIKDANAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2958.2958.2.dta 5 IPI00290078.5 keratin 4 40 64442 1 1 1 1 884 4556 1 0 0 414.2192 826.4238 2 826.4225 0.0013 0 39.7 0.0021 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5542.5542.2.dta 5 IPI00790961.1 KRT8L2 protein 22 13076 1 1 1 1 2752 1541 1 0 0 544.3087 1086.6028 2 1086.6033 -0.0005 1 21.59 0.046 K EQIKTLNNK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2250.2250.2.dta 6 1 IPI00398625.5 Hornerin 894 283140 24 24 21 21 724 1137 1 1 1 397.6935 793.3725 2 793.3719 0.0006 0 33.93 0.0036 R QSPSYGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1813.1813.2.dta 6 1 IPI00398625.5 Hornerin 894 283140 24 24 21 21 1410 1759 1 1 1 455.7043 909.394 2 909.3941 -0.0001 0 30.13 0.0083 R SGSGWSSSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2487.2487.2.dta 6 1 IPI00398625.5 Hornerin 894 283140 24 24 21 21 1672 7281 1 1 1 474.7177 947.4208 2 947.4209 -0.0002 0 49 2.50E-05 R YGQHGSGSR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.828.828.2.dta 6 1 IPI00398625.5 Hornerin 894 283140 24 24 21 21 3035 951 1 1 1 563.2676 1124.5206 2 1124.521 -0.0004 1 44.55 0.00048 R SSSRGPYESR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1611.1611.2.dta 6 1 IPI00398625.5 Hornerin 894 283140 24 24 21 21 3057 852 1 1 1 565.2468 1128.4791 2 1128.4796 -0.0005 0 73.38 2.00E-07 R GSGSSQSSGYGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1504.1504.2.dta 6 1 IPI00398625.5 Hornerin 894 283140 24 24 21 21 3135 1208 1 1 1 570.2571 1138.4997 2 1138.5003 -0.0006 0 49.59 2.20E-05 R GSGSGQSPSYGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1890.1890.2.dta 6 1 IPI00398625.5 Hornerin 894 283140 24 24 21 21 4008 187 1 1 1 620.7867 1239.5589 2 1239.5592 -0.0003 0 53.56 9.50E-06 R HGSGSGQSPSPSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1032.1032.2.dta 6 1 IPI00398625.5 Hornerin 894 283140 24 24 21 21 4095 587 1 1 1 417.5376 1249.591 3 1249.5912 -0.0002 0 54.52 7.70E-06 R HGAGSGQSLSHGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1217.1217.3.dta 6 1 IPI00398625.5 Hornerin 894 283140 24 24 21 21 4096 593 1 1 1 625.8029 1249.5912 2 1249.5912 0 0 55.36 6.40E-06 R HGAGSGQSLSHGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1223.1223.2.dta 6 1 IPI00398625.5 Hornerin 894 283140 24 24 21 21 4765 673 1 1 1 665.2993 1328.584 2 1328.5858 -0.0018 0 50.2 2.00E-05 R HGSGSGQSSGFGHK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1310.1310.2.dta 6 1 IPI00398625.5 Hornerin 894 283140 24 24 21 21 4843 6484 1 1 1 670.3079 1338.6012 2 1338.6025 -0.0013 0 56.38 5.20E-06 R QGSGSGQSPGHGQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.749.749.2.dta 6 1 IPI00398625.5 Hornerin 894 283140 24 24 21 21 4844 6522 1 1 1 447.208 1338.6022 3 1338.6025 -0.0003 0 30.47 0.0016 R QGSGSGQSPGHGQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.753.753.3.dta 6 1 IPI00398625.5 Hornerin 894 283140 24 24 21 21 4941 5656 1 1 1 674.8089 1347.6032 2 1347.6028 0.0004 0 105.95 2.90E-10 R HGSGSGQSPGHGQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.667.667.2.dta 6 1 IPI00398625.5 Hornerin 894 283140 24 24 21 21 5308 883 1 1 1 698.3159 1394.6173 2 1394.6175 -0.0002 0 85.06 1.10E-08 R YGQQGSGSGQSPSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1538.1538.2.dta 6 1 IPI00398625.5 Hornerin 894 283140 24 24 21 21 5655 1737 1 1 1 480.5478 1438.6216 3 1438.6226 -0.0009 0 21.46 0.022 R QSSSYGPHGYGSGR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2463.2463.3.dta 6 1 IPI00398625.5 Hornerin 894 283140 24 24 21 21 6380 5899 1 1 1 782.3531 1562.6916 2 1562.6935 -0.0018 0 60.56 2.10E-06 R GQHSSGSGQSPGHGQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.691.691.2.dta 6 1 IPI00398625.5 Hornerin 894 283140 24 24 21 21 6556 1336 1 1 1 792.861 1583.7075 2 1583.7077 -0.0002 0 89.82 1.20E-08 R GPYESGSGHSSGLGHR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2028.2028.2.dta 6 1 IPI00398625.5 Hornerin 894 283140 24 24 21 21 6666 610 1 1 1 807.8403 1613.6661 2 1613.6666 -0.0005 0 117.3 6.50E-12 R SSSGSSSSYGQHGSGSR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1242.1242.2.dta 6 1 IPI00398625.5 Hornerin 894 283140 24 24 21 21 7597 453 1 1 1 603.5893 1807.7461 3 1807.747 -0.0009 0 69.47 4.50E-07 R HGSSSGSSSSYGQHGSGSR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1074.1074.3.dta 6 1 IPI00398625.5 Hornerin 894 283140 24 24 21 21 7598 469 1 1 1 904.8808 1807.747 2 1807.747 0 0 26.75 0.0092 R HGSSSGSSSSYGQHGSGSR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1090.1090.2.dta 6 1 IPI00398625.5 Hornerin 894 283140 24 24 21 21 7738 7566 1 1 1 620.2645 1857.7718 3 1857.7739 -0.0021 0 19.44 0.038 R HGSSSGSSSHYGQHGSGSR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.857.857.3.dta 6 1 IPI00398625.5 Hornerin 894 283140 24 24 21 21 7985 800 1 1 1 649.9718 1946.8936 3 1946.8943 -0.0008 0 56.68 2.60E-05 R QSLGHGQHGSGSGQSPSPSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1448.1448.3.dta 6 1 IPI00398625.5 Hornerin 894 283140 24 24 21 21 8153 551 1 1 1 708.2975 2121.8708 3 2121.8696 0.0012 0 54.93 4.30E-06 R GEQHGSSSGSSSSYGQHGSGSR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1178.1178.3.dta 6 1 IPI00398625.5 Hornerin 894 283140 24 24 21 21 8296 1250 1 1 1 587.2665 2345.0368 4 2345.0381 -0.0013 1 28.06 0.0078 R SSSRGPYESGSGHSSGLGHQESR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1935.1935.4.dta 6 IPI00787362.1 similar to Hornerin 801 188565 21 21 19 19 724 1137 1 0 1 397.6935 793.3725 2 793.3719 0.0006 0 33.93 0.0036 R QSPSYGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1813.1813.2.dta 6 IPI00787362.1 similar to Hornerin 801 188565 21 21 19 19 1410 1759 1 0 1 455.7043 909.394 2 909.3941 -0.0001 0 30.13 0.0083 R SGSGWSSSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2487.2487.2.dta 6 IPI00787362.1 similar to Hornerin 801 188565 21 21 19 19 1672 7281 1 0 1 474.7177 947.4208 2 947.4209 -0.0002 0 49 2.50E-05 R YGQHGSGSR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.828.828.2.dta 6 IPI00787362.1 similar to Hornerin 801 188565 21 21 19 19 3035 951 1 0 1 563.2676 1124.5206 2 1124.521 -0.0004 1 44.55 0.00048 R SSSRGPYESR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1611.1611.2.dta 6 IPI00787362.1 similar to Hornerin 801 188565 21 21 19 19 3057 852 1 0 1 565.2468 1128.4791 2 1128.4796 -0.0005 0 73.38 2.00E-07 R GSGSSQSSGYGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1504.1504.2.dta 6 IPI00787362.1 similar to Hornerin 801 188565 21 21 19 19 3135 1208 1 0 1 570.2571 1138.4997 2 1138.5003 -0.0006 0 49.59 2.20E-05 R GSGSGQSPSYGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1890.1890.2.dta 6 IPI00787362.1 similar to Hornerin 801 188565 21 21 19 19 4008 187 1 0 1 620.7867 1239.5589 2 1239.5592 -0.0003 0 53.56 9.50E-06 R HGSGSGQSPSPSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1032.1032.2.dta 6 IPI00787362.1 similar to Hornerin 801 188565 21 21 19 19 4095 587 1 0 1 417.5376 1249.591 3 1249.5912 -0.0002 0 54.52 7.70E-06 R HGAGSGQSLSHGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1217.1217.3.dta 6 IPI00787362.1 similar to Hornerin 801 188565 21 21 19 19 4096 593 1 0 1 625.8029 1249.5912 2 1249.5912 0 0 55.36 6.40E-06 R HGAGSGQSLSHGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1223.1223.2.dta 6 IPI00787362.1 similar to Hornerin 801 188565 21 21 19 19 4843 6484 1 0 1 670.3079 1338.6012 2 1338.6025 -0.0013 0 56.38 5.20E-06 R QGSGSGQSPGHGQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.749.749.2.dta 6 IPI00787362.1 similar to Hornerin 801 188565 21 21 19 19 4844 6522 1 0 1 447.208 1338.6022 3 1338.6025 -0.0003 0 30.47 0.0016 R QGSGSGQSPGHGQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.753.753.3.dta 6 IPI00787362.1 similar to Hornerin 801 188565 21 21 19 19 4941 5656 1 0 1 674.8089 1347.6032 2 1347.6028 0.0004 0 105.95 2.90E-10 R HGSGSGQSPGHGQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.667.667.2.dta 6 IPI00787362.1 similar to Hornerin 801 188565 21 21 19 19 5308 883 1 0 1 698.3159 1394.6173 2 1394.6175 -0.0002 0 85.06 1.10E-08 R YGQQGSGSGQSPSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1538.1538.2.dta 6 IPI00787362.1 similar to Hornerin 801 188565 21 21 19 19 5655 1737 1 0 1 480.5478 1438.6216 3 1438.6226 -0.0009 0 21.46 0.022 R QSSSYGPHGYGSGR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2463.2463.3.dta 6 IPI00787362.1 similar to Hornerin 801 188565 21 21 19 19 6380 5899 1 0 1 782.3531 1562.6916 2 1562.6935 -0.0018 0 60.56 2.10E-06 R GQHSSGSGQSPGHGQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.691.691.2.dta 6 IPI00787362.1 similar to Hornerin 801 188565 21 21 19 19 6556 1336 1 0 1 792.861 1583.7075 2 1583.7077 -0.0002 0 89.82 1.20E-08 R GPYESGSGHSSGLGHR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2028.2028.2.dta 6 IPI00787362.1 similar to Hornerin 801 188565 21 21 19 19 6666 610 1 0 1 807.8403 1613.6661 2 1613.6666 -0.0005 0 117.3 6.50E-12 R SSSGSSSSYGQHGSGSR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1242.1242.2.dta 6 IPI00787362.1 similar to Hornerin 801 188565 21 21 19 19 7738 7566 1 0 1 620.2645 1857.7718 3 1857.7739 -0.0021 0 19.44 0.038 R HGSSSGSSSHYGQHGSGSR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.857.857.3.dta 6 IPI00787362.1 similar to Hornerin 801 188565 21 21 19 19 7985 800 1 0 1 649.9718 1946.8936 3 1946.8943 -0.0008 0 56.68 2.60E-05 R QSLGHGQHGSGSGQSPSPSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1448.1448.3.dta 6 IPI00787362.1 similar to Hornerin 801 188565 21 21 19 19 8153 551 1 0 1 708.2975 2121.8708 3 2121.8696 0.0012 0 54.93 4.30E-06 R GEQHGSSSGSSSSYGQHGSGSR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1178.1178.3.dta 6 IPI00787362.1 similar to Hornerin 801 188565 21 21 19 19 8296 1250 1 0 1 587.2665 2345.0368 4 2345.0381 -0.0013 1 28.06 0.0078 R SSSRGPYESGSGHSSGLGHQESR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1935.1935.4.dta 6 IPI00783478.1 129 kDa protein 111 129438 2 2 2 2 3035 951 1 0 1 563.2676 1124.5206 2 1124.521 -0.0004 1 44.55 0.00048 R SSSRGPYESR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1611.1611.2.dta 6 IPI00783478.1 129 kDa protein 111 129438 2 2 2 2 6556 1336 1 0 1 792.861 1583.7075 2 1583.7077 -0.0002 0 89.82 1.20E-08 R GPYESGSGHSSGLGHR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2028.2028.2.dta 7 1 IPI00456969.1 "Dynein heavy chain, cytosolic" 793 534809 33 33 31 31 115 977 7 1 1 315.221 628.4275 2 628.4272 0.0004 1 29.8 0.021 R IQKIK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1639.1639.2.dta 7 1 IPI00456969.1 "Dynein heavy chain, cytosolic" 793 534809 33 33 31 31 481 4930 1 1 1 367.7316 733.4487 2 733.4487 0 0 37 0.0013 R VISFIR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5941.5941.2.dta 7 1 IPI00456969.1 "Dynein heavy chain, cytosolic" 793 534809 33 33 31 31 781 3662 1 1 1 401.726 801.4375 2 801.4344 0.0031 0 37.69 0.0072 K NLESALR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4575.4575.2.dta 7 1 IPI00456969.1 "Dynein heavy chain, cytosolic" 793 534809 33 33 31 31 1039 2017 1 1 1 423.2402 844.4659 2 844.4654 0.0005 0 51.54 0.0002 R TAEVLANK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2766.2766.2.dta 7 1 IPI00456969.1 "Dynein heavy chain, cytosolic" 793 534809 33 33 31 31 1815 537 1 1 1 322.8461 965.5165 3 965.5155 0.001 1 16.13 0.031 R RQHEQLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1163.1163.3.dta 7 1 IPI00456969.1 "Dynein heavy chain, cytosolic" 793 534809 33 33 31 31 1816 4390 1 1 1 483.7663 965.518 2 965.5182 -0.0001 0 34.59 0.0024 R IFTIESTR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5362.5362.2.dta 7 1 IPI00456969.1 "Dynein heavy chain, cytosolic" 793 534809 33 33 31 31 2091 1705 1 1 1 501.2905 1000.5665 2 1000.5665 0 1 51.32 0.00012 R LRDQLGTAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2428.2428.2.dta 7 1 IPI00456969.1 "Dynein heavy chain, cytosolic" 793 534809 33 33 31 31 2380 6593 1 1 1 520.285 1038.5555 2 1038.5532 0.0023 0 40.03 0.00073 K TMTLFSALR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7599.7599.2.dta 7 1 IPI00456969.1 "Dynein heavy chain, cytosolic" 793 534809 33 33 31 31 2440 4031 1 1 1 524.283 1046.5514 2 1046.5509 0.0005 0 52.75 0.00013 R AATSPALFNR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4974.4974.2.dta 7 1 IPI00456969.1 "Dynein heavy chain, cytosolic" 793 534809 33 33 31 31 2485 5807 1 1 1 528.2813 1054.5481 2 1054.5481 0 0 34.63 0.00057 K TMTLFSALR A Oxidation (M) 0.010000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6819.6819.2.dta 7 1 IPI00456969.1 "Dynein heavy chain, cytosolic" 793 534809 33 33 31 31 2625 2254 1 1 1 537.3129 1072.6112 2 1072.6128 -0.0016 1 40.07 0.00039 R IKSQELEVK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3023.3023.2.dta 7 1 IPI00456969.1 "Dynein heavy chain, cytosolic" 793 534809 33 33 31 31 2626 2251 1 1 1 358.5453 1072.6141 3 1072.6128 0.0013 1 35.35 0.0046 R IKSQELEVK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3020.3020.3.dta 7 1 IPI00456969.1 "Dynein heavy chain, cytosolic" 793 534809 33 33 31 31 2938 6075 1 1 1 557.8268 1113.639 2 1113.6393 -0.0003 0 52.43 6.40E-05 K SLLQALNEVK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7088.7088.2.dta 7 1 IPI00456969.1 "Dynein heavy chain, cytosolic" 793 534809 33 33 31 31 3017 5852 1 1 1 561.7963 1121.578 2 1121.5791 -0.0011 0 23.92 0.038 R IMFEVQDLK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6863.6863.2.dta 7 1 IPI00456969.1 "Dynein heavy chain, cytosolic" 793 534809 33 33 31 31 3187 3896 1 1 1 573.3011 1144.5876 2 1144.5877 -0.0001 0 77.35 5.60E-08 R LGGSPFGPAGTGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4828.4828.2.dta 7 1 IPI00456969.1 "Dynein heavy chain, cytosolic" 793 534809 33 33 31 31 3625 5149 1 1 1 400.5404 1198.5994 3 1198.5982 0.0011 1 17.12 0.025 R TSFLDDAFRK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6166.6166.3.dta 7 1 IPI00456969.1 "Dynein heavy chain, cytosolic" 793 534809 33 33 31 31 3729 1789 1 1 1 604.7897 1207.5648 2 1207.5656 -0.0008 0 44.47 0.00056 K VQYPQSQACK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2519.2519.2.dta 7 1 IPI00456969.1 "Dynein heavy chain, cytosolic" 793 534809 33 33 31 31 3826 6014 1 1 1 611.304 1220.5935 2 1220.5925 0.001 0 51.08 1.80E-05 R TTDLLTDWEK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7027.7027.2.dta 7 1 IPI00456969.1 "Dynein heavy chain, cytosolic" 793 534809 33 33 31 31 3887 6135 1 1 1 615.3495 1228.6844 2 1228.6856 -0.0012 0 22.66 0.0075 R IFVFEPPPGVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7146.7146.2.dta 7 1 IPI00456969.1 "Dynein heavy chain, cytosolic" 793 534809 33 33 31 31 4278 6507 1 1 1 635.3613 1268.7081 2 1268.7088 -0.0007 0 36.09 0.0033 R QNLDALLNQLK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7513.7513.2.dta 7 1 IPI00456969.1 "Dynein heavy chain, cytosolic" 793 534809 33 33 31 31 4530 3823 1 1 1 650.8468 1299.6791 2 1299.6783 0.0008 0 73.36 1.30E-07 R GNEIVLSAGSTPR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4749.4749.2.dta 7 1 IPI00456969.1 "Dynein heavy chain, cytosolic" 793 534809 33 33 31 31 4792 4596 1 1 1 444.5822 1330.7249 3 1330.7245 0.0004 1 27.63 0.0026 R TVENIKDPLFR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5585.5585.3.dta 7 1 IPI00456969.1 "Dynein heavy chain, cytosolic" 793 534809 33 33 31 31 4919 4807 1 1 1 673.8517 1345.6888 2 1345.6911 -0.0023 0 60.18 2.70E-06 K TSAPITCELLNK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5811.5811.2.dta 7 1 IPI00456969.1 "Dynein heavy chain, cytosolic" 793 534809 33 33 31 31 5196 6303 1 1 1 691.8867 1381.7589 2 1381.7605 -0.0017 0 17.3 0.024 R DLPPVSGSIIWAK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7312.7312.2.dta 7 1 IPI00456969.1 "Dynein heavy chain, cytosolic" 793 534809 33 33 31 31 5382 4953 1 1 1 702.8527 1403.6909 2 1403.6933 -0.0024 0 56.61 1.10E-05 R WTDENIDTVALK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5965.5965.2.dta 7 1 IPI00456969.1 "Dynein heavy chain, cytosolic" 793 534809 33 33 31 31 5388 5359 1 1 1 702.8916 1403.7687 2 1403.7694 -0.0008 0 58.84 8.00E-06 R VLLTTQGVDMISK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6375.6375.2.dta 7 1 IPI00456969.1 "Dynein heavy chain, cytosolic" 793 534809 33 33 31 31 5558 4215 1 1 1 714.8931 1427.7716 2 1427.7732 -0.0016 0 52.55 1.20E-05 K QLQNISLAAASGGAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5173.5173.2.dta 7 1 IPI00456969.1 "Dynein heavy chain, cytosolic" 793 534809 33 33 31 31 6097 6802 1 1 1 754.3618 1506.709 2 1506.7103 -0.0013 0 27.63 0.0039 K LNTQEIFDDWAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7806.7806.2.dta 7 1 IPI00456969.1 "Dynein heavy chain, cytosolic" 793 534809 33 33 31 31 6121 5226 1 1 1 756.9213 1511.8281 2 1511.8308 -0.0027 0 96 2.60E-09 R IQGLTVEQAEAVVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6243.6243.2.dta 7 1 IPI00456969.1 "Dynein heavy chain, cytosolic" 793 534809 33 33 31 31 6528 6231 1 1 1 790.374 1578.7335 2 1578.7355 -0.002 0 48.24 4.80E-05 K FNYGFEYLGVQDK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7240.7240.2.dta 7 1 IPI00456969.1 "Dynein heavy chain, cytosolic" 793 534809 33 33 31 31 6770 4210 1 1 1 814.8963 1627.7781 2 1627.7777 0.0004 0 80.21 1.50E-07 R IQFVGACNPPTDPGR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5168.5168.2.dta 7 1 IPI00456969.1 "Dynein heavy chain, cytosolic" 793 534809 33 33 31 31 6885 4635 1 1 1 547.2988 1638.8747 3 1638.873 0.0017 0 14.25 0.046 K FLSDPQVHTVLVER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5627.5627.3.dta 7 1 IPI00456969.1 "Dynein heavy chain, cytosolic" 793 534809 33 33 31 31 7629 5920 1 1 1 910.4515 1818.8884 2 1818.8847 0.0037 0 22.27 0.0081 K EALELTDTGLLSGSEER V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6930.6930.2.dta 7 IPI00440177.1 DYNC1H1 protein 65 22225 2 2 2 2 4792 4596 1 0 1 444.5822 1330.7249 3 1330.7245 0.0004 1 27.63 0.0026 R TVENIKDPLFR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5585.5585.3.dta 7 IPI00440177.1 DYNC1H1 protein 65 22225 2 2 2 2 5558 4215 1 0 1 714.8931 1427.7716 2 1427.7732 -0.0016 0 52.55 1.20E-05 K QLQNISLAAASGGAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5173.5173.2.dta 8 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 749 193260 37 37 34 34 198 3024 1 1 1 329.2054 656.3963 2 656.3969 -0.0007 0 52.42 0.00013 K AGLLQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3878.3878.2.dta 8 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 749 193260 37 37 34 34 566 1593 2 1 1 379.7426 757.4706 2 757.4698 0.0008 1 31.29 0.016 R KQLLEK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2307.2307.2.dta 8 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 749 193260 37 37 34 34 742 1537 1 1 1 399.2028 796.3911 2 796.3901 0.0009 0 30.19 0.014 K YLQMAR K Oxidation (M) 0.000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2246.2246.2.dta 8 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 749 193260 37 37 34 34 880 5135 1 1 1 413.2472 824.4799 2 824.4796 0.0003 0 42.6 0.00069 R IAAYLFK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6152.6152.2.dta 8 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 749 193260 37 37 34 34 883 5321 1 1 1 413.7793 825.5441 2 825.5436 0.0005 0 32.62 0.0018 K NLILVVR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6337.6337.2.dta 8 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 749 193260 37 37 34 34 1055 2415 1 1 1 425.2458 848.4771 2 848.4756 0.0016 1 36.88 0.0028 K NFLKEAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3197.3197.2.dta 8 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 749 193260 37 37 34 34 1089 1476 1 1 1 427.2152 852.4159 2 852.4164 -0.0004 0 28.65 0.02 K YIQAACK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2180.2180.2.dta 8 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 749 193260 37 37 34 34 1256 3259 1 1 1 443.2093 884.4041 2 884.4028 0.0013 0 33.62 0.0033 R AYEFAER C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4138.4138.2.dta 8 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 749 193260 37 37 34 34 1597 4049 1 1 1 469.7448 937.4751 2 937.4756 -0.0005 0 24.58 0.013 K EAIDSYIK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4993.4993.2.dta 8 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 749 193260 37 37 34 34 1923 1079 1 1 1 491.7547 981.4949 2 981.4953 -0.0004 1 22.01 0.0086 R VVGKYCEK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1750.1750.2.dta 8 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 749 193260 37 37 34 34 2402 2343 1 1 1 522.2253 1042.4361 2 1042.4356 0.0006 0 37.03 0.00069 R ENPYYDSR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3119.3119.2.dta 8 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 749 193260 37 37 34 34 2487 4560 1 1 1 528.2924 1054.5702 2 1054.5699 0.0003 0 34.02 0.0018 K YIEIYVQK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5546.5546.2.dta 8 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 749 193260 37 37 34 34 2520 1398 1 1 1 530.2924 1058.5703 2 1058.572 -0.0017 1 56.05 7.30E-05 K TGQIKEVER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2096.2096.2.dta 8 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 749 193260 37 37 34 34 2586 2145 1 1 1 357.1874 1068.5403 3 1068.5386 0.0017 0 24.72 0.0057 R AHIAQLCEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2905.2905.3.dta 8 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 749 193260 37 37 34 34 2905 7657 1 1 1 555.8364 1109.6583 2 1109.6597 -0.0014 0 34.84 0.0017 K LLLPWLEAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8675.8675.2.dta 8 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 749 193260 37 37 34 34 3922 2812 1 1 1 616.8275 1231.6404 2 1231.6408 -0.0005 1 33.07 0.00079 K VDKLDASESLR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3641.3641.2.dta 8 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 749 193260 37 37 34 34 3923 2807 1 1 1 411.5544 1231.6412 3 1231.6408 0.0004 1 44.95 0.00076 K VDKLDASESLR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3636.3636.3.dta 8 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 749 193260 37 37 34 34 3985 6722 1 1 1 618.8361 1235.6576 2 1235.6584 -0.0008 0 52.82 8.50E-05 K TLQIFNIEMK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7727.7727.2.dta 8 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 749 193260 37 37 34 34 4111 5984 1 1 1 626.8347 1251.6548 2 1251.6533 0.0015 0 61.35 1.30E-05 K TLQIFNIEMK S Oxidation (M) 0.0000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6997.6997.2.dta 8 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 749 193260 37 37 34 34 4575 5684 1 1 1 652.8323 1303.6501 2 1303.652 -0.0019 0 71.02 2.70E-07 R NNLAGAEELFAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6698.6698.2.dta 8 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 749 193260 37 37 34 34 5095 1967 1 1 1 456.9043 1367.6911 3 1367.6906 0.0005 0 28 0.0024 K NNRPSEGPLQTR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2712.2712.3.dta 8 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 749 193260 37 37 34 34 5277 5063 1 1 1 696.3387 1390.6628 2 1390.665 -0.0022 0 51.01 0.00012 K LECSEELGDLVK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6078.6078.2.dta 8 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 749 193260 37 37 34 34 5322 2054 1 1 1 698.8102 1395.6058 2 1395.6089 -0.0031 1 18.29 0.019 R ESNCYDPERVK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2806.2806.2.dta 8 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 749 193260 37 37 34 34 5366 5228 1 1 1 701.8418 1401.669 2 1401.6711 -0.002 0 43.08 0.00078 R CNEPAVWSQLAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6245.6245.2.dta 8 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 749 193260 37 37 34 34 5765 3414 1 1 1 730.351 1458.6874 2 1458.6891 -0.0018 1 30.41 0.014 R FLRENPYYDSR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4307.4307.2.dta 8 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 749 193260 37 37 34 34 5766 3403 1 1 1 487.2366 1458.6879 3 1458.6891 -0.0013 1 26.26 0.013 R FLRENPYYDSR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4295.4295.3.dta 8 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 749 193260 37 37 34 34 5815 5482 1 1 1 488.9177 1463.7313 3 1463.7296 0.0017 0 20.11 0.013 R ALEHFTDLYDIK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6497.6497.3.dta 8 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 749 193260 37 37 34 34 6100 3605 1 1 1 754.3816 1506.7486 2 1506.7501 -0.0014 0 74.04 7.50E-07 K VIQCFAETGQVQK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4514.4514.2.dta 8 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 749 193260 37 37 34 34 6350 6776 1 1 1 778.4287 1554.8429 2 1554.844 -0.0011 0 34.14 0.00067 K LTDQLPLIIVCDR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7780.7780.2.dta 8 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 749 193260 37 37 34 34 6621 4637 1 1 1 533.9148 1598.7226 3 1598.7222 0.0004 1 21.29 0.015 R TWKEVCFACVDGK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5629.5629.3.dta 8 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 749 193260 37 37 34 34 6692 4782 1 1 1 540.9511 1619.8313 3 1619.8307 0.0006 1 42.91 0.00011 R ALEHFTDLYDIKR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5785.5785.3.dta 8 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 749 193260 37 37 34 34 6777 5191 1 1 1 815.8965 1629.7785 2 1629.7787 -0.0002 0 71.89 9.80E-07 K FNALFAQGNYSEAAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6208.6208.2.dta 8 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 749 193260 37 37 34 34 7326 4258 1 1 1 572.9613 1715.8621 3 1715.8631 -0.001 0 42.2 0.00019 K VSQPIEGHAASFAQFK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5220.5220.3.dta 8 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 749 193260 37 37 34 34 7474 4564 1 1 1 879.9444 1757.8742 2 1757.8736 0.0006 1 59.37 2.70E-06 R KFNALFAQGNYSEAAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5550.5550.2.dta 8 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 749 193260 37 37 34 34 7527 1734 1 1 1 592.9481 1775.8225 3 1775.826 -0.0035 0 38.95 0.00022 R IHEGCEEPATHNALAK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2460.2460.3.dta 8 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 749 193260 37 37 34 34 8020 5142 1 1 1 657.6809 1970.0209 3 1970.0221 -0.0012 0 31.69 0.0018 R LASTLVHLGEYQAAVDGAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6159.6159.3.dta 8 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 749 193260 37 37 34 34 8156 4855 1 1 1 711.0359 2130.0858 3 2130.0892 -0.0033 1 50.12 2.00E-05 R ANVPNKVIQCFAETGQVQK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5862.5862.3.dta 8 IPI00022881.1 Isoform 1 of Clathrin heavy chain 2 222 189020 11 11 10 10 566 1593 2 0 1 379.7426 757.4706 2 757.4698 0.0008 1 31.29 0.016 R KQLLEK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2307.2307.2.dta 8 IPI00022881.1 Isoform 1 of Clathrin heavy chain 2 222 189020 11 11 10 10 1055 2415 1 0 1 425.2458 848.4771 2 848.4756 0.0016 1 36.88 0.0028 K NFLKEAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3197.3197.2.dta 8 IPI00022881.1 Isoform 1 of Clathrin heavy chain 2 222 189020 11 11 10 10 1089 1476 1 0 1 427.2152 852.4159 2 852.4164 -0.0004 0 28.65 0.02 K YIQAACK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2180.2180.2.dta 8 IPI00022881.1 Isoform 1 of Clathrin heavy chain 2 222 189020 11 11 10 10 1256 3259 1 0 1 443.2093 884.4041 2 884.4028 0.0013 0 33.62 0.0033 R AYEFAER C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4138.4138.2.dta 8 IPI00022881.1 Isoform 1 of Clathrin heavy chain 2 222 189020 11 11 10 10 2487 4560 1 0 1 528.2924 1054.5702 2 1054.5699 0.0003 0 34.02 0.0018 R YIEIYVQK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5546.5546.2.dta 8 IPI00022881.1 Isoform 1 of Clathrin heavy chain 2 222 189020 11 11 10 10 2520 1398 1 0 1 530.2924 1058.5703 2 1058.572 -0.0017 1 56.05 7.30E-05 K TGQIKEVER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2096.2096.2.dta 8 IPI00022881.1 Isoform 1 of Clathrin heavy chain 2 222 189020 11 11 10 10 2586 2145 1 0 1 357.1874 1068.5403 3 1068.5386 0.0017 0 24.72 0.0057 R AHIAQLCEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2905.2905.3.dta 8 IPI00022881.1 Isoform 1 of Clathrin heavy chain 2 222 189020 11 11 10 10 3985 6722 1 0 1 618.8361 1235.6576 2 1235.6584 -0.0008 0 52.82 8.50E-05 K TLQIFNIEMK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7727.7727.2.dta 8 IPI00022881.1 Isoform 1 of Clathrin heavy chain 2 222 189020 11 11 10 10 4111 5984 1 0 1 626.8347 1251.6548 2 1251.6533 0.0015 0 61.35 1.30E-05 K TLQIFNIEMK S Oxidation (M) 0.0000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6997.6997.2.dta 8 IPI00022881.1 Isoform 1 of Clathrin heavy chain 2 222 189020 11 11 10 10 5277 5063 1 0 1 696.3387 1390.6628 2 1390.665 -0.0022 0 51.01 0.00012 K LECSEELGDLVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6078.6078.2.dta 8 IPI00022881.1 Isoform 1 of Clathrin heavy chain 2 222 189020 11 11 10 10 6350 6776 1 0 1 778.4287 1554.8429 2 1554.844 -0.0011 0 34.14 0.00067 K LTDQLPLIIVCDR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7780.7780.2.dta 9 1 IPI00021405.3 Isoform A of Lamin-A/C 694 74380 20 20 19 19 1331 2896 1 1 1 451.2536 900.4926 2 900.4916 0.001 0 25.84 0.045 K LEAALGEAK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3739.3739.2.dta 9 1 IPI00021405.3 Isoform A of Lamin-A/C 694 74380 20 20 19 19 1459 967 1 1 1 460.2228 918.4311 2 918.4308 0.0003 0 57.76 2.90E-05 R SSFSQHAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1629.1629.2.dta 9 1 IPI00021405.3 Isoform A of Lamin-A/C 694 74380 20 20 19 19 1683 660 1 1 1 475.2508 948.4871 2 948.4876 -0.0005 1 43.22 0.00046 R KLESTESR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1296.1296.2.dta 9 1 IPI00021405.3 Isoform A of Lamin-A/C 694 74380 20 20 19 19 2294 4828 1 1 1 514.7904 1027.5663 2 1027.5662 0.0001 0 62.98 8.40E-06 R LADALQELR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5834.5834.2.dta 9 1 IPI00021405.3 Isoform A of Lamin-A/C 694 74380 20 20 19 19 2408 3171 1 1 1 522.2776 1042.5407 2 1042.5407 0 0 66.99 1.50E-06 K EGDLIAAQAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4042.4042.2.dta 9 1 IPI00021405.3 Isoform A of Lamin-A/C 694 74380 20 20 19 19 2772 2927 1 1 1 545.2798 1088.5451 2 1088.5462 -0.001 0 63.35 1.20E-05 R SLETENAGLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3773.3773.2.dta 9 1 IPI00021405.3 Isoform A of Lamin-A/C 694 74380 20 20 19 19 3342 3353 1 1 1 583.2768 1164.539 2 1164.5411 -0.002 0 82.06 1.10E-07 K AAYEAELGDAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4241.4241.2.dta 9 1 IPI00021405.3 Isoform A of Lamin-A/C 694 74380 20 20 19 19 3519 3812 1 1 1 396.5513 1186.6322 3 1186.6306 0.0016 1 48.95 0.00026 K LRDLEDSLAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4737.4737.3.dta 9 1 IPI00021405.3 Isoform A of Lamin-A/C 694 74380 20 20 19 19 4035 3270 1 1 1 622.336 1242.6574 2 1242.6568 0.0007 1 26.58 0.0058 K LLEGEEERLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4151.4151.2.dta 9 1 IPI00021405.3 Isoform A of Lamin-A/C 694 74380 20 20 19 19 5060 3427 1 1 1 682.3114 1362.6083 2 1362.6099 -0.0016 0 67.5 4.70E-07 K AQNTWGCGNSLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4321.4321.2.dta 9 1 IPI00021405.3 Isoform A of Lamin-A/C 694 74380 20 20 19 19 5186 3355 1 1 1 691.3491 1380.6837 2 1380.6885 -0.0048 1 43.85 9.20E-05 K NIYSEELRETK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4243.4243.2.dta 9 1 IPI00021405.3 Isoform A of Lamin-A/C 694 74380 20 20 19 19 5406 2365 1 1 1 703.8236 1405.6327 2 1405.633 -0.0003 0 61.27 7.90E-06 R TVLCGTCGQPADK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3143.3143.2.dta 9 1 IPI00021405.3 Isoform A of Lamin-A/C 694 74380 20 20 19 19 5574 5361 1 1 1 715.8951 1429.7757 2 1429.7776 -0.0019 0 44.4 0.00023 R IDSLSAQLSQLQK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6377.6377.2.dta 9 1 IPI00021405.3 Isoform A of Lamin-A/C 694 74380 20 20 19 19 6065 1161 1 1 1 501.5788 1501.7147 3 1501.7161 -0.0014 1 39.64 0.00019 R AQHEDQVEQYKK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1839.1839.3.dta 9 1 IPI00021405.3 Isoform A of Lamin-A/C 694 74380 20 20 19 19 6143 455 1 1 1 506.9096 1517.707 3 1517.707 0 0 50.94 0.0001 R ASSHSSQTQGGGSVTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1076.1076.3.dta 9 1 IPI00021405.3 Isoform A of Lamin-A/C 694 74380 20 20 19 19 6144 461 1 1 1 759.8609 1517.7073 2 1517.707 0.0002 0 75.85 7.70E-08 R ASSHSSQTQGGGSVTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1082.1082.2.dta 9 1 IPI00021405.3 Isoform A of Lamin-A/C 694 74380 20 20 19 19 6402 4254 1 1 1 783.8775 1565.7405 2 1565.7434 -0.003 0 101.77 2.90E-10 R SVGGSGGGSFGDNLVTR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5216.5216.2.dta 9 1 IPI00021405.3 Isoform A of Lamin-A/C 694 74380 20 20 19 19 6642 3816 1 1 1 803.4093 1604.8041 2 1604.8046 -0.0005 1 55.75 5.90E-06 R VAVEEVDEEGKFVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4741.4741.2.dta 9 1 IPI00021405.3 Isoform A of Lamin-A/C 694 74380 20 20 19 19 6903 7432 1 1 1 549.6073 1645.8001 3 1645.802 -0.0019 1 19.91 0.014 R ASSHSSQTQGGGSVTKK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.843.843.3.dta 9 1 IPI00021405.3 Isoform A of Lamin-A/C 694 74380 20 20 19 19 7380 8385 1 1 1 577.9501 1730.8286 3 1730.8296 -0.001 1 46.44 7.90E-05 R GRASSHSSQTQGGGSVTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.982.982.3.dta 9 IPI00644087.1 Progerin 611 69492 19 19 18 18 1331 2896 1 0 1 451.2536 900.4926 2 900.4916 0.001 0 25.84 0.045 K LEAALGEAK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3739.3739.2.dta 9 IPI00644087.1 Progerin 611 69492 19 19 18 18 1459 967 1 0 1 460.2228 918.4311 2 918.4308 0.0003 0 57.76 2.90E-05 R SSFSQHAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1629.1629.2.dta 9 IPI00644087.1 Progerin 611 69492 19 19 18 18 1683 660 1 0 1 475.2508 948.4871 2 948.4876 -0.0005 1 43.22 0.00046 R KLESTESR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1296.1296.2.dta 9 IPI00644087.1 Progerin 611 69492 19 19 18 18 2294 4828 1 0 1 514.7904 1027.5663 2 1027.5662 0.0001 0 62.98 8.40E-06 R LADALQELR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5834.5834.2.dta 9 IPI00644087.1 Progerin 611 69492 19 19 18 18 2408 3171 1 0 1 522.2776 1042.5407 2 1042.5407 0 0 66.99 1.50E-06 K EGDLIAAQAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4042.4042.2.dta 9 IPI00644087.1 Progerin 611 69492 19 19 18 18 2772 2927 1 0 1 545.2798 1088.5451 2 1088.5462 -0.001 0 63.35 1.20E-05 R SLETENAGLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3773.3773.2.dta 9 IPI00644087.1 Progerin 611 69492 19 19 18 18 3342 3353 1 0 1 583.2768 1164.539 2 1164.5411 -0.002 0 82.06 1.10E-07 K AAYEAELGDAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4241.4241.2.dta 9 IPI00644087.1 Progerin 611 69492 19 19 18 18 3519 3812 1 0 1 396.5513 1186.6322 3 1186.6306 0.0016 1 48.95 0.00026 K LRDLEDSLAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4737.4737.3.dta 9 IPI00644087.1 Progerin 611 69492 19 19 18 18 4035 3270 1 0 1 622.336 1242.6574 2 1242.6568 0.0007 1 26.58 0.0058 K LLEGEEERLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4151.4151.2.dta 9 IPI00644087.1 Progerin 611 69492 19 19 18 18 5060 3427 1 0 1 682.3114 1362.6083 2 1362.6099 -0.0016 0 67.5 4.70E-07 K AQNTWGCGNSLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4321.4321.2.dta 9 IPI00644087.1 Progerin 611 69492 19 19 18 18 5186 3355 1 0 1 691.3491 1380.6837 2 1380.6885 -0.0048 1 43.85 9.20E-05 K NIYSEELRETK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4243.4243.2.dta 9 IPI00644087.1 Progerin 611 69492 19 19 18 18 5406 2365 1 0 1 703.8236 1405.6327 2 1405.633 -0.0003 0 61.27 7.90E-06 R TVLCGTCGQPADK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3143.3143.2.dta 9 IPI00644087.1 Progerin 611 69492 19 19 18 18 5574 5361 1 0 1 715.8951 1429.7757 2 1429.7776 -0.0019 0 44.4 0.00023 R IDSLSAQLSQLQK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6377.6377.2.dta 9 IPI00644087.1 Progerin 611 69492 19 19 18 18 6065 1161 1 0 1 501.5788 1501.7147 3 1501.7161 -0.0014 1 39.64 0.00019 R AQHEDQVEQYKK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1839.1839.3.dta 9 IPI00644087.1 Progerin 611 69492 19 19 18 18 6143 455 1 0 1 506.9096 1517.707 3 1517.707 0 0 50.94 0.0001 R ASSHSSQTQGGGSVTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1076.1076.3.dta 9 IPI00644087.1 Progerin 611 69492 19 19 18 18 6144 461 1 0 1 759.8609 1517.7073 2 1517.707 0.0002 0 75.85 7.70E-08 R ASSHSSQTQGGGSVTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1082.1082.2.dta 9 IPI00644087.1 Progerin 611 69492 19 19 18 18 6642 3816 1 0 1 803.4093 1604.8041 2 1604.8046 -0.0005 1 55.75 5.90E-06 R VAVEEVDEEGKFVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4741.4741.2.dta 9 IPI00644087.1 Progerin 611 69492 19 19 18 18 6903 7432 1 0 1 549.6073 1645.8001 3 1645.802 -0.0019 1 19.91 0.014 R ASSHSSQTQGGGSVTKK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.843.843.3.dta 9 IPI00644087.1 Progerin 611 69492 19 19 18 18 7380 8385 1 0 1 577.9501 1730.8286 3 1730.8296 -0.001 1 46.44 7.90E-05 R GRASSHSSQTQGGGSVTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.982.982.3.dta 9 IPI00216952.1 Isoform C of Lamin-A/C 573 65153 18 18 17 17 1331 2896 1 0 1 451.2536 900.4926 2 900.4916 0.001 0 25.84 0.045 K LEAALGEAK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3739.3739.2.dta 9 IPI00216952.1 Isoform C of Lamin-A/C 573 65153 18 18 17 17 1459 967 1 0 1 460.2228 918.4311 2 918.4308 0.0003 0 57.76 2.90E-05 R SSFSQHAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1629.1629.2.dta 9 IPI00216952.1 Isoform C of Lamin-A/C 573 65153 18 18 17 17 1683 660 1 0 1 475.2508 948.4871 2 948.4876 -0.0005 1 43.22 0.00046 R KLESTESR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1296.1296.2.dta 9 IPI00216952.1 Isoform C of Lamin-A/C 573 65153 18 18 17 17 2294 4828 1 0 1 514.7904 1027.5663 2 1027.5662 0.0001 0 62.98 8.40E-06 R LADALQELR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5834.5834.2.dta 9 IPI00216952.1 Isoform C of Lamin-A/C 573 65153 18 18 17 17 2408 3171 1 0 1 522.2776 1042.5407 2 1042.5407 0 0 66.99 1.50E-06 K EGDLIAAQAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4042.4042.2.dta 9 IPI00216952.1 Isoform C of Lamin-A/C 573 65153 18 18 17 17 2772 2927 1 0 1 545.2798 1088.5451 2 1088.5462 -0.001 0 63.35 1.20E-05 R SLETENAGLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3773.3773.2.dta 9 IPI00216952.1 Isoform C of Lamin-A/C 573 65153 18 18 17 17 3342 3353 1 0 1 583.2768 1164.539 2 1164.5411 -0.002 0 82.06 1.10E-07 K AAYEAELGDAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4241.4241.2.dta 9 IPI00216952.1 Isoform C of Lamin-A/C 573 65153 18 18 17 17 3519 3812 1 0 1 396.5513 1186.6322 3 1186.6306 0.0016 1 48.95 0.00026 K LRDLEDSLAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4737.4737.3.dta 9 IPI00216952.1 Isoform C of Lamin-A/C 573 65153 18 18 17 17 4035 3270 1 0 1 622.336 1242.6574 2 1242.6568 0.0007 1 26.58 0.0058 K LLEGEEERLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4151.4151.2.dta 9 IPI00216952.1 Isoform C of Lamin-A/C 573 65153 18 18 17 17 5060 3427 1 0 1 682.3114 1362.6083 2 1362.6099 -0.0016 0 67.5 4.70E-07 K AQNTWGCGNSLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4321.4321.2.dta 9 IPI00216952.1 Isoform C of Lamin-A/C 573 65153 18 18 17 17 5186 3355 1 0 1 691.3491 1380.6837 2 1380.6885 -0.0048 1 43.85 9.20E-05 K NIYSEELRETK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4243.4243.2.dta 9 IPI00216952.1 Isoform C of Lamin-A/C 573 65153 18 18 17 17 5574 5361 1 0 1 715.8951 1429.7757 2 1429.7776 -0.0019 0 44.4 0.00023 R IDSLSAQLSQLQK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6377.6377.2.dta 9 IPI00216952.1 Isoform C of Lamin-A/C 573 65153 18 18 17 17 6065 1161 1 0 1 501.5788 1501.7147 3 1501.7161 -0.0014 1 39.64 0.00019 R AQHEDQVEQYKK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1839.1839.3.dta 9 IPI00216952.1 Isoform C of Lamin-A/C 573 65153 18 18 17 17 6143 455 1 0 1 506.9096 1517.707 3 1517.707 0 0 50.94 0.0001 R ASSHSSQTQGGGSVTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1076.1076.3.dta 9 IPI00216952.1 Isoform C of Lamin-A/C 573 65153 18 18 17 17 6144 461 1 0 1 759.8609 1517.7073 2 1517.707 0.0002 0 75.85 7.70E-08 R ASSHSSQTQGGGSVTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1082.1082.2.dta 9 IPI00216952.1 Isoform C of Lamin-A/C 573 65153 18 18 17 17 6642 3816 1 0 1 803.4093 1604.8041 2 1604.8046 -0.0005 1 55.75 5.90E-06 R VAVEEVDEEGKFVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4741.4741.2.dta 9 IPI00216952.1 Isoform C of Lamin-A/C 573 65153 18 18 17 17 6903 7432 1 0 1 549.6073 1645.8001 3 1645.802 -0.0019 1 19.91 0.014 R ASSHSSQTQGGGSVTKK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.843.843.3.dta 9 IPI00216952.1 Isoform C of Lamin-A/C 573 65153 18 18 17 17 7380 8385 1 0 1 577.9501 1730.8286 3 1730.8296 -0.001 1 46.44 7.90E-05 R GRASSHSSQTQGGGSVTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.982.982.3.dta 9 IPI00514204.3 Lamin A/C 483 53219 16 16 15 15 1331 2896 1 0 1 451.2536 900.4926 2 900.4916 0.001 0 25.84 0.045 K LEAALGEAK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3739.3739.2.dta 9 IPI00514204.3 Lamin A/C 483 53219 16 16 15 15 1459 967 1 0 1 460.2228 918.4311 2 918.4308 0.0003 0 57.76 2.90E-05 R SSFSQHAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1629.1629.2.dta 9 IPI00514204.3 Lamin A/C 483 53219 16 16 15 15 1683 660 1 0 1 475.2508 948.4871 2 948.4876 -0.0005 1 43.22 0.00046 R KLESTESR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1296.1296.2.dta 9 IPI00514204.3 Lamin A/C 483 53219 16 16 15 15 2294 4828 1 0 1 514.7904 1027.5663 2 1027.5662 0.0001 0 62.98 8.40E-06 R LADALQELR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5834.5834.2.dta 9 IPI00514204.3 Lamin A/C 483 53219 16 16 15 15 2408 3171 1 0 1 522.2776 1042.5407 2 1042.5407 0 0 66.99 1.50E-06 K EGDLIAAQAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4042.4042.2.dta 9 IPI00514204.3 Lamin A/C 483 53219 16 16 15 15 2772 2927 1 0 1 545.2798 1088.5451 2 1088.5462 -0.001 0 63.35 1.20E-05 R SLETENAGLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3773.3773.2.dta 9 IPI00514204.3 Lamin A/C 483 53219 16 16 15 15 3342 3353 1 0 1 583.2768 1164.539 2 1164.5411 -0.002 0 82.06 1.10E-07 K AAYEAELGDAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4241.4241.2.dta 9 IPI00514204.3 Lamin A/C 483 53219 16 16 15 15 3519 3812 1 0 1 396.5513 1186.6322 3 1186.6306 0.0016 1 48.95 0.00026 K LRDLEDSLAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4737.4737.3.dta 9 IPI00514204.3 Lamin A/C 483 53219 16 16 15 15 4035 3270 1 0 1 622.336 1242.6574 2 1242.6568 0.0007 1 26.58 0.0058 K LLEGEEERLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4151.4151.2.dta 9 IPI00514204.3 Lamin A/C 483 53219 16 16 15 15 5186 3355 1 0 1 691.3491 1380.6837 2 1380.6885 -0.0048 1 43.85 9.20E-05 K NIYSEELRETK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4243.4243.2.dta 9 IPI00514204.3 Lamin A/C 483 53219 16 16 15 15 5574 5361 1 0 1 715.8951 1429.7757 2 1429.7776 -0.0019 0 44.4 0.00023 R IDSLSAQLSQLQK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6377.6377.2.dta 9 IPI00514204.3 Lamin A/C 483 53219 16 16 15 15 6065 1161 1 0 1 501.5788 1501.7147 3 1501.7161 -0.0014 1 39.64 0.00019 R AQHEDQVEQYKK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1839.1839.3.dta 9 IPI00514204.3 Lamin A/C 483 53219 16 16 15 15 6143 455 1 0 1 506.9096 1517.707 3 1517.707 0 0 50.94 0.0001 R ASSHSSQTQGGGSVTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1076.1076.3.dta 9 IPI00514204.3 Lamin A/C 483 53219 16 16 15 15 6144 461 1 0 1 759.8609 1517.7073 2 1517.707 0.0002 0 75.85 7.70E-08 R ASSHSSQTQGGGSVTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1082.1082.2.dta 9 IPI00514204.3 Lamin A/C 483 53219 16 16 15 15 6903 7432 1 0 1 549.6073 1645.8001 3 1645.802 -0.0019 1 19.91 0.014 R ASSHSSQTQGGGSVTKK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.843.843.3.dta 9 IPI00514204.3 Lamin A/C 483 53219 16 16 15 15 7380 8385 1 0 1 577.9501 1730.8286 3 1730.8296 -0.001 1 46.44 7.90E-05 R GRASSHSSQTQGGGSVTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.982.982.3.dta 9 IPI00514320.3 Lamin A/C 478 57897 16 16 15 15 1331 2896 1 0 1 451.2536 900.4926 2 900.4916 0.001 0 25.84 0.045 K LEAALGEAK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3739.3739.2.dta 9 IPI00514320.3 Lamin A/C 478 57897 16 16 15 15 1459 967 1 0 1 460.2228 918.4311 2 918.4308 0.0003 0 57.76 2.90E-05 R SSFSQHAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1629.1629.2.dta 9 IPI00514320.3 Lamin A/C 478 57897 16 16 15 15 1683 660 1 0 1 475.2508 948.4871 2 948.4876 -0.0005 1 43.22 0.00046 R KLESTESR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1296.1296.2.dta 9 IPI00514320.3 Lamin A/C 478 57897 16 16 15 15 2294 4828 1 0 1 514.7904 1027.5663 2 1027.5662 0.0001 0 62.98 8.40E-06 R LADALQELR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5834.5834.2.dta 9 IPI00514320.3 Lamin A/C 478 57897 16 16 15 15 2408 3171 1 0 1 522.2776 1042.5407 2 1042.5407 0 0 66.99 1.50E-06 K EGDLIAAQAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4042.4042.2.dta 9 IPI00514320.3 Lamin A/C 478 57897 16 16 15 15 3519 3812 1 0 1 396.5513 1186.6322 3 1186.6306 0.0016 1 48.95 0.00026 K LRDLEDSLAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4737.4737.3.dta 9 IPI00514320.3 Lamin A/C 478 57897 16 16 15 15 4035 3270 1 0 1 622.336 1242.6574 2 1242.6568 0.0007 1 26.58 0.0058 K LLEGEEERLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4151.4151.2.dta 9 IPI00514320.3 Lamin A/C 478 57897 16 16 15 15 5060 3427 1 0 1 682.3114 1362.6083 2 1362.6099 -0.0016 0 67.5 4.70E-07 K AQNTWGCGNSLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4321.4321.2.dta 9 IPI00514320.3 Lamin A/C 478 57897 16 16 15 15 5186 3355 1 0 1 691.3491 1380.6837 2 1380.6885 -0.0048 1 43.85 9.20E-05 K NIYSEELRETK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4243.4243.2.dta 9 IPI00514320.3 Lamin A/C 478 57897 16 16 15 15 5574 5361 1 0 1 715.8951 1429.7757 2 1429.7776 -0.0019 0 44.4 0.00023 R IDSLSAQLSQLQK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6377.6377.2.dta 9 IPI00514320.3 Lamin A/C 478 57897 16 16 15 15 6065 1161 1 0 1 501.5788 1501.7147 3 1501.7161 -0.0014 1 39.64 0.00019 R AQHEDQVEQYKK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1839.1839.3.dta 9 IPI00514320.3 Lamin A/C 478 57897 16 16 15 15 6143 455 1 0 1 506.9096 1517.707 3 1517.707 0 0 50.94 0.0001 R ASSHSSQTQGGGSVTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1076.1076.3.dta 9 IPI00514320.3 Lamin A/C 478 57897 16 16 15 15 6144 461 1 0 1 759.8609 1517.7073 2 1517.707 0.0002 0 75.85 7.70E-08 R ASSHSSQTQGGGSVTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1082.1082.2.dta 9 IPI00514320.3 Lamin A/C 478 57897 16 16 15 15 6642 3816 1 0 1 803.4093 1604.8041 2 1604.8046 -0.0005 1 55.75 5.90E-06 R VAVEEVDEEGKFVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4741.4741.2.dta 9 IPI00514320.3 Lamin A/C 478 57897 16 16 15 15 6903 7432 1 0 1 549.6073 1645.8001 3 1645.802 -0.0019 1 19.91 0.014 R ASSHSSQTQGGGSVTKK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.843.843.3.dta 9 IPI00514320.3 Lamin A/C 478 57897 16 16 15 15 7380 8385 1 0 1 577.9501 1730.8286 3 1730.8296 -0.001 1 46.44 7.90E-05 R GRASSHSSQTQGGGSVTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.982.982.3.dta 10 1 IPI00450768.7 "Keratin, type I cytoskeletal 17" 636 48361 23 23 21 21 344 4464 1 1 0 350.7345 699.4544 2 699.4531 0.0014 0 26.96 0.0066 K ILLDVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5443.5443.2.dta 10 1 IPI00450768.7 "Keratin, type I cytoskeletal 17" 636 48361 23 23 21 21 794 3389 1 1 0 404.2036 806.3927 2 806.3923 0.0004 0 29.47 0.027 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4280.4280.2.dta 10 1 IPI00450768.7 "Keratin, type I cytoskeletal 17" 636 48361 23 23 21 21 807 3174 1 1 0 405.2239 808.4333 2 808.433 0.0002 0 28.79 0.013 R LASYLDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4046.4046.2.dta 10 1 IPI00450768.7 "Keratin, type I cytoskeletal 17" 636 48361 23 23 21 21 1467 1014 1 1 1 461.2231 920.4316 2 920.4312 0.0004 0 47.6 0.00035 K GSSGLGGGSSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1680.1680.2.dta 10 1 IPI00450768.7 "Keratin, type I cytoskeletal 17" 636 48361 23 23 21 21 1935 2311 1 1 1 492.7535 983.4925 2 983.4924 0.0001 0 36.42 0.0012 R QFTSSSSIK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3085.3085.2.dta 10 1 IPI00450768.7 "Keratin, type I cytoskeletal 17" 636 48361 23 23 21 21 2020 3405 1 1 1 497.7163 993.4181 2 993.4192 -0.0011 0 23.95 0.0057 R DYSQYYR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4297.4297.2.dta 10 1 IPI00450768.7 "Keratin, type I cytoskeletal 17" 636 48361 23 23 21 21 2059 8246 1 1 1 499.7542 997.4939 2 997.4941 -0.0002 0 41.5 0.00073 R EQVHQTTR - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.954.954.2.dta 10 1 IPI00450768.7 "Keratin, type I cytoskeletal 17" 636 48361 23 23 21 21 2342 2274 1 1 1 517.7559 1033.4973 2 1033.4975 -0.0002 0 70.56 1.60E-06 R LSGGLGAGSCR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3045.3045.2.dta 10 1 IPI00450768.7 "Keratin, type I cytoskeletal 17" 636 48361 23 23 21 21 2357 3201 1 1 0 518.769 1035.5235 2 1035.525 -0.0015 1 32.37 0.0029 K IRDWYQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4075.4075.2.dta 10 1 IPI00450768.7 "Keratin, type I cytoskeletal 17" 636 48361 23 23 21 21 2359 2756 1 1 0 518.7756 1035.5367 2 1035.5349 0.0018 1 19.85 0.043 R LAADDFRTK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3572.3572.2.dta 10 1 IPI00450768.7 "Keratin, type I cytoskeletal 17" 636 48361 23 23 21 21 2535 2211 1 1 1 531.7527 1061.4909 2 1061.4924 -0.0014 0 40.64 0.0015 K ATMQNLNDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2976.2976.2.dta 10 1 IPI00450768.7 "Keratin, type I cytoskeletal 17" 636 48361 23 23 21 21 2556 3525 1 1 0 532.809 1063.6034 2 1063.6026 0.0008 1 45.25 0.00012 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4427.4427.2.dta 10 1 IPI00450768.7 "Keratin, type I cytoskeletal 17" 636 48361 23 23 21 21 2665 1165 1 1 1 539.7504 1077.4862 2 1077.4873 -0.0011 0 57.64 2.40E-05 K ATMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1843.1843.2.dta 10 1 IPI00450768.7 "Keratin, type I cytoskeletal 17" 636 48361 23 23 21 21 3015 3345 1 1 0 561.7913 1121.5681 2 1121.5717 -0.0036 0 42.75 0.00042 R LEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4232.4232.2.dta 10 1 IPI00450768.7 "Keratin, type I cytoskeletal 17" 636 48361 23 23 21 21 3173 6683 1 1 1 572.7507 1143.4868 2 1143.4873 -0.0005 0 56.34 5.20E-06 K DAEDWFFSK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7688.7688.2.dta 10 1 IPI00450768.7 "Keratin, type I cytoskeletal 17" 636 48361 23 23 21 21 3838 2708 1 1 0 408.2193 1221.636 3 1221.6353 0.0006 1 48.97 0.00031 R TKFETEQALR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3517.3517.3.dta 10 1 IPI00450768.7 "Keratin, type I cytoskeletal 17" 636 48361 23 23 21 21 4901 3834 1 1 1 673.3468 1344.6791 2 1344.6772 0.0018 0 83.75 4.00E-08 R ALEEANTELEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4761.4761.2.dta 10 1 IPI00450768.7 "Keratin, type I cytoskeletal 17" 636 48361 23 23 21 21 5045 2608 1 1 0 681.3479 1360.6812 2 1360.6834 -0.0022 0 91.16 5.90E-09 R EVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3409.3409.2.dta 10 1 IPI00450768.7 "Keratin, type I cytoskeletal 17" 636 48361 23 23 21 21 5174 3996 1 1 0 690.3662 1378.7179 2 1378.7204 -0.0026 1 29.99 0.0046 K TRLEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4936.4936.2.dta 10 1 IPI00450768.7 "Keratin, type I cytoskeletal 17" 636 48361 23 23 21 21 5372 3572 1 1 1 702.3408 1402.667 2 1402.6688 -0.0018 0 88.18 2.10E-08 K ASLEGNLAETENR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4478.4478.2.dta 10 1 IPI00450768.7 "Keratin, type I cytoskeletal 17" 636 48361 23 23 21 21 6970 4078 1 1 1 830.4471 1658.8797 2 1658.8839 -0.0042 1 86.5 7.80E-09 R TIVEEVQDGKVISSR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5025.5025.2.dta 10 1 IPI00450768.7 "Keratin, type I cytoskeletal 17" 636 48361 23 23 21 21 6971 4062 1 1 1 553.9678 1658.8815 3 1658.8839 -0.0024 1 26.45 0.028 R TIVEEVQDGKVISSR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5008.5008.3.dta 10 1 IPI00450768.7 "Keratin, type I cytoskeletal 17" 636 48361 23 23 21 21 8142 3613 1 1 0 702.0205 2103.0397 3 2103.0444 -0.0047 1 47.2 3.70E-05 K TEELNREVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4522.4522.3.dta 10 2 IPI00019359.3 "Keratin, type I cytoskeletal 9" 610 62320 19 19 15 15 807 3174 1 0 0 405.2239 808.4333 2 808.433 0.0002 0 28.79 0.013 R LASYLDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4046.4046.2.dta 10 2 IPI00019359.3 "Keratin, type I cytoskeletal 9" 610 62320 19 19 15 15 1420 3791 1 0 1 457.2077 912.4009 2 912.4011 -0.0003 0 31.42 0.0041 R MTLDDFR I Oxidation (M) 0.1000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4714.4714.2.dta 10 2 IPI00019359.3 "Keratin, type I cytoskeletal 9" 610 62320 19 19 15 15 1780 863 1 0 1 481.7484 961.4822 2 961.4828 -0.0006 1 36.74 0.0059 K SLEDTKNR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1516.1516.2.dta 10 2 IPI00019359.3 "Keratin, type I cytoskeletal 9" 610 62320 19 19 15 15 2528 4711 1 0 1 530.7854 1059.5562 2 1059.556 0.0002 0 49.95 0.00026 K TLLDIDNTR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5710.5710.2.dta 10 2 IPI00019359.3 "Keratin, type I cytoskeletal 9" 610 62320 19 19 15 15 2697 1352 1 0 1 541.2501 1080.4857 2 1080.487 -0.0013 0 60.32 1.10E-05 K STMQELNSR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2046.2046.2.dta 10 2 IPI00019359.3 "Keratin, type I cytoskeletal 9" 610 62320 19 19 15 15 2998 3895 1 0 1 561.2958 1120.577 2 1120.5764 0.0006 0 34.51 0.008 R QEYEQLIAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4827.4827.2.dta 10 2 IPI00019359.3 "Keratin, type I cytoskeletal 9" 610 62320 19 19 15 15 3541 4490 1 0 1 595.8094 1189.6043 2 1189.6013 0.0031 0 23.79 0.015 R QVLDNLTMEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5471.5471.2.dta 10 2 IPI00019359.3 "Keratin, type I cytoskeletal 9" 610 62320 19 19 15 15 3711 3887 1 0 1 603.8057 1205.5969 2 1205.5962 0.0007 0 45.09 6.80E-05 R QVLDNLTMEK S Oxidation (M) 0.0000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4818.4818.2.dta 10 2 IPI00019359.3 "Keratin, type I cytoskeletal 9" 610 62320 19 19 15 15 3918 2333 1 0 1 616.8019 1231.5892 2 1231.5906 -0.0014 0 118.22 1.70E-11 R SGGGGGGGLGSGGSIR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3108.3108.2.dta 10 2 IPI00019359.3 "Keratin, type I cytoskeletal 9" 610 62320 19 19 15 15 3957 1931 1 0 1 618.2672 1234.5198 2 1234.5215 -0.0017 0 67.66 7.70E-07 R FSSSSGYGGGSSR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2673.2673.2.dta 10 2 IPI00019359.3 "Keratin, type I cytoskeletal 9" 610 62320 19 19 15 15 3958 1783 1 0 1 618.268 1234.5215 2 1234.5215 0 0 65.97 6.50E-07 R FSSSSGYGGGSSR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2513.2513.2.dta 10 2 IPI00019359.3 "Keratin, type I cytoskeletal 9" 610 62320 19 19 15 15 4716 3181 1 0 1 662.3387 1322.6629 2 1322.6652 -0.0023 1 41.77 0.00075 R IKFEMEQNLR Q Oxidation (M) 0.0000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4053.4053.2.dta 10 2 IPI00019359.3 "Keratin, type I cytoskeletal 9" 610 62320 19 19 15 15 4717 3187 1 0 1 441.8958 1322.6657 3 1322.6652 0.0005 1 35.48 0.002 R IKFEMEQNLR Q Oxidation (M) 0.0000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4060.4060.3.dta 10 2 IPI00019359.3 "Keratin, type I cytoskeletal 9" 610 62320 19 19 15 15 6569 3715 1 0 1 793.8867 1585.7589 2 1585.7583 0.0006 0 85.62 9.40E-09 K VQALEEANNDLENK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4632.4632.2.dta 10 2 IPI00019359.3 "Keratin, type I cytoskeletal 9" 610 62320 19 19 15 15 7564 1554 1 0 1 896.3669 1790.7192 2 1790.7205 -0.0013 0 89.12 2.00E-09 R GGSGGSYGGGGSGGGYGGGSGSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2265.2265.2.dta 10 2 IPI00019359.3 "Keratin, type I cytoskeletal 9" 610 62320 19 19 15 15 7565 1558 1 0 1 597.9138 1790.7196 3 1790.7205 -0.0009 0 39.84 0.00017 R GGSGGSYGGGGSGGGYGGGSGSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2269.2269.3.dta 10 2 IPI00019359.3 "Keratin, type I cytoskeletal 9" 610 62320 19 19 15 15 7776 4455 1 0 1 934.4614 1866.9082 2 1866.9145 -0.0063 1 35.92 0.00043 K TLNDMRQEYEQLIAK N Oxidation (M) 0.000010000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5433.5433.2.dta 10 2 IPI00019359.3 "Keratin, type I cytoskeletal 9" 610 62320 19 19 15 15 8395 5192 1 0 1 837.381 2509.1213 3 2509.1245 -0.0032 0 42.34 0.00011 K EIETYHNLLEGGQEDFESSGAGK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6209.6209.3.dta 10 2 IPI00019359.3 "Keratin, type I cytoskeletal 9" 610 62320 19 19 15 15 8502 2528 1 0 1 1075.0994 3222.2763 3 3222.2744 0.0019 0 31.71 0.00067 R GGSGGSHGGGSGFGGESGGSYGGGEEASGSGGGYGGGSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3322.3322.3.dta 10 3 IPI00009865.1 "Keratin, type I cytoskeletal 10" 555 59711 16 16 16 16 794 3389 1 0 0 404.2036 806.3927 2 806.3923 0.0004 0 29.47 0.027 R LAADDFR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4280.4280.2.dta 10 3 IPI00009865.1 "Keratin, type I cytoskeletal 10" 555 59711 16 16 16 16 807 3174 1 0 0 405.2239 808.4333 2 808.433 0.0002 0 28.79 0.013 R LASYLDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4046.4046.2.dta 10 3 IPI00009865.1 "Keratin, type I cytoskeletal 10" 555 59711 16 16 16 16 2013 3123 1 0 1 497.2536 992.4927 2 992.4927 0 0 49.4 4.30E-05 K YENEVALR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3989.3989.2.dta 10 3 IPI00009865.1 "Keratin, type I cytoskeletal 10" 555 59711 16 16 16 16 2556 3525 1 0 0 532.809 1063.6034 2 1063.6026 0.0008 1 45.25 0.00012 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4427.4427.2.dta 10 3 IPI00009865.1 "Keratin, type I cytoskeletal 10" 555 59711 16 16 16 16 2869 1482 1 0 0 553.7665 1105.5185 2 1105.5186 -0.0001 0 79.29 2.10E-07 K VTMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2187.2187.2.dta 10 3 IPI00009865.1 "Keratin, type I cytoskeletal 10" 555 59711 16 16 16 16 2891 5110 1 0 1 555.2475 1108.4804 2 1108.4825 -0.0021 0 45.13 0.00032 K DAEAWFNEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6126.6126.2.dta 10 3 IPI00009865.1 "Keratin, type I cytoskeletal 10" 555 59711 16 16 16 16 2967 6098 1 0 1 559.7575 1117.5005 2 1117.5013 -0.0008 0 26.34 0.0038 K HGNSHQGEPR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.711.711.2.dta 10 3 IPI00009865.1 "Keratin, type I cytoskeletal 10" 555 59711 16 16 16 16 3346 3262 1 0 1 583.2962 1164.5779 2 1164.5775 0.0004 0 43.08 0.00077 R LENEIQTYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4142.4142.2.dta 10 3 IPI00009865.1 "Keratin, type I cytoskeletal 10" 555 59711 16 16 16 16 3639 4407 1 0 1 601.312 1200.6095 2 1200.6098 -0.0004 0 19.48 0.015 R QSVEADINGLR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5380.5380.2.dta 10 3 IPI00009865.1 "Keratin, type I cytoskeletal 10" 555 59711 16 16 16 16 4218 3007 1 0 1 631.8008 1261.5871 2 1261.5899 -0.0027 0 59.75 1.70E-05 R SLLEGEGSSGGGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3859.3859.2.dta 10 3 IPI00009865.1 "Keratin, type I cytoskeletal 10" 555 59711 16 16 16 16 5185 3569 1 0 1 691.3275 1380.6404 2 1380.6408 -0.0005 0 91.26 2.80E-09 R ALEESNYELEGK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4475.4475.2.dta 10 3 IPI00009865.1 "Keratin, type I cytoskeletal 10" 555 59711 16 16 16 16 5600 3985 1 0 1 717.8875 1433.7605 2 1433.7626 -0.0022 1 39.37 0.0011 K IRLENEIQTYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4924.4924.2.dta 10 3 IPI00009865.1 "Keratin, type I cytoskeletal 10" 555 59711 16 16 16 16 6029 2266 1 0 1 747.3698 1492.725 2 1492.727 -0.002 1 52.05 1.40E-05 R SQYEQLAEQNRK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3036.3036.2.dta 10 3 IPI00009865.1 "Keratin, type I cytoskeletal 10" 555 59711 16 16 16 16 6309 2262 1 0 1 775.3409 1548.6672 2 1548.67 -0.0028 0 128.17 7.90E-13 R SGGGGGGGGCGGGGGVSSLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3032.3032.2.dta 10 3 IPI00009865.1 "Keratin, type I cytoskeletal 10" 555 59711 16 16 16 16 7283 5138 1 0 1 854.3887 1706.7629 2 1706.7649 -0.002 0 87.28 6.60E-09 K GSLGGGFSSGGFSGGSFSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6155.6155.2.dta 10 3 IPI00009865.1 "Keratin, type I cytoskeletal 10" 555 59711 16 16 16 16 8131 5745 1 0 1 1041.9852 2081.9559 2 2081.9575 -0.0016 0 33.01 0.0011 R AETECQNTEYQQLLDIK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6757.6757.2.dta 10 4 IPI00384444.5 "Keratin, type I cytoskeletal 14" 513 51875 19 19 19 19 344 4464 1 0 0 350.7345 699.4544 2 699.4531 0.0014 0 26.96 0.0066 K ILLDVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5443.5443.2.dta 10 4 IPI00384444.5 "Keratin, type I cytoskeletal 14" 513 51875 19 19 19 19 794 3389 1 0 0 404.2036 806.3927 2 806.3923 0.0004 0 29.47 0.027 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4280.4280.2.dta 10 4 IPI00384444.5 "Keratin, type I cytoskeletal 14" 513 51875 19 19 19 19 807 3174 1 0 0 405.2239 808.4333 2 808.433 0.0002 0 28.79 0.013 R LASYLDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4046.4046.2.dta 10 4 IPI00384444.5 "Keratin, type I cytoskeletal 14" 513 51875 19 19 19 19 2220 1121 1 0 0 509.7289 1017.4433 2 1017.4437 -0.0004 0 22.78 0.018 R QFTSSSSMK G Oxidation (M) 0.000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1795.1795.2.dta 10 4 IPI00384444.5 "Keratin, type I cytoskeletal 14" 513 51875 19 19 19 19 2357 3201 1 0 0 518.769 1035.5235 2 1035.525 -0.0015 1 32.37 0.0029 K IRDWYQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4075.4075.2.dta 10 4 IPI00384444.5 "Keratin, type I cytoskeletal 14" 513 51875 19 19 19 19 2359 2756 1 0 0 518.7756 1035.5367 2 1035.5349 0.0018 1 19.85 0.043 R LAADDFRTK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3572.3572.2.dta 10 4 IPI00384444.5 "Keratin, type I cytoskeletal 14" 513 51875 19 19 19 19 2556 3525 1 0 0 532.809 1063.6034 2 1063.6026 0.0008 1 45.25 0.00012 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4427.4427.2.dta 10 4 IPI00384444.5 "Keratin, type I cytoskeletal 14" 513 51875 19 19 19 19 2869 1482 1 0 0 553.7665 1105.5185 2 1105.5186 -0.0001 0 79.29 2.10E-07 K VTMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2187.2187.2.dta 10 4 IPI00384444.5 "Keratin, type I cytoskeletal 14" 513 51875 19 19 19 19 2872 3128 1 0 0 553.7843 1105.5541 2 1105.555 -0.0009 0 65.05 8.00E-06 R ISSVLAGGSCR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3995.3995.2.dta 10 4 IPI00384444.5 "Keratin, type I cytoskeletal 14" 513 51875 19 19 19 19 3015 3345 1 0 0 561.7913 1121.5681 2 1121.5717 -0.0036 0 42.75 0.00042 R LEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4232.4232.2.dta 10 4 IPI00384444.5 "Keratin, type I cytoskeletal 14" 513 51875 19 19 19 19 3412 6552 1 0 1 586.7667 1171.5188 2 1171.5186 0.0002 0 46.35 4.70E-05 K DAEEWFFTK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7559.7559.2.dta 10 4 IPI00384444.5 "Keratin, type I cytoskeletal 14" 513 51875 19 19 19 19 4244 3556 1 0 1 633.8367 1265.6588 2 1265.6615 -0.0027 1 28.3 0.023 R TKYETELNLR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4460.4460.2.dta 10 4 IPI00384444.5 "Keratin, type I cytoskeletal 14" 513 51875 19 19 19 19 4347 2669 1 0 0 639.795 1277.5754 2 1277.5783 -0.0029 0 73.79 5.20E-07 K GSCGIGGGIGGGSSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3475.3475.2.dta 10 4 IPI00384444.5 "Keratin, type I cytoskeletal 14" 513 51875 19 19 19 19 4541 3787 1 0 0 651.3328 1300.651 2 1300.651 0 0 79.99 1.90E-07 R ALEEANADLEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4710.4710.2.dta 10 4 IPI00384444.5 "Keratin, type I cytoskeletal 14" 513 51875 19 19 19 19 5045 2608 1 0 0 681.3479 1360.6812 2 1360.6834 -0.0022 0 91.16 5.90E-09 R EVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3409.3409.2.dta 10 4 IPI00384444.5 "Keratin, type I cytoskeletal 14" 513 51875 19 19 19 19 5174 3996 1 0 0 690.3662 1378.7179 2 1378.7204 -0.0026 1 29.99 0.0046 K TRLEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4936.4936.2.dta 10 4 IPI00384444.5 "Keratin, type I cytoskeletal 14" 513 51875 19 19 19 19 5528 3298 1 0 1 713.3515 1424.6885 2 1424.6896 -0.0011 0 57.17 7.10E-06 R APSTYGGGLSVSSSR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4181.4181.2.dta 10 4 IPI00384444.5 "Keratin, type I cytoskeletal 14" 513 51875 19 19 19 19 8142 3613 1 0 0 702.0205 2103.0397 3 2103.0444 -0.0047 1 47.2 3.70E-05 K TEELNREVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4522.4522.3.dta 10 4 IPI00384444.5 "Keratin, type I cytoskeletal 14" 513 51875 19 19 19 19 8264 3764 1 0 1 770.3578 2308.0517 3 2308.0567 -0.005 0 39.94 0.00025 R LLEGEDAHLSSSQFSSGSQSSR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4685.4685.3.dta 10 5 IPI00554788.4 49 kDa protein 511 48793 27 27 22 22 283 546 1 0 0 342.7116 683.4086 2 683.4079 0.0008 1 37.84 0.001 K KGPQVR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1173.1173.2.dta 10 5 IPI00554788.4 49 kDa protein 511 48793 27 27 22 22 412 3097 1 0 1 359.7001 717.3857 2 717.3843 0.0014 0 33.03 0.016 K IMADIR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3960.3960.2.dta 10 5 IPI00554788.4 49 kDa protein 511 48793 27 27 22 22 478 2316 1 0 1 367.6973 733.3801 2 733.3792 0.0009 0 39.96 0.0029 K IMADIR A Oxidation (M) 0.010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3090.3090.2.dta 10 5 IPI00554788.4 49 kDa protein 511 48793 27 27 22 22 794 3389 1 0 0 404.2036 806.3927 2 806.3923 0.0004 0 29.47 0.027 R LAADDFR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4280.4280.2.dta 10 5 IPI00554788.4 49 kDa protein 511 48793 27 27 22 22 1489 992 2 0 1 462.7673 923.5201 2 923.5188 0.0012 1 27.04 0.022 K IREHLEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1656.1656.2.dta 10 5 IPI00554788.4 49 kDa protein 511 48793 27 27 22 22 1807 2965 1 0 1 483.2379 964.4613 2 964.4614 -0.0001 0 35.45 0.0058 R AQYDELAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3814.3814.2.dta 10 5 IPI00554788.4 49 kDa protein 511 48793 27 27 22 22 2345 3637 1 0 1 517.7842 1033.5538 2 1033.5556 -0.0018 1 30.37 0.013 R LAADDFRVK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4548.4548.2.dta 10 5 IPI00554788.4 49 kDa protein 511 48793 27 27 22 22 2392 4339 1 0 0 521.3058 1040.5971 2 1040.5978 -0.0007 0 50.62 7.20E-05 R IVLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5307.5307.2.dta 10 5 IPI00554788.4 49 kDa protein 511 48793 27 27 22 22 2561 3838 1 0 1 533.2831 1064.5516 2 1064.5502 0.0014 0 48.83 7.80E-05 K LEAEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4765.4765.2.dta 10 5 IPI00554788.4 49 kDa protein 511 48793 27 27 22 22 2789 3608 1 0 1 546.8107 1091.6069 2 1091.6087 -0.0018 1 23.35 0.032 R LASYLDRVR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4517.4517.2.dta 10 5 IPI00554788.4 49 kDa protein 511 48793 27 27 22 22 2791 2432 1 0 1 547.2512 1092.4879 2 1092.487 0.0009 0 41.25 0.00085 K ETMQSLNDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3216.3216.2.dta 10 5 IPI00554788.4 49 kDa protein 511 48793 27 27 22 22 2797 2275 1 0 1 547.2849 1092.5553 2 1092.5563 -0.0011 1 36.94 0.0015 R AQYDELARK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3046.3046.2.dta 10 5 IPI00554788.4 49 kDa protein 511 48793 27 27 22 22 2857 1382 1 0 1 552.2931 1102.5716 2 1102.5731 -0.0014 1 21.78 0.035 R VRSLETENR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2078.2078.2.dta 10 5 IPI00554788.4 49 kDa protein 511 48793 27 27 22 22 3433 2410 1 0 1 587.8241 1173.6336 2 1173.6353 -0.0017 1 48.72 0.00029 R KVIDDTNITR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3192.3192.2.dta 10 5 IPI00554788.4 49 kDa protein 511 48793 27 27 22 22 3999 3504 1 0 1 620.3231 1238.6317 2 1238.6329 -0.0012 1 21.43 0.023 R VKYETELAMR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4404.4404.2.dta 10 5 IPI00554788.4 49 kDa protein 511 48793 27 27 22 22 4133 2678 1 0 1 628.3201 1254.6257 2 1254.6278 -0.0021 1 31.32 0.0019 R VKYETELAMR Q Oxidation (M) 0.0000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3484.3484.2.dta 10 5 IPI00554788.4 49 kDa protein 511 48793 27 27 22 22 4134 2672 1 0 1 419.2165 1254.6276 3 1254.6278 -0.0002 1 30.76 0.0071 R VKYETELAMR Q Oxidation (M) 0.0000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3478.3478.3.dta 10 5 IPI00554788.4 49 kDa protein 511 48793 27 27 22 22 4253 3243 1 0 1 634.3211 1266.6277 2 1266.6317 -0.004 0 42.02 0.00016 R QSVENDIHGLR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4120.4120.2.dta 10 5 IPI00554788.4 49 kDa protein 511 48793 27 27 22 22 4682 3979 1 0 1 660.3389 1318.6632 2 1318.6629 0.0002 0 83.84 3.30E-08 R AQIFANTVDNAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4918.4918.2.dta 10 5 IPI00554788.4 49 kDa protein 511 48793 27 27 22 22 5316 2578 1 0 1 698.3714 1394.7282 2 1394.7266 0.0016 1 22.54 0.0077 R QSVENDIHGLRK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3376.3376.2.dta 10 5 IPI00554788.4 49 kDa protein 511 48793 27 27 22 22 5479 5772 1 0 1 710.3779 1418.7413 2 1418.7405 0.0008 0 39.46 0.0023 R QAQEYEALLNIK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6784.6784.2.dta 10 5 IPI00554788.4 49 kDa protein 511 48793 27 27 22 22 5863 4456 1 0 1 491.9261 1472.7564 3 1472.7583 -0.0018 1 27.51 0.014 K ASLENSLREVEAR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5434.5434.3.dta 10 5 IPI00554788.4 49 kDa protein 511 48793 27 27 22 22 6079 2062 1 0 1 502.2668 1503.7785 3 1503.7781 0.0005 1 33.73 0.0014 R IVDGKVVSETNDTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2815.2815.3.dta 10 5 IPI00554788.4 49 kDa protein 511 48793 27 27 22 22 6088 6210 1 0 1 753.8766 1505.7387 2 1505.7395 -0.0008 0 92.84 1.00E-08 R TVQSLEIDLDSMR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7220.7220.2.dta 10 5 IPI00554788.4 49 kDa protein 511 48793 27 27 22 22 6171 5166 1 0 1 761.8735 1521.7325 2 1521.7345 -0.002 0 75.25 2.00E-07 R TVQSLEIDLDSMR N Oxidation (M) 0.0000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6182.6182.2.dta 10 5 IPI00554788.4 49 kDa protein 511 48793 27 27 22 22 8001 5356 1 0 1 654.3406 1959.9999 3 1960.0013 -0.0014 1 34.64 0.00062 R AEGQRQAQEYEALLNIK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6371.6371.3.dta 10 5 IPI00554788.4 49 kDa protein 511 48793 27 27 22 22 8002 5362 1 0 1 654.3408 1960.0004 3 1960.0013 -0.0009 1 27.83 0.0047 R AEGQRQAQEYEALLNIK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6378.6378.3.dta 10 6 IPI00217963.3 "Keratin, type I cytoskeletal 16" 331 51578 13 13 13 13 794 3389 1 0 0 404.2036 806.3927 2 806.3923 0.0004 0 29.47 0.027 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4280.4280.2.dta 10 6 IPI00217963.3 "Keratin, type I cytoskeletal 16" 331 51578 13 13 13 13 807 3174 1 0 0 405.2239 808.4333 2 808.433 0.0002 0 28.79 0.013 R LASYLDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4046.4046.2.dta 10 6 IPI00217963.3 "Keratin, type I cytoskeletal 16" 331 51578 13 13 13 13 2220 1121 1 0 0 509.7289 1017.4433 2 1017.4437 -0.0004 0 22.78 0.018 R QFTSSSSMK G Oxidation (M) 0.000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1795.1795.2.dta 10 6 IPI00217963.3 "Keratin, type I cytoskeletal 16" 331 51578 13 13 13 13 2357 3201 1 0 0 518.769 1035.5235 2 1035.525 -0.0015 1 32.37 0.0029 K IRDWYQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4075.4075.2.dta 10 6 IPI00217963.3 "Keratin, type I cytoskeletal 16" 331 51578 13 13 13 13 2359 2756 1 0 0 518.7756 1035.5367 2 1035.5349 0.0018 1 19.85 0.043 R LAADDFRTK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3572.3572.2.dta 10 6 IPI00217963.3 "Keratin, type I cytoskeletal 16" 331 51578 13 13 13 13 2556 3525 1 0 0 532.809 1063.6034 2 1063.6026 0.0008 1 45.25 0.00012 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4427.4427.2.dta 10 6 IPI00217963.3 "Keratin, type I cytoskeletal 16" 331 51578 13 13 13 13 2813 6197 1 0 1 548.7692 1095.5238 2 1095.5237 0.0001 0 49.49 0.00016 R DAETWFLSK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7208.7208.2.dta 10 6 IPI00217963.3 "Keratin, type I cytoskeletal 16" 331 51578 13 13 13 13 2869 1482 1 0 0 553.7665 1105.5185 2 1105.5186 -0.0001 0 79.29 2.10E-07 K VTMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2187.2187.2.dta 10 6 IPI00217963.3 "Keratin, type I cytoskeletal 16" 331 51578 13 13 13 13 2872 3128 1 0 0 553.7843 1105.5541 2 1105.555 -0.0009 0 65.05 8.00E-06 R ISSVLAGGSCR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3995.3995.2.dta 10 6 IPI00217963.3 "Keratin, type I cytoskeletal 16" 331 51578 13 13 13 13 3015 3345 1 0 0 561.7913 1121.5681 2 1121.5717 -0.0036 0 42.75 0.00042 R LEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4232.4232.2.dta 10 6 IPI00217963.3 "Keratin, type I cytoskeletal 16" 331 51578 13 13 13 13 4347 2669 1 0 0 639.795 1277.5754 2 1277.5783 -0.0029 0 73.79 5.20E-07 K GSCGIGGGIGGGSSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3475.3475.2.dta 10 6 IPI00217963.3 "Keratin, type I cytoskeletal 16" 331 51578 13 13 13 13 4541 3787 1 0 0 651.3328 1300.651 2 1300.651 0 0 79.99 1.90E-07 R ALEEANADLEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4710.4710.2.dta 10 6 IPI00217963.3 "Keratin, type I cytoskeletal 16" 331 51578 13 13 13 13 5174 3996 1 0 0 690.3662 1378.7179 2 1378.7204 -0.0026 1 29.99 0.0046 K TRLEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4936.4936.2.dta 10 7 IPI00479145.2 "Keratin, type I cytoskeletal 19" 260 44065 13 13 13 13 794 3389 1 0 0 404.2036 806.3927 2 806.3923 0.0004 0 29.47 0.027 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4280.4280.2.dta 10 7 IPI00479145.2 "Keratin, type I cytoskeletal 19" 260 44065 13 13 13 13 807 3174 1 0 0 405.2239 808.4333 2 808.433 0.0002 0 28.79 0.013 R LASYLDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4046.4046.2.dta 10 7 IPI00479145.2 "Keratin, type I cytoskeletal 19" 260 44065 13 13 13 13 1056 4615 1 0 1 425.7323 849.4501 2 849.4497 0.0004 0 54.58 4.30E-05 R FGPGVAFR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5606.5606.2.dta 10 7 IPI00479145.2 "Keratin, type I cytoskeletal 19" 260 44065 13 13 13 13 2030 970 1 0 1 498.2543 994.4941 2 994.4944 -0.0004 0 33.13 0.00078 R APSIHGGSGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1632.1632.2.dta 10 7 IPI00479145.2 "Keratin, type I cytoskeletal 19" 260 44065 13 13 13 13 2140 3005 1 0 1 504.7658 1007.5171 2 1007.5188 -0.0018 1 22.1 0.03 K IRDWYQK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3857.3857.2.dta 10 7 IPI00479145.2 "Keratin, type I cytoskeletal 19" 260 44065 13 13 13 13 2359 2756 1 0 0 518.7756 1035.5367 2 1035.5349 0.0018 1 19.85 0.043 R LAADDFRTK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3572.3572.2.dta 10 7 IPI00479145.2 "Keratin, type I cytoskeletal 19" 260 44065 13 13 13 13 2392 4339 1 0 0 521.3058 1040.5971 2 1040.5978 -0.0007 0 50.62 7.20E-05 R IVLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5307.5307.2.dta 10 7 IPI00479145.2 "Keratin, type I cytoskeletal 19" 260 44065 13 13 13 13 2556 3525 1 0 0 532.809 1063.6034 2 1063.6026 0.0008 1 45.25 0.00012 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4427.4427.2.dta 10 7 IPI00479145.2 "Keratin, type I cytoskeletal 19" 260 44065 13 13 13 13 2707 5462 1 0 1 541.7491 1081.4837 2 1081.4829 0.0009 0 52.62 6.60E-05 K DAEAWFTSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6478.6478.2.dta 10 7 IPI00479145.2 "Keratin, type I cytoskeletal 19" 260 44065 13 13 13 13 3015 3345 1 0 0 561.7913 1121.5681 2 1121.5717 -0.0036 0 42.75 0.00042 R LEQEIATYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4232.4232.2.dta 10 7 IPI00479145.2 "Keratin, type I cytoskeletal 19" 260 44065 13 13 13 13 3838 2708 1 0 0 408.2193 1221.636 3 1221.6353 0.0006 1 48.97 0.00031 R TKFETEQALR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3517.3517.3.dta 10 7 IPI00479145.2 "Keratin, type I cytoskeletal 19" 260 44065 13 13 13 13 4031 3837 1 0 1 622.3299 1242.6452 2 1242.6455 -0.0003 0 64.74 6.90E-06 R ALEAANGELEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4764.4764.2.dta 10 7 IPI00479145.2 "Keratin, type I cytoskeletal 19" 260 44065 13 13 13 13 7840 3736 1 0 1 635.6367 1903.8883 3 1903.8911 -0.0028 0 22.55 0.0077 R SLLEGQEDHYNNLSASK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4654.4654.3.dta 10 8 IPI00419574.3 keratin 33A 154 47166 5 5 5 5 863 2882 1 0 1 412.2009 822.3872 2 822.3872 0 0 28.06 0.0024 K LASDDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3724.3724.2.dta 10 8 IPI00419574.3 keratin 33A 154 47166 5 5 5 5 2071 3711 1 0 1 500.2957 998.5769 2 998.576 0.0008 0 51.56 7.20E-05 R LVVQIDNAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4627.4627.2.dta 10 8 IPI00419574.3 keratin 33A 154 47166 5 5 5 5 3610 3303 1 0 1 599.2825 1196.5505 2 1196.5495 0.001 0 38.05 0.00078 R LECEINTYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4186.4186.2.dta 10 8 IPI00419574.3 keratin 33A 154 47166 5 5 5 5 4033 4373 1 0 1 622.3348 1242.655 2 1242.6568 -0.0018 0 47.31 0.00037 R QLVESDINGLR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5343.5343.2.dta 10 8 IPI00419574.3 keratin 33A 154 47166 5 5 5 5 6078 5719 1 0 1 752.8932 1503.7718 2 1503.7681 0.0037 0 74.48 7.80E-07 R QNQEYQVLLDVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6731.6731.2.dta 10 9 IPI00290077.1 "Keratin, type I cytoskeletal 15" 154 49365 7 7 7 7 794 3389 1 0 0 404.2036 806.3927 2 806.3923 0.0004 0 29.47 0.027 R LAADDFR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4280.4280.2.dta 10 9 IPI00290077.1 "Keratin, type I cytoskeletal 15" 154 49365 7 7 7 7 807 3174 1 0 0 405.2239 808.4333 2 808.433 0.0002 0 28.79 0.013 R LASYLDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4046.4046.2.dta 10 9 IPI00290077.1 "Keratin, type I cytoskeletal 15" 154 49365 7 7 7 7 2398 4509 1 0 1 521.7985 1041.5824 2 1041.5818 0.0005 0 27.69 0.0057 R VILEIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5491.5491.2.dta 10 9 IPI00290077.1 "Keratin, type I cytoskeletal 15" 154 49365 7 7 7 7 2556 3525 1 0 0 532.809 1063.6034 2 1063.6026 0.0008 1 45.25 0.00012 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4427.4427.2.dta 10 9 IPI00290077.1 "Keratin, type I cytoskeletal 15" 154 49365 7 7 7 7 3015 3345 1 0 0 561.7913 1121.5681 2 1121.5717 -0.0036 0 42.75 0.00042 R LEQEIATYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4232.4232.2.dta 10 9 IPI00290077.1 "Keratin, type I cytoskeletal 15" 154 49365 7 7 7 7 4541 3787 1 0 0 651.3328 1300.651 2 1300.651 0 0 79.99 1.90E-07 R ALEEANADLEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4710.4710.2.dta 10 9 IPI00290077.1 "Keratin, type I cytoskeletal 15" 154 49365 7 7 7 7 5174 3996 1 0 0 690.3662 1378.7179 2 1378.7204 -0.0026 1 29.99 0.0046 K TRLEQEIATYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4936.4936.2.dta 10 IPI00791852.1 42 kDa protein 440 41729 16 16 15 15 794 3389 1 0 0 404.2036 806.3927 2 806.3923 0.0004 0 29.47 0.027 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4280.4280.2.dta 10 IPI00791852.1 42 kDa protein 440 41729 16 16 15 15 807 3174 1 0 0 405.2239 808.4333 2 808.433 0.0002 0 28.79 0.013 R LASYLDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4046.4046.2.dta 10 IPI00791852.1 42 kDa protein 440 41729 16 16 15 15 1467 1014 1 0 1 461.2231 920.4316 2 920.4312 0.0004 0 47.6 0.00035 K GSSGLGGGSSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1680.1680.2.dta 10 IPI00791852.1 42 kDa protein 440 41729 16 16 15 15 1935 2311 1 0 1 492.7535 983.4925 2 983.4924 0.0001 0 36.42 0.0012 R QFTSSSSIK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3085.3085.2.dta 10 IPI00791852.1 42 kDa protein 440 41729 16 16 15 15 2020 3405 1 0 1 497.7163 993.4181 2 993.4192 -0.0011 0 23.95 0.0057 R DYSQYYR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4297.4297.2.dta 10 IPI00791852.1 42 kDa protein 440 41729 16 16 15 15 2342 2274 1 0 1 517.7559 1033.4973 2 1033.4975 -0.0002 0 70.56 1.60E-06 R LSGGLGAGSCR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3045.3045.2.dta 10 IPI00791852.1 42 kDa protein 440 41729 16 16 15 15 2357 3201 1 0 0 518.769 1035.5235 2 1035.525 -0.0015 1 32.37 0.0029 K IRDWYQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4075.4075.2.dta 10 IPI00791852.1 42 kDa protein 440 41729 16 16 15 15 2359 2756 1 0 0 518.7756 1035.5367 2 1035.5349 0.0018 1 19.85 0.043 R LAADDFRTK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3572.3572.2.dta 10 IPI00791852.1 42 kDa protein 440 41729 16 16 15 15 2535 2211 1 0 1 531.7527 1061.4909 2 1061.4924 -0.0014 0 40.64 0.0015 K ATMQNLNDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2976.2976.2.dta 10 IPI00791852.1 42 kDa protein 440 41729 16 16 15 15 2556 3525 1 0 0 532.809 1063.6034 2 1063.6026 0.0008 1 45.25 0.00012 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4427.4427.2.dta 10 IPI00791852.1 42 kDa protein 440 41729 16 16 15 15 2665 1165 1 0 1 539.7504 1077.4862 2 1077.4873 -0.0011 0 57.64 2.40E-05 K ATMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1843.1843.2.dta 10 IPI00791852.1 42 kDa protein 440 41729 16 16 15 15 3173 6683 1 0 1 572.7507 1143.4868 2 1143.4873 -0.0005 0 56.34 5.20E-06 K DAEDWFFSK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7688.7688.2.dta 10 IPI00791852.1 42 kDa protein 440 41729 16 16 15 15 3838 2708 1 0 0 408.2193 1221.636 3 1221.6353 0.0006 1 48.97 0.00031 R TKFETEQALR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3517.3517.3.dta 10 IPI00791852.1 42 kDa protein 440 41729 16 16 15 15 4901 3834 1 0 1 673.3468 1344.6791 2 1344.6772 0.0018 0 83.75 4.00E-08 R ALEEANTELEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4761.4761.2.dta 10 IPI00791852.1 42 kDa protein 440 41729 16 16 15 15 5045 2608 1 0 0 681.3479 1360.6812 2 1360.6834 -0.0022 0 91.16 5.90E-09 R EVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3409.3409.2.dta 10 IPI00791852.1 42 kDa protein 440 41729 16 16 15 15 8142 3613 1 0 0 702.0205 2103.0397 3 2103.0444 -0.0047 1 47.2 3.70E-05 K TEELNREVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4522.4522.3.dta 10 IPI00383111.2 57 kDa protein 412 56699 14 14 14 14 794 3389 1 0 0 404.2036 806.3927 2 806.3923 0.0004 0 29.47 0.027 R LAADDFR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4280.4280.2.dta 10 IPI00383111.2 57 kDa protein 412 56699 14 14 14 14 807 3174 1 0 0 405.2239 808.4333 2 808.433 0.0002 0 28.79 0.013 R LASYLDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4046.4046.2.dta 10 IPI00383111.2 57 kDa protein 412 56699 14 14 14 14 2013 3123 1 0 1 497.2536 992.4927 2 992.4927 0 0 49.4 4.30E-05 K YENEVALR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3989.3989.2.dta 10 IPI00383111.2 57 kDa protein 412 56699 14 14 14 14 2556 3525 1 0 0 532.809 1063.6034 2 1063.6026 0.0008 1 45.25 0.00012 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4427.4427.2.dta 10 IPI00383111.2 57 kDa protein 412 56699 14 14 14 14 2869 1482 1 0 0 553.7665 1105.5185 2 1105.5186 -0.0001 0 79.29 2.10E-07 K VTMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2187.2187.2.dta 10 IPI00383111.2 57 kDa protein 412 56699 14 14 14 14 2891 5110 1 0 1 555.2475 1108.4804 2 1108.4825 -0.0021 0 45.13 0.00032 K DAEAWFNEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6126.6126.2.dta 10 IPI00383111.2 57 kDa protein 412 56699 14 14 14 14 2967 6098 1 0 1 559.7575 1117.5005 2 1117.5013 -0.0008 0 26.34 0.0038 K HGNSHQGEPR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.711.711.2.dta 10 IPI00383111.2 57 kDa protein 412 56699 14 14 14 14 3346 3262 1 0 1 583.2962 1164.5779 2 1164.5775 0.0004 0 43.08 0.00077 R LENEIQTYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4142.4142.2.dta 10 IPI00383111.2 57 kDa protein 412 56699 14 14 14 14 3639 4407 1 0 1 601.312 1200.6095 2 1200.6098 -0.0004 0 19.48 0.015 R QSVEADINGLR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5380.5380.2.dta 10 IPI00383111.2 57 kDa protein 412 56699 14 14 14 14 5185 3569 1 0 1 691.3275 1380.6404 2 1380.6408 -0.0005 0 91.26 2.80E-09 R ALEESNYELEGK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4475.4475.2.dta 10 IPI00383111.2 57 kDa protein 412 56699 14 14 14 14 5600 3985 1 0 1 717.8875 1433.7605 2 1433.7626 -0.0022 1 39.37 0.0011 K IRLENEIQTYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4924.4924.2.dta 10 IPI00383111.2 57 kDa protein 412 56699 14 14 14 14 6029 2266 1 0 1 747.3698 1492.725 2 1492.727 -0.002 1 52.05 1.40E-05 R SQYEQLAEQNRK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3036.3036.2.dta 10 IPI00383111.2 57 kDa protein 412 56699 14 14 14 14 7283 5138 1 0 1 854.3887 1706.7629 2 1706.7649 -0.002 0 87.28 6.60E-09 K GSLGGGFSSGGFSGGSFSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6155.6155.2.dta 10 IPI00383111.2 57 kDa protein 412 56699 14 14 14 14 8131 5745 1 0 1 1041.9852 2081.9559 2 2081.9575 -0.0016 0 33.01 0.0011 R AETECQNTEYQQLLDIK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6757.6757.2.dta 10 IPI00747707.1 KRT17 protein 408 41332 15 15 14 14 344 4464 1 0 0 350.7345 699.4544 2 699.4531 0.0014 0 26.96 0.0066 K ILLDVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5443.5443.2.dta 10 IPI00747707.1 KRT17 protein 408 41332 15 15 14 14 794 3389 1 0 0 404.2036 806.3927 2 806.3923 0.0004 0 29.47 0.027 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4280.4280.2.dta 10 IPI00747707.1 KRT17 protein 408 41332 15 15 14 14 2020 3405 1 0 1 497.7163 993.4181 2 993.4192 -0.0011 0 23.95 0.0057 R DYSQYYR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4297.4297.2.dta 10 IPI00747707.1 KRT17 protein 408 41332 15 15 14 14 2059 8246 1 0 1 499.7542 997.4939 2 997.4941 -0.0002 0 41.5 0.00073 R EQVHQTTR - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.954.954.2.dta 10 IPI00747707.1 KRT17 protein 408 41332 15 15 14 14 2357 3201 1 0 0 518.769 1035.5235 2 1035.525 -0.0015 1 32.37 0.0029 K IRDWYQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4075.4075.2.dta 10 IPI00747707.1 KRT17 protein 408 41332 15 15 14 14 2359 2756 1 0 0 518.7756 1035.5367 2 1035.5349 0.0018 1 19.85 0.043 R LAADDFRTK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3572.3572.2.dta 10 IPI00747707.1 KRT17 protein 408 41332 15 15 14 14 3015 3345 1 0 0 561.7913 1121.5681 2 1121.5717 -0.0036 0 42.75 0.00042 R LEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4232.4232.2.dta 10 IPI00747707.1 KRT17 protein 408 41332 15 15 14 14 3173 6683 1 0 1 572.7507 1143.4868 2 1143.4873 -0.0005 0 56.34 5.20E-06 K DAEDWFFSK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7688.7688.2.dta 10 IPI00747707.1 KRT17 protein 408 41332 15 15 14 14 3838 2708 1 0 0 408.2193 1221.636 3 1221.6353 0.0006 1 48.97 0.00031 R TKFETEQALR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3517.3517.3.dta 10 IPI00747707.1 KRT17 protein 408 41332 15 15 14 14 5045 2608 1 0 0 681.3479 1360.6812 2 1360.6834 -0.0022 0 91.16 5.90E-09 R EVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3409.3409.2.dta 10 IPI00747707.1 KRT17 protein 408 41332 15 15 14 14 5174 3996 1 0 0 690.3662 1378.7179 2 1378.7204 -0.0026 1 29.99 0.0046 K TRLEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4936.4936.2.dta 10 IPI00747707.1 KRT17 protein 408 41332 15 15 14 14 5372 3572 1 0 1 702.3408 1402.667 2 1402.6688 -0.0018 0 88.18 2.10E-08 K ASLEGNLAETENR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4478.4478.2.dta 10 IPI00747707.1 KRT17 protein 408 41332 15 15 14 14 6970 4078 1 0 1 830.4471 1658.8797 2 1658.8839 -0.0042 1 86.5 7.80E-09 R TIVEEVQDGKVISSR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5025.5025.2.dta 10 IPI00747707.1 KRT17 protein 408 41332 15 15 14 14 6971 4062 1 0 1 553.9678 1658.8815 3 1658.8839 -0.0024 1 26.45 0.028 R TIVEEVQDGKVISSR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5008.5008.3.dta 10 IPI00747707.1 KRT17 protein 408 41332 15 15 14 14 8142 3613 1 0 0 702.0205 2103.0397 3 2103.0444 -0.0047 1 47.2 3.70E-05 K TEELNREVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4522.4522.3.dta 10 IPI00180956.6 49 kDa protein 369 49001 12 12 11 11 807 3174 1 0 0 405.2239 808.4333 2 808.433 0.0002 0 28.79 0.013 R LASYLDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4046.4046.2.dta 10 IPI00180956.6 49 kDa protein 369 49001 12 12 11 11 1467 1014 1 0 1 461.2231 920.4316 2 920.4312 0.0004 0 47.6 0.00035 K GSSGLGGGSSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1680.1680.2.dta 10 IPI00180956.6 49 kDa protein 369 49001 12 12 11 11 1935 2311 1 0 1 492.7535 983.4925 2 983.4924 0.0001 0 36.42 0.0012 R QFTSSSSIK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3085.3085.2.dta 10 IPI00180956.6 49 kDa protein 369 49001 12 12 11 11 2020 3405 1 0 1 497.7163 993.4181 2 993.4192 -0.0011 0 23.95 0.0057 R DYSQYYR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4297.4297.2.dta 10 IPI00180956.6 49 kDa protein 369 49001 12 12 11 11 2357 3201 1 0 0 518.769 1035.5235 2 1035.525 -0.0015 1 32.37 0.0029 K IRDWYQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4075.4075.2.dta 10 IPI00180956.6 49 kDa protein 369 49001 12 12 11 11 2535 2211 1 0 1 531.7527 1061.4909 2 1061.4924 -0.0014 0 40.64 0.0015 K ATMQNLNDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2976.2976.2.dta 10 IPI00180956.6 49 kDa protein 369 49001 12 12 11 11 2556 3525 1 0 0 532.809 1063.6034 2 1063.6026 0.0008 1 45.25 0.00012 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4427.4427.2.dta 10 IPI00180956.6 49 kDa protein 369 49001 12 12 11 11 2665 1165 1 0 1 539.7504 1077.4862 2 1077.4873 -0.0011 0 57.64 2.40E-05 K ATMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1843.1843.2.dta 10 IPI00180956.6 49 kDa protein 369 49001 12 12 11 11 3173 6683 1 0 1 572.7507 1143.4868 2 1143.4873 -0.0005 0 56.34 5.20E-06 K DAEDWFFSK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7688.7688.2.dta 10 IPI00180956.6 49 kDa protein 369 49001 12 12 11 11 5045 2608 1 0 0 681.3479 1360.6812 2 1360.6834 -0.0022 0 91.16 5.90E-09 R EVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3409.3409.2.dta 10 IPI00180956.6 49 kDa protein 369 49001 12 12 11 11 5372 3572 1 0 1 702.3408 1402.667 2 1402.6688 -0.0018 0 88.18 2.10E-08 K ASLEGNLAETENR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4478.4478.2.dta 10 IPI00180956.6 49 kDa protein 369 49001 12 12 11 11 8142 3613 1 0 0 702.0205 2103.0397 3 2103.0444 -0.0047 1 47.2 3.70E-05 K TEELNREVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4522.4522.3.dta 10 IPI00791156.1 31 kDa protein 328 30866 14 14 13 13 794 3389 1 0 0 404.2036 806.3927 2 806.3923 0.0004 0 29.47 0.027 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4280.4280.2.dta 10 IPI00791156.1 31 kDa protein 328 30866 14 14 13 13 807 3174 1 0 0 405.2239 808.4333 2 808.433 0.0002 0 28.79 0.013 R LASYLDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4046.4046.2.dta 10 IPI00791156.1 31 kDa protein 328 30866 14 14 13 13 1467 1014 1 0 1 461.2231 920.4316 2 920.4312 0.0004 0 47.6 0.00035 K GSSGLGGGSSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1680.1680.2.dta 10 IPI00791156.1 31 kDa protein 328 30866 14 14 13 13 1935 2311 1 0 1 492.7535 983.4925 2 983.4924 0.0001 0 36.42 0.0012 R QFTSSSSIK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3085.3085.2.dta 10 IPI00791156.1 31 kDa protein 328 30866 14 14 13 13 2020 3405 1 0 1 497.7163 993.4181 2 993.4192 -0.0011 0 23.95 0.0057 R DYSQYYR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4297.4297.2.dta 10 IPI00791156.1 31 kDa protein 328 30866 14 14 13 13 2342 2274 1 0 1 517.7559 1033.4973 2 1033.4975 -0.0002 0 70.56 1.60E-06 R LSGGLGAGSCR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3045.3045.2.dta 10 IPI00791156.1 31 kDa protein 328 30866 14 14 13 13 2357 3201 1 0 0 518.769 1035.5235 2 1035.525 -0.0015 1 32.37 0.0029 K IRDWYQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4075.4075.2.dta 10 IPI00791156.1 31 kDa protein 328 30866 14 14 13 13 2359 2756 1 0 0 518.7756 1035.5367 2 1035.5349 0.0018 1 19.85 0.043 R LAADDFRTK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3572.3572.2.dta 10 IPI00791156.1 31 kDa protein 328 30866 14 14 13 13 2535 2211 1 0 1 531.7527 1061.4909 2 1061.4924 -0.0014 0 40.64 0.0015 K ATMQNLNDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2976.2976.2.dta 10 IPI00791156.1 31 kDa protein 328 30866 14 14 13 13 2556 3525 1 0 0 532.809 1063.6034 2 1063.6026 0.0008 1 45.25 0.00012 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4427.4427.2.dta 10 IPI00791156.1 31 kDa protein 328 30866 14 14 13 13 2665 1165 1 0 1 539.7504 1077.4862 2 1077.4873 -0.0011 0 57.64 2.40E-05 K ATMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1843.1843.2.dta 10 IPI00791156.1 31 kDa protein 328 30866 14 14 13 13 3412 6552 1 0 1 586.7667 1171.5188 2 1171.5186 0.0002 0 46.35 4.70E-05 K DAEEWFFTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7559.7559.2.dta 10 IPI00791156.1 31 kDa protein 328 30866 14 14 13 13 3838 2708 1 0 0 408.2193 1221.636 3 1221.6353 0.0006 1 48.97 0.00031 R TKFETEQALR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3517.3517.3.dta 10 IPI00791156.1 31 kDa protein 328 30866 14 14 13 13 4901 3834 1 0 1 673.3468 1344.6791 2 1344.6772 0.0018 0 83.75 4.00E-08 R ALEEANTELEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4761.4761.2.dta 10 IPI00794047.1 18 kDa protein 275 18209 12 12 11 11 794 3389 1 0 0 404.2036 806.3927 2 806.3923 0.0004 0 29.47 0.027 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4280.4280.2.dta 10 IPI00794047.1 18 kDa protein 275 18209 12 12 11 11 807 3174 1 0 0 405.2239 808.4333 2 808.433 0.0002 0 28.79 0.013 R LASYLDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4046.4046.2.dta 10 IPI00794047.1 18 kDa protein 275 18209 12 12 11 11 1467 1014 1 0 1 461.2231 920.4316 2 920.4312 0.0004 0 47.6 0.00035 K GSSGLGGGSSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1680.1680.2.dta 10 IPI00794047.1 18 kDa protein 275 18209 12 12 11 11 1935 2311 1 0 1 492.7535 983.4925 2 983.4924 0.0001 0 36.42 0.0012 R QFTSSSSIK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3085.3085.2.dta 10 IPI00794047.1 18 kDa protein 275 18209 12 12 11 11 2020 3405 1 0 1 497.7163 993.4181 2 993.4192 -0.0011 0 23.95 0.0057 R DYSQYYR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4297.4297.2.dta 10 IPI00794047.1 18 kDa protein 275 18209 12 12 11 11 2342 2274 1 0 1 517.7559 1033.4973 2 1033.4975 -0.0002 0 70.56 1.60E-06 R LSGGLGAGSCR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3045.3045.2.dta 10 IPI00794047.1 18 kDa protein 275 18209 12 12 11 11 2357 3201 1 0 0 518.769 1035.5235 2 1035.525 -0.0015 1 32.37 0.0029 K IRDWYQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4075.4075.2.dta 10 IPI00794047.1 18 kDa protein 275 18209 12 12 11 11 2359 2756 1 0 0 518.7756 1035.5367 2 1035.5349 0.0018 1 19.85 0.043 R LAADDFRTK - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3572.3572.2.dta 10 IPI00794047.1 18 kDa protein 275 18209 12 12 11 11 2535 2211 1 0 1 531.7527 1061.4909 2 1061.4924 -0.0014 0 40.64 0.0015 K ATMQNLNDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2976.2976.2.dta 10 IPI00794047.1 18 kDa protein 275 18209 12 12 11 11 2556 3525 1 0 0 532.809 1063.6034 2 1063.6026 0.0008 1 45.25 0.00012 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4427.4427.2.dta 10 IPI00794047.1 18 kDa protein 275 18209 12 12 11 11 2665 1165 1 0 1 539.7504 1077.4862 2 1077.4873 -0.0011 0 57.64 2.40E-05 K ATMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1843.1843.2.dta 10 IPI00794047.1 18 kDa protein 275 18209 12 12 11 11 4901 3834 1 0 1 673.3468 1344.6791 2 1344.6772 0.0018 0 83.75 4.00E-08 R ALEEANTELEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4761.4761.2.dta 10 IPI00789750.1 27 kDa protein 254 26775 10 10 10 10 794 3389 1 0 0 404.2036 806.3927 2 806.3923 0.0004 0 29.47 0.027 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4280.4280.2.dta 10 IPI00789750.1 27 kDa protein 254 26775 10 10 10 10 807 3174 1 0 0 405.2239 808.4333 2 808.433 0.0002 0 28.79 0.013 R LASYLDK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4046.4046.2.dta 10 IPI00789750.1 27 kDa protein 254 26775 10 10 10 10 2220 1121 1 0 0 509.7289 1017.4433 2 1017.4437 -0.0004 0 22.78 0.018 R QFTSSSSMK G Oxidation (M) 0.000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1795.1795.2.dta 10 IPI00789750.1 27 kDa protein 254 26775 10 10 10 10 2359 2756 1 0 0 518.7756 1035.5367 2 1035.5349 0.0018 1 19.85 0.043 R LAADDFRTK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3572.3572.2.dta 10 IPI00789750.1 27 kDa protein 254 26775 10 10 10 10 2869 1482 1 0 0 553.7665 1105.5185 2 1105.5186 -0.0001 0 79.29 2.10E-07 K VTMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2187.2187.2.dta 10 IPI00789750.1 27 kDa protein 254 26775 10 10 10 10 2872 3128 1 0 0 553.7843 1105.5541 2 1105.555 -0.0009 0 65.05 8.00E-06 R ISSVLAGGSCR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3995.3995.2.dta 10 IPI00789750.1 27 kDa protein 254 26775 10 10 10 10 3412 6552 1 0 1 586.7667 1171.5188 2 1171.5186 0.0002 0 46.35 4.70E-05 K DAEEWFFTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7559.7559.2.dta 10 IPI00789750.1 27 kDa protein 254 26775 10 10 10 10 4244 3556 1 0 1 633.8367 1265.6588 2 1265.6615 -0.0027 1 28.3 0.023 R TKYETELNLR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4460.4460.2.dta 10 IPI00789750.1 27 kDa protein 254 26775 10 10 10 10 4347 2669 1 0 0 639.795 1277.5754 2 1277.5783 -0.0029 0 73.79 5.20E-07 K GSCGIGGGIGGGSSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3475.3475.2.dta 10 IPI00789750.1 27 kDa protein 254 26775 10 10 10 10 5528 3298 1 0 1 713.3515 1424.6885 2 1424.6896 -0.0011 0 57.17 7.10E-06 R APSTYGGGLSVSSSR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4181.4181.2.dta 10 IPI00794807.1 15 kDa protein 242 15435 8 8 6 6 1807 2965 1 0 1 483.2379 964.4613 2 964.4614 -0.0001 0 35.45 0.0058 R AQYDELAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3814.3814.2.dta 10 IPI00794807.1 15 kDa protein 242 15435 8 8 6 6 2561 3838 1 0 1 533.2831 1064.5516 2 1064.5502 0.0014 0 48.83 7.80E-05 K LEAEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4765.4765.2.dta 10 IPI00794807.1 15 kDa protein 242 15435 8 8 6 6 2797 2275 1 0 1 547.2849 1092.5553 2 1092.5563 -0.0011 1 36.94 0.0015 R AQYDELARK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3046.3046.2.dta 10 IPI00794807.1 15 kDa protein 242 15435 8 8 6 6 5479 5772 1 0 1 710.3779 1418.7413 2 1418.7405 0.0008 0 39.46 0.0023 R QAQEYEALLNIK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6784.6784.2.dta 10 IPI00794807.1 15 kDa protein 242 15435 8 8 6 6 6088 6210 1 0 1 753.8766 1505.7387 2 1505.7395 -0.0008 0 92.84 1.00E-08 R TVQSLEIDLDSMR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7220.7220.2.dta 10 IPI00794807.1 15 kDa protein 242 15435 8 8 6 6 6171 5166 1 0 1 761.8735 1521.7325 2 1521.7345 -0.002 0 75.25 2.00E-07 R TVQSLEIDLDSMR N Oxidation (M) 0.0000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6182.6182.2.dta 10 IPI00794807.1 15 kDa protein 242 15435 8 8 6 6 8001 5356 1 0 1 654.3406 1959.9999 3 1960.0013 -0.0014 1 34.64 0.00062 R AEGQRQAQEYEALLNIK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6371.6371.3.dta 10 IPI00794807.1 15 kDa protein 242 15435 8 8 6 6 8002 5362 1 0 1 654.3408 1960.0004 3 1960.0013 -0.0009 1 27.83 0.0047 R AEGQRQAQEYEALLNIK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6378.6378.3.dta 10 IPI00792454.1 30 kDa protein 215 30075 7 7 7 7 344 4464 1 0 0 350.7345 699.4544 2 699.4531 0.0014 0 26.96 0.0066 K ILLDVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5443.5443.2.dta 10 IPI00792454.1 30 kDa protein 215 30075 7 7 7 7 3015 3345 1 0 0 561.7913 1121.5681 2 1121.5717 -0.0036 0 42.75 0.00042 R LEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4232.4232.2.dta 10 IPI00792454.1 30 kDa protein 215 30075 7 7 7 7 3412 6552 1 0 1 586.7667 1171.5188 2 1171.5186 0.0002 0 46.35 4.70E-05 K DAEEWFFTK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7559.7559.2.dta 10 IPI00792454.1 30 kDa protein 215 30075 7 7 7 7 5045 2608 1 0 0 681.3479 1360.6812 2 1360.6834 -0.0022 0 91.16 5.90E-09 R EVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3409.3409.2.dta 10 IPI00792454.1 30 kDa protein 215 30075 7 7 7 7 5174 3996 1 0 0 690.3662 1378.7179 2 1378.7204 -0.0026 1 29.99 0.0046 K TRLEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4936.4936.2.dta 10 IPI00792454.1 30 kDa protein 215 30075 7 7 7 7 8142 3613 1 0 0 702.0205 2103.0397 3 2103.0444 -0.0047 1 47.2 3.70E-05 K TEELNREVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4522.4522.3.dta 10 IPI00792454.1 30 kDa protein 215 30075 7 7 7 7 8264 3764 1 0 1 770.3578 2308.0517 3 2308.0567 -0.005 0 39.94 0.00025 R LLEGEDAHLSSSQFSSGSQSSR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4685.4685.3.dta 10 IPI00791348.1 20 kDa protein 172 19811 4 4 4 4 2220 1121 1 0 0 509.7289 1017.4433 2 1017.4437 -0.0004 0 22.78 0.018 R QFTSSSSMK G Oxidation (M) 0.000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1795.1795.2.dta 10 IPI00791348.1 20 kDa protein 172 19811 4 4 4 4 2872 3128 1 0 0 553.7843 1105.5541 2 1105.555 -0.0009 0 65.05 8.00E-06 R ISSVLAGGSCR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3995.3995.2.dta 10 IPI00791348.1 20 kDa protein 172 19811 4 4 4 4 4347 2669 1 0 0 639.795 1277.5754 2 1277.5783 -0.0029 0 73.79 5.20E-07 K GSCGIGGGIGGGSSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3475.3475.2.dta 10 IPI00791348.1 20 kDa protein 172 19811 4 4 4 4 4541 3787 1 0 0 651.3328 1300.651 2 1300.651 0 0 79.99 1.90E-07 R ALEEANADLEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4710.4710.2.dta 10 IPI00794267.1 18 kDa protein 168 18099 9 9 9 9 283 546 1 0 0 342.7116 683.4086 2 683.4079 0.0008 1 37.84 0.001 K KGPQVR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1173.1173.2.dta 10 IPI00794267.1 18 kDa protein 168 18099 9 9 9 9 794 3389 1 0 0 404.2036 806.3927 2 806.3923 0.0004 0 29.47 0.027 R LAADDFR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4280.4280.2.dta 10 IPI00794267.1 18 kDa protein 168 18099 9 9 9 9 1489 992 2 0 1 462.7673 923.5201 2 923.5188 0.0012 1 27.04 0.022 K IREHLEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1656.1656.2.dta 10 IPI00794267.1 18 kDa protein 168 18099 9 9 9 9 2345 3637 1 0 1 517.7842 1033.5538 2 1033.5556 -0.0018 1 30.37 0.013 R LAADDFRVK - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4548.4548.2.dta 10 IPI00794267.1 18 kDa protein 168 18099 9 9 9 9 2392 4339 1 0 0 521.3058 1040.5971 2 1040.5978 -0.0007 0 50.62 7.20E-05 R IVLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5307.5307.2.dta 10 IPI00794267.1 18 kDa protein 168 18099 9 9 9 9 2789 3608 1 0 1 546.8107 1091.6069 2 1091.6087 -0.0018 1 23.35 0.032 R LASYLDRVR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4517.4517.2.dta 10 IPI00794267.1 18 kDa protein 168 18099 9 9 9 9 2791 2432 1 0 1 547.2512 1092.4879 2 1092.487 0.0009 0 41.25 0.00085 K ETMQSLNDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3216.3216.2.dta 10 IPI00794267.1 18 kDa protein 168 18099 9 9 9 9 2857 1382 1 0 1 552.2931 1102.5716 2 1102.5731 -0.0014 1 21.78 0.035 R VRSLETENR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2078.2078.2.dta 10 IPI00794267.1 18 kDa protein 168 18099 9 9 9 9 4682 3979 1 0 1 660.3389 1318.6632 2 1318.6629 0.0002 0 83.84 3.30E-08 R AQIFANTVDNAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4918.4918.2.dta 10 IPI00792629.1 18 kDa protein 163 18074 8 8 7 7 807 3174 1 0 0 405.2239 808.4333 2 808.433 0.0002 0 28.79 0.013 R LASYLDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4046.4046.2.dta 10 IPI00792629.1 18 kDa protein 163 18074 8 8 7 7 1467 1014 1 0 1 461.2231 920.4316 2 920.4312 0.0004 0 47.6 0.00035 K GSSGLGGGSSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1680.1680.2.dta 10 IPI00792629.1 18 kDa protein 163 18074 8 8 7 7 1935 2311 1 0 1 492.7535 983.4925 2 983.4924 0.0001 0 36.42 0.0012 R QFTSSSSIK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3085.3085.2.dta 10 IPI00792629.1 18 kDa protein 163 18074 8 8 7 7 2020 3405 1 0 1 497.7163 993.4181 2 993.4192 -0.0011 0 23.95 0.0057 R DYSQYYR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4297.4297.2.dta 10 IPI00792629.1 18 kDa protein 163 18074 8 8 7 7 2357 3201 1 0 0 518.769 1035.5235 2 1035.525 -0.0015 1 32.37 0.0029 K IRDWYQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4075.4075.2.dta 10 IPI00792629.1 18 kDa protein 163 18074 8 8 7 7 2535 2211 1 0 1 531.7527 1061.4909 2 1061.4924 -0.0014 0 40.64 0.0015 K ATMQNLNDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2976.2976.2.dta 10 IPI00792629.1 18 kDa protein 163 18074 8 8 7 7 2556 3525 1 0 0 532.809 1063.6034 2 1063.6026 0.0008 1 45.25 0.00012 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4427.4427.2.dta 10 IPI00792629.1 18 kDa protein 163 18074 8 8 7 7 2665 1165 1 0 1 539.7504 1077.4862 2 1077.4873 -0.0011 0 57.64 2.40E-05 K ATMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1843.1843.2.dta 10 IPI00794644.1 21 kDa protein 159 20831 8 8 8 8 794 3389 1 0 0 404.2036 806.3927 2 806.3923 0.0004 0 29.47 0.027 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4280.4280.2.dta 10 IPI00794644.1 21 kDa protein 159 20831 8 8 8 8 807 3174 1 0 0 405.2239 808.4333 2 808.433 0.0002 0 28.79 0.013 R LASYLDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4046.4046.2.dta 10 IPI00794644.1 21 kDa protein 159 20831 8 8 8 8 1056 4615 1 0 1 425.7323 849.4501 2 849.4497 0.0004 0 54.58 4.30E-05 R FGPGVAFR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5606.5606.2.dta 10 IPI00794644.1 21 kDa protein 159 20831 8 8 8 8 2030 970 1 0 1 498.2543 994.4941 2 994.4944 -0.0004 0 33.13 0.00078 R APSIHGGSGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1632.1632.2.dta 10 IPI00794644.1 21 kDa protein 159 20831 8 8 8 8 2359 2756 1 0 0 518.7756 1035.5367 2 1035.5349 0.0018 1 19.85 0.043 R LAADDFRTK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3572.3572.2.dta 10 IPI00794644.1 21 kDa protein 159 20831 8 8 8 8 2392 4339 1 0 0 521.3058 1040.5971 2 1040.5978 -0.0007 0 50.62 7.20E-05 R IVLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5307.5307.2.dta 10 IPI00794644.1 21 kDa protein 159 20831 8 8 8 8 2556 3525 1 0 0 532.809 1063.6034 2 1063.6026 0.0008 1 45.25 0.00012 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4427.4427.2.dta 10 IPI00794644.1 21 kDa protein 159 20831 8 8 8 8 3838 2708 1 0 0 408.2193 1221.636 3 1221.6353 0.0006 1 48.97 0.00031 R TKFETEQALR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3517.3517.3.dta 10 IPI00184195.2 19 kDa protein 152 18696 8 8 8 8 794 3389 1 0 0 404.2036 806.3927 2 806.3923 0.0004 0 29.47 0.027 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4280.4280.2.dta 10 IPI00184195.2 19 kDa protein 152 18696 8 8 8 8 807 3174 1 0 0 405.2239 808.4333 2 808.433 0.0002 0 28.79 0.013 R LASYLDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4046.4046.2.dta 10 IPI00184195.2 19 kDa protein 152 18696 8 8 8 8 2140 3005 1 0 1 504.7658 1007.5171 2 1007.5188 -0.0018 1 22.1 0.03 K IRDWYQK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3857.3857.2.dta 10 IPI00184195.2 19 kDa protein 152 18696 8 8 8 8 2359 2756 1 0 0 518.7756 1035.5367 2 1035.5349 0.0018 1 19.85 0.043 R LAADDFRTK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3572.3572.2.dta 10 IPI00184195.2 19 kDa protein 152 18696 8 8 8 8 2392 4339 1 0 0 521.3058 1040.5971 2 1040.5978 -0.0007 0 50.62 7.20E-05 R IVLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5307.5307.2.dta 10 IPI00184195.2 19 kDa protein 152 18696 8 8 8 8 2556 3525 1 0 0 532.809 1063.6034 2 1063.6026 0.0008 1 45.25 0.00012 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4427.4427.2.dta 10 IPI00184195.2 19 kDa protein 152 18696 8 8 8 8 3838 2708 1 0 0 408.2193 1221.636 3 1221.6353 0.0006 1 48.97 0.00031 R TKFETEQALR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3517.3517.3.dta 10 IPI00184195.2 19 kDa protein 152 18696 8 8 8 8 4031 3837 1 0 1 622.3299 1242.6452 2 1242.6455 -0.0003 0 64.74 6.90E-06 R ALEAANGELEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4764.4764.2.dta 10 IPI00796364.1 51 kDa protein 146 52118 6 6 6 6 794 3389 1 0 0 404.2036 806.3927 2 806.3923 0.0004 0 29.47 0.027 K LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4280.4280.2.dta 10 IPI00796364.1 51 kDa protein 146 52118 6 6 6 6 2071 3711 1 0 1 500.2957 998.5769 2 998.576 0.0008 0 51.56 7.20E-05 R LVVQIDNAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4627.4627.2.dta 10 IPI00796364.1 51 kDa protein 146 52118 6 6 6 6 2359 2756 1 0 0 518.7756 1035.5367 2 1035.5349 0.0018 1 19.85 0.043 K LAADDFRTK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3572.3572.2.dta 10 IPI00796364.1 51 kDa protein 146 52118 6 6 6 6 3610 3303 1 0 1 599.2825 1196.5505 2 1196.5495 0.001 0 38.05 0.00078 R LECEINTYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4186.4186.2.dta 10 IPI00796364.1 51 kDa protein 146 52118 6 6 6 6 4033 4373 1 0 1 622.3348 1242.655 2 1242.6568 -0.0018 0 47.31 0.00037 R QLVESDINGLR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5343.5343.2.dta 10 IPI00796364.1 51 kDa protein 146 52118 6 6 6 6 6078 5719 1 0 1 752.8932 1503.7718 2 1503.7681 0.0037 0 74.48 7.80E-07 R QNQEYQVLLDVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6731.6731.2.dta 10 IPI00294649.5 keratin 35 135 51640 6 6 6 6 794 3389 1 0 0 404.2036 806.3927 2 806.3923 0.0004 0 29.47 0.027 K LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4280.4280.2.dta 10 IPI00294649.5 keratin 35 135 51640 6 6 6 6 2359 2756 1 0 0 518.7756 1035.5367 2 1035.5349 0.0018 1 19.85 0.043 K LAADDFRTK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3572.3572.2.dta 10 IPI00294649.5 keratin 35 135 51640 6 6 6 6 2791 2432 1 0 1 547.2512 1092.4879 2 1092.487 0.0009 0 41.25 0.00085 K ETMQSLNDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3216.3216.2.dta 10 IPI00294649.5 keratin 35 135 51640 6 6 6 6 3610 3303 1 0 1 599.2825 1196.5505 2 1196.5495 0.001 0 38.05 0.00078 R LECEINTYR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4186.4186.2.dta 10 IPI00294649.5 keratin 35 135 51640 6 6 6 6 4033 4373 1 0 1 622.3348 1242.655 2 1242.6568 -0.0018 0 47.31 0.00037 R QLVESDINGLR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5343.5343.2.dta 10 IPI00294649.5 keratin 35 135 51640 6 6 6 6 6078 5719 1 0 1 752.8932 1503.7718 2 1503.7681 0.0037 0 74.48 7.80E-07 R QNQEYQVLLDVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6731.6731.2.dta 10 IPI00297632.3 "Keratin, type I cuticular Ha3-I" 131 47161 4 4 4 4 863 2882 1 0 1 412.2009 822.3872 2 822.3872 0 0 28.06 0.0024 K LASDDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3724.3724.2.dta 10 IPI00297632.3 "Keratin, type I cuticular Ha3-I" 131 47161 4 4 4 4 2071 3711 1 0 1 500.2957 998.5769 2 998.576 0.0008 0 51.56 7.20E-05 R LVVQIDNAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4627.4627.2.dta 10 IPI00297632.3 "Keratin, type I cuticular Ha3-I" 131 47161 4 4 4 4 3610 3303 1 0 1 599.2825 1196.5505 2 1196.5495 0.001 0 38.05 0.00078 R LECEINTYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4186.4186.2.dta 10 IPI00297632.3 "Keratin, type I cuticular Ha3-I" 131 47161 4 4 4 4 6078 5719 1 0 1 752.8932 1503.7718 2 1503.7681 0.0037 0 74.48 7.80E-07 R QNQEYQVLLDVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6731.6731.2.dta 10 IPI00791342.1 13 kDa protein 130 13121 7 7 7 7 794 3389 1 0 0 404.2036 806.3927 2 806.3923 0.0004 0 29.47 0.027 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4280.4280.2.dta 10 IPI00791342.1 13 kDa protein 130 13121 7 7 7 7 807 3174 1 0 0 405.2239 808.4333 2 808.433 0.0002 0 28.79 0.013 R LASYLDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4046.4046.2.dta 10 IPI00791342.1 13 kDa protein 130 13121 7 7 7 7 2357 3201 1 0 0 518.769 1035.5235 2 1035.525 -0.0015 1 32.37 0.0029 K IRDWYQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4075.4075.2.dta 10 IPI00791342.1 13 kDa protein 130 13121 7 7 7 7 2359 2756 1 0 0 518.7756 1035.5367 2 1035.5349 0.0018 1 19.85 0.043 R LAADDFRTK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3572.3572.2.dta 10 IPI00791342.1 13 kDa protein 130 13121 7 7 7 7 2556 3525 1 0 0 532.809 1063.6034 2 1063.6026 0.0008 1 45.25 0.00012 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4427.4427.2.dta 10 IPI00791342.1 13 kDa protein 130 13121 7 7 7 7 4244 3556 1 0 1 633.8367 1265.6588 2 1265.6615 -0.0027 1 28.3 0.023 R TKYETELNLR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4460.4460.2.dta 10 IPI00791342.1 13 kDa protein 130 13121 7 7 7 7 4541 3787 1 0 0 651.3328 1300.651 2 1300.651 0 0 79.99 1.90E-07 R ALEEANADLEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4710.4710.2.dta 10 IPI00171196.2 keratin 13 isoform b 126 46181 6 6 6 6 794 3389 1 0 0 404.2036 806.3927 2 806.3923 0.0004 0 29.47 0.027 R LAADDFR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4280.4280.2.dta 10 IPI00171196.2 keratin 13 isoform b 126 46181 6 6 6 6 2398 4509 1 0 1 521.7985 1041.5824 2 1041.5818 0.0005 0 27.69 0.0057 R VILEIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5491.5491.2.dta 10 IPI00171196.2 keratin 13 isoform b 126 46181 6 6 6 6 3015 3345 1 0 0 561.7913 1121.5681 2 1121.5717 -0.0036 0 42.75 0.00042 R LEQEIATYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4232.4232.2.dta 10 IPI00171196.2 keratin 13 isoform b 126 46181 6 6 6 6 3639 4407 1 0 1 601.312 1200.6095 2 1200.6098 -0.0004 0 19.48 0.015 R QSVEADINGLR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5380.5380.2.dta 10 IPI00171196.2 keratin 13 isoform b 126 46181 6 6 6 6 4541 3787 1 0 0 651.3328 1300.651 2 1300.651 0 0 79.99 1.90E-07 R ALEEANADLEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4710.4710.2.dta 10 IPI00171196.2 keratin 13 isoform b 126 46181 6 6 6 6 5174 3996 1 0 0 690.3662 1378.7179 2 1378.7204 -0.0026 1 29.99 0.0046 K TRLEQEIATYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4936.4936.2.dta 10 IPI00795719.1 16 kDa protein 126 16241 6 6 6 6 794 3389 1 0 0 404.2036 806.3927 2 806.3923 0.0004 0 29.47 0.027 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4280.4280.2.dta 10 IPI00795719.1 16 kDa protein 126 16241 6 6 6 6 807 3174 1 0 0 405.2239 808.4333 2 808.433 0.0002 0 28.79 0.013 R LASYLDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4046.4046.2.dta 10 IPI00795719.1 16 kDa protein 126 16241 6 6 6 6 2357 3201 1 0 0 518.769 1035.5235 2 1035.525 -0.0015 1 32.37 0.0029 K IRDWYQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4075.4075.2.dta 10 IPI00795719.1 16 kDa protein 126 16241 6 6 6 6 2359 2756 1 0 0 518.7756 1035.5367 2 1035.5349 0.0018 1 19.85 0.043 R LAADDFRTK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3572.3572.2.dta 10 IPI00795719.1 16 kDa protein 126 16241 6 6 6 6 2556 3525 1 0 0 532.809 1063.6034 2 1063.6026 0.0008 1 45.25 0.00012 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4427.4427.2.dta 10 IPI00795719.1 16 kDa protein 126 16241 6 6 6 6 4541 3787 1 0 0 651.3328 1300.651 2 1300.651 0 0 79.99 1.90E-07 R ALEEANADLEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4710.4710.2.dta 10 IPI00789536.1 MGC102966 protein 125 15752 5 5 5 5 794 3389 1 0 0 404.2036 806.3927 2 806.3923 0.0004 0 29.47 0.027 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4280.4280.2.dta 10 IPI00789536.1 MGC102966 protein 125 15752 5 5 5 5 807 3174 1 0 0 405.2239 808.4333 2 808.433 0.0002 0 28.79 0.013 R LASYLDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4046.4046.2.dta 10 IPI00789536.1 MGC102966 protein 125 15752 5 5 5 5 2357 3201 1 0 0 518.769 1035.5235 2 1035.525 -0.0015 1 32.37 0.0029 K IRDWYQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4075.4075.2.dta 10 IPI00789536.1 MGC102966 protein 125 15752 5 5 5 5 2556 3525 1 0 0 532.809 1063.6034 2 1063.6026 0.0008 1 45.25 0.00012 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4427.4427.2.dta 10 IPI00789536.1 MGC102966 protein 125 15752 5 5 5 5 4541 3787 1 0 0 651.3328 1300.651 2 1300.651 0 0 79.99 1.90E-07 R ALEEANADLEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4710.4710.2.dta 10 IPI00031423.1 "Keratin, type I cuticular Ha3-II" 123 47325 5 5 5 5 794 3389 1 0 0 404.2036 806.3927 2 806.3923 0.0004 0 29.47 0.027 K LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4280.4280.2.dta 10 IPI00031423.1 "Keratin, type I cuticular Ha3-II" 123 47325 5 5 5 5 2071 3711 1 0 1 500.2957 998.5769 2 998.576 0.0008 0 51.56 7.20E-05 R LVVQIDNAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4627.4627.2.dta 10 IPI00031423.1 "Keratin, type I cuticular Ha3-II" 123 47325 5 5 5 5 2359 2756 1 0 0 518.7756 1035.5367 2 1035.5349 0.0018 1 19.85 0.043 K LAADDFRTK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3572.3572.2.dta 10 IPI00031423.1 "Keratin, type I cuticular Ha3-II" 123 47325 5 5 5 5 3610 3303 1 0 1 599.2825 1196.5505 2 1196.5495 0.001 0 38.05 0.00078 R LECEINTYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4186.4186.2.dta 10 IPI00031423.1 "Keratin, type I cuticular Ha3-II" 123 47325 5 5 5 5 6078 5719 1 0 1 752.8932 1503.7718 2 1503.7681 0.0037 0 74.48 7.80E-07 R QNQEYQVLLDVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6731.6731.2.dta 10 IPI00009866.6 "Isoform 1 of Keratin, type I cytoskeletal 13" 122 49898 5 5 5 5 2398 4509 1 0 1 521.7985 1041.5824 2 1041.5818 0.0005 0 27.69 0.0057 R VILEIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5491.5491.2.dta 10 IPI00009866.6 "Isoform 1 of Keratin, type I cytoskeletal 13" 122 49898 5 5 5 5 3015 3345 1 0 0 561.7913 1121.5681 2 1121.5717 -0.0036 0 42.75 0.00042 R LEQEIATYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4232.4232.2.dta 10 IPI00009866.6 "Isoform 1 of Keratin, type I cytoskeletal 13" 122 49898 5 5 5 5 3639 4407 1 0 1 601.312 1200.6095 2 1200.6098 -0.0004 0 19.48 0.015 R QSVEADINGLR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5380.5380.2.dta 10 IPI00009866.6 "Isoform 1 of Keratin, type I cytoskeletal 13" 122 49898 5 5 5 5 4541 3787 1 0 0 651.3328 1300.651 2 1300.651 0 0 79.99 1.90E-07 R ALEEANADLEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4710.4710.2.dta 10 IPI00009866.6 "Isoform 1 of Keratin, type I cytoskeletal 13" 122 49898 5 5 5 5 5174 3996 1 0 0 690.3662 1378.7179 2 1378.7204 -0.0026 1 29.99 0.0046 K TRLEQEIATYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4936.4936.2.dta 10 IPI00790298.1 20 kDa protein 110 19591 4 4 4 4 807 3174 1 0 0 405.2239 808.4333 2 808.433 0.0002 0 28.79 0.013 R LASYLDK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4046.4046.2.dta 10 IPI00790298.1 20 kDa protein 110 19591 4 4 4 4 2020 3405 1 0 1 497.7163 993.4181 2 993.4192 -0.0011 0 23.95 0.0057 R DYSQYYR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4297.4297.2.dta 10 IPI00790298.1 20 kDa protein 110 19591 4 4 4 4 2357 3201 1 0 0 518.769 1035.5235 2 1035.525 -0.0015 1 32.37 0.0029 K IRDWYQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4075.4075.2.dta 10 IPI00790298.1 20 kDa protein 110 19591 4 4 4 4 4901 3834 1 0 1 673.3468 1344.6791 2 1344.6772 0.0018 0 83.75 4.00E-08 R ALEEANTELEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4761.4761.2.dta 10 IPI00795353.1 11 kDa protein 108 10894 5 5 4 4 2561 3838 1 0 1 533.2831 1064.5516 2 1064.5502 0.0014 0 48.83 7.80E-05 K LEAEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4765.4765.2.dta 10 IPI00795353.1 11 kDa protein 108 10894 5 5 4 4 5479 5772 1 0 1 710.3779 1418.7413 2 1418.7405 0.0008 0 39.46 0.0023 R QAQEYEALLNIK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6784.6784.2.dta 10 IPI00795353.1 11 kDa protein 108 10894 5 5 4 4 6079 2062 1 0 1 502.2668 1503.7785 3 1503.7781 0.0005 1 33.73 0.0014 R IVDGKVVSETNDTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2815.2815.3.dta 10 IPI00795353.1 11 kDa protein 108 10894 5 5 4 4 8001 5356 1 0 1 654.3406 1959.9999 3 1960.0013 -0.0014 1 34.64 0.00062 R AEGQRQAQEYEALLNIK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6371.6371.3.dta 10 IPI00795353.1 11 kDa protein 108 10894 5 5 4 4 8002 5362 1 0 1 654.3408 1960.0004 3 1960.0013 -0.0009 1 27.83 0.0047 R AEGQRQAQEYEALLNIK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6378.6378.3.dta 10 IPI00418663.3 Keratin-28 105 53733 3 3 3 3 794 3389 1 0 0 404.2036 806.3927 2 806.3923 0.0004 0 29.47 0.027 R LAADDFR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4280.4280.2.dta 10 IPI00418663.3 Keratin-28 105 53733 3 3 3 3 2869 1482 1 0 0 553.7665 1105.5185 2 1105.5186 -0.0001 0 79.29 2.10E-07 K VTMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2187.2187.2.dta 10 IPI00418663.3 Keratin-28 105 53733 3 3 3 3 2891 5110 1 0 1 555.2475 1108.4804 2 1108.4825 -0.0021 0 45.13 0.00032 K DAEAWFNEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6126.6126.2.dta 10 IPI00292715.3 keratin 34 101 50818 3 3 3 3 863 2882 1 0 1 412.2009 822.3872 2 822.3872 0 0 28.06 0.0024 K LASDDFR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3724.3724.2.dta 10 IPI00292715.3 keratin 34 101 50818 3 3 3 3 3610 3303 1 0 1 599.2825 1196.5505 2 1196.5495 0.001 0 38.05 0.00078 R LECEINTYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4186.4186.2.dta 10 IPI00292715.3 keratin 34 101 50818 3 3 3 3 6078 5719 1 0 1 752.8932 1503.7718 2 1503.7681 0.0037 0 74.48 7.80E-07 R QNQEYQVLLDVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6731.6731.2.dta 10 IPI00328103.2 Keratin-27 100 50419 2 2 2 2 2869 1482 1 0 0 553.7665 1105.5185 2 1105.5186 -0.0001 0 79.29 2.10E-07 K VTMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2187.2187.2.dta 10 IPI00328103.2 Keratin-27 100 50419 2 2 2 2 2891 5110 1 0 1 555.2475 1108.4804 2 1108.4825 -0.0021 0 45.13 0.00032 R DAEAWFNEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6126.6126.2.dta 10 IPI00791927.1 32 kDa protein 90 32658 2 2 2 2 3610 3303 1 0 1 599.2825 1196.5505 2 1196.5495 0.001 0 38.05 0.00078 R LECEINTYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4186.4186.2.dta 10 IPI00791927.1 32 kDa protein 90 32658 2 2 2 2 6078 5719 1 0 1 752.8932 1503.7718 2 1503.7681 0.0037 0 74.48 7.80E-07 R QNQEYQVLLDVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6731.6731.2.dta 10 IPI00550661.2 "Isoform 2 of Keratin, type I cytoskeletal 13" 89 38783 3 3 3 3 2398 4509 1 0 1 521.7985 1041.5824 2 1041.5818 0.0005 0 27.69 0.0057 R VILEIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5491.5491.2.dta 10 IPI00550661.2 "Isoform 2 of Keratin, type I cytoskeletal 13" 89 38783 3 3 3 3 3639 4407 1 0 1 601.312 1200.6095 2 1200.6098 -0.0004 0 19.48 0.015 R QSVEADINGLR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5380.5380.2.dta 10 IPI00550661.2 "Isoform 2 of Keratin, type I cytoskeletal 13" 89 38783 3 3 3 3 4541 3787 1 0 0 651.3328 1300.651 2 1300.651 0 0 79.99 1.90E-07 R ALEEANADLEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4710.4710.2.dta 10 IPI00789893.1 22 kDa protein 86 21912 4 4 4 4 794 3389 1 0 0 404.2036 806.3927 2 806.3923 0.0004 0 29.47 0.027 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4280.4280.2.dta 10 IPI00789893.1 22 kDa protein 86 21912 4 4 4 4 2220 1121 1 0 0 509.7289 1017.4433 2 1017.4437 -0.0004 0 22.78 0.018 R QFTSSSSMK G Oxidation (M) 0.000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1795.1795.2.dta 10 IPI00789893.1 22 kDa protein 86 21912 4 4 4 4 2359 2756 1 0 0 518.7756 1035.5367 2 1035.5349 0.0018 1 19.85 0.043 R LAADDFRTK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3572.3572.2.dta 10 IPI00789893.1 22 kDa protein 86 21912 4 4 4 4 4541 3787 1 0 0 651.3328 1300.651 2 1300.651 0 0 79.99 1.90E-07 R ALEEANADLEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4710.4710.2.dta 10 IPI00654614.1 Epidermal type I keratin (Fragment) 83 17892 4 4 4 4 344 4464 1 0 0 350.7345 699.4544 2 699.4531 0.0014 0 26.96 0.0066 K ILLDVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5443.5443.2.dta 10 IPI00654614.1 Epidermal type I keratin (Fragment) 83 17892 4 4 4 4 3015 3345 1 0 0 561.7913 1121.5681 2 1121.5717 -0.0036 0 42.75 0.00042 R LEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4232.4232.2.dta 10 IPI00654614.1 Epidermal type I keratin (Fragment) 83 17892 4 4 4 4 5174 3996 1 0 0 690.3662 1378.7179 2 1378.7204 -0.0026 1 29.99 0.0046 K TRLEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4936.4936.2.dta 10 IPI00654614.1 Epidermal type I keratin (Fragment) 83 17892 4 4 4 4 8264 3764 1 0 1 770.3578 2308.0517 3 2308.0567 -0.005 0 39.94 0.00025 R LLEGEDAHLSSSQFSSGSQSSR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4685.4685.3.dta 10 IPI00793191.1 14 kDa protein 83 14545 3 3 3 3 794 3389 1 0 0 404.2036 806.3927 2 806.3923 0.0004 0 29.47 0.027 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4280.4280.2.dta 10 IPI00793191.1 14 kDa protein 83 14545 3 3 3 3 2359 2756 1 0 0 518.7756 1035.5367 2 1035.5349 0.0018 1 19.85 0.043 R LAADDFRTK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3572.3572.2.dta 10 IPI00793191.1 14 kDa protein 83 14545 3 3 3 3 4541 3787 1 0 0 651.3328 1300.651 2 1300.651 0 0 79.99 1.90E-07 R ALEEANADLEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4710.4710.2.dta 10 IPI00793909.1 19 kDa protein 81 19713 2 2 2 2 2220 1121 1 0 0 509.7289 1017.4433 2 1017.4437 -0.0004 0 22.78 0.018 R QFTSSSSMK G Oxidation (M) 0.000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1795.1795.2.dta 10 IPI00793909.1 19 kDa protein 81 19713 2 2 2 2 4541 3787 1 0 0 651.3328 1300.651 2 1300.651 0 0 79.99 1.90E-07 R ALEEANADLEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4710.4710.2.dta 10 IPI00375910.2 Keratin-26 79 52620 1 1 1 1 2869 1482 1 0 0 553.7665 1105.5185 2 1105.5186 -0.0001 0 79.29 2.10E-07 K VTMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2187.2187.2.dta 10 IPI00790191.1 25 kDa protein 79 25322 3 3 3 3 2707 5462 1 0 1 541.7491 1081.4837 2 1081.4829 0.0009 0 52.62 6.60E-05 K DAEAWFTSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6478.6478.2.dta 10 IPI00790191.1 25 kDa protein 79 25322 3 3 3 3 3015 3345 1 0 0 561.7913 1121.5681 2 1121.5717 -0.0036 0 42.75 0.00042 R LEQEIATYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4232.4232.2.dta 10 IPI00790191.1 25 kDa protein 79 25322 3 3 3 3 7840 3736 1 0 1 635.6367 1903.8883 3 1903.8911 -0.0028 0 22.55 0.0077 R SLLEGQEDHYNNLSASK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4654.4654.3.dta 10 IPI00291540.3 "Keratin, type I cuticular Ha2" 78 51769 2 2 2 2 794 3389 1 0 0 404.2036 806.3927 2 806.3923 0.0004 0 29.47 0.027 K LAADDFR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4280.4280.2.dta 10 IPI00291540.3 "Keratin, type I cuticular Ha2" 78 51769 2 2 2 2 6078 5719 1 0 1 752.8932 1503.7718 2 1503.7681 0.0037 0 74.48 7.80E-07 R QNQEYQVLLDVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6731.6731.2.dta 10 IPI00304458.1 "Keratin, type I cytoskeletal 23" 74 48209 2 2 1 1 2535 2211 1 0 1 531.7527 1061.4909 2 1061.4924 -0.0014 0 40.64 0.0015 K ATMQNLNDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2976.2976.2.dta 10 IPI00304458.1 "Keratin, type I cytoskeletal 23" 74 48209 2 2 1 1 2665 1165 1 0 1 539.7504 1077.4862 2 1077.4873 -0.0011 0 57.64 2.40E-05 K ATMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1843.1843.2.dta 10 IPI00797594.1 18 kDa protein 56 19009 3 3 3 3 794 3389 1 0 0 404.2036 806.3927 2 806.3923 0.0004 0 29.47 0.027 K LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4280.4280.2.dta 10 IPI00797594.1 18 kDa protein 56 19009 3 3 3 3 2071 3711 1 0 1 500.2957 998.5769 2 998.576 0.0008 0 51.56 7.20E-05 R LVVQIDNAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4627.4627.2.dta 10 IPI00797594.1 18 kDa protein 56 19009 3 3 3 3 2359 2756 1 0 0 518.7756 1035.5367 2 1035.5349 0.0018 1 19.85 0.043 K LAADDFRTK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3572.3572.2.dta 10 IPI00015309.1 "Keratin, type I cytoskeletal 12" 53 53592 2 2 2 2 807 3174 1 0 0 405.2239 808.4333 2 808.433 0.0002 0 28.79 0.013 R LASYLDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4046.4046.2.dta 10 IPI00015309.1 "Keratin, type I cytoskeletal 12" 53 53592 2 2 2 2 2556 3525 1 0 0 532.809 1063.6034 2 1063.6026 0.0008 1 45.25 0.00012 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4427.4427.2.dta 10 IPI00021298.1 "Keratin, type I cytoskeletal 20" 52 48514 2 2 2 2 3015 3345 1 0 0 561.7913 1121.5681 2 1121.5717 -0.0036 0 42.75 0.00042 R LEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4232.4232.2.dta 10 IPI00021298.1 "Keratin, type I cytoskeletal 20" 52 48514 2 2 2 2 5174 3996 1 0 0 690.3662 1378.7179 2 1378.7204 -0.0026 1 29.99 0.0046 K TRLEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4936.4936.2.dta 10 IPI00783306.1 Similar to keratin 14 50 9604 2 2 2 2 344 4464 1 0 0 350.7345 699.4544 2 699.4531 0.0014 0 26.96 0.0066 K ILLDVK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5443.5443.2.dta 10 IPI00783306.1 Similar to keratin 14 50 9604 2 2 2 2 3015 3345 1 0 0 561.7913 1121.5681 2 1121.5717 -0.0036 0 42.75 0.00042 R LEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4232.4232.2.dta 10 IPI00748465.1 44 kDa protein 49 44811 1 1 1 1 2561 3838 1 0 1 533.2831 1064.5516 2 1064.5502 0.0014 0 48.83 7.80E-05 K LEAEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4765.4765.2.dta 10 IPI00745035.1 "CDNA FLJ46155 fis, clone TESTI4001517, moderately similar to Keratin, type I cytoskeletal 18" 35 15117 2 2 2 2 794 3389 1 0 0 404.2036 806.3927 2 806.3923 0.0004 0 29.47 0.027 R LAADDFR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4280.4280.2.dta 10 IPI00745035.1 "CDNA FLJ46155 fis, clone TESTI4001517, moderately similar to Keratin, type I cytoskeletal 18" 35 15117 2 2 2 2 2345 3637 1 0 1 517.7842 1033.5538 2 1033.5556 -0.0018 1 30.37 0.013 R LAADDFRVK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4548.4548.2.dta 10 IPI00297641.1 "Keratin, type I cuticular Ha8" 29 52054 1 1 1 1 794 3389 1 0 0 404.2036 806.3927 2 806.3923 0.0004 0 29.47 0.027 K LAADDFR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4280.4280.2.dta 10 IPI00004550.5 Keratin-24 29 55567 2 2 2 2 794 3389 1 0 0 404.2036 806.3927 2 806.3923 0.0004 0 29.47 0.027 R LAADDFR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4280.4280.2.dta 10 IPI00004550.5 Keratin-24 29 55567 2 2 2 2 3639 4407 1 0 1 601.312 1200.6095 2 1200.6098 -0.0004 0 19.48 0.015 R QSVEADINGLR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5380.5380.2.dta 10 IPI00737922.1 "similar to Keratin, type I cytoskeletal 18" 28 9331 1 1 1 1 5863 4456 1 0 1 491.9261 1472.7564 3 1472.7583 -0.0018 1 27.51 0.014 K ASLENSLREVEAR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5434.5434.3.dta 10 IPI00008692.1 "Keratin, type I cuticular Ha6" 27 53354 2 2 2 2 794 3389 1 0 0 404.2036 806.3927 2 806.3923 0.0004 0 29.47 0.027 K LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4280.4280.2.dta 10 IPI00008692.1 "Keratin, type I cuticular Ha6" 27 53354 2 2 2 2 2359 2756 1 0 0 518.7756 1035.5367 2 1035.5349 0.0018 1 19.85 0.043 K LAADDFRTK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3572.3572.2.dta 11 1 IPI00221114.1 Isoform Beta of Transcription intermediary factor 1-gamma 619 122619 21 21 17 17 310 777 1 1 0 346.1547 690.2948 2 690.2942 0.0006 0 31.08 0.0014 R CPVCR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1423.1423.2.dta 11 1 IPI00221114.1 Isoform Beta of Transcription intermediary factor 1-gamma 619 122619 21 21 17 17 489 704 1 1 1 372.2119 742.4093 2 742.4086 0.0007 0 53.67 6.10E-05 R LAQNAAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1344.1344.2.dta 11 1 IPI00221114.1 Isoform Beta of Transcription intermediary factor 1-gamma 619 122619 21 21 17 17 1522 5115 1 1 1 464.7765 927.5384 2 927.5389 -0.0005 0 54.34 4.20E-05 K GAIENLLAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6130.6130.2.dta 11 1 IPI00221114.1 Isoform Beta of Transcription intermediary factor 1-gamma 619 122619 21 21 17 17 2182 937 1 1 1 507.7423 1013.4701 2 1013.4713 -0.0011 0 27.89 0.011 K TCIEAHQR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1596.1596.2.dta 11 1 IPI00221114.1 Isoform Beta of Transcription intermediary factor 1-gamma 619 122619 21 21 17 17 2183 944 1 1 1 338.8323 1013.4752 3 1013.4713 0.0039 0 22.14 0.018 K TCIEAHQR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1604.1604.3.dta 11 1 IPI00221114.1 Isoform Beta of Transcription intermediary factor 1-gamma 619 122619 21 21 17 17 2692 1308 1 1 1 360.8647 1079.5724 3 1079.5723 0.0001 0 20.38 0.022 K SDERPVHIK - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1998.1998.3.dta 11 1 IPI00221114.1 Isoform Beta of Transcription intermediary factor 1-gamma 619 122619 21 21 17 17 2834 3023 1 1 1 550.7277 1099.4408 2 1099.4427 -0.0019 0 34.94 0.00093 K LFCETCDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3877.3877.2.dta 11 1 IPI00221114.1 Isoform Beta of Transcription intermediary factor 1-gamma 619 122619 21 21 17 17 3394 2609 1 1 1 586.3054 1170.5963 2 1170.5993 -0.003 0 52.86 2.50E-05 K TAQGLSPVDQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3410.3410.2.dta 11 1 IPI00221114.1 Isoform Beta of Transcription intermediary factor 1-gamma 619 122619 21 21 17 17 3745 4907 1 1 1 605.8481 1209.6816 2 1209.683 -0.0013 0 61.45 5.80E-06 K TPGQINLAQLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5918.5918.2.dta 11 1 IPI00221114.1 Isoform Beta of Transcription intermediary factor 1-gamma 619 122619 21 21 17 17 4003 3045 1 1 1 620.3313 1238.648 2 1238.6507 -0.0026 1 34.65 0.0021 K TSLSFKSDQVK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3901.3901.2.dta 11 1 IPI00221114.1 Isoform Beta of Transcription intermediary factor 1-gamma 619 122619 21 21 17 17 4304 6629 1 1 1 636.861 1271.7075 2 1271.7085 -0.001 0 62.67 8.20E-06 K SLLQQLENVTK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7634.7634.2.dta 11 1 IPI00221114.1 Isoform Beta of Transcription intermediary factor 1-gamma 619 122619 21 21 17 17 4982 6287 1 1 1 677.3561 1352.6976 2 1352.6976 0 0 43.36 8.60E-05 R QIDLVDNYFVK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7297.7297.2.dta 11 1 IPI00221114.1 Isoform Beta of Transcription intermediary factor 1-gamma 619 122619 21 21 17 17 5071 2652 1 1 1 683.3195 1364.6245 2 1364.6208 0.0037 0 95.98 3.10E-09 R FNEADSEVAQAGK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3456.3456.2.dta 11 1 IPI00221114.1 Isoform Beta of Transcription intermediary factor 1-gamma 619 122619 21 21 17 17 5813 1869 1 1 0 488.9053 1463.6941 3 1463.6939 0.0002 1 21.45 0.045 R DCQLLEHKEHR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2606.2606.3.dta 11 1 IPI00221114.1 Isoform Beta of Transcription intermediary factor 1-gamma 619 122619 21 21 17 17 5814 1870 1 1 0 366.9313 1463.6961 4 1463.6939 0.0022 1 19 0.041 R DCQLLEHKEHR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2607.2607.4.dta 11 1 IPI00221114.1 Isoform Beta of Transcription intermediary factor 1-gamma 619 122619 21 21 17 17 5986 4122 1 1 1 743.4042 1484.7938 2 1484.7947 -0.0009 0 110.21 1.00E-10 K LLQQQNDITGLSR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5073.5073.2.dta 11 1 IPI00221114.1 Isoform Beta of Transcription intermediary factor 1-gamma 619 122619 21 21 17 17 6294 5634 1 1 1 772.8712 1543.7278 2 1543.7307 -0.0029 0 82.54 7.70E-08 R YQFLEEAFQNQK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6648.6648.2.dta 11 1 IPI00221114.1 Isoform Beta of Transcription intermediary factor 1-gamma 619 122619 21 21 17 17 6295 5896 1 1 1 772.8716 1543.7287 2 1543.7307 -0.0019 0 82.53 7.60E-08 R YQFLEEAFQNQK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6907.6907.2.dta 11 1 IPI00221114.1 Isoform Beta of Transcription intermediary factor 1-gamma 619 122619 21 21 17 17 6296 5917 1 1 1 515.5843 1543.731 3 1543.7307 0.0004 0 31.32 0.011 R YQFLEEAFQNQK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6927.6927.3.dta 11 1 IPI00221114.1 Isoform Beta of Transcription intermediary factor 1-gamma 619 122619 21 21 17 17 6305 3538 1 1 1 516.5962 1546.7667 3 1546.7641 0.0027 0 38.25 0.00049 K NYVHFAATQVQNR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4441.4441.3.dta 11 1 IPI00221114.1 Isoform Beta of Transcription intermediary factor 1-gamma 619 122619 21 21 17 17 8172 3230 1 1 1 716.3257 2145.9554 3 2145.9637 -0.0083 0 40.41 0.00016 R DIGKPEVEYDCDNLQHSK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4106.4106.3.dta 11 2 IPI00005184.1 Isoform Long of Transcription intermediary factor 1-alpha 372 118696 16 16 13 13 1210 1510 1 0 1 437.7533 873.492 2 873.4919 0 1 31.51 0.018 R LKSIEER Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2217.2217.2.dta 11 2 IPI00005184.1 Isoform Long of Transcription intermediary factor 1-alpha 372 118696 16 16 13 13 2204 5383 1 0 1 508.3236 1014.6327 2 1014.6325 0.0002 0 48.1 3.20E-05 K VIIDTLITK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6399.6399.2.dta 11 2 IPI00005184.1 Isoform Long of Transcription intermediary factor 1-alpha 372 118696 16 16 13 13 2662 1976 1 0 1 539.2748 1076.535 2 1076.5363 -0.0013 0 55.52 5.10E-05 K FTGNQIQNR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2722.2722.2.dta 11 2 IPI00005184.1 Isoform Long of Transcription intermediary factor 1-alpha 372 118696 16 16 13 13 2735 2239 1 0 1 543.3004 1084.5863 2 1084.5876 -0.0014 0 48.14 0.00026 R IIEVNQNQK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3007.3007.2.dta 11 2 IPI00005184.1 Isoform Long of Transcription intermediary factor 1-alpha 372 118696 16 16 13 13 2756 1777 1 0 1 544.7233 1087.432 2 1087.4314 0.0006 0 31.46 0.0011 K LYCETCDK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2506.2506.2.dta 11 2 IPI00005184.1 Isoform Long of Transcription intermediary factor 1-alpha 372 118696 16 16 13 13 4311 5934 1 0 1 637.366 1272.7175 2 1272.719 -0.0015 0 69.98 2.70E-07 K FPTQISLAQLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6945.6945.2.dta 11 2 IPI00005184.1 Isoform Long of Transcription intermediary factor 1-alpha 372 118696 16 16 13 13 4459 2278 1 0 1 646.8138 1291.613 2 1291.6143 -0.0013 0 43.63 0.00018 K DTTEVPSSTVEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3049.3049.2.dta 11 2 IPI00005184.1 Isoform Long of Transcription intermediary factor 1-alpha 372 118696 16 16 13 13 4497 7439 1 0 1 649.336 1296.6574 2 1296.6601 -0.0027 0 22.21 0.044 K LENYFEELLK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8437.8437.2.dta 11 2 IPI00005184.1 Isoform Long of Transcription intermediary factor 1-alpha 372 118696 16 16 13 13 5813 1869 1 0 0 488.9053 1463.6941 3 1463.6939 0.0002 1 21.45 0.045 R DCQLLEHKEHR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2606.2606.3.dta 11 2 IPI00005184.1 Isoform Long of Transcription intermediary factor 1-alpha 372 118696 16 16 13 13 5814 1870 1 0 0 366.9313 1463.6961 4 1463.6939 0.0022 1 19 0.041 R DCQLLEHKEHR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2607.2607.4.dta 11 2 IPI00005184.1 Isoform Long of Transcription intermediary factor 1-alpha 372 118696 16 16 13 13 6294 5634 1 0 1 772.8712 1543.7278 2 1543.7307 -0.0029 0 82.54 7.70E-08 R YQFIEEAFQNQK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6648.6648.2.dta 11 2 IPI00005184.1 Isoform Long of Transcription intermediary factor 1-alpha 372 118696 16 16 13 13 6295 5896 1 0 1 772.8716 1543.7287 2 1543.7307 -0.0019 0 82.53 7.60E-08 R YQFIEEAFQNQK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6907.6907.2.dta 11 2 IPI00005184.1 Isoform Long of Transcription intermediary factor 1-alpha 372 118696 16 16 13 13 6296 5917 1 0 1 515.5843 1543.731 3 1543.7307 0.0004 0 31.32 0.011 R YQFIEEAFQNQK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6927.6927.3.dta 11 2 IPI00005184.1 Isoform Long of Transcription intermediary factor 1-alpha 372 118696 16 16 13 13 7270 1522 1 0 1 568.6113 1702.8122 3 1702.8135 -0.0014 0 20.86 0.013 K DTNIDHGQPRPPSNR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2230.2230.3.dta 11 2 IPI00005184.1 Isoform Long of Transcription intermediary factor 1-alpha 372 118696 16 16 13 13 8293 3555 1 0 1 780.0573 2337.1501 3 2337.1561 -0.0059 0 28.98 0.0019 K QNPVVEQNSQPPSGLSSNQLSK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4459.4459.3.dta 11 2 IPI00005184.1 Isoform Long of Transcription intermediary factor 1-alpha 372 118696 16 16 13 13 8385 3159 1 0 1 833.7272 2498.1597 3 2498.1633 -0.0036 0 31.92 0.0012 K AVAAAAAASAAASGGPSAAPSGENEAESR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4029.4029.3.dta 11 IPI00010252.3 Isoform Alpha of Transcription intermediary factor 1-gamma 546 124610 20 20 16 16 310 777 1 0 0 346.1547 690.2948 2 690.2942 0.0006 0 31.08 0.0014 R CPVCR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1423.1423.2.dta 11 IPI00010252.3 Isoform Alpha of Transcription intermediary factor 1-gamma 546 124610 20 20 16 16 489 704 1 0 1 372.2119 742.4093 2 742.4086 0.0007 0 53.67 6.10E-05 R LAQNAAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1344.1344.2.dta 11 IPI00010252.3 Isoform Alpha of Transcription intermediary factor 1-gamma 546 124610 20 20 16 16 1522 5115 1 0 1 464.7765 927.5384 2 927.5389 -0.0005 0 54.34 4.20E-05 K GAIENLLAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6130.6130.2.dta 11 IPI00010252.3 Isoform Alpha of Transcription intermediary factor 1-gamma 546 124610 20 20 16 16 2182 937 1 0 1 507.7423 1013.4701 2 1013.4713 -0.0011 0 27.89 0.011 K TCIEAHQR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1596.1596.2.dta 11 IPI00010252.3 Isoform Alpha of Transcription intermediary factor 1-gamma 546 124610 20 20 16 16 2183 944 1 0 1 338.8323 1013.4752 3 1013.4713 0.0039 0 22.14 0.018 K TCIEAHQR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1604.1604.3.dta 11 IPI00010252.3 Isoform Alpha of Transcription intermediary factor 1-gamma 546 124610 20 20 16 16 2692 1308 1 0 1 360.8647 1079.5724 3 1079.5723 0.0001 0 20.38 0.022 K SDERPVHIK - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1998.1998.3.dta 11 IPI00010252.3 Isoform Alpha of Transcription intermediary factor 1-gamma 546 124610 20 20 16 16 2834 3023 1 0 1 550.7277 1099.4408 2 1099.4427 -0.0019 0 34.94 0.00093 K LFCETCDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3877.3877.2.dta 11 IPI00010252.3 Isoform Alpha of Transcription intermediary factor 1-gamma 546 124610 20 20 16 16 3394 2609 1 0 1 586.3054 1170.5963 2 1170.5993 -0.003 0 52.86 2.50E-05 K TAQGLSPVDQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3410.3410.2.dta 11 IPI00010252.3 Isoform Alpha of Transcription intermediary factor 1-gamma 546 124610 20 20 16 16 3745 4907 1 0 1 605.8481 1209.6816 2 1209.683 -0.0013 0 61.45 5.80E-06 K TPGQINLAQLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5918.5918.2.dta 11 IPI00010252.3 Isoform Alpha of Transcription intermediary factor 1-gamma 546 124610 20 20 16 16 4003 3045 1 0 1 620.3313 1238.648 2 1238.6507 -0.0026 1 34.65 0.0021 K TSLSFKSDQVK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3901.3901.2.dta 11 IPI00010252.3 Isoform Alpha of Transcription intermediary factor 1-gamma 546 124610 20 20 16 16 4304 6629 1 0 1 636.861 1271.7075 2 1271.7085 -0.001 0 62.67 8.20E-06 K SLLQQLENVTK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7634.7634.2.dta 11 IPI00010252.3 Isoform Alpha of Transcription intermediary factor 1-gamma 546 124610 20 20 16 16 4982 6287 1 0 1 677.3561 1352.6976 2 1352.6976 0 0 43.36 8.60E-05 R QIDLVDNYFVK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7297.7297.2.dta 11 IPI00010252.3 Isoform Alpha of Transcription intermediary factor 1-gamma 546 124610 20 20 16 16 5813 1869 1 0 0 488.9053 1463.6941 3 1463.6939 0.0002 1 21.45 0.045 R DCQLLEHKEHR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2606.2606.3.dta 11 IPI00010252.3 Isoform Alpha of Transcription intermediary factor 1-gamma 546 124610 20 20 16 16 5814 1870 1 0 0 366.9313 1463.6961 4 1463.6939 0.0022 1 19 0.041 R DCQLLEHKEHR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2607.2607.4.dta 11 IPI00010252.3 Isoform Alpha of Transcription intermediary factor 1-gamma 546 124610 20 20 16 16 5986 4122 1 0 1 743.4042 1484.7938 2 1484.7947 -0.0009 0 110.21 1.00E-10 K LLQQQNDITGLSR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5073.5073.2.dta 11 IPI00010252.3 Isoform Alpha of Transcription intermediary factor 1-gamma 546 124610 20 20 16 16 6294 5634 1 0 1 772.8712 1543.7278 2 1543.7307 -0.0029 0 82.54 7.70E-08 R YQFLEEAFQNQK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6648.6648.2.dta 11 IPI00010252.3 Isoform Alpha of Transcription intermediary factor 1-gamma 546 124610 20 20 16 16 6295 5896 1 0 1 772.8716 1543.7287 2 1543.7307 -0.0019 0 82.53 7.60E-08 R YQFLEEAFQNQK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6907.6907.2.dta 11 IPI00010252.3 Isoform Alpha of Transcription intermediary factor 1-gamma 546 124610 20 20 16 16 6296 5917 1 0 1 515.5843 1543.731 3 1543.7307 0.0004 0 31.32 0.011 R YQFLEEAFQNQK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6927.6927.3.dta 11 IPI00010252.3 Isoform Alpha of Transcription intermediary factor 1-gamma 546 124610 20 20 16 16 6305 3538 1 0 1 516.5962 1546.7667 3 1546.7641 0.0027 0 38.25 0.00049 K NYVHFAATQVQNR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4441.4441.3.dta 11 IPI00010252.3 Isoform Alpha of Transcription intermediary factor 1-gamma 546 124610 20 20 16 16 8172 3230 1 0 1 716.3257 2145.9554 3 2145.9637 -0.0083 0 40.41 0.00016 R DIGKPEVEYDCDNLQHSK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4106.4106.3.dta 11 IPI00444332.1 "CDNA FLJ45687 fis, clone FCBBF3020030, highly similar to Transcription intermediary factor 1-alpha" 343 63509 12 12 9 9 2204 5383 1 0 1 508.3236 1014.6327 2 1014.6325 0.0002 0 48.1 3.20E-05 K VIIDTLITK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6399.6399.2.dta 11 IPI00444332.1 "CDNA FLJ45687 fis, clone FCBBF3020030, highly similar to Transcription intermediary factor 1-alpha" 343 63509 12 12 9 9 2662 1976 1 0 1 539.2748 1076.535 2 1076.5363 -0.0013 0 55.52 5.10E-05 K FTGNQIQNR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2722.2722.2.dta 11 IPI00444332.1 "CDNA FLJ45687 fis, clone FCBBF3020030, highly similar to Transcription intermediary factor 1-alpha" 343 63509 12 12 9 9 2735 2239 1 0 1 543.3004 1084.5863 2 1084.5876 -0.0014 0 48.14 0.00026 R IIEVNQNQK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3007.3007.2.dta 11 IPI00444332.1 "CDNA FLJ45687 fis, clone FCBBF3020030, highly similar to Transcription intermediary factor 1-alpha" 343 63509 12 12 9 9 2756 1777 1 0 1 544.7233 1087.432 2 1087.4314 0.0006 0 31.46 0.0011 K LYCETCDK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2506.2506.2.dta 11 IPI00444332.1 "CDNA FLJ45687 fis, clone FCBBF3020030, highly similar to Transcription intermediary factor 1-alpha" 343 63509 12 12 9 9 4311 5934 1 0 1 637.366 1272.7175 2 1272.719 -0.0015 0 69.98 2.70E-07 K FPTQISLAQLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6945.6945.2.dta 11 IPI00444332.1 "CDNA FLJ45687 fis, clone FCBBF3020030, highly similar to Transcription intermediary factor 1-alpha" 343 63509 12 12 9 9 4459 2278 1 0 1 646.8138 1291.613 2 1291.6143 -0.0013 0 43.63 0.00018 K DTTEVPSSTVEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3049.3049.2.dta 11 IPI00444332.1 "CDNA FLJ45687 fis, clone FCBBF3020030, highly similar to Transcription intermediary factor 1-alpha" 343 63509 12 12 9 9 5813 1869 1 0 0 488.9053 1463.6941 3 1463.6939 0.0002 1 21.45 0.045 R DCQLLEHKEHR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2606.2606.3.dta 11 IPI00444332.1 "CDNA FLJ45687 fis, clone FCBBF3020030, highly similar to Transcription intermediary factor 1-alpha" 343 63509 12 12 9 9 5814 1870 1 0 0 366.9313 1463.6961 4 1463.6939 0.0022 1 19 0.041 R DCQLLEHKEHR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2607.2607.4.dta 11 IPI00444332.1 "CDNA FLJ45687 fis, clone FCBBF3020030, highly similar to Transcription intermediary factor 1-alpha" 343 63509 12 12 9 9 6294 5634 1 0 1 772.8712 1543.7278 2 1543.7307 -0.0029 0 82.54 7.70E-08 R YQFIEEAFQNQK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6648.6648.2.dta 11 IPI00444332.1 "CDNA FLJ45687 fis, clone FCBBF3020030, highly similar to Transcription intermediary factor 1-alpha" 343 63509 12 12 9 9 6295 5896 1 0 1 772.8716 1543.7287 2 1543.7307 -0.0019 0 82.53 7.60E-08 R YQFIEEAFQNQK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6907.6907.2.dta 11 IPI00444332.1 "CDNA FLJ45687 fis, clone FCBBF3020030, highly similar to Transcription intermediary factor 1-alpha" 343 63509 12 12 9 9 6296 5917 1 0 1 515.5843 1543.731 3 1543.7307 0.0004 0 31.32 0.011 R YQFIEEAFQNQK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6927.6927.3.dta 11 IPI00444332.1 "CDNA FLJ45687 fis, clone FCBBF3020030, highly similar to Transcription intermediary factor 1-alpha" 343 63509 12 12 9 9 8293 3555 1 0 1 780.0573 2337.1501 3 2337.1561 -0.0059 0 28.98 0.0019 K QNPVVEQNSQPPSGLSSNQLSK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4459.4459.3.dta 12 1 IPI00376317.3 autoantigen RCD8 612 152992 22 22 20 20 716 4401 1 1 1 395.7448 789.475 2 789.4749 0.0001 0 26.97 0.013 K QGFIVVK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5374.5374.2.dta 12 1 IPI00376317.3 autoantigen RCD8 612 152992 22 22 20 20 1196 1055 1 1 1 436.7328 871.4511 2 871.4512 0 0 47.21 0.0003 R ALAEGQQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1724.1724.2.dta 12 1 IPI00376317.3 autoantigen RCD8 612 152992 22 22 20 20 1203 3651 1 1 1 437.2427 872.4708 2 872.4716 -0.0008 0 43.3 0.0015 K NLTDAIAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4563.4563.2.dta 12 1 IPI00376317.3 autoantigen RCD8 612 152992 22 22 20 20 1501 4485 1 1 1 463.2771 924.5396 2 924.5392 0.0003 0 53.55 9.50E-06 R EPVLAQLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5466.5466.2.dta 12 1 IPI00376317.3 autoantigen RCD8 612 152992 22 22 20 20 2762 2879 1 1 1 544.8063 1087.598 2 1087.5985 -0.0005 1 29.42 0.0061 K SKNLTDAIAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3721.3721.2.dta 12 1 IPI00376317.3 autoantigen RCD8 612 152992 22 22 20 20 2763 2876 1 1 1 363.5405 1087.5998 3 1087.5985 0.0012 1 43.16 0.00091 K SKNLTDAIAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3717.3717.3.dta 12 1 IPI00376317.3 autoantigen RCD8 612 152992 22 22 20 20 3098 4159 1 1 1 567.7987 1133.5829 2 1133.5829 -0.0001 0 49.45 6.40E-05 R FLITGADQNR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5113.5113.2.dta 12 1 IPI00376317.3 autoantigen RCD8 612 152992 22 22 20 20 3136 2524 1 1 1 570.2937 1138.5729 2 1138.5731 -0.0002 0 64.83 5.50E-06 R HSQEELLQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3318.3318.2.dta 12 1 IPI00376317.3 autoantigen RCD8 612 152992 22 22 20 20 4073 6926 1 1 1 624.3082 1246.6018 2 1246.6016 0.0002 0 36.64 0.0013 R AEVWDLDMLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7928.7928.2.dta 12 1 IPI00376317.3 autoantigen RCD8 612 152992 22 22 20 20 4214 6447 1 1 1 631.3789 1260.7433 2 1260.7442 -0.0009 0 38.48 0.00053 R GLLPGLLPAPADK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7454.7454.2.dta 12 1 IPI00376317.3 autoantigen RCD8 612 152992 22 22 20 20 5328 691 1 1 1 698.8497 1395.6848 2 1395.6855 -0.0007 1 34 0.0017 R ALETRHEQEQR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1330.1330.2.dta 12 1 IPI00376317.3 autoantigen RCD8 612 152992 22 22 20 20 5816 6429 1 1 1 732.8883 1463.7621 2 1463.766 -0.004 0 60.64 1.30E-05 R EAFQSVVLPAFEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7436.7436.2.dta 12 1 IPI00376317.3 autoantigen RCD8 612 152992 22 22 20 20 6091 2994 1 1 1 502.9322 1505.7747 3 1505.7759 -0.0013 1 15.32 0.037 K LTAVEGSMKENISK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3845.3845.3.dta 12 1 IPI00376317.3 autoantigen RCD8 612 152992 22 22 20 20 6254 3644 1 1 1 769.3832 1536.7518 2 1536.7519 -0.0001 0 91.8 2.50E-09 K EVEIVASSDSSISSK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4556.4556.2.dta 12 1 IPI00376317.3 autoantigen RCD8 612 152992 22 22 20 20 6382 4332 1 1 1 782.3813 1562.748 2 1562.7511 -0.0031 0 66.67 2.00E-06 R AAADTLQGPMQAAYR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5299.5299.2.dta 12 1 IPI00376317.3 autoantigen RCD8 612 152992 22 22 20 20 6421 4832 1 1 1 524.267 1569.7791 3 1569.7787 0.0003 0 24.3 0.022 R SSHSTWPVDVSQIK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5838.5838.3.dta 12 1 IPI00376317.3 autoantigen RCD8 612 152992 22 22 20 20 6529 3158 1 1 1 790.3792 1578.7439 2 1578.746 -0.0021 0 51.28 2.20E-05 R AAADTLQGPMQAAYR E Oxidation (M) 0.000000000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4028.4028.2.dta 12 1 IPI00376317.3 autoantigen RCD8 612 152992 22 22 20 20 6913 3612 1 1 1 824.9132 1647.8119 2 1647.8138 -0.0019 0 71.02 2.20E-07 R SLEPMAGQLSNSVATK L Oxidation (M) 0.0000100000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4521.4521.2.dta 12 1 IPI00376317.3 autoantigen RCD8 612 152992 22 22 20 20 7378 5842 1 1 1 866.3795 1730.7444 2 1730.7505 -0.0061 0 85.37 1.10E-08 K SCQAMFQQINDSFR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6852.6852.2.dta 12 1 IPI00376317.3 autoantigen RCD8 612 152992 22 22 20 20 7633 4736 1 1 1 607.6329 1819.8768 3 1819.8774 -0.0006 0 42.47 0.00012 R LGTQEYLQQLESHMK S Oxidation (M) 0.000000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5737.5737.3.dta 12 1 IPI00376317.3 autoantigen RCD8 612 152992 22 22 20 20 7722 4114 1 1 1 617.6614 1849.9623 3 1849.9646 -0.0023 1 24.2 0.017 R ELAELRHSQEELLQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5064.5064.3.dta 12 1 IPI00376317.3 autoantigen RCD8 612 152992 22 22 20 20 8086 4911 1 1 1 676.6761 2027.0064 3 2027.0106 -0.0042 0 26.85 0.0041 R LCTQLEGLQSTVTGHVER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5922.5922.3.dta 12 IPI00477242.1 Autoantigen 595 133202 21 21 19 19 716 4401 1 0 1 395.7448 789.475 2 789.4749 0.0001 0 26.97 0.013 K QGFIVVK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5374.5374.2.dta 12 IPI00477242.1 Autoantigen 595 133202 21 21 19 19 1196 1055 1 0 1 436.7328 871.4511 2 871.4512 0 0 47.21 0.0003 R ALAEGQQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1724.1724.2.dta 12 IPI00477242.1 Autoantigen 595 133202 21 21 19 19 1203 3651 1 0 1 437.2427 872.4708 2 872.4716 -0.0008 0 43.3 0.0015 K NLTDAIAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4563.4563.2.dta 12 IPI00477242.1 Autoantigen 595 133202 21 21 19 19 1501 4485 1 0 1 463.2771 924.5396 2 924.5392 0.0003 0 53.55 9.50E-06 R EPVLAQLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5466.5466.2.dta 12 IPI00477242.1 Autoantigen 595 133202 21 21 19 19 2762 2879 1 0 1 544.8063 1087.598 2 1087.5985 -0.0005 1 29.42 0.0061 K SKNLTDAIAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3721.3721.2.dta 12 IPI00477242.1 Autoantigen 595 133202 21 21 19 19 2763 2876 1 0 1 363.5405 1087.5998 3 1087.5985 0.0012 1 43.16 0.00091 K SKNLTDAIAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3717.3717.3.dta 12 IPI00477242.1 Autoantigen 595 133202 21 21 19 19 3098 4159 1 0 1 567.7987 1133.5829 2 1133.5829 -0.0001 0 49.45 6.40E-05 R FLITGADQNR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5113.5113.2.dta 12 IPI00477242.1 Autoantigen 595 133202 21 21 19 19 3136 2524 1 0 1 570.2937 1138.5729 2 1138.5731 -0.0002 0 64.83 5.50E-06 R HSQEELLQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3318.3318.2.dta 12 IPI00477242.1 Autoantigen 595 133202 21 21 19 19 4214 6447 1 0 1 631.3789 1260.7433 2 1260.7442 -0.0009 0 38.48 0.00053 R GLLPGLLPAPADK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7454.7454.2.dta 12 IPI00477242.1 Autoantigen 595 133202 21 21 19 19 5328 691 1 0 1 698.8497 1395.6848 2 1395.6855 -0.0007 1 34 0.0017 R ALETRHEQEQR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1330.1330.2.dta 12 IPI00477242.1 Autoantigen 595 133202 21 21 19 19 5816 6429 1 0 1 732.8883 1463.7621 2 1463.766 -0.004 0 60.64 1.30E-05 R EAFQSVVLPAFEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7436.7436.2.dta 12 IPI00477242.1 Autoantigen 595 133202 21 21 19 19 6091 2994 1 0 1 502.9322 1505.7747 3 1505.7759 -0.0013 1 15.32 0.037 K LTAVEGSMKENISK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3845.3845.3.dta 12 IPI00477242.1 Autoantigen 595 133202 21 21 19 19 6254 3644 1 0 1 769.3832 1536.7518 2 1536.7519 -0.0001 0 91.8 2.50E-09 K EVEIVASSDSSISSK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4556.4556.2.dta 12 IPI00477242.1 Autoantigen 595 133202 21 21 19 19 6382 4332 1 0 1 782.3813 1562.748 2 1562.7511 -0.0031 0 66.67 2.00E-06 R AAADTLQGPMQAAYR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5299.5299.2.dta 12 IPI00477242.1 Autoantigen 595 133202 21 21 19 19 6421 4832 1 0 1 524.267 1569.7791 3 1569.7787 0.0003 0 24.3 0.022 R SSHSTWPVDVSQIK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5838.5838.3.dta 12 IPI00477242.1 Autoantigen 595 133202 21 21 19 19 6529 3158 1 0 1 790.3792 1578.7439 2 1578.746 -0.0021 0 51.28 2.20E-05 R AAADTLQGPMQAAYR E Oxidation (M) 0.000000000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4028.4028.2.dta 12 IPI00477242.1 Autoantigen 595 133202 21 21 19 19 6913 3612 1 0 1 824.9132 1647.8119 2 1647.8138 -0.0019 0 71.02 2.20E-07 R SLEPMAGQLSNSVATK L Oxidation (M) 0.0000100000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4521.4521.2.dta 12 IPI00477242.1 Autoantigen 595 133202 21 21 19 19 7378 5842 1 0 1 866.3795 1730.7444 2 1730.7505 -0.0061 0 85.37 1.10E-08 K SCQAMFQQINDSFR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6852.6852.2.dta 12 IPI00477242.1 Autoantigen 595 133202 21 21 19 19 7633 4736 1 0 1 607.6329 1819.8768 3 1819.8774 -0.0006 0 42.47 0.00012 R LGTQEYLQQLESHMK S Oxidation (M) 0.000000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5737.5737.3.dta 12 IPI00477242.1 Autoantigen 595 133202 21 21 19 19 7722 4114 1 0 1 617.6614 1849.9623 3 1849.9646 -0.0023 1 24.2 0.017 R ELAELRHSQEELLQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5064.5064.3.dta 12 IPI00477242.1 Autoantigen 595 133202 21 21 19 19 8086 4911 1 0 1 676.6761 2027.0064 3 2027.0106 -0.0042 0 26.85 0.0041 R LCTQLEGLQSTVTGHVER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5922.5922.3.dta 12 IPI00641449.1 "CDNA FLJ46741 fis, clone TRACH3021373, highly similar to Homo sapiens autoantigen" 521 123252 20 20 18 18 716 4401 1 0 1 395.7448 789.475 2 789.4749 0.0001 0 26.97 0.013 K QGFIVVK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5374.5374.2.dta 12 IPI00641449.1 "CDNA FLJ46741 fis, clone TRACH3021373, highly similar to Homo sapiens autoantigen" 521 123252 20 20 18 18 1196 1055 1 0 1 436.7328 871.4511 2 871.4512 0 0 47.21 0.0003 R ALAEGQQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1724.1724.2.dta 12 IPI00641449.1 "CDNA FLJ46741 fis, clone TRACH3021373, highly similar to Homo sapiens autoantigen" 521 123252 20 20 18 18 1203 3651 1 0 1 437.2427 872.4708 2 872.4716 -0.0008 0 43.3 0.0015 K NLTDAIAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4563.4563.2.dta 12 IPI00641449.1 "CDNA FLJ46741 fis, clone TRACH3021373, highly similar to Homo sapiens autoantigen" 521 123252 20 20 18 18 1501 4485 1 0 1 463.2771 924.5396 2 924.5392 0.0003 0 53.55 9.50E-06 R EPVLAQLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5466.5466.2.dta 12 IPI00641449.1 "CDNA FLJ46741 fis, clone TRACH3021373, highly similar to Homo sapiens autoantigen" 521 123252 20 20 18 18 2762 2879 1 0 1 544.8063 1087.598 2 1087.5985 -0.0005 1 29.42 0.0061 K SKNLTDAIAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3721.3721.2.dta 12 IPI00641449.1 "CDNA FLJ46741 fis, clone TRACH3021373, highly similar to Homo sapiens autoantigen" 521 123252 20 20 18 18 2763 2876 1 0 1 363.5405 1087.5998 3 1087.5985 0.0012 1 43.16 0.00091 K SKNLTDAIAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3717.3717.3.dta 12 IPI00641449.1 "CDNA FLJ46741 fis, clone TRACH3021373, highly similar to Homo sapiens autoantigen" 521 123252 20 20 18 18 3098 4159 1 0 1 567.7987 1133.5829 2 1133.5829 -0.0001 0 49.45 6.40E-05 R FLITGADQNR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5113.5113.2.dta 12 IPI00641449.1 "CDNA FLJ46741 fis, clone TRACH3021373, highly similar to Homo sapiens autoantigen" 521 123252 20 20 18 18 3136 2524 1 0 1 570.2937 1138.5729 2 1138.5731 -0.0002 0 64.83 5.50E-06 R HSQEELLQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3318.3318.2.dta 12 IPI00641449.1 "CDNA FLJ46741 fis, clone TRACH3021373, highly similar to Homo sapiens autoantigen" 521 123252 20 20 18 18 4214 6447 1 0 1 631.3789 1260.7433 2 1260.7442 -0.0009 0 38.48 0.00053 R GLLPGLLPAPADK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7454.7454.2.dta 12 IPI00641449.1 "CDNA FLJ46741 fis, clone TRACH3021373, highly similar to Homo sapiens autoantigen" 521 123252 20 20 18 18 5328 691 1 0 1 698.8497 1395.6848 2 1395.6855 -0.0007 1 34 0.0017 R ALETRHEQEQR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1330.1330.2.dta 12 IPI00641449.1 "CDNA FLJ46741 fis, clone TRACH3021373, highly similar to Homo sapiens autoantigen" 521 123252 20 20 18 18 5816 6429 1 0 1 732.8883 1463.7621 2 1463.766 -0.004 0 60.64 1.30E-05 R EAFQSVVLPAFEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7436.7436.2.dta 12 IPI00641449.1 "CDNA FLJ46741 fis, clone TRACH3021373, highly similar to Homo sapiens autoantigen" 521 123252 20 20 18 18 6091 2994 1 0 1 502.9322 1505.7747 3 1505.7759 -0.0013 1 15.32 0.037 K LTAVEGSMKENISK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3845.3845.3.dta 12 IPI00641449.1 "CDNA FLJ46741 fis, clone TRACH3021373, highly similar to Homo sapiens autoantigen" 521 123252 20 20 18 18 6382 4332 1 0 1 782.3813 1562.748 2 1562.7511 -0.0031 0 66.67 2.00E-06 R AAADTLQGPMQAAYR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5299.5299.2.dta 12 IPI00641449.1 "CDNA FLJ46741 fis, clone TRACH3021373, highly similar to Homo sapiens autoantigen" 521 123252 20 20 18 18 6421 4832 1 0 1 524.267 1569.7791 3 1569.7787 0.0003 0 24.3 0.022 R SSHSTWPVDVSQIK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5838.5838.3.dta 12 IPI00641449.1 "CDNA FLJ46741 fis, clone TRACH3021373, highly similar to Homo sapiens autoantigen" 521 123252 20 20 18 18 6529 3158 1 0 1 790.3792 1578.7439 2 1578.746 -0.0021 0 51.28 2.20E-05 R AAADTLQGPMQAAYR E Oxidation (M) 0.000000000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4028.4028.2.dta 12 IPI00641449.1 "CDNA FLJ46741 fis, clone TRACH3021373, highly similar to Homo sapiens autoantigen" 521 123252 20 20 18 18 6913 3612 1 0 1 824.9132 1647.8119 2 1647.8138 -0.0019 0 71.02 2.20E-07 R SLEPMAGQLSNSVATK L Oxidation (M) 0.0000100000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4521.4521.2.dta 12 IPI00641449.1 "CDNA FLJ46741 fis, clone TRACH3021373, highly similar to Homo sapiens autoantigen" 521 123252 20 20 18 18 7378 5842 1 0 1 866.3795 1730.7444 2 1730.7505 -0.0061 0 85.37 1.10E-08 K SCQAMFQQINDSFR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6852.6852.2.dta 12 IPI00641449.1 "CDNA FLJ46741 fis, clone TRACH3021373, highly similar to Homo sapiens autoantigen" 521 123252 20 20 18 18 7633 4736 1 0 1 607.6329 1819.8768 3 1819.8774 -0.0006 0 42.47 0.00012 R LGTQEYLQQLESHMK S Oxidation (M) 0.000000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5737.5737.3.dta 12 IPI00641449.1 "CDNA FLJ46741 fis, clone TRACH3021373, highly similar to Homo sapiens autoantigen" 521 123252 20 20 18 18 7722 4114 1 0 1 617.6614 1849.9623 3 1849.9646 -0.0023 1 24.2 0.017 R ELAELRHSQEELLQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5064.5064.3.dta 12 IPI00641449.1 "CDNA FLJ46741 fis, clone TRACH3021373, highly similar to Homo sapiens autoantigen" 521 123252 20 20 18 18 8086 4911 1 0 1 676.6761 2027.0064 3 2027.0106 -0.0042 0 26.85 0.0041 R LCTQLEGLQSTVTGHVER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5922.5922.3.dta 13 1 IPI00301263.2 CAD protein 558 245167 23 23 23 23 483 1832 1 1 1 368.2063 734.398 2 734.3963 0.0017 0 27.31 0.039 K FIQEAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2566.2566.2.dta 13 1 IPI00301263.2 CAD protein 558 245167 23 23 23 23 1450 5079 1 1 1 458.7843 915.5541 2 915.5542 -0.0001 0 45.11 0.00012 R LGYPVLVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6094.6094.2.dta 13 1 IPI00301263.2 CAD protein 558 245167 23 23 23 23 1456 2360 1 1 1 459.7435 917.4724 2 917.4719 0.0005 0 55.77 5.30E-05 R VFNTGGAPR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3138.3138.2.dta 13 1 IPI00301263.2 CAD protein 558 245167 23 23 23 23 1821 4817 1 1 1 484.2534 966.4922 2 966.4923 -0.0001 0 51.95 3.60E-05 K VPQFSFSR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5822.5822.2.dta 13 1 IPI00301263.2 CAD protein 558 245167 23 23 23 23 1911 3119 1 1 1 490.7738 979.5331 2 979.5338 -0.0007 0 56.18 2.60E-05 R FLSSAAAVSK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3985.3985.2.dta 13 1 IPI00301263.2 CAD protein 558 245167 23 23 23 23 1939 4075 1 1 1 493.2347 984.4549 2 984.4552 -0.0004 0 28.65 0.014 R SFEEAFQK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5022.5022.2.dta 13 1 IPI00301263.2 CAD protein 558 245167 23 23 23 23 1949 4330 1 1 1 493.3182 984.6219 2 984.6219 0 1 40.15 0.00012 R KEEILLIK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5297.5297.2.dta 13 1 IPI00301263.2 CAD protein 558 245167 23 23 23 23 2097 5009 1 1 1 501.7863 1001.5581 2 1001.5579 0.0001 0 34.09 0.0057 R ILALDCGLK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6023.6023.2.dta 13 1 IPI00301263.2 CAD protein 558 245167 23 23 23 23 2229 3319 1 1 1 510.2525 1018.4905 2 1018.4931 -0.0026 0 37.02 0.00069 R ELSDLESAR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4204.4204.2.dta 13 1 IPI00301263.2 CAD protein 558 245167 23 23 23 23 2317 5371 1 1 1 515.7928 1029.571 2 1029.5706 0.0004 0 53.55 9.00E-05 R SILEQLAEK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6387.6387.2.dta 13 1 IPI00301263.2 CAD protein 558 245167 23 23 23 23 2608 6682 1 1 1 536.8033 1071.592 2 1071.5924 -0.0004 0 40.2 0.0012 R LSLDDLLQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7687.7687.2.dta 13 1 IPI00301263.2 CAD protein 558 245167 23 23 23 23 2670 1474 1 1 1 360.1911 1077.5516 3 1077.5502 0.0014 0 31.33 0.0047 R SVHICHVAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2178.2178.3.dta 13 1 IPI00301263.2 CAD protein 558 245167 23 23 23 23 2935 3912 1 1 1 557.7997 1113.5849 2 1113.5852 -0.0003 0 38.46 0.0023 R QELGICPAVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4845.4845.2.dta 13 1 IPI00301263.2 CAD protein 558 245167 23 23 23 23 2943 2363 1 1 1 558.2612 1114.5078 2 1114.5077 0.0001 0 61.38 5.10E-06 R TSSSFAAAMAR L Oxidation (M) 0.00000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3141.3141.2.dta 13 1 IPI00301263.2 CAD protein 558 245167 23 23 23 23 3557 7177 1 1 1 596.3763 1190.738 2 1190.7387 -0.0006 0 18.33 0.033 K LALGIPLPELR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8177.8177.2.dta 13 1 IPI00301263.2 CAD protein 558 245167 23 23 23 23 3628 3941 1 1 1 600.7922 1199.5698 2 1199.5724 -0.0026 0 15.12 0.039 K AHWTPFEGQK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4876.4876.2.dta 13 1 IPI00301263.2 CAD protein 558 245167 23 23 23 23 3847 4933 1 1 1 612.8335 1223.6524 2 1223.655 -0.0026 0 50.7 1.80E-05 K ATGYPLAYVAAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5945.5945.2.dta 13 1 IPI00301263.2 CAD protein 558 245167 23 23 23 23 3882 6808 1 1 1 614.8657 1227.7169 2 1227.7187 -0.0018 0 62.22 5.10E-06 K TLGVDLVALATR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7811.7811.2.dta 13 1 IPI00301263.2 CAD protein 558 245167 23 23 23 23 4145 1396 1 1 1 629.3121 1256.6097 2 1256.6109 -0.0012 0 53.72 7.20E-05 K EATAGNPGGQTVR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2093.2093.2.dta 13 1 IPI00301263.2 CAD protein 558 245167 23 23 23 23 5389 4918 1 1 1 702.8944 1403.7743 2 1403.7773 -0.003 0 22.49 0.0078 R GQPLPPDLLQQAK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5929.5929.2.dta 13 1 IPI00301263.2 CAD protein 558 245167 23 23 23 23 5761 3937 1 1 1 729.8572 1457.6998 2 1457.6998 0 0 61.6 1.20E-05 R VNEISVEVDSDPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4872.4872.2.dta 13 1 IPI00301263.2 CAD protein 558 245167 23 23 23 23 6214 5962 1 1 1 763.9195 1525.8244 2 1525.8253 -0.0008 0 53.4 9.80E-06 R LLDTIGISQPQWR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6973.6973.2.dta 13 1 IPI00301263.2 CAD protein 558 245167 23 23 23 23 6361 3697 1 1 1 779.889 1557.7634 2 1557.7634 0 0 69.96 2.80E-07 R VLGTSPEAIDSAENR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4612.4612.2.dta 14 1 IPI00019502.3 Myosin-9 529 227646 27 27 26 26 415 2557 1 1 1 360.7073 719.4001 2 719.4 0.0001 0 31.76 0.0095 K LMATLR N Oxidation (M) 0.010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3353.3353.2.dta 14 1 IPI00019502.3 Myosin-9 529 227646 27 27 26 26 1353 3535 1 1 1 452.2611 902.5077 2 902.5073 0.0004 0 34.79 0.0067 K ASITALEAK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4438.4438.2.dta 14 1 IPI00019502.3 Myosin-9 529 227646 27 27 26 26 1486 4760 1 1 1 462.7504 923.4862 2 923.4865 -0.0003 0 46.68 0.00011 R VVFQEFR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5762.5762.2.dta 14 1 IPI00019502.3 Myosin-9 529 227646 27 27 26 26 1754 907 1 1 1 480.2615 958.5085 2 958.5083 0.0001 1 45.6 0.00058 K VNKDDIQK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1564.1564.2.dta 14 1 IPI00019502.3 Myosin-9 529 227646 27 27 26 26 2111 1844 1 1 1 502.7844 1003.5542 2 1003.555 -0.0008 1 43.8 0.00028 R TELADKVTK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2579.2579.2.dta 14 1 IPI00019502.3 Myosin-9 529 227646 27 27 26 26 2213 4141 1 1 1 509.2606 1016.5067 2 1016.5073 -0.0006 0 53.25 4.90E-05 R CNGVLEGIR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5093.5093.2.dta 14 1 IPI00019502.3 Myosin-9 529 227646 27 27 26 26 2263 1691 1 1 1 342.1823 1023.5251 3 1023.5237 0.0014 1 19.79 0.048 K ATDKSFVEK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2413.2413.3.dta 14 1 IPI00019502.3 Myosin-9 529 227646 27 27 26 26 2360 2383 1 1 1 346.1947 1035.5623 3 1035.56 0.0022 1 22.66 0.0078 K VAAYDKLEK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3163.3163.3.dta 14 1 IPI00019502.3 Myosin-9 529 227646 27 27 26 26 2382 3446 1 1 1 347.2261 1038.6565 3 1038.655 0.0015 0 22.61 0.017 K VKPLLQVSR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4341.4341.3.dta 14 1 IPI00019502.3 Myosin-9 529 227646 27 27 26 26 2840 2911 1 1 1 550.8215 1099.6284 2 1099.6237 0.0047 1 23.48 0.02 R EQEVNILKK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3755.3755.2.dta 14 1 IPI00019502.3 Myosin-9 529 227646 27 27 26 26 3248 806 1 1 1 577.7845 1153.5545 2 1153.555 -0.0004 0 25.35 0.0085 K VMQEQGTHPK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1454.1454.2.dta 14 1 IPI00019502.3 Myosin-9 529 227646 27 27 26 26 3263 4896 1 1 1 578.3345 1154.6545 2 1154.656 -0.0015 1 35.43 0.00097 R RGDLPFVVPR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5907.5907.2.dta 14 1 IPI00019502.3 Myosin-9 529 227646 27 27 26 26 3265 4900 1 1 1 385.8925 1154.6558 3 1154.656 -0.0002 1 49.23 0.00014 R RGDLPFVVPR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5910.5910.3.dta 14 1 IPI00019502.3 Myosin-9 529 227646 27 27 26 26 3569 4988 1 1 1 597.3112 1192.6079 2 1192.6088 -0.0009 0 62.19 1.90E-06 K ALELDSNLYR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6002.6002.2.dta 14 1 IPI00019502.3 Myosin-9 529 227646 27 27 26 26 3842 4061 1 1 1 408.5509 1222.6309 3 1222.6306 0.0003 0 30.59 0.0014 R AGVLAHLEEER D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5006.5006.3.dta 14 1 IPI00019502.3 Myosin-9 529 227646 27 27 26 26 4315 5061 1 1 1 637.8527 1273.6908 2 1273.6918 -0.001 0 56.21 4.50E-05 R YEILTPNSIPK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6076.6076.2.dta 14 1 IPI00019502.3 Myosin-9 529 227646 27 27 26 26 4584 5793 1 1 1 653.3373 1304.66 2 1304.6612 -0.0012 0 55.79 8.20E-06 K EQADFAIEALAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6805.6805.2.dta 14 1 IPI00019502.3 Myosin-9 529 227646 27 27 26 26 4680 5864 1 1 1 440.2538 1317.7395 3 1317.7405 -0.001 0 19.47 0.025 K LDPHLVLDQLR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6875.6875.3.dta 14 1 IPI00019502.3 Myosin-9 529 227646 27 27 26 26 5153 3371 1 1 1 689.3886 1376.7627 2 1376.7663 -0.0037 1 39.85 0.00056 R TVGQLYKEQLAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4260.4260.2.dta 14 1 IPI00019502.3 Myosin-9 529 227646 27 27 26 26 6224 4260 1 1 1 765.8842 1529.7539 2 1529.7573 -0.0034 0 71.41 4.40E-07 K IAQLEEQLDNETK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5222.5222.2.dta 14 1 IPI00019502.3 Myosin-9 529 227646 27 27 26 26 6428 5969 1 1 1 524.6234 1570.8484 3 1570.8468 0.0017 0 33.1 0.0013 K VSHLLGINVTDFTR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6980.6980.3.dta 14 1 IPI00019502.3 Myosin-9 529 227646 27 27 26 26 6672 6360 1 1 1 808.4121 1614.8097 2 1614.8109 -0.0012 0 23.24 0.015 R IMGIPEEEQMGLLR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7368.7368.2.dta 14 1 IPI00019502.3 Myosin-9 529 227646 27 27 26 26 7617 4051 1 1 1 605.9744 1814.9015 3 1814.901 0.0005 1 33.23 0.00078 K IAQLEEQLDNETKER Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4996.4996.3.dta 14 1 IPI00019502.3 Myosin-9 529 227646 27 27 26 26 7658 2736 1 1 1 610.9566 1829.848 3 1829.8503 -0.0023 1 19.14 0.016 R QLEEAEEEAQRANASR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3547.3547.3.dta 14 1 IPI00019502.3 Myosin-9 529 227646 27 27 26 26 7782 5876 1 1 1 935.4863 1868.9581 2 1868.9592 -0.0011 0 51.31 3.10E-05 K ANLQIDQINTDLNLER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6887.6887.2.dta 14 1 IPI00019502.3 Myosin-9 529 227646 27 27 26 26 8053 5193 1 1 1 666.6911 1997.0515 3 1997.0541 -0.0026 1 32.14 0.0012 K KANLQIDQINTDLNLER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6210.6210.3.dta 14 1 IPI00019502.3 Myosin-9 529 227646 27 27 26 26 8136 3900 1 1 1 696.9984 2087.9732 3 2087.9719 0.0013 1 39.41 0.0002 R QAQQERDELADEIANSSGK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4832.4832.3.dta 14 IPI00395772.4 Hypothetical protein DKFZp451J0218 425 155148 20 20 20 20 415 2557 1 0 1 360.7073 719.4001 2 719.4 0.0001 0 31.76 0.0095 K LMATLR N Oxidation (M) 0.010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3353.3353.2.dta 14 IPI00395772.4 Hypothetical protein DKFZp451J0218 425 155148 20 20 20 20 1353 3535 1 0 1 452.2611 902.5077 2 902.5073 0.0004 0 34.79 0.0067 K ASITALEAK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4438.4438.2.dta 14 IPI00395772.4 Hypothetical protein DKFZp451J0218 425 155148 20 20 20 20 1486 4760 1 0 1 462.7504 923.4862 2 923.4865 -0.0003 0 46.68 0.00011 R VVFQEFR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5762.5762.2.dta 14 IPI00395772.4 Hypothetical protein DKFZp451J0218 425 155148 20 20 20 20 2213 4141 1 0 1 509.2606 1016.5067 2 1016.5073 -0.0006 0 53.25 4.90E-05 R CNGVLEGIR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5093.5093.2.dta 14 IPI00395772.4 Hypothetical protein DKFZp451J0218 425 155148 20 20 20 20 2263 1691 1 0 1 342.1823 1023.5251 3 1023.5237 0.0014 1 19.79 0.048 K ATDKSFVEK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2413.2413.3.dta 14 IPI00395772.4 Hypothetical protein DKFZp451J0218 425 155148 20 20 20 20 2382 3446 1 0 1 347.2261 1038.6565 3 1038.655 0.0015 0 22.61 0.017 K VKPLLQVSR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4341.4341.3.dta 14 IPI00395772.4 Hypothetical protein DKFZp451J0218 425 155148 20 20 20 20 3248 806 1 0 1 577.7845 1153.5545 2 1153.555 -0.0004 0 25.35 0.0085 K VMQEQGTHPK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1454.1454.2.dta 14 IPI00395772.4 Hypothetical protein DKFZp451J0218 425 155148 20 20 20 20 3569 4988 1 0 1 597.3112 1192.6079 2 1192.6088 -0.0009 0 62.19 1.90E-06 K ALELDSNLYR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6002.6002.2.dta 14 IPI00395772.4 Hypothetical protein DKFZp451J0218 425 155148 20 20 20 20 3842 4061 1 0 1 408.5509 1222.6309 3 1222.6306 0.0003 0 30.59 0.0014 R AGVLAHLEEER D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5006.5006.3.dta 14 IPI00395772.4 Hypothetical protein DKFZp451J0218 425 155148 20 20 20 20 4315 5061 1 0 1 637.8527 1273.6908 2 1273.6918 -0.001 0 56.21 4.50E-05 R YEILTPNSIPK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6076.6076.2.dta 14 IPI00395772.4 Hypothetical protein DKFZp451J0218 425 155148 20 20 20 20 4584 5793 1 0 1 653.3373 1304.66 2 1304.6612 -0.0012 0 55.79 8.20E-06 K EQADFAIEALAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6805.6805.2.dta 14 IPI00395772.4 Hypothetical protein DKFZp451J0218 425 155148 20 20 20 20 4680 5864 1 0 1 440.2538 1317.7395 3 1317.7405 -0.001 0 19.47 0.025 K LDPHLVLDQLR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6875.6875.3.dta 14 IPI00395772.4 Hypothetical protein DKFZp451J0218 425 155148 20 20 20 20 5153 3371 1 0 1 689.3886 1376.7627 2 1376.7663 -0.0037 1 39.85 0.00056 R TVGQLYKEQLAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4260.4260.2.dta 14 IPI00395772.4 Hypothetical protein DKFZp451J0218 425 155148 20 20 20 20 6224 4260 1 0 1 765.8842 1529.7539 2 1529.7573 -0.0034 0 71.41 4.40E-07 K IAQLEEQLDNETK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5222.5222.2.dta 14 IPI00395772.4 Hypothetical protein DKFZp451J0218 425 155148 20 20 20 20 6428 5969 1 0 1 524.6234 1570.8484 3 1570.8468 0.0017 0 33.1 0.0013 K VSHLLGINVTDFTR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6980.6980.3.dta 14 IPI00395772.4 Hypothetical protein DKFZp451J0218 425 155148 20 20 20 20 6672 6360 1 0 1 808.4121 1614.8097 2 1614.8109 -0.0012 0 23.24 0.015 R IMGIPEEEQMGLLR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7368.7368.2.dta 14 IPI00395772.4 Hypothetical protein DKFZp451J0218 425 155148 20 20 20 20 7617 4051 1 0 1 605.9744 1814.9015 3 1814.901 0.0005 1 33.23 0.00078 K IAQLEEQLDNETKER Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4996.4996.3.dta 14 IPI00395772.4 Hypothetical protein DKFZp451J0218 425 155148 20 20 20 20 7782 5876 1 0 1 935.4863 1868.9581 2 1868.9592 -0.0011 0 51.31 3.10E-05 K ANLQIDQINTDLNLER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6887.6887.2.dta 14 IPI00395772.4 Hypothetical protein DKFZp451J0218 425 155148 20 20 20 20 8053 5193 1 0 1 666.6911 1997.0515 3 1997.0541 -0.0026 1 32.14 0.0012 K KANLQIDQINTDLNLER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6210.6210.3.dta 14 IPI00395772.4 Hypothetical protein DKFZp451J0218 425 155148 20 20 20 20 8136 3900 1 0 1 696.9984 2087.9732 3 2087.9719 0.0013 1 39.41 0.0002 R QAQQERDELADEIANSSGK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4832.4832.3.dta 14 IPI00742780.1 FLJ00279 protein (Fragment) 219 66015 9 9 8 8 1353 3535 1 0 1 452.2611 902.5077 2 902.5073 0.0004 0 34.79 0.0067 K ASITALEAK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4438.4438.2.dta 14 IPI00742780.1 FLJ00279 protein (Fragment) 219 66015 9 9 8 8 3263 4896 1 0 1 578.3345 1154.6545 2 1154.656 -0.0015 1 35.43 0.00097 R RGDLPFVVPR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5907.5907.2.dta 14 IPI00742780.1 FLJ00279 protein (Fragment) 219 66015 9 9 8 8 3265 4900 1 0 1 385.8925 1154.6558 3 1154.656 -0.0002 1 49.23 0.00014 R RGDLPFVVPR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5910.5910.3.dta 14 IPI00742780.1 FLJ00279 protein (Fragment) 219 66015 9 9 8 8 6224 4260 1 0 1 765.8842 1529.7539 2 1529.7573 -0.0034 0 71.41 4.40E-07 K IAQLEEQLDNETK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5222.5222.2.dta 14 IPI00742780.1 FLJ00279 protein (Fragment) 219 66015 9 9 8 8 7617 4051 1 0 1 605.9744 1814.9015 3 1814.901 0.0005 1 33.23 0.00078 K IAQLEEQLDNETKER Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4996.4996.3.dta 14 IPI00742780.1 FLJ00279 protein (Fragment) 219 66015 9 9 8 8 7658 2736 1 0 1 610.9566 1829.848 3 1829.8503 -0.0023 1 19.14 0.016 R QLEEAEEEAQRANASR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3547.3547.3.dta 14 IPI00742780.1 FLJ00279 protein (Fragment) 219 66015 9 9 8 8 7782 5876 1 0 1 935.4863 1868.9581 2 1868.9592 -0.0011 0 51.31 3.10E-05 K ANLQIDQINTDLNLER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6887.6887.2.dta 14 IPI00742780.1 FLJ00279 protein (Fragment) 219 66015 9 9 8 8 8053 5193 1 0 1 666.6911 1997.0515 3 1997.0541 -0.0026 1 32.14 0.0012 K KANLQIDQINTDLNLER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6210.6210.3.dta 14 IPI00742780.1 FLJ00279 protein (Fragment) 219 66015 9 9 8 8 8136 3900 1 0 1 696.9984 2087.9732 3 2087.9719 0.0013 1 39.41 0.0002 R QAQQERDELADEIANSSGK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4832.4832.3.dta 14 IPI00029818.4 Isoform 5 of Myosin-14 89 170107 3 3 3 3 2213 4141 1 0 1 509.2606 1016.5067 2 1016.5073 -0.0006 0 53.25 4.90E-05 R CNGVLEGIR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5093.5093.2.dta 14 IPI00029818.4 Isoform 5 of Myosin-14 89 170107 3 3 3 3 2263 1691 1 0 1 342.1823 1023.5251 3 1023.5237 0.0014 1 19.79 0.048 K ATDKSFVEK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2413.2413.3.dta 14 IPI00029818.4 Isoform 5 of Myosin-14 89 170107 3 3 3 3 4584 5793 1 0 1 653.3373 1304.66 2 1304.6612 -0.0012 0 55.79 8.20E-06 K EQADFALEALAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6805.6805.2.dta 14 IPI00397526.2 Isoform 1 of Myosin-10 77 229824 4 4 4 4 415 2557 1 0 1 360.7073 719.4001 2 719.4 0.0001 0 31.76 0.0095 K LMATLR N Oxidation (M) 0.010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3353.3353.2.dta 14 IPI00397526.2 Isoform 1 of Myosin-10 77 229824 4 4 4 4 2213 4141 1 0 1 509.2606 1016.5067 2 1016.5073 -0.0006 0 53.25 4.90E-05 R CNGVLEGIR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5093.5093.2.dta 14 IPI00397526.2 Isoform 1 of Myosin-10 77 229824 4 4 4 4 3842 4061 1 0 1 408.5509 1222.6309 3 1222.6306 0.0003 0 30.59 0.0014 R AGVLAHLEEER D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5006.5006.3.dta 14 IPI00397526.2 Isoform 1 of Myosin-10 77 229824 4 4 4 4 4680 5864 1 0 1 440.2538 1317.7395 3 1317.7405 -0.001 0 19.47 0.025 K LDPHLVLDQLR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6875.6875.3.dta 14 IPI00001753.1 Myosin-4 58 223844 2 2 2 2 1210 1510 2 0 1 437.7533 873.492 2 873.492 0 1 29.78 0.027 K IKEVTER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2217.2217.2.dta 14 IPI00001753.1 Myosin-4 58 223844 2 2 2 2 2213 4141 1 0 1 509.2606 1016.5067 2 1016.5073 -0.0006 0 53.25 4.90E-05 R CNGVLEGIR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5093.5093.2.dta 14 IPI00020501.1 Myosin-11 52 228054 2 2 2 2 2213 4141 1 0 1 509.2606 1016.5067 2 1016.5073 -0.0006 0 53.25 4.90E-05 R CNGVLEGIR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5093.5093.2.dta 14 IPI00020501.1 Myosin-11 52 228054 2 2 2 2 2263 1691 1 0 1 342.1823 1023.5251 3 1023.5237 0.0014 1 19.79 0.048 K ATDKSFVEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2413.2413.3.dta 14 IPI00556012.1 MYH9 protein 46 24989 1 1 1 1 1754 907 1 0 1 480.2615 958.5085 2 958.5083 0.0001 1 45.6 0.00058 K VNKDDIQK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1564.1564.2.dta 15 1 IPI00420014.2 U5 small nuclear ribonucleoprotein 200 kDa helicase 476 246006 17 17 17 17 1236 3237 1 1 1 440.747 879.4795 2 879.4814 -0.002 0 23.4 0.04 R TYTQLVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4114.4114.2.dta 15 1 IPI00420014.2 U5 small nuclear ribonucleoprotein 200 kDa helicase 476 246006 17 17 17 17 1572 6714 1 1 1 467.7713 933.528 2 933.5284 -0.0004 0 43.98 0.00043 K DTLGLFLR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7718.7718.2.dta 15 1 IPI00420014.2 U5 small nuclear ribonucleoprotein 200 kDa helicase 476 246006 17 17 17 17 2139 2021 1 1 1 504.7534 1007.4922 2 1007.4924 -0.0002 0 39.55 0.002 K GTQVYSPEK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2770.2770.2.dta 15 1 IPI00420014.2 U5 small nuclear ribonucleoprotein 200 kDa helicase 476 246006 17 17 17 17 2337 1815 1 1 1 345.1777 1032.5114 3 1032.5101 0.0013 0 31.99 0.018 R HHEDNLLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2547.2547.3.dta 15 1 IPI00420014.2 U5 small nuclear ribonucleoprotein 200 kDa helicase 476 246006 17 17 17 17 2348 959 1 1 1 345.8472 1034.5198 3 1034.5145 0.0053 0 18.23 0.035 R AGRPQYDTK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1620.1620.3.dta 15 1 IPI00420014.2 U5 small nuclear ribonucleoprotein 200 kDa helicase 476 246006 17 17 17 17 2355 2464 1 1 1 518.7587 1035.5028 2 1035.5019 0.0009 0 28.92 0.028 R MLLQSSEGR C Oxidation (M) 0.100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3250.3250.2.dta 15 1 IPI00420014.2 U5 small nuclear ribonucleoprotein 200 kDa helicase 476 246006 17 17 17 17 2406 5607 1 1 1 522.2741 1042.5337 2 1042.5335 0.0002 0 42.09 0.00012 R VFSLSSEFK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6620.6620.2.dta 15 1 IPI00420014.2 U5 small nuclear ribonucleoprotein 200 kDa helicase 476 246006 17 17 17 17 2962 4510 1 1 1 559.2693 1116.524 2 1116.524 0 0 68.68 3.60E-07 K YAQAGFEGFK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5492.5492.2.dta 15 1 IPI00420014.2 U5 small nuclear ribonucleoprotein 200 kDa helicase 476 246006 17 17 17 17 3223 6636 1 1 1 575.8029 1149.5912 2 1149.5918 -0.0006 0 29.92 0.0051 R TLVEDLFADK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7640.7640.2.dta 15 1 IPI00420014.2 U5 small nuclear ribonucleoprotein 200 kDa helicase 476 246006 17 17 17 17 3282 5185 1 1 1 579.3416 1156.6687 2 1156.6703 -0.0016 1 74.82 2.80E-07 K KADEVLEILK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6201.6201.2.dta 15 1 IPI00420014.2 U5 small nuclear ribonucleoprotein 200 kDa helicase 476 246006 17 17 17 17 3537 4135 1 1 1 595.342 1188.6695 2 1188.6714 -0.0018 0 83.69 2.40E-08 R IVALSSSLSNAK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5087.5087.2.dta 15 1 IPI00420014.2 U5 small nuclear ribonucleoprotein 200 kDa helicase 476 246006 17 17 17 17 3632 3554 1 1 1 600.8191 1199.6236 2 1199.6258 -0.0022 0 60.37 2.00E-05 K ANSNLVLQADR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4458.4458.2.dta 15 1 IPI00420014.2 U5 small nuclear ribonucleoprotein 200 kDa helicase 476 246006 17 17 17 17 3827 4435 1 1 1 611.3126 1220.6106 2 1220.615 -0.0044 0 55.08 7.40E-06 K TGNFQVTELGR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5411.5411.2.dta 15 1 IPI00420014.2 U5 small nuclear ribonucleoprotein 200 kDa helicase 476 246006 17 17 17 17 4359 6787 1 1 1 641.3282 1280.6418 2 1280.6435 -0.0017 0 76.4 9.60E-08 R SLVQEMVGSFGK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7791.7791.2.dta 15 1 IPI00420014.2 U5 small nuclear ribonucleoprotein 200 kDa helicase 476 246006 17 17 17 17 5246 7095 1 1 1 694.8459 1387.6772 2 1387.6772 0 0 43.02 0.00074 R EEGWWVVIGDAK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8095.8095.2.dta 15 1 IPI00420014.2 U5 small nuclear ribonucleoprotein 200 kDa helicase 476 246006 17 17 17 17 7249 5771 1 1 1 566.9641 1697.8703 3 1697.8736 -0.0033 0 15.62 0.034 R LYDLNHNEIGELIR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6783.6783.3.dta 15 1 IPI00420014.2 U5 small nuclear ribonucleoprotein 200 kDa helicase 476 246006 17 17 17 17 7982 5746 1 1 1 972.4895 1942.9645 2 1942.967 -0.0025 0 70.1 5.60E-07 R AALETDENLLLCAPTGAGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6758.6758.2.dta 15 IPI00740142.1 "similar to U5 snRNP-specific protein, 200 kDa" 273 186865 11 11 11 11 1236 3237 1 0 1 440.747 879.4795 2 879.4814 -0.002 0 23.4 0.04 R TYTQLVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4114.4114.2.dta 15 IPI00740142.1 "similar to U5 snRNP-specific protein, 200 kDa" 273 186865 11 11 11 11 1572 6714 1 0 1 467.7713 933.528 2 933.5284 -0.0004 0 43.98 0.00043 K DTLGLFLR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7718.7718.2.dta 15 IPI00740142.1 "similar to U5 snRNP-specific protein, 200 kDa" 273 186865 11 11 11 11 2139 2021 1 0 1 504.7534 1007.4922 2 1007.4924 -0.0002 0 39.55 0.002 K GTQVYSPEK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2770.2770.2.dta 15 IPI00740142.1 "similar to U5 snRNP-specific protein, 200 kDa" 273 186865 11 11 11 11 2337 1815 1 0 1 345.1777 1032.5114 3 1032.5101 0.0013 0 31.99 0.018 R HHEDNLLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2547.2547.3.dta 15 IPI00740142.1 "similar to U5 snRNP-specific protein, 200 kDa" 273 186865 11 11 11 11 2348 959 1 0 1 345.8472 1034.5198 3 1034.5145 0.0053 0 18.23 0.035 R AGRPQYDTK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1620.1620.3.dta 15 IPI00740142.1 "similar to U5 snRNP-specific protein, 200 kDa" 273 186865 11 11 11 11 2406 5607 1 0 1 522.2741 1042.5337 2 1042.5335 0.0002 0 42.09 0.00012 R VFSLSSEFK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6620.6620.2.dta 15 IPI00740142.1 "similar to U5 snRNP-specific protein, 200 kDa" 273 186865 11 11 11 11 3537 4135 1 0 1 595.342 1188.6695 2 1188.6714 -0.0018 0 83.69 2.40E-08 R IVALSSSLSNAK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5087.5087.2.dta 15 IPI00740142.1 "similar to U5 snRNP-specific protein, 200 kDa" 273 186865 11 11 11 11 3827 4435 1 0 1 611.3126 1220.6106 2 1220.615 -0.0044 0 55.08 7.40E-06 K TGNFQVTELGR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5411.5411.2.dta 15 IPI00740142.1 "similar to U5 snRNP-specific protein, 200 kDa" 273 186865 11 11 11 11 4359 6787 1 0 1 641.3282 1280.6418 2 1280.6435 -0.0017 0 76.4 9.60E-08 R SLVQEMVGSFGK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7791.7791.2.dta 15 IPI00740142.1 "similar to U5 snRNP-specific protein, 200 kDa" 273 186865 11 11 11 11 5246 7095 1 0 1 694.8459 1387.6772 2 1387.6772 0 0 43.02 0.00074 R EEGWWVVIGDAK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8095.8095.2.dta 15 IPI00740142.1 "similar to U5 snRNP-specific protein, 200 kDa" 273 186865 11 11 11 11 7249 5771 1 0 1 566.9641 1697.8703 3 1697.8736 -0.0033 0 15.62 0.034 R LYDLNHNEIGELIR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6783.6783.3.dta 15 IPI00168235.4 "CDNA FLJ33352 fis, clone BRACE2005087, weakly similar to PRE-MRNA SPLICING HELICASE BRR2" 267 71883 5 5 5 5 2962 4510 1 0 1 559.2693 1116.524 2 1116.524 0 0 68.68 3.60E-07 K YAQAGFEGFK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5492.5492.2.dta 15 IPI00168235.4 "CDNA FLJ33352 fis, clone BRACE2005087, weakly similar to PRE-MRNA SPLICING HELICASE BRR2" 267 71883 5 5 5 5 3282 5185 1 0 1 579.3416 1156.6687 2 1156.6703 -0.0016 1 74.82 2.80E-07 K KADEVLEILK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6201.6201.2.dta 15 IPI00168235.4 "CDNA FLJ33352 fis, clone BRACE2005087, weakly similar to PRE-MRNA SPLICING HELICASE BRR2" 267 71883 5 5 5 5 3632 3554 1 0 1 600.8191 1199.6236 2 1199.6258 -0.0022 0 60.37 2.00E-05 K ANSNLVLQADR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4458.4458.2.dta 15 IPI00168235.4 "CDNA FLJ33352 fis, clone BRACE2005087, weakly similar to PRE-MRNA SPLICING HELICASE BRR2" 267 71883 5 5 5 5 4359 6787 1 0 1 641.3282 1280.6418 2 1280.6435 -0.0017 0 76.4 9.60E-08 R SLVQEMVGSFGK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7791.7791.2.dta 15 IPI00168235.4 "CDNA FLJ33352 fis, clone BRACE2005087, weakly similar to PRE-MRNA SPLICING HELICASE BRR2" 267 71883 5 5 5 5 7982 5746 1 0 1 972.4895 1942.9645 2 1942.967 -0.0025 0 70.1 5.60E-07 R AALETDENLLLCAPTGAGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6758.6758.2.dta 16 1 IPI00742905.1 ATP-dependent RNA helicase A 475 147921 19 19 19 19 324 1530 1 1 1 348.2141 694.4137 2 694.4126 0.0011 0 25.99 0.011 R NALIHK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2239.2239.2.dta 16 1 IPI00742905.1 ATP-dependent RNA helicase A 475 147921 19 19 19 19 428 3021 1 1 1 362.7213 723.4281 2 723.4279 0.0002 0 28.73 0.0058 K LPIEPR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3874.3874.2.dta 16 1 IPI00742905.1 ATP-dependent RNA helicase A 475 147921 19 19 19 19 1547 1407 1 1 1 466.1991 930.3837 2 930.3831 0.0006 0 35.65 0.00061 R YDNGSGYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2105.2105.2.dta 16 1 IPI00742905.1 ATP-dependent RNA helicase A 475 147921 19 19 19 19 1616 3216 1 1 1 470.7465 939.4784 2 939.4814 -0.003 0 50.36 0.00017 R LNQYFQK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4091.4091.2.dta 16 1 IPI00742905.1 ATP-dependent RNA helicase A 475 147921 19 19 19 19 1951 1378 1 1 1 493.7567 985.4988 2 985.4981 0.0006 0 44.36 0.00071 R YGDGPRPPK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2074.2074.2.dta 16 1 IPI00742905.1 ATP-dependent RNA helicase A 475 147921 19 19 19 19 2109 5780 1 1 1 502.3005 1002.5865 2 1002.5862 0.0003 0 64.1 3.60E-06 R LGGIGQFLAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6792.6792.2.dta 16 1 IPI00742905.1 ATP-dependent RNA helicase A 475 147921 19 19 19 19 2644 3090 1 1 1 538.2795 1074.5445 2 1074.5458 -0.0013 0 44.62 9.20E-05 K LAQFEPSQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3952.3952.2.dta 16 1 IPI00742905.1 ATP-dependent RNA helicase A 475 147921 19 19 19 19 2755 2449 1 1 1 363.2126 1086.6159 3 1086.6145 0.0014 1 23.32 0.019 R RISAVSVAER V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3234.3234.3.dta 16 1 IPI00742905.1 ATP-dependent RNA helicase A 475 147921 19 19 19 19 3281 4944 1 1 1 579.3306 1156.6466 2 1156.6492 -0.0027 0 56.71 9.20E-06 K VFDPVPVGVTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5957.5957.2.dta 16 1 IPI00742905.1 ATP-dependent RNA helicase A 475 147921 19 19 19 19 3284 6066 1 1 1 579.7735 1157.5324 2 1157.5328 -0.0003 0 36.82 0.0029 K NFLYAWCGK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7078.7078.2.dta 16 1 IPI00742905.1 ATP-dependent RNA helicase A 475 147921 19 19 19 19 3442 3779 1 1 1 588.3064 1174.5982 2 1174.5982 0 0 35.8 0.0064 R DVVQAYPEVR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4701.4701.2.dta 16 1 IPI00742905.1 ATP-dependent RNA helicase A 475 147921 19 19 19 19 3507 1274 1 1 1 593.783 1185.5515 2 1185.5527 -0.0012 0 15.11 0.038 K YTQVGPDHNR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1961.1961.2.dta 16 1 IPI00742905.1 ATP-dependent RNA helicase A 475 147921 19 19 19 19 3613 2547 1 1 1 599.3155 1196.6164 2 1196.6189 -0.0025 1 26.51 0.021 R LNQYFQKEK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3342.3342.2.dta 16 1 IPI00742905.1 ATP-dependent RNA helicase A 475 147921 19 19 19 19 4395 4212 1 1 1 643.379 1284.7435 2 1284.7442 -0.0007 1 50.52 6.40E-05 R KVFDPVPVGVTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5170.5170.2.dta 16 1 IPI00742905.1 ATP-dependent RNA helicase A 475 147921 19 19 19 19 4436 4870 1 1 1 644.8555 1287.6964 2 1287.6969 -0.0005 0 83.71 2.30E-08 K LAAQSCALSLVR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5879.5879.2.dta 16 1 IPI00742905.1 ATP-dependent RNA helicase A 475 147921 19 19 19 19 5009 3189 1 1 1 679.3477 1356.6808 2 1356.682 -0.0012 0 54.85 2.90E-05 R AAECNIVVTQPR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4062.4062.2.dta 16 1 IPI00742905.1 ATP-dependent RNA helicase A 475 147921 19 19 19 19 6072 3945 1 1 1 501.9355 1502.7845 3 1502.7841 0.0004 0 45.37 5.60E-05 R GISHVIVDEIHER D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4881.4881.3.dta 16 1 IPI00742905.1 ATP-dependent RNA helicase A 475 147921 19 19 19 19 6531 5442 1 1 1 790.4246 1578.8347 2 1578.8365 -0.0019 0 27.79 0.0025 K QPAIISQLDPVNER M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6458.6458.2.dta 16 1 IPI00742905.1 ATP-dependent RNA helicase A 475 147921 19 19 19 19 7417 5860 1 1 1 871.4318 1740.8491 2 1740.853 -0.0039 0 86.8 2.90E-08 R ELDALDANDELTPLGR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6871.6871.2.dta 17 1 IPI00555610.3 313 kDa protein 472 312619 15 15 15 15 99 3805 1 1 1 313.6685 625.3224 2 625.3224 0 0 28.33 0.012 K FGFGAK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4729.4729.2.dta 17 1 IPI00555610.3 313 kDa protein 472 312619 15 15 15 15 425 2546 1 1 1 362.1928 722.3711 2 722.3712 0 0 27 0.028 K FGVSTGR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3341.3341.2.dta 17 1 IPI00555610.3 313 kDa protein 472 312619 15 15 15 15 1192 2348 1 1 1 436.2479 870.4813 2 870.4811 0.0002 0 53.61 4.80E-05 K ADVVVSGPK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3125.3125.2.dta 17 1 IPI00555610.3 313 kDa protein 472 312619 15 15 15 15 2087 1722 1 1 1 501.2724 1000.5303 2 1000.5302 0.0001 0 77.49 4.40E-07 K VGGSGVNVNAK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2447.2447.2.dta 17 1 IPI00555610.3 313 kDa protein 472 312619 15 15 15 15 4116 4282 1 1 1 627.3212 1252.6279 2 1252.6299 -0.002 0 61.04 4.70E-06 K GEGPEVDVNLPK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5246.5246.2.dta 17 1 IPI00555610.3 313 kDa protein 472 312619 15 15 15 15 5983 4789 1 1 1 495.6118 1483.8134 3 1483.8134 0.0001 1 26.06 0.025 K VESEIKVPDVELK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5792.5792.3.dta 17 1 IPI00555610.3 313 kDa protein 472 312619 15 15 15 15 6056 5468 1 1 1 750.8879 1499.7612 2 1499.762 -0.0008 0 32.15 0.00097 R ISAPNVDFNLEGPK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6483.6483.2.dta 17 1 IPI00555610.3 313 kDa protein 472 312619 15 15 15 15 6655 5267 1 1 1 805.9205 1609.8264 2 1609.8311 -0.0048 0 79.73 2.10E-07 K VNVEAPDVNLEGLGGK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6284.6284.2.dta 17 1 IPI00555610.3 313 kDa protein 472 312619 15 15 15 15 6873 5146 1 1 1 819.4219 1636.8293 2 1636.8308 -0.0015 0 50.32 4.20E-05 K VGVEVPDVNIEGPEGK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6162.6162.2.dta 17 1 IPI00555610.3 313 kDa protein 472 312619 15 15 15 15 6893 4418 1 1 1 821.4003 1640.7861 2 1640.7893 -0.0032 0 44.22 8.10E-05 K VDTNAPDLSLEGPEGK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5392.5392.2.dta 17 1 IPI00555610.3 313 kDa protein 472 312619 15 15 15 15 6951 5065 1 1 1 827.9114 1653.8082 2 1653.8097 -0.0015 0 51.56 0.00012 K VDIEAPDVSLEGPEGK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6080.6080.2.dta 17 1 IPI00555610.3 313 kDa protein 472 312619 15 15 15 15 7061 5370 1 1 1 834.9188 1667.8231 2 1667.8254 -0.0023 0 60.67 2.00E-06 K VDVEVPDVSLEGPEGK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6386.6386.2.dta 17 1 IPI00555610.3 313 kDa protein 472 312619 15 15 15 15 7122 5062 1 1 1 841.4166 1680.8187 2 1680.8207 -0.002 0 47.11 3.80E-05 K VDVDVPDVNIEGPDAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6077.6077.2.dta 17 1 IPI00555610.3 313 kDa protein 472 312619 15 15 15 15 7246 4751 1 1 1 849.9239 1697.8332 2 1697.836 -0.0027 0 76.42 6.80E-08 K IDVTAPDVSIEEPEGK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5753.5753.2.dta 17 1 IPI00555610.3 313 kDa protein 472 312619 15 15 15 15 7692 5744 1 1 1 919.4838 1836.953 2 1836.9581 -0.0051 0 37 0.0004 K VQANLGAPDINIEGLDAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6756.6756.2.dta 17 IPI00021812.1 Neuroblast differentiation-associated protein AHNAK (Fragment) 434 312580 13 13 13 13 425 2546 1 0 1 362.1928 722.3711 2 722.3712 0 0 27 0.028 K FGVSTGR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3341.3341.2.dta 17 IPI00021812.1 Neuroblast differentiation-associated protein AHNAK (Fragment) 434 312580 13 13 13 13 2087 1722 1 0 1 501.2724 1000.5303 2 1000.5302 0.0001 0 77.49 4.40E-07 K VGGSGVNVNAK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2447.2447.2.dta 17 IPI00021812.1 Neuroblast differentiation-associated protein AHNAK (Fragment) 434 312580 13 13 13 13 4116 4282 1 0 1 627.3212 1252.6279 2 1252.6299 -0.002 0 61.04 4.70E-06 K GEGPEVDVNLPK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5246.5246.2.dta 17 IPI00021812.1 Neuroblast differentiation-associated protein AHNAK (Fragment) 434 312580 13 13 13 13 5983 4789 1 0 1 495.6118 1483.8134 3 1483.8134 0.0001 1 26.06 0.025 K VESEIKVPDVELK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5792.5792.3.dta 17 IPI00021812.1 Neuroblast differentiation-associated protein AHNAK (Fragment) 434 312580 13 13 13 13 6056 5468 1 0 1 750.8879 1499.7612 2 1499.762 -0.0008 0 32.15 0.00097 R ISAPNVDFNLEGPK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6483.6483.2.dta 17 IPI00021812.1 Neuroblast differentiation-associated protein AHNAK (Fragment) 434 312580 13 13 13 13 6655 5267 1 0 1 805.9205 1609.8264 2 1609.8311 -0.0048 0 79.73 2.10E-07 K VNVEAPDVNLEGLGGK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6284.6284.2.dta 17 IPI00021812.1 Neuroblast differentiation-associated protein AHNAK (Fragment) 434 312580 13 13 13 13 6873 5146 1 0 1 819.4219 1636.8293 2 1636.8308 -0.0015 0 50.32 4.20E-05 K VGVEVPDVNIEGPEGK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6162.6162.2.dta 17 IPI00021812.1 Neuroblast differentiation-associated protein AHNAK (Fragment) 434 312580 13 13 13 13 6893 4418 1 0 1 821.4003 1640.7861 2 1640.7893 -0.0032 0 44.22 8.10E-05 K VDTNAPDLSLEGPEGK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5392.5392.2.dta 17 IPI00021812.1 Neuroblast differentiation-associated protein AHNAK (Fragment) 434 312580 13 13 13 13 6951 5065 1 0 1 827.9114 1653.8082 2 1653.8097 -0.0015 0 51.56 0.00012 K VDIEAPDVSLEGPEGK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6080.6080.2.dta 17 IPI00021812.1 Neuroblast differentiation-associated protein AHNAK (Fragment) 434 312580 13 13 13 13 7061 5370 1 0 1 834.9188 1667.8231 2 1667.8254 -0.0023 0 60.67 2.00E-06 K VDVEVPDVSLEGPEGK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6386.6386.2.dta 17 IPI00021812.1 Neuroblast differentiation-associated protein AHNAK (Fragment) 434 312580 13 13 13 13 7122 5062 1 0 1 841.4166 1680.8187 2 1680.8207 -0.002 0 47.11 3.80E-05 K VDVDVPDVNIEGPDAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6077.6077.2.dta 17 IPI00021812.1 Neuroblast differentiation-associated protein AHNAK (Fragment) 434 312580 13 13 13 13 7246 4751 1 0 1 849.9239 1697.8332 2 1697.836 -0.0027 0 76.42 6.80E-08 K IDVTAPDVSIEEPEGK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5753.5753.2.dta 17 IPI00021812.1 Neuroblast differentiation-associated protein AHNAK (Fragment) 434 312580 13 13 13 13 7692 5744 1 0 1 919.4838 1836.953 2 1836.9581 -0.0051 0 37 0.0004 K VQANLGAPDINIEGLDAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6756.6756.2.dta 18 1 IPI00009342.1 Ras GTPase-activating-like protein IQGAP1 461 189761 16 16 15 15 133 3482 1 1 0 318.1973 634.38 2 634.3802 -0.0002 0 25.8 0.035 R LAYLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4380.4380.2.dta 18 1 IPI00009342.1 Ras GTPase-activating-like protein IQGAP1 461 189761 16 16 15 15 149 4562 1 1 1 321.7313 641.448 2 641.4476 0.0004 0 40.89 0.00018 K IGLLVK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5548.5548.2.dta 18 1 IPI00009342.1 Ras GTPase-activating-like protein IQGAP1 461 189761 16 16 15 15 258 1311 1 1 1 337.2339 672.4533 2 672.4534 -0.0001 1 23.23 0.018 K VVSLKK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2001.2001.2.dta 18 1 IPI00009342.1 Ras GTPase-activating-like protein IQGAP1 461 189761 16 16 15 15 785 3712 1 1 1 401.757 801.4994 2 801.496 0.0034 0 26.99 0.02 R TILLNTK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4628.4628.2.dta 18 1 IPI00009342.1 Ras GTPase-activating-like protein IQGAP1 461 189761 16 16 15 15 890 5204 1 1 1 414.271 826.5275 2 826.5276 -0.0001 0 35.43 0.0012 R LIVDVIR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6221.6221.2.dta 18 1 IPI00009342.1 Ras GTPase-activating-like protein IQGAP1 461 189761 16 16 15 15 1406 5113 1 1 1 455.2449 908.4752 2 908.4756 -0.0004 0 51.92 0.00012 K LGNFFSPK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6129.6129.2.dta 18 1 IPI00009342.1 Ras GTPase-activating-like protein IQGAP1 461 189761 16 16 15 15 2272 4473 1 1 1 513.3087 1024.6028 2 1024.6029 -0.0002 0 54.3 2.20E-05 R ALQSPALGLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5453.5453.2.dta 18 1 IPI00009342.1 Ras GTPase-activating-like protein IQGAP1 461 189761 16 16 15 15 2973 5326 1 1 1 559.8046 1117.5946 2 1117.5954 -0.0008 0 25.35 0.021 K LIFQMPQNK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6342.6342.2.dta 18 1 IPI00009342.1 Ras GTPase-activating-like protein IQGAP1 461 189761 16 16 15 15 3244 4791 1 1 1 577.3499 1152.6853 2 1152.6866 -0.0014 0 56.74 7.40E-06 K TLQALQIPAAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5794.5794.2.dta 18 1 IPI00009342.1 Ras GTPase-activating-like protein IQGAP1 461 189761 16 16 15 15 3984 3093 1 1 1 618.8325 1235.6505 2 1235.651 -0.0005 0 64.41 7.40E-06 K LQQTYAALNSK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3956.3956.2.dta 18 1 IPI00009342.1 Ras GTPase-activating-like protein IQGAP1 461 189761 16 16 15 15 4677 4573 1 1 1 659.835 1317.6555 2 1317.6565 -0.001 0 77.62 6.70E-08 R ALESGDVNTVWK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5560.5560.2.dta 18 1 IPI00009342.1 Ras GTPase-activating-like protein IQGAP1 461 189761 16 16 15 15 5460 5994 1 1 1 708.3976 1414.7806 2 1414.782 -0.0014 0 41.36 0.00013 K LGLAPQIQDLYGK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7006.7006.2.dta 18 1 IPI00009342.1 Ras GTPase-activating-like protein IQGAP1 461 189761 16 16 15 15 5974 4699 1 1 1 742.34 1482.6655 2 1482.6667 -0.0012 0 50.61 7.30E-05 K ATFYGEQVDYYK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5697.5697.2.dta 18 1 IPI00009342.1 Ras GTPase-activating-like protein IQGAP1 461 189761 16 16 15 15 6288 6394 1 1 1 771.9166 1541.8186 2 1541.8202 -0.0016 0 86.02 3.10E-08 R EQLWLANEGLITR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7402.7402.2.dta 18 1 IPI00009342.1 Ras GTPase-activating-like protein IQGAP1 461 189761 16 16 15 15 7457 5603 1 1 1 585.3269 1752.9589 3 1752.9622 -0.0033 0 19.61 0.014 K VDQIQEIVTGNPTVIK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6616.6616.3.dta 18 1 IPI00009342.1 Ras GTPase-activating-like protein IQGAP1 461 189761 16 16 15 15 7458 5589 1 1 1 877.4869 1752.9592 2 1752.9622 -0.003 0 81.61 3.30E-08 K VDQIQEIVTGNPTVIK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6602.6602.2.dta 18 IPI00299048.6 Isoform 1 of Ras GTPase-activating-like protein IQGAP2 48 181071 2 2 2 2 149 4562 1 0 1 321.7313 641.448 2 641.4476 0.0004 0 40.89 0.00018 K IGLLVK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5548.5548.2.dta 18 IPI00299048.6 Isoform 1 of Ras GTPase-activating-like protein IQGAP2 48 181071 2 2 2 2 2973 5326 1 0 1 559.8046 1117.5946 2 1117.5954 -0.0008 0 25.35 0.021 K LIFQMPQNK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6342.6342.2.dta 19 1 IPI00295857.6 Coatomer subunit alpha 460 139783 18 18 17 17 339 3827 1 1 1 350.2298 698.445 2 698.4439 0.0011 0 33.52 0.0056 K LALINR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4753.4753.2.dta 19 1 IPI00295857.6 Coatomer subunit alpha 460 139783 18 18 17 17 798 2588 1 1 1 404.7183 807.4221 2 807.4239 -0.0018 0 43.29 0.00088 R TGVQTFR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3387.3387.2.dta 19 1 IPI00295857.6 Coatomer subunit alpha 460 139783 18 18 17 17 1779 709 1 1 1 321.4985 961.4738 3 961.473 0.0008 0 33.01 0.002 K HVLEGHDR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1349.1349.3.dta 19 1 IPI00295857.6 Coatomer subunit alpha 460 139783 18 18 17 17 1876 4655 1 1 1 488.2432 974.4719 2 974.4722 -0.0004 0 38.44 0.0033 R VWNWQSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5649.5649.2.dta 19 1 IPI00295857.6 Coatomer subunit alpha 460 139783 18 18 17 17 2354 3599 1 1 1 518.7291 1035.4436 2 1035.4444 -0.0008 0 22.75 0.026 K AWEVDTCR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4507.4507.2.dta 19 1 IPI00295857.6 Coatomer subunit alpha 460 139783 18 18 17 17 2501 4971 1 1 1 528.7715 1055.5285 2 1055.5288 -0.0002 0 48.41 2.90E-05 K GFFEGTIASK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5985.5985.2.dta 19 1 IPI00295857.6 Coatomer subunit alpha 460 139783 18 18 17 17 3194 5428 1 1 1 573.8167 1145.6189 2 1145.6193 -0.0004 0 69.33 2.30E-06 R SSGLTAVWVAR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6443.6443.2.dta 19 1 IPI00295857.6 Coatomer subunit alpha 460 139783 18 18 17 17 3319 5593 1 1 1 581.8209 1161.6273 2 1161.6281 -0.0008 0 38.7 0.00023 R VLTIDPTEFK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6607.6607.2.dta 19 1 IPI00295857.6 Coatomer subunit alpha 460 139783 18 18 17 17 4029 3704 1 1 1 622.3179 1242.6213 2 1242.6204 0.0009 0 55.73 1.80E-05 K NLSPGAVESDVR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4620.4620.2.dta 19 1 IPI00295857.6 Coatomer subunit alpha 460 139783 18 18 17 17 4325 3775 1 1 1 638.3258 1274.6371 2 1274.6354 0.0017 0 31.13 0.0015 R QELILSNSEDK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4697.4697.2.dta 19 1 IPI00295857.6 Coatomer subunit alpha 460 139783 18 18 17 17 4551 3302 1 1 1 651.8439 1301.6732 2 1301.6728 0.0004 0 41.11 0.00014 K YAVTTGDHGIIR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4185.4185.2.dta 19 1 IPI00295857.6 Coatomer subunit alpha 460 139783 18 18 17 17 4552 3289 1 1 1 434.8991 1301.6756 3 1301.6728 0.0028 0 29.16 0.0093 K YAVTTGDHGIIR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4171.4171.3.dta 19 1 IPI00295857.6 Coatomer subunit alpha 460 139783 18 18 17 17 5958 5974 1 1 1 740.3694 1478.7243 2 1478.7253 -0.001 0 79.39 1.80E-07 R DADSITLFDVQQK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6986.6986.2.dta 19 1 IPI00295857.6 Coatomer subunit alpha 460 139783 18 18 17 17 6134 4416 1 1 1 758.3334 1514.6522 2 1514.6534 -0.0012 0 59.87 2.40E-06 K CPLSGACYSPEFK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5390.5390.2.dta 19 1 IPI00295857.6 Coatomer subunit alpha 460 139783 18 18 17 17 6785 3789 1 1 1 544.6245 1630.8515 3 1630.8526 -0.001 1 18.87 0.018 R QELILSNSEDKSIR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4712.4712.3.dta 19 1 IPI00295857.6 Coatomer subunit alpha 460 139783 18 18 17 17 6853 5320 1 1 1 545.9495 1634.8267 3 1634.8264 0.0003 1 24.96 0.01 R DADSITLFDVQQKR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6336.6336.3.dta 19 1 IPI00295857.6 Coatomer subunit alpha 460 139783 18 18 17 17 7104 4090 1 1 1 560.3207 1677.9404 3 1677.9413 -0.001 0 53.94 2.80E-05 R LLELGPKPEVAQQTR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5038.5038.3.dta 19 1 IPI00295857.6 Coatomer subunit alpha 460 139783 18 18 17 17 7652 5508 1 1 1 914.9509 1827.8873 2 1827.889 -0.0017 0 69.72 2.90E-07 R ASNLENSTYDLYTIPK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6522.6522.2.dta 20 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 452 57510 18 18 13 13 287 2036 1 1 0 343.2398 684.465 2 684.4646 0.0004 1 31.7 0.0031 R ILGVKR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2787.2787.2.dta 20 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 452 57510 18 18 13 13 1114 2167 1 1 1 430.7457 859.4768 2 859.4763 0.0005 1 38.3 0.0045 K SEDIKIR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2929.2929.2.dta 20 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 452 57510 18 18 13 13 1664 812 1 1 1 473.7697 945.5249 2 945.5243 0.0006 1 40.13 0.0017 K IRQDSVTK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1461.1461.2.dta 20 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 452 57510 18 18 13 13 1665 818 1 1 1 316.1824 945.5255 3 945.5243 0.0011 1 40.32 0.0016 K IRQDSVTK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1467.1467.3.dta 20 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 452 57510 18 18 13 13 2288 5084 1 1 0 514.7532 1027.4919 2 1027.4909 0.001 0 34.65 0.00098 R QLNMYGFR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6100.6100.2.dta 20 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 452 57510 18 18 13 13 2530 5265 1 1 1 530.8073 1059.6001 2 1059.5998 0.0003 0 55.89 3.50E-05 K LLTDVQLMK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6282.6282.2.dta 20 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 452 57510 18 18 13 13 2640 3116 1 1 0 538.2588 1074.5031 2 1074.5029 0.0003 0 28.98 0.0073 K HNNMASFVR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3981.3981.2.dta 20 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 452 57510 18 18 13 13 2657 4278 1 1 1 538.8048 1075.5951 2 1075.5947 0.0003 0 48.38 0.00028 K LLTDVQLMK G Oxidation (M) 0.000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5242.5242.2.dta 20 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 452 57510 18 18 13 13 2779 1924 1 1 0 546.2557 1090.4968 2 1090.4978 -0.001 0 64.69 8.60E-07 K HNNMASFVR Q Oxidation (M) 0.000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2665.2665.2.dta 20 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 452 57510 18 18 13 13 3396 4519 1 1 1 586.3199 1170.6253 2 1170.6244 0.0009 0 66.78 3.20E-06 R GQEQLLENIK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5502.5502.2.dta 20 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 452 57510 18 18 13 13 4753 3811 1 1 1 664.3696 1326.7246 2 1326.7255 -0.0009 1 27.64 0.0048 R GQEQLLENIKR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4736.4736.2.dta 20 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 452 57510 18 18 13 13 6373 2929 1 1 1 520.9662 1559.8767 3 1559.8784 -0.0016 0 17.4 0.023 K VVHIEQGGLVKPER D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3775.3775.3.dta 20 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 452 57510 18 18 13 13 6391 4859 1 1 1 782.8444 1563.6743 2 1563.6776 -0.0033 0 54.56 1.80E-05 R DDTEFQHPCFLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5867.5867.2.dta 20 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 452 57510 18 18 13 13 6669 4392 1 1 1 807.9011 1613.7877 2 1613.7897 -0.002 0 97.9 1.00E-09 R ESEPAPASVTALTDAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5364.5364.2.dta 20 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 452 57510 18 18 13 13 6670 4408 1 1 1 538.9372 1613.7898 3 1613.7897 0.0001 0 57.45 3.80E-05 R ESEPAPASVTALTDAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5381.5381.3.dta 20 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 452 57510 18 18 13 13 7151 2351 1 1 1 563.6645 1687.9716 3 1687.9733 -0.0017 1 29.44 0.0034 R KVVHIEQGGLVKPER D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3128.3128.3.dta 20 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 452 57510 18 18 13 13 7152 2344 1 1 1 423.0009 1687.9744 4 1687.9733 0.0011 1 43.57 0.00013 R KVVHIEQGGLVKPER D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3120.3120.4.dta 20 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 452 57510 18 18 13 13 7243 4492 1 1 1 566.6164 1696.8274 3 1696.8276 -0.0003 0 26.72 0.0083 K IPLMLNDSGSAHSMPK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5473.5473.3.dta 20 2 IPI00012878.1 Heat shock factor protein 2 99 60482 5 5 4 4 2288 5084 1 0 0 514.7532 1027.4919 2 1027.4909 0.001 0 34.65 0.00098 R QLNMYGFR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6100.6100.2.dta 20 2 IPI00012878.1 Heat shock factor protein 2 99 60482 5 5 4 4 2640 3116 1 0 0 538.2588 1074.5031 2 1074.5029 0.0003 0 28.98 0.0073 K HNNMASFVR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3981.3981.2.dta 20 2 IPI00012878.1 Heat shock factor protein 2 99 60482 5 5 4 4 2779 1924 1 0 0 546.2557 1090.4968 2 1090.4978 -0.001 0 64.69 8.60E-07 K HNNMASFVR Q Oxidation (M) 0.000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2665.2665.2.dta 20 2 IPI00012878.1 Heat shock factor protein 2 99 60482 5 5 4 4 4788 2370 1 0 1 444.2499 1329.7279 3 1329.7252 0.0027 1 24.48 0.017 K VQIKQETIESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3149.3149.3.dta 20 2 IPI00012878.1 Heat shock factor protein 2 99 60482 5 5 4 4 5555 4201 1 0 1 476.9193 1427.7361 3 1427.7368 -0.0007 1 15.77 0.039 K QGQDDLLENIKR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5158.5158.3.dta 20 IPI00008456.1 Isoform HSF4B of Heat shock factor protein 4 35 53362 1 1 1 1 2288 5084 1 0 0 514.7532 1027.4919 2 1027.4909 0.001 0 34.65 0.00098 R QLNMYGFR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6100.6100.2.dta 21 1 IPI00069084.2 Isoform 1 of Transformation/transcription domain-associated protein 421 441766 19 19 17 17 643 5613 1 1 1 388.2576 774.5006 2 774.5003 0.0003 0 18.73 0.013 K IIAALFK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6626.6626.2.dta 21 1 IPI00069084.2 Isoform 1 of Transformation/transcription domain-associated protein 421 441766 19 19 17 17 2100 3839 1 1 1 502.2314 1002.4483 2 1002.4481 0.0003 0 28.64 0.0021 K CYSVAFEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4766.4766.2.dta 21 1 IPI00069084.2 Isoform 1 of Transformation/transcription domain-associated protein 421 441766 19 19 17 17 2435 6600 1 1 1 523.794 1045.5735 2 1045.5709 0.0026 0 25.69 0.017 K TWVQLFPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7605.7605.2.dta 21 1 IPI00069084.2 Isoform 1 of Transformation/transcription domain-associated protein 421 441766 19 19 17 17 2451 965 1 1 1 525.2731 1048.5316 2 1048.5301 0.0015 1 26.55 0.011 R YKAQDTPAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1626.1626.2.dta 21 1 IPI00069084.2 Isoform 1 of Transformation/transcription domain-associated protein 421 441766 19 19 17 17 2864 6767 1 1 1 552.8077 1103.6009 2 1103.6009 0.0001 0 42.93 0.00016 K TTLEQLLMR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7770.7770.2.dta 21 1 IPI00069084.2 Isoform 1 of Transformation/transcription domain-associated protein 421 441766 19 19 17 17 2992 6150 1 1 1 560.8051 1119.5956 2 1119.5958 -0.0002 0 45.7 0.00056 K TTLEQLLMR C Oxidation (M) 0.000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7161.7161.2.dta 21 1 IPI00069084.2 Isoform 1 of Transformation/transcription domain-associated protein 421 441766 19 19 17 17 3225 5465 1 1 1 575.8143 1149.614 2 1149.6142 -0.0002 0 73.25 7.20E-07 R TATGAISAVFGR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6480.6480.2.dta 21 1 IPI00069084.2 Isoform 1 of Transformation/transcription domain-associated protein 421 441766 19 19 17 17 3234 7097 1 1 1 576.7678 1151.521 2 1151.5222 -0.0013 0 23.81 0.0064 R MDPAWHPWL - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8097.8097.2.dta 21 1 IPI00069084.2 Isoform 1 of Transformation/transcription domain-associated protein 421 441766 19 19 17 17 3382 4025 1 1 1 390.5605 1168.6595 3 1168.6604 -0.0009 0 17.2 0.025 K ITPHTLNFVK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4967.4967.3.dta 21 1 IPI00069084.2 Isoform 1 of Transformation/transcription domain-associated protein 421 441766 19 19 17 17 3878 7034 1 1 1 614.8566 1227.6987 2 1227.7009 -0.0022 0 23.04 0.0069 K LLLNLVDCIR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8034.8034.2.dta 21 1 IPI00069084.2 Isoform 1 of Transformation/transcription domain-associated protein 421 441766 19 19 17 17 4434 2566 1 1 1 644.8455 1287.6764 2 1287.6783 -0.0019 1 24.13 0.006 R GLSVDSAQEVKR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3363.3363.2.dta 21 1 IPI00069084.2 Isoform 1 of Transformation/transcription domain-associated protein 421 441766 19 19 17 17 4435 2552 1 1 1 430.2333 1287.6781 3 1287.6783 -0.0002 1 19 0.017 R GLSVDSAQEVKR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3348.3348.3.dta 21 1 IPI00069084.2 Isoform 1 of Transformation/transcription domain-associated protein 421 441766 19 19 17 17 4567 3147 1 1 1 652.3353 1302.656 2 1302.6568 -0.0008 0 62.05 1.50E-06 R AQATAQDPVFQK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4016.4016.2.dta 21 1 IPI00069084.2 Isoform 1 of Transformation/transcription domain-associated protein 421 441766 19 19 17 17 4757 4546 1 1 1 664.8392 1327.6639 2 1327.666 -0.002 0 54.12 2.80E-05 K VIYEGLTNYEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5531.5531.2.dta 21 1 IPI00069084.2 Isoform 1 of Transformation/transcription domain-associated protein 421 441766 19 19 17 17 4931 1906 1 1 1 337.6787 1346.6857 4 1346.6844 0.0013 0 36.03 0.0028 K SFHHVTHDLVR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2646.2646.4.dta 21 1 IPI00069084.2 Isoform 1 of Transformation/transcription domain-associated protein 421 441766 19 19 17 17 4935 5117 1 1 1 674.3658 1346.717 2 1346.7194 -0.0024 0 75.99 2.10E-07 R LGFTPSVTIEQR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6132.6132.2.dta 21 1 IPI00069084.2 Isoform 1 of Transformation/transcription domain-associated protein 421 441766 19 19 17 17 4972 6120 1 1 1 676.871 1351.7274 2 1351.7289 -0.0015 0 15.18 0.038 R VYPQAVYFPIR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7131.7131.2.dta 21 1 IPI00069084.2 Isoform 1 of Transformation/transcription domain-associated protein 421 441766 19 19 17 17 7578 5980 1 1 1 898.4291 1794.8436 2 1794.8424 0.0012 0 50.31 2.10E-05 K ELNQWEALTEYGQSK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6992.6992.2.dta 21 1 IPI00069084.2 Isoform 1 of Transformation/transcription domain-associated protein 421 441766 19 19 17 17 7595 6273 1 1 1 903.4792 1804.9439 2 1804.9458 -0.0019 0 73.37 1.30E-07 R LVEDNPSSLSLVEIYK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7283.7283.2.dta 22 1 IPI00013452.8 glutamyl-prolyl tRNA synthetase 413 172080 16 16 15 15 119 2723 1 1 1 315.6949 629.3753 2 629.3748 0.0005 0 33.64 0.006 R LGLEAK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3533.3533.2.dta 22 1 IPI00013452.8 glutamyl-prolyl tRNA synthetase 413 172080 16 16 15 15 234 2434 1 1 1 335.6984 669.3823 2 669.381 0.0013 0 31.01 0.0087 R LEVGPR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3218.3218.2.dta 22 1 IPI00013452.8 glutamyl-prolyl tRNA synthetase 413 172080 16 16 15 15 932 3015 1 1 1 418.7112 835.4078 2 835.4076 0.0002 0 26.24 0.0081 K WDVSTTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3868.3868.2.dta 22 1 IPI00013452.8 glutamyl-prolyl tRNA synthetase 413 172080 16 16 15 15 1136 3226 1 1 1 433.7579 865.5013 2 865.5022 -0.0009 0 40.31 0.0004 K VIDPVAPR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4102.4102.2.dta 22 1 IPI00013452.8 glutamyl-prolyl tRNA synthetase 413 172080 16 16 15 15 1460 5700 1 1 1 460.2374 918.4603 2 918.4599 0.0004 0 38.81 0.0015 K YYTLFGR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6713.6713.2.dta 22 1 IPI00013452.8 glutamyl-prolyl tRNA synthetase 413 172080 16 16 15 15 1632 2593 1 1 1 471.7712 941.5279 2 941.5294 -0.0015 0 48.13 0.00019 R VAVQGDVVR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3392.3392.2.dta 22 1 IPI00013452.8 glutamyl-prolyl tRNA synthetase 413 172080 16 16 15 15 2551 2576 1 1 1 532.7771 1063.5396 2 1063.541 -0.0014 0 41.65 0.00087 K QFIAAQGSSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3374.3374.2.dta 22 1 IPI00013452.8 glutamyl-prolyl tRNA synthetase 413 172080 16 16 15 15 2595 3409 1 1 1 357.5482 1069.6229 3 1069.6244 -0.0015 1 27.24 0.021 K KGDIIQLQR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4301.4301.3.dta 22 1 IPI00013452.8 glutamyl-prolyl tRNA synthetase 413 172080 16 16 15 15 3522 4325 1 1 1 594.8002 1187.5858 2 1187.587 -0.0012 0 38.35 0.00074 K LNQWCNVVR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5291.5291.2.dta 22 1 IPI00013452.8 glutamyl-prolyl tRNA synthetase 413 172080 16 16 15 15 4510 3065 1 1 1 650.2813 1298.5481 2 1298.5496 -0.0015 0 36.23 0.00081 K GSQFGQSCCLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3924.3924.2.dta 22 1 IPI00013452.8 glutamyl-prolyl tRNA synthetase 413 172080 16 16 15 15 4867 2889 1 1 1 671.827 1341.6394 2 1341.6412 -0.0018 0 55.3 4.50E-05 R NSEPAGLETPEAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3731.3731.2.dta 22 1 IPI00013452.8 glutamyl-prolyl tRNA synthetase 413 172080 16 16 15 15 4868 2830 1 1 1 671.8273 1341.64 2 1341.6412 -0.0012 0 58.85 2.10E-05 R NSEPAGLETPEAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3663.3663.2.dta 22 1 IPI00013452.8 glutamyl-prolyl tRNA synthetase 413 172080 16 16 15 15 5250 6748 1 1 1 694.8758 1387.737 2 1387.7381 -0.001 0 43.65 0.00038 K INEAVECLLSLK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7752.7752.2.dta 22 1 IPI00013452.8 glutamyl-prolyl tRNA synthetase 413 172080 16 16 15 15 6242 5111 1 1 1 768.3872 1534.7599 2 1534.7627 -0.0029 0 97.37 7.50E-10 K SLYDEVAAQGEVVR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6127.6127.2.dta 22 1 IPI00013452.8 glutamyl-prolyl tRNA synthetase 413 172080 16 16 15 15 6573 1639 1 1 1 794.371 1586.7274 2 1586.7285 -0.0011 0 88.45 5.10E-09 K NQGGGLSSSGAGEGQGPK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2357.2357.2.dta 22 1 IPI00013452.8 glutamyl-prolyl tRNA synthetase 413 172080 16 16 15 15 7638 6232 1 1 1 608.6429 1822.907 3 1822.9101 -0.0031 1 27.79 0.0058 K KEENLADWYSQVITK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7241.7241.3.dta 23 1 IPI00334775.6 85 kDa protein 412 85104 11 11 9 9 899 6104 1 1 1 415.2686 828.5226 2 828.5221 0.0005 0 28.49 0.01 R ALLFIPR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7116.7116.2.dta 23 1 IPI00334775.6 85 kDa protein 412 85104 11 11 9 9 1275 4076 1 1 1 446.2159 890.4173 2 890.4174 -0.0001 0 35.33 0.0014 K FYEAFSK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5023.5023.2.dta 23 1 IPI00334775.6 85 kDa protein 412 85104 11 11 9 9 3149 1850 1 1 1 571.2829 1140.5512 2 1140.5523 -0.0011 0 27.57 0.0026 K LGIHEDSTNR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2585.2585.2.dta 23 1 IPI00334775.6 85 kDa protein 412 85104 11 11 9 9 3150 1849 1 1 1 381.1918 1140.5535 3 1140.5523 0.0011 0 41.91 0.0012 K LGIHEDSTNR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2584.2584.3.dta 23 1 IPI00334775.6 85 kDa protein 412 85104 11 11 9 9 3228 2858 1 1 0 576.2823 1150.55 2 1150.5506 -0.0006 0 55.93 4.60E-05 K YIDQEELNK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3696.3696.2.dta 23 1 IPI00334775.6 85 kDa protein 412 85104 11 11 9 9 4025 5501 1 1 0 621.8563 1241.698 2 1241.6979 0.0001 0 78.83 1.40E-07 K ADLINNLGTIAK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6516.6516.2.dta 23 1 IPI00334775.6 85 kDa protein 412 85104 11 11 9 9 4089 3309 1 1 1 625.3144 1248.6142 2 1248.6098 0.0044 0 41.36 0.00034 K EQVANSAFVER V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4193.4193.2.dta 23 1 IPI00334775.6 85 kDa protein 412 85104 11 11 9 9 4953 5659 1 1 1 675.3685 1348.7225 2 1348.7272 -0.0047 0 54.89 1.20E-05 R TLTLVDTGIGMTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6673.6673.2.dta 23 1 IPI00334775.6 85 kDa protein 412 85104 11 11 9 9 5081 5004 1 1 1 683.3664 1364.7182 2 1364.7221 -0.0039 0 79.42 4.20E-08 R TLTLVDTGIGMTK A Oxidation (M) 0.0000000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6018.6018.2.dta 23 1 IPI00334775.6 85 kDa protein 412 85104 11 11 9 9 6126 5437 1 1 0 757.3947 1512.7748 2 1512.7784 -0.0036 0 80.86 9.30E-08 R GVVDSEDLPLNISR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6453.6453.2.dta 23 1 IPI00334775.6 85 kDa protein 412 85104 11 11 9 9 7719 4975 1 1 1 924.4009 1846.7873 2 1846.7897 -0.0024 0 90.73 4.20E-09 R NPDDITQEEYGEFYK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5989.5989.2.dta 23 2 IPI00382470.3 Heat shock protein HSP 90-alpha 2 381 98670 10 10 9 9 1674 3631 1 0 1 474.7262 947.4378 2 947.4389 -0.0011 0 34.1 0.0056 K FYEQFSK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4542.4542.2.dta 23 2 IPI00382470.3 Heat shock protein HSP 90-alpha 2 381 98670 10 10 9 9 2883 6316 1 0 1 554.7744 1107.5342 2 1107.5349 -0.0007 0 47.33 3.60E-05 R APFDLFENR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7325.7325.2.dta 23 2 IPI00382470.3 Heat shock protein HSP 90-alpha 2 381 98670 10 10 9 9 3228 2858 1 0 0 576.2823 1150.55 2 1150.5506 -0.0006 0 55.93 4.60E-05 K YIDQEELNK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3696.3696.2.dta 23 2 IPI00382470.3 Heat shock protein HSP 90-alpha 2 381 98670 10 10 9 9 3966 3439 1 0 1 618.3046 1234.5946 2 1234.5942 0.0004 0 58.84 7.10E-06 K DQVANSAFVER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4334.4334.2.dta 23 2 IPI00382470.3 Heat shock protein HSP 90-alpha 2 381 98670 10 10 9 9 4025 5501 1 0 0 621.8563 1241.698 2 1241.6979 0.0001 0 78.83 1.40E-07 K ADLINNLGTIAK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6516.6516.2.dta 23 2 IPI00382470.3 Heat shock protein HSP 90-alpha 2 381 98670 10 10 9 9 4231 5747 1 0 1 632.8236 1263.6327 2 1263.636 -0.0033 1 29.74 0.0016 R RAPFDLFENR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6759.6759.2.dta 23 2 IPI00382470.3 Heat shock protein HSP 90-alpha 2 381 98670 10 10 9 9 4953 5659 1 0 1 675.3685 1348.7225 2 1348.7272 -0.0047 0 54.89 1.20E-05 R TLTIVDTGIGMTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6673.6673.2.dta 23 2 IPI00382470.3 Heat shock protein HSP 90-alpha 2 381 98670 10 10 9 9 5081 5004 1 0 1 683.3664 1364.7182 2 1364.7221 -0.0039 0 79.42 4.20E-08 R TLTIVDTGIGMTK A Oxidation (M) 0.0000000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6018.6018.2.dta 23 2 IPI00382470.3 Heat shock protein HSP 90-alpha 2 381 98670 10 10 9 9 6126 5437 1 0 0 757.3947 1512.7748 2 1512.7784 -0.0036 0 80.86 9.30E-08 R GVVDSEDLPLNISR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6453.6453.2.dta 23 2 IPI00382470.3 Heat shock protein HSP 90-alpha 2 381 98670 10 10 9 9 7663 4914 1 0 1 917.3935 1832.7724 2 1832.7741 -0.0016 0 37.78 0.00042 R NPDDITNEEYGEFYK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5925.5925.2.dta 23 IPI00604607.2 Hsp89-alpha-delta-N 227 63839 7 7 7 7 1674 3631 1 0 1 474.7262 947.4378 2 947.4389 -0.0011 0 34.1 0.0056 K FYEQFSK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4542.4542.2.dta 23 IPI00604607.2 Hsp89-alpha-delta-N 227 63839 7 7 7 7 2883 6316 1 0 1 554.7744 1107.5342 2 1107.5349 -0.0007 0 47.33 3.60E-05 R APFDLFENR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7325.7325.2.dta 23 IPI00604607.2 Hsp89-alpha-delta-N 227 63839 7 7 7 7 3228 2858 1 0 0 576.2823 1150.55 2 1150.5506 -0.0006 0 55.93 4.60E-05 K YIDQEELNK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3696.3696.2.dta 23 IPI00604607.2 Hsp89-alpha-delta-N 227 63839 7 7 7 7 3966 3439 1 0 1 618.3046 1234.5946 2 1234.5942 0.0004 0 58.84 7.10E-06 K DQVANSAFVER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4334.4334.2.dta 23 IPI00604607.2 Hsp89-alpha-delta-N 227 63839 7 7 7 7 4231 5747 1 0 1 632.8236 1263.6327 2 1263.636 -0.0033 1 29.74 0.0016 R RAPFDLFENR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6759.6759.2.dta 23 IPI00604607.2 Hsp89-alpha-delta-N 227 63839 7 7 7 7 6126 5437 1 0 0 757.3947 1512.7748 2 1512.7784 -0.0036 0 80.86 9.30E-08 R GVVDSEDLPLNISR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6453.6453.2.dta 23 IPI00604607.2 Hsp89-alpha-delta-N 227 63839 7 7 7 7 7663 4914 1 0 1 917.3935 1832.7724 2 1832.7741 -0.0016 0 37.78 0.00042 R NPDDITNEEYGEFYK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5925.5925.2.dta 23 IPI00411633.3 Heat shock protein beta 174 17005 3 3 2 2 4025 5501 1 0 0 621.8563 1241.698 2 1241.6979 0.0001 0 78.83 1.40E-07 K ADLINNLGTIAK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6516.6516.2.dta 23 IPI00411633.3 Heat shock protein beta 174 17005 3 3 2 2 4953 5659 1 0 1 675.3685 1348.7225 2 1348.7272 -0.0047 0 54.89 1.20E-05 R TLTLVDTGIGMTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6673.6673.2.dta 23 IPI00411633.3 Heat shock protein beta 174 17005 3 3 2 2 5081 5004 1 0 1 683.3664 1364.7182 2 1364.7221 -0.0039 0 79.42 4.20E-08 R TLTLVDTGIGMTK A Oxidation (M) 0.0000000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6018.6018.2.dta 23 IPI00515119.3 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 147 19120 5 5 4 4 1275 4076 1 0 1 446.2159 890.4173 2 890.4174 -0.0001 0 35.33 0.0014 K FYEAFSK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5023.5023.2.dta 23 IPI00515119.3 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 147 19120 5 5 4 4 3149 1850 1 0 1 571.2829 1140.5512 2 1140.5523 -0.0011 0 27.57 0.0026 K LGIHEDSTNR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2585.2585.2.dta 23 IPI00515119.3 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 147 19120 5 5 4 4 3150 1849 1 0 1 381.1918 1140.5535 3 1140.5523 0.0011 0 41.91 0.0012 K LGIHEDSTNR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2584.2584.3.dta 23 IPI00515119.3 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 147 19120 5 5 4 4 4089 3309 1 0 1 625.3144 1248.6142 2 1248.6098 0.0044 0 41.36 0.00034 K EQVANSAFVER C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4193.4193.2.dta 23 IPI00515119.3 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 147 19120 5 5 4 4 6126 5437 1 0 0 757.3947 1512.7748 2 1512.7784 -0.0036 0 80.86 9.30E-08 R GVVDSEDLPLNISR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6453.6453.2.dta 23 IPI00514659.2 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 125 20112 4 4 3 3 1275 4076 1 0 1 446.2159 890.4173 2 890.4174 -0.0001 0 35.33 0.0014 K FYEAFSK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5023.5023.2.dta 23 IPI00514659.2 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 125 20112 4 4 3 3 3149 1850 1 0 1 571.2829 1140.5512 2 1140.5523 -0.0011 0 27.57 0.0026 K LGIHEDSTNR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2585.2585.2.dta 23 IPI00514659.2 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 125 20112 4 4 3 3 3150 1849 1 0 1 381.1918 1140.5535 3 1140.5523 0.0011 0 41.91 0.0012 K LGIHEDSTNR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2584.2584.3.dta 23 IPI00514659.2 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 125 20112 4 4 3 3 6126 5437 1 0 0 757.3947 1512.7748 2 1512.7784 -0.0036 0 80.86 9.30E-08 R GVVDSEDLPLNISR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6453.6453.2.dta 23 IPI00555957.1 Heat shock protein 90Ad 116 47796 2 2 1 1 4953 5659 1 0 1 675.3685 1348.7225 2 1348.7272 -0.0047 0 54.89 1.20E-05 R TLTIVDTGIGMTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6673.6673.2.dta 23 IPI00555957.1 Heat shock protein 90Ad 116 47796 2 2 1 1 5081 5004 1 0 1 683.3664 1364.7182 2 1364.7221 -0.0039 0 79.42 4.20E-08 R TLTIVDTGIGMTK A Oxidation (M) 0.0000000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6018.6018.2.dta 23 IPI00031523.3 Heat shock protein 90 kDa alpha class A member 2 (Fragment) 111 35709 2 2 2 2 3228 2858 1 0 0 576.2823 1150.55 2 1150.5506 -0.0006 0 55.93 4.60E-05 K YIDQEELNK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3696.3696.2.dta 23 IPI00031523.3 Heat shock protein 90 kDa alpha class A member 2 (Fragment) 111 35709 2 2 2 2 4025 5501 1 0 0 621.8563 1241.698 2 1241.6979 0.0001 0 78.83 1.40E-07 K ADLINNLGTIAK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6516.6516.2.dta 23 IPI00796258.1 12 kDa protein 91 11880 2 2 2 2 1674 3631 1 0 1 474.7262 947.4378 2 947.4389 -0.0011 0 34.1 0.0056 K FYEQFSK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4542.4542.2.dta 23 IPI00796258.1 12 kDa protein 91 11880 2 2 2 2 6126 5437 1 0 0 757.3947 1512.7748 2 1512.7784 -0.0036 0 80.86 9.30E-08 R GVVDSEDLPLNISR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6453.6453.2.dta 23 IPI00030275.5 "Heat shock protein 75 kDa, mitochondrial precursor" 81 80345 1 1 1 1 6126 5437 1 0 1 757.3947 1512.7748 2 1512.7784 -0.0036 0 80.86 9.30E-08 R GVVDSEDIPLNLSR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6453.6453.2.dta 23 IPI00555614.1 Heat shock protein 90Bc 41 68624 1 1 1 1 4089 3309 1 0 1 625.3144 1248.6142 2 1248.6098 0.0044 0 41.36 0.00034 K EQVANSAFVER V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4193.4193.2.dta 23 IPI00555915.1 Heat shock protein 90Bf 35 41833 1 1 1 1 1275 4076 1 0 1 446.2159 890.4173 2 890.4174 -0.0001 0 35.33 0.0014 K FYEAFSK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5023.5023.2.dta 24 1 IPI00023785.5 Isoform 1 of Probable ATP-dependent RNA helicase DDX17 382 72953 10 10 10 10 1996 5214 1 1 1 496.2639 990.5132 2 990.5134 -0.0002 0 53.44 0.0001 R QLAEDFLR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6231.6231.2.dta 24 1 IPI00023785.5 Isoform 1 of Probable ATP-dependent RNA helicase DDX17 382 72953 10 10 10 10 2244 5960 1 1 1 511.2822 1020.5498 2 1020.5491 0.0007 0 46.45 0.00013 R LIDFLESGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6971.6971.2.dta 24 1 IPI00023785.5 Isoform 1 of Probable ATP-dependent RNA helicase DDX17 382 72953 10 10 10 10 2667 6562 1 1 1 539.7694 1077.5243 2 1077.5243 -0.0001 0 22.99 0.007 R DWVLNEFR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7569.7569.2.dta 24 1 IPI00023785.5 Isoform 1 of Probable ATP-dependent RNA helicase DDX17 382 72953 10 10 10 10 2722 2838 1 1 0 361.8685 1082.5836 3 1082.5832 0.0003 1 19.05 0.016 K GPQIRDLER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3673.3673.3.dta 24 1 IPI00023785.5 Isoform 1 of Probable ATP-dependent RNA helicase DDX17 382 72953 10 10 10 10 3869 4957 1 1 0 613.858 1225.7015 2 1225.703 -0.0015 0 56.78 4.70E-06 K APILIATDVASR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5970.5970.2.dta 24 1 IPI00023785.5 Isoform 1 of Probable ATP-dependent RNA helicase DDX17 382 72953 10 10 10 10 4737 3105 1 1 1 663.3556 1324.6966 2 1324.6986 -0.002 0 82.63 8.40E-08 K VLEEANQAINPK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3969.3969.2.dta 24 1 IPI00023785.5 Isoform 1 of Probable ATP-dependent RNA helicase DDX17 382 72953 10 10 10 10 5096 6054 1 1 0 684.8672 1367.7198 2 1367.7231 -0.0033 0 49.02 3.90E-05 R GDGPICLVLAPTR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7066.7066.2.dta 24 1 IPI00023785.5 Isoform 1 of Probable ATP-dependent RNA helicase DDX17 382 72953 10 10 10 10 5462 6076 1 1 1 708.8609 1415.7073 2 1415.7085 -0.0013 0 62.54 1.40E-06 K GTAYTFFTPGNLK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7089.7089.2.dta 24 1 IPI00023785.5 Isoform 1 of Probable ATP-dependent RNA helicase DDX17 382 72953 10 10 10 10 5754 3095 1 1 1 728.3448 1454.6751 2 1454.675 0.0002 0 83.89 1.40E-08 R SSQSSSQQFSGIGR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3958.3958.2.dta 24 1 IPI00023785.5 Isoform 1 of Probable ATP-dependent RNA helicase DDX17 382 72953 10 10 10 10 7161 5008 1 1 1 846.4141 1690.8137 2 1690.8162 -0.0025 0 68.99 3.40E-07 R ELAQQVQQVADDYGK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6022.6022.2.dta 24 2 IPI00017617.1 Probable ATP-dependent RNA helicase DDX5 377 69618 15 15 15 15 35 2174 1 0 1 302.6638 603.313 2 603.3129 0.0001 0 32.88 0.014 R GFGAPR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2936.2936.2.dta 24 2 IPI00017617.1 Probable ATP-dependent RNA helicase DDX5 377 69618 15 15 15 15 517 1501 1 0 1 374.6853 747.3561 2 747.3551 0.0009 0 32.85 0.013 K FGNPGEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2207.2207.2.dta 24 2 IPI00017617.1 Probable ATP-dependent RNA helicase DDX5 377 69618 15 15 15 15 914 1359 1 0 1 416.7478 831.481 2 831.4814 -0.0004 1 45.44 0.00059 R SKEITVR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2053.2053.2.dta 24 2 IPI00017617.1 Probable ATP-dependent RNA helicase DDX5 377 69618 15 15 15 15 1936 1348 1 0 1 492.7592 983.5038 2 983.5036 0.0002 0 43.53 0.00046 R EANQAINPK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2041.2041.2.dta 24 2 IPI00017617.1 Probable ATP-dependent RNA helicase DDX5 377 69618 15 15 15 15 1947 4797 1 0 1 493.2875 984.5605 2 984.5604 0.0001 0 50.03 9.60E-05 K LLQLVEDR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5801.5801.2.dta 24 2 IPI00017617.1 Probable ATP-dependent RNA helicase DDX5 377 69618 15 15 15 15 2456 6459 1 0 1 525.7664 1049.5182 2 1049.5182 0 0 38.41 0.0021 R DWVLNEFK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7466.7466.2.dta 24 2 IPI00017617.1 Probable ATP-dependent RNA helicase DDX5 377 69618 15 15 15 15 2722 2838 1 0 0 361.8685 1082.5836 3 1082.5832 0.0003 1 19.05 0.016 K GPQIRDLER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3673.3673.3.dta 24 2 IPI00017617.1 Probable ATP-dependent RNA helicase DDX5 377 69618 15 15 15 15 2807 6036 1 0 1 547.7811 1093.5476 2 1093.5478 -0.0002 0 56.33 8.20E-06 R LIDFLECGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7049.7049.2.dta 24 2 IPI00017617.1 Probable ATP-dependent RNA helicase DDX5 377 69618 15 15 15 15 3066 6292 1 0 1 565.3323 1128.65 2 1128.6503 -0.0003 0 38.5 0.0014 K QVSDLISVLR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7301.7301.2.dta 24 2 IPI00017617.1 Probable ATP-dependent RNA helicase DDX5 377 69618 15 15 15 15 3869 4957 1 0 0 613.858 1225.7015 2 1225.703 -0.0015 0 56.78 4.70E-06 K APILIATDVASR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5970.5970.2.dta 24 2 IPI00017617.1 Probable ATP-dependent RNA helicase DDX5 377 69618 15 15 15 15 4109 1642 1 0 1 626.817 1251.6195 2 1251.6207 -0.0013 1 18.45 0.019 R TAQEVETYRR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2360.2360.2.dta 24 2 IPI00017617.1 Probable ATP-dependent RNA helicase DDX5 377 69618 15 15 15 15 4481 5064 1 0 1 648.3273 1294.6401 2 1294.6405 -0.0004 0 58.02 3.60E-06 R TTYLVLDEADR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6079.6079.2.dta 24 2 IPI00017617.1 Probable ATP-dependent RNA helicase DDX5 377 69618 15 15 15 15 5096 6054 1 0 0 684.8672 1367.7198 2 1367.7231 -0.0033 0 49.02 3.90E-05 R GDGPICLVLAPTR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7066.7066.2.dta 24 2 IPI00017617.1 Probable ATP-dependent RNA helicase DDX5 377 69618 15 15 15 15 6506 5832 1 0 1 787.8944 1573.7743 2 1573.7777 -0.0034 0 66.09 3.20E-06 K TGTAYTFFTPNNIK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6843.6843.2.dta 24 2 IPI00017617.1 Probable ATP-dependent RNA helicase DDX5 377 69618 15 15 15 15 7571 5366 1 0 1 896.9356 1791.8567 2 1791.8574 -0.0007 0 57.19 4.30E-06 R ELAQQVQQVAAEYCR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6381.6381.2.dta 24 IPI00798375.1 23 kDa protein 130 23474 4 4 4 4 1936 1348 1 0 1 492.7592 983.5038 2 983.5036 0.0002 0 43.53 0.00046 R EANQAINPK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2041.2041.2.dta 24 IPI00798375.1 23 kDa protein 130 23474 4 4 4 4 1947 4797 1 0 1 493.2875 984.5605 2 984.5604 0.0001 0 50.03 9.60E-05 K LLQLVEDR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5801.5801.2.dta 24 IPI00798375.1 23 kDa protein 130 23474 4 4 4 4 3066 6292 1 0 1 565.3323 1128.65 2 1128.6503 -0.0003 0 38.5 0.0014 K QVSDLISVLR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7301.7301.2.dta 24 IPI00798375.1 23 kDa protein 130 23474 4 4 4 4 6506 5832 1 0 1 787.8944 1573.7743 2 1573.7777 -0.0034 0 66.09 3.20E-06 K TGTAYTFFTPNNIK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6843.6843.2.dta 25 1 IPI00007928.4 Pre-mRNA-processing-splicing factor 8 375 274738 22 22 22 22 114 1977 1 1 1 315.2034 628.3922 2 628.3908 0.0014 0 43.91 0.0013 R LGQLAK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2723.2723.2.dta 25 1 IPI00007928.4 Pre-mRNA-processing-splicing factor 8 375 274738 22 22 22 22 577 4177 1 1 1 380.7212 759.4279 2 759.4279 0 0 18.51 0.018 K FEPLVR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5132.5132.2.dta 25 1 IPI00007928.4 Pre-mRNA-processing-splicing factor 8 375 274738 22 22 22 22 594 4235 1 1 1 382.2397 762.4648 2 762.464 0.0009 0 27.06 0.016 R VYLGALK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5195.5195.2.dta 25 1 IPI00007928.4 Pre-mRNA-processing-splicing factor 8 375 274738 22 22 22 22 790 5411 1 1 1 403.2445 804.4745 2 804.4745 0 0 45.47 0.00013 K FGDLILK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6427.6427.2.dta 25 1 IPI00007928.4 Pre-mRNA-processing-splicing factor 8 375 274738 22 22 22 22 793 4405 1 1 1 403.7422 805.4699 2 805.4698 0.0002 0 29.67 0.01 R TGQLFLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5378.5378.2.dta 25 1 IPI00007928.4 Pre-mRNA-processing-splicing factor 8 375 274738 22 22 22 22 811 1470 1 1 1 405.7142 809.4139 2 809.4144 -0.0005 0 28.08 0.018 K HDVNLGR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2174.2174.2.dta 25 1 IPI00007928.4 Pre-mRNA-processing-splicing factor 8 375 274738 22 22 22 22 851 2480 1 1 1 410.2219 818.4293 2 818.4287 0.0006 0 34.81 0.0082 R FNTGPVGK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3268.3268.2.dta 25 1 IPI00007928.4 Pre-mRNA-processing-splicing factor 8 375 274738 22 22 22 22 1229 6105 1 1 1 439.7422 877.4699 2 877.4698 0.0002 0 31.2 0.019 R AVFWDIK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7117.7117.2.dta 25 1 IPI00007928.4 Pre-mRNA-processing-splicing factor 8 375 274738 22 22 22 22 1313 4742 1 1 1 449.7717 897.5288 2 897.5284 0.0005 0 19.28 0.019 R GITPLLER W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5743.5743.2.dta 25 1 IPI00007928.4 Pre-mRNA-processing-splicing factor 8 375 274738 22 22 22 22 1593 1916 1 1 1 313.1836 936.5289 3 936.528 0.0009 1 25.31 0.016 R LKEAYSVK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2657.2657.3.dta 25 1 IPI00007928.4 Pre-mRNA-processing-splicing factor 8 375 274738 22 22 22 22 1596 1151 1 1 1 313.4986 937.474 3 937.473 0.001 0 37.3 0.0036 R ALHVNNDR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1828.1828.3.dta 25 1 IPI00007928.4 Pre-mRNA-processing-splicing factor 8 375 274738 22 22 22 22 1732 5773 1 1 1 479.2897 956.5649 2 956.5655 -0.0005 0 53.45 6.90E-05 K IDLTLLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6785.6785.2.dta 25 1 IPI00007928.4 Pre-mRNA-processing-splicing factor 8 375 274738 22 22 22 22 1930 5348 1 1 1 492.2815 982.5484 2 982.5487 -0.0003 0 29.71 0.0018 K YYVLNALK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6364.6364.2.dta 25 1 IPI00007928.4 Pre-mRNA-processing-splicing factor 8 375 274738 22 22 22 22 1987 7345 1 1 1 495.3107 988.6068 2 988.6069 -0.0002 0 22.28 0.026 K ISLIQIFR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8342.8342.2.dta 25 1 IPI00007928.4 Pre-mRNA-processing-splicing factor 8 375 274738 22 22 22 22 2255 5594 1 1 1 512.2686 1022.5227 2 1022.5219 0.0008 0 27.14 0.0059 K FICISDLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6608.6608.2.dta 25 1 IPI00007928.4 Pre-mRNA-processing-splicing factor 8 375 274738 22 22 22 22 2265 4609 1 1 1 512.8293 1023.6441 2 1023.644 0.0001 1 35.59 0.00095 R RALDIPLVK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5599.5599.2.dta 25 1 IPI00007928.4 Pre-mRNA-processing-splicing factor 8 375 274738 22 22 22 22 2610 4972 1 1 1 536.8038 1071.593 2 1071.5924 0.0006 0 93.02 1.30E-08 K TAEEVAALIR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5986.5986.2.dta 25 1 IPI00007928.4 Pre-mRNA-processing-splicing factor 8 375 274738 22 22 22 22 2734 885 1 1 1 543.2935 1084.5724 2 1084.5737 -0.0014 1 77.52 3.70E-07 K RQEAIAQNR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1540.1540.2.dta 25 1 IPI00007928.4 Pre-mRNA-processing-splicing factor 8 375 274738 22 22 22 22 3009 890 1 1 1 561.7712 1121.5279 2 1121.5288 -0.0009 0 31.13 0.0023 R EHCPAGQPVK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1545.1545.2.dta 25 1 IPI00007928.4 Pre-mRNA-processing-splicing factor 8 375 274738 22 22 22 22 3581 6139 1 1 1 597.8312 1193.6478 2 1193.6485 -0.0007 0 19.63 0.014 R FPPVVFYTPK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7150.7150.2.dta 25 1 IPI00007928.4 Pre-mRNA-processing-splicing factor 8 375 274738 22 22 22 22 4219 1796 1 1 1 631.8197 1261.6249 2 1261.6262 -0.0014 0 48.68 0.00016 K EQSQLTATQTR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2527.2527.2.dta 25 1 IPI00007928.4 Pre-mRNA-processing-splicing factor 8 375 274738 22 22 22 22 6022 7099 1 1 1 746.3516 1490.6887 2 1490.6889 -0.0002 0 30 0.0015 R LTLEDLEDSWDR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8099.8099.2.dta 25 IPI00445357.1 "CDNA FLJ44181 fis, clone THYMU2038301, highly similar to Homo sapiens PRP8 protein" 56 15173 2 2 2 2 2255 5594 1 0 1 512.2686 1022.5227 2 1022.5219 0.0008 0 27.14 0.0059 K FICISDLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6608.6608.2.dta 25 IPI00445357.1 "CDNA FLJ44181 fis, clone THYMU2038301, highly similar to Homo sapiens PRP8 protein" 56 15173 2 2 2 2 4219 1796 1 0 1 631.8197 1261.6249 2 1261.6262 -0.0014 0 48.68 0.00016 K EQSQLTATQTR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2527.2527.2.dta 25 IPI00386844.4 PRPF8 protein 27 31767 1 1 1 1 594 4235 1 0 1 382.2397 762.4648 2 762.464 0.0009 0 27.06 0.016 R VYLGALK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5195.5195.2.dta 26 1 IPI00179330.6 ubiquitin and ribosomal protein S27a precursor 371 18296 14 14 6 6 2578 4482 1 1 1 534.3145 1066.6144 2 1066.6135 0.0009 0 48.36 0.00018 K ESTLHLVLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5463.5463.2.dta 26 1 IPI00179330.6 ubiquitin and ribosomal protein S27a precursor 371 18296 14 14 6 6 2700 3186 1 1 1 541.2797 1080.5448 2 1080.5451 -0.0003 0 41.21 0.00047 R TLSDYNIQK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4059.4059.2.dta 26 1 IPI00179330.6 ubiquitin and ribosomal protein S27a precursor 371 18296 14 14 6 6 4921 4245 1 1 1 673.8737 1345.7328 2 1345.7354 -0.0026 1 60.45 1.80E-05 R LIFAGKQLEDGR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5206.5206.2.dta 26 1 IPI00179330.6 ubiquitin and ribosomal protein S27a precursor 371 18296 14 14 6 6 6176 2164 1 1 1 762.3926 1522.7707 2 1522.774 -0.0032 1 34.33 0.0006 K IQDKEGIPPDQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2925.2925.2.dta 26 1 IPI00179330.6 ubiquitin and ribosomal protein S27a precursor 371 18296 14 14 6 6 6180 2166 1 1 1 508.5983 1522.7731 3 1522.774 -0.0009 1 21.68 0.014 K IQDKEGIPPDQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2928.2928.3.dta 26 1 IPI00179330.6 ubiquitin and ribosomal protein S27a precursor 371 18296 14 14 6 6 6182 1679 1 1 1 762.3939 1522.7732 2 1522.774 -0.0008 1 61.68 1.60E-06 K IQDKEGIPPDQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2400.2400.2.dta 26 1 IPI00179330.6 ubiquitin and ribosomal protein S27a precursor 371 18296 14 14 6 6 6184 1835 1 1 1 762.3941 1522.7737 2 1522.774 -0.0003 1 51.61 1.60E-05 K IQDKEGIPPDQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2569.2569.2.dta 26 1 IPI00179330.6 ubiquitin and ribosomal protein S27a precursor 371 18296 14 14 6 6 6185 1674 1 1 1 508.5986 1522.7739 3 1522.774 -0.0001 1 28.39 0.0023 K IQDKEGIPPDQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2395.2395.3.dta 26 1 IPI00179330.6 ubiquitin and ribosomal protein S27a precursor 371 18296 14 14 6 6 6186 2774 1 1 1 762.3943 1522.774 2 1522.774 0.0001 1 54.07 8.50E-06 K IQDKEGIPPDQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3595.3595.2.dta 26 1 IPI00179330.6 ubiquitin and ribosomal protein S27a precursor 371 18296 14 14 6 6 6187 1997 1 1 1 762.3944 1522.7743 2 1522.774 0.0003 1 40.28 0.00017 K IQDKEGIPPDQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2744.2744.2.dta 26 1 IPI00179330.6 ubiquitin and ribosomal protein S27a precursor 371 18296 14 14 6 6 6190 2469 1 1 1 508.5992 1522.7756 3 1522.774 0.0017 1 14.96 0.039 K IQDKEGIPPDQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3256.3256.3.dta 26 1 IPI00179330.6 ubiquitin and ribosomal protein S27a precursor 371 18296 14 14 6 6 6192 2752 1 1 1 508.5994 1522.7764 3 1522.774 0.0024 1 18.87 0.017 K IQDKEGIPPDQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3567.3567.3.dta 26 1 IPI00179330.6 ubiquitin and ribosomal protein S27a precursor 371 18296 14 14 6 6 7555 5308 1 1 1 894.4668 1786.919 2 1786.92 -0.001 0 56.22 1.50E-05 K TITLEVEPSDTIENVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6324.6324.2.dta 26 1 IPI00179330.6 ubiquitin and ribosomal protein S27a precursor 371 18296 14 14 6 6 8035 4748 1 1 1 994.0325 1986.0504 2 1986.0521 -0.0017 1 60.64 2.10E-06 K TITLEVEPSDTIENVKAK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5750.5750.2.dta 26 IPI00418813.2 "CDNA FLJ46113 fis, clone TESTI2036285, highly similar to Rattus norvegicus ubiquitin C" 349 25309 13 13 5 5 2578 4482 1 0 1 534.3145 1066.6144 2 1066.6135 0.0009 0 48.36 0.00018 K ESTLHLVLR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5463.5463.2.dta 26 IPI00418813.2 "CDNA FLJ46113 fis, clone TESTI2036285, highly similar to Rattus norvegicus ubiquitin C" 349 25309 13 13 5 5 4921 4245 1 0 1 673.8737 1345.7328 2 1345.7354 -0.0026 1 60.45 1.80E-05 R LIFAGKQLEDGR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5206.5206.2.dta 26 IPI00418813.2 "CDNA FLJ46113 fis, clone TESTI2036285, highly similar to Rattus norvegicus ubiquitin C" 349 25309 13 13 5 5 6176 2164 1 0 1 762.3926 1522.7707 2 1522.774 -0.0032 1 34.33 0.0006 K IQDKEGIPPDQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2925.2925.2.dta 26 IPI00418813.2 "CDNA FLJ46113 fis, clone TESTI2036285, highly similar to Rattus norvegicus ubiquitin C" 349 25309 13 13 5 5 6180 2166 1 0 1 508.5983 1522.7731 3 1522.774 -0.0009 1 21.68 0.014 K IQDKEGIPPDQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2928.2928.3.dta 26 IPI00418813.2 "CDNA FLJ46113 fis, clone TESTI2036285, highly similar to Rattus norvegicus ubiquitin C" 349 25309 13 13 5 5 6182 1679 1 0 1 762.3939 1522.7732 2 1522.774 -0.0008 1 61.68 1.60E-06 K IQDKEGIPPDQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2400.2400.2.dta 26 IPI00418813.2 "CDNA FLJ46113 fis, clone TESTI2036285, highly similar to Rattus norvegicus ubiquitin C" 349 25309 13 13 5 5 6184 1835 1 0 1 762.3941 1522.7737 2 1522.774 -0.0003 1 51.61 1.60E-05 K IQDKEGIPPDQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2569.2569.2.dta 26 IPI00418813.2 "CDNA FLJ46113 fis, clone TESTI2036285, highly similar to Rattus norvegicus ubiquitin C" 349 25309 13 13 5 5 6185 1674 1 0 1 508.5986 1522.7739 3 1522.774 -0.0001 1 28.39 0.0023 K IQDKEGIPPDQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2395.2395.3.dta 26 IPI00418813.2 "CDNA FLJ46113 fis, clone TESTI2036285, highly similar to Rattus norvegicus ubiquitin C" 349 25309 13 13 5 5 6186 2774 1 0 1 762.3943 1522.774 2 1522.774 0.0001 1 54.07 8.50E-06 K IQDKEGIPPDQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3595.3595.2.dta 26 IPI00418813.2 "CDNA FLJ46113 fis, clone TESTI2036285, highly similar to Rattus norvegicus ubiquitin C" 349 25309 13 13 5 5 6187 1997 1 0 1 762.3944 1522.7743 2 1522.774 0.0003 1 40.28 0.00017 K IQDKEGIPPDQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2744.2744.2.dta 26 IPI00418813.2 "CDNA FLJ46113 fis, clone TESTI2036285, highly similar to Rattus norvegicus ubiquitin C" 349 25309 13 13 5 5 6190 2469 1 0 1 508.5992 1522.7756 3 1522.774 0.0017 1 14.96 0.039 K IQDKEGIPPDQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3256.3256.3.dta 26 IPI00418813.2 "CDNA FLJ46113 fis, clone TESTI2036285, highly similar to Rattus norvegicus ubiquitin C" 349 25309 13 13 5 5 6192 2752 1 0 1 508.5994 1522.7764 3 1522.774 0.0024 1 18.87 0.017 K IQDKEGIPPDQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3567.3567.3.dta 26 IPI00418813.2 "CDNA FLJ46113 fis, clone TESTI2036285, highly similar to Rattus norvegicus ubiquitin C" 349 25309 13 13 5 5 7555 5308 1 0 1 894.4668 1786.919 2 1786.92 -0.001 0 56.22 1.50E-05 K TITLEVEPSDTIENVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6324.6324.2.dta 26 IPI00418813.2 "CDNA FLJ46113 fis, clone TESTI2036285, highly similar to Rattus norvegicus ubiquitin C" 349 25309 13 13 5 5 8035 4748 1 0 1 994.0325 1986.0504 2 1986.0521 -0.0017 1 60.64 2.10E-06 K TITLEVEPSDTIENVKAK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5750.5750.2.dta 26 IPI00654754.1 RPS27A protein 345 10833 13 13 5 5 2700 3186 1 0 1 541.2797 1080.5448 2 1080.5451 -0.0003 0 41.21 0.00047 R TLSDYNIQK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4059.4059.2.dta 26 IPI00654754.1 RPS27A protein 345 10833 13 13 5 5 4921 4245 1 0 1 673.8737 1345.7328 2 1345.7354 -0.0026 1 60.45 1.80E-05 R LIFAGKQLEDGR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5206.5206.2.dta 26 IPI00654754.1 RPS27A protein 345 10833 13 13 5 5 6176 2164 1 0 1 762.3926 1522.7707 2 1522.774 -0.0032 1 34.33 0.0006 K IQDKEGIPPDQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2925.2925.2.dta 26 IPI00654754.1 RPS27A protein 345 10833 13 13 5 5 6180 2166 1 0 1 508.5983 1522.7731 3 1522.774 -0.0009 1 21.68 0.014 K IQDKEGIPPDQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2928.2928.3.dta 26 IPI00654754.1 RPS27A protein 345 10833 13 13 5 5 6182 1679 1 0 1 762.3939 1522.7732 2 1522.774 -0.0008 1 61.68 1.60E-06 K IQDKEGIPPDQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2400.2400.2.dta 26 IPI00654754.1 RPS27A protein 345 10833 13 13 5 5 6184 1835 1 0 1 762.3941 1522.7737 2 1522.774 -0.0003 1 51.61 1.60E-05 K IQDKEGIPPDQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2569.2569.2.dta 26 IPI00654754.1 RPS27A protein 345 10833 13 13 5 5 6185 1674 1 0 1 508.5986 1522.7739 3 1522.774 -0.0001 1 28.39 0.0023 K IQDKEGIPPDQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2395.2395.3.dta 26 IPI00654754.1 RPS27A protein 345 10833 13 13 5 5 6186 2774 1 0 1 762.3943 1522.774 2 1522.774 0.0001 1 54.07 8.50E-06 K IQDKEGIPPDQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3595.3595.2.dta 26 IPI00654754.1 RPS27A protein 345 10833 13 13 5 5 6187 1997 1 0 1 762.3944 1522.7743 2 1522.774 0.0003 1 40.28 0.00017 K IQDKEGIPPDQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2744.2744.2.dta 26 IPI00654754.1 RPS27A protein 345 10833 13 13 5 5 6190 2469 1 0 1 508.5992 1522.7756 3 1522.774 0.0017 1 14.96 0.039 K IQDKEGIPPDQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3256.3256.3.dta 26 IPI00654754.1 RPS27A protein 345 10833 13 13 5 5 6192 2752 1 0 1 508.5994 1522.7764 3 1522.774 0.0024 1 18.87 0.017 K IQDKEGIPPDQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3567.3567.3.dta 26 IPI00654754.1 RPS27A protein 345 10833 13 13 5 5 7555 5308 1 0 1 894.4668 1786.919 2 1786.92 -0.001 0 56.22 1.50E-05 K TITLEVEPSDTIENVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6324.6324.2.dta 26 IPI00654754.1 RPS27A protein 345 10833 13 13 5 5 8035 4748 1 0 1 994.0325 1986.0504 2 1986.0521 -0.0017 1 60.64 2.10E-06 K TITLEVEPSDTIENVKAK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5750.5750.2.dta 26 IPI00397808.3 similar to ubiquitin and ribosomal protein S27a precursor 290 18355 12 12 4 4 2578 4482 1 0 1 534.3145 1066.6144 2 1066.6135 0.0009 0 48.36 0.00018 K ESTLHLVLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5463.5463.2.dta 26 IPI00397808.3 similar to ubiquitin and ribosomal protein S27a precursor 290 18355 12 12 4 4 2700 3186 1 0 1 541.2797 1080.5448 2 1080.5451 -0.0003 0 41.21 0.00047 R TLSDYNIQK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4059.4059.2.dta 26 IPI00397808.3 similar to ubiquitin and ribosomal protein S27a precursor 290 18355 12 12 4 4 4921 4245 1 0 1 673.8737 1345.7328 2 1345.7354 -0.0026 1 60.45 1.80E-05 R LIFAGKQLEDGR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5206.5206.2.dta 26 IPI00397808.3 similar to ubiquitin and ribosomal protein S27a precursor 290 18355 12 12 4 4 6176 2164 1 0 1 762.3926 1522.7707 2 1522.774 -0.0032 1 34.33 0.0006 K IQDKEGIPPDQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2925.2925.2.dta 26 IPI00397808.3 similar to ubiquitin and ribosomal protein S27a precursor 290 18355 12 12 4 4 6180 2166 1 0 1 508.5983 1522.7731 3 1522.774 -0.0009 1 21.68 0.014 K IQDKEGIPPDQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2928.2928.3.dta 26 IPI00397808.3 similar to ubiquitin and ribosomal protein S27a precursor 290 18355 12 12 4 4 6182 1679 1 0 1 762.3939 1522.7732 2 1522.774 -0.0008 1 61.68 1.60E-06 K IQDKEGIPPDQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2400.2400.2.dta 26 IPI00397808.3 similar to ubiquitin and ribosomal protein S27a precursor 290 18355 12 12 4 4 6184 1835 1 0 1 762.3941 1522.7737 2 1522.774 -0.0003 1 51.61 1.60E-05 K IQDKEGIPPDQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2569.2569.2.dta 26 IPI00397808.3 similar to ubiquitin and ribosomal protein S27a precursor 290 18355 12 12 4 4 6185 1674 1 0 1 508.5986 1522.7739 3 1522.774 -0.0001 1 28.39 0.0023 K IQDKEGIPPDQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2395.2395.3.dta 26 IPI00397808.3 similar to ubiquitin and ribosomal protein S27a precursor 290 18355 12 12 4 4 6186 2774 1 0 1 762.3943 1522.774 2 1522.774 0.0001 1 54.07 8.50E-06 K IQDKEGIPPDQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3595.3595.2.dta 26 IPI00397808.3 similar to ubiquitin and ribosomal protein S27a precursor 290 18355 12 12 4 4 6187 1997 1 0 1 762.3944 1522.7743 2 1522.774 0.0003 1 40.28 0.00017 K IQDKEGIPPDQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2744.2744.2.dta 26 IPI00397808.3 similar to ubiquitin and ribosomal protein S27a precursor 290 18355 12 12 4 4 6190 2469 1 0 1 508.5992 1522.7756 3 1522.774 0.0017 1 14.96 0.039 K IQDKEGIPPDQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3256.3256.3.dta 26 IPI00397808.3 similar to ubiquitin and ribosomal protein S27a precursor 290 18355 12 12 4 4 6192 2752 1 0 1 508.5994 1522.7764 3 1522.774 0.0024 1 18.87 0.017 K IQDKEGIPPDQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3567.3567.3.dta 26 IPI00788210.1 similar to ribosomal protein S27a 232 13892 10 10 2 2 2578 4482 1 0 1 534.3145 1066.6144 2 1066.6135 0.0009 0 48.36 0.00018 K ESTLHLVLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5463.5463.2.dta 26 IPI00788210.1 similar to ribosomal protein S27a 232 13892 10 10 2 2 6176 2164 1 0 1 762.3926 1522.7707 2 1522.774 -0.0032 1 34.33 0.0006 K IQDKEGIPPDQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2925.2925.2.dta 26 IPI00788210.1 similar to ribosomal protein S27a 232 13892 10 10 2 2 6180 2166 1 0 1 508.5983 1522.7731 3 1522.774 -0.0009 1 21.68 0.014 K IQDKEGIPPDQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2928.2928.3.dta 26 IPI00788210.1 similar to ribosomal protein S27a 232 13892 10 10 2 2 6182 1679 1 0 1 762.3939 1522.7732 2 1522.774 -0.0008 1 61.68 1.60E-06 K IQDKEGIPPDQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2400.2400.2.dta 26 IPI00788210.1 similar to ribosomal protein S27a 232 13892 10 10 2 2 6184 1835 1 0 1 762.3941 1522.7737 2 1522.774 -0.0003 1 51.61 1.60E-05 K IQDKEGIPPDQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2569.2569.2.dta 26 IPI00788210.1 similar to ribosomal protein S27a 232 13892 10 10 2 2 6185 1674 1 0 1 508.5986 1522.7739 3 1522.774 -0.0001 1 28.39 0.0023 K IQDKEGIPPDQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2395.2395.3.dta 26 IPI00788210.1 similar to ribosomal protein S27a 232 13892 10 10 2 2 6186 2774 1 0 1 762.3943 1522.774 2 1522.774 0.0001 1 54.07 8.50E-06 K IQDKEGIPPDQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3595.3595.2.dta 26 IPI00788210.1 similar to ribosomal protein S27a 232 13892 10 10 2 2 6187 1997 1 0 1 762.3944 1522.7743 2 1522.774 0.0003 1 40.28 0.00017 K IQDKEGIPPDQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2744.2744.2.dta 26 IPI00788210.1 similar to ribosomal protein S27a 232 13892 10 10 2 2 6190 2469 1 0 1 508.5992 1522.7756 3 1522.774 0.0017 1 14.96 0.039 K IQDKEGIPPDQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3256.3256.3.dta 26 IPI00788210.1 similar to ribosomal protein S27a 232 13892 10 10 2 2 6192 2752 1 0 1 508.5994 1522.7764 3 1522.774 0.0024 1 18.87 0.017 K IQDKEGIPPDQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3567.3567.3.dta 26 IPI00783778.1 40S ribosomal protein S27a 105 15687 3 3 3 3 2578 4482 1 0 1 534.3145 1066.6144 2 1066.6135 0.0009 0 48.36 0.00018 K ESTLHLVLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5463.5463.2.dta 26 IPI00783778.1 40S ribosomal protein S27a 105 15687 3 3 3 3 2700 3186 1 0 1 541.2797 1080.5448 2 1080.5451 -0.0003 0 41.21 0.00047 R TLSDYNIQK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4059.4059.2.dta 26 IPI00783778.1 40S ribosomal protein S27a 105 15687 3 3 3 3 4921 4245 1 0 1 673.8737 1345.7328 2 1345.7354 -0.0026 1 60.45 1.80E-05 R LIFAGKQLEDGR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5206.5206.2.dta 27 1 IPI00179452.1 Isoform 1 of Protein CBFA2T2 360 67889 13 13 12 12 1308 1980 1 1 1 449.732 897.4494 2 897.4491 0.0003 0 25.18 0.022 R ELLHCAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2726.2726.2.dta 27 1 IPI00179452.1 Isoform 1 of Protein CBFA2T2 360 67889 13 13 12 12 1491 4950 1 1 1 462.7849 923.5553 2 923.5552 0.0001 0 43.7 0.00025 K ANLPLLQR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5962.5962.2.dta 27 1 IPI00179452.1 Isoform 1 of Protein CBFA2T2 360 67889 13 13 12 12 1993 1667 1 1 1 495.7824 989.5503 2 989.5506 -0.0002 1 43.61 0.0008 R KTGTELVSR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2387.2387.2.dta 27 1 IPI00179452.1 Isoform 1 of Protein CBFA2T2 360 67889 13 13 12 12 2078 2385 1 1 1 500.766 999.5175 2 999.5172 0.0003 0 44.74 0.00019 R VCTISPAPR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3165.3165.2.dta 27 1 IPI00179452.1 Isoform 1 of Protein CBFA2T2 360 67889 13 13 12 12 2350 4341 1 1 1 518.2769 1034.5393 2 1034.5396 -0.0004 0 61.34 1.10E-05 K AFEVIATER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5309.5309.2.dta 27 1 IPI00179452.1 Isoform 1 of Protein CBFA2T2 360 67889 13 13 12 12 2368 2228 1 1 1 519.7458 1037.477 2 1037.4778 -0.0007 0 43.62 0.00042 R YNENTELR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2995.2995.2.dta 27 1 IPI00179452.1 Isoform 1 of Protein CBFA2T2 360 67889 13 13 12 12 3353 1535 1 1 1 583.7932 1165.5718 2 1165.5727 -0.001 1 45.62 0.00047 R YNENTELRK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2244.2244.2.dta 27 1 IPI00179452.1 Isoform 1 of Protein CBFA2T2 360 67889 13 13 12 12 3542 2397 1 1 1 397.5449 1189.6128 3 1189.6125 0.0003 1 34.8 0.0035 R MEQTIADVKR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3178.3178.3.dta 27 1 IPI00179452.1 Isoform 1 of Protein CBFA2T2 360 67889 13 13 12 12 4730 1640 1 1 1 663.2819 1324.5492 2 1324.55 -0.0008 0 61.72 2.50E-06 K ASETCSGCNIAR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2358.2358.2.dta 27 1 IPI00179452.1 Isoform 1 of Protein CBFA2T2 360 67889 13 13 12 12 5745 1266 1 1 1 485.2218 1452.6435 3 1452.6449 -0.0014 1 50.12 9.70E-05 R KASETCSGCNIAR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1953.1953.3.dta 27 1 IPI00179452.1 Isoform 1 of Protein CBFA2T2 360 67889 13 13 12 12 5746 1268 1 1 1 727.3292 1452.6439 2 1452.6449 -0.001 1 69.4 4.70E-07 R KASETCSGCNIAR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1955.1955.2.dta 27 1 IPI00179452.1 Isoform 1 of Protein CBFA2T2 360 67889 13 13 12 12 7461 4079 1 1 1 586.2577 1755.7512 3 1755.7522 -0.001 1 40.81 0.00034 R CQESDREELNYWK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5026.5026.3.dta 27 1 IPI00179452.1 Isoform 1 of Protein CBFA2T2 360 67889 13 13 12 12 7742 5461 1 1 1 621.3268 1860.9585 3 1860.9581 0.0004 1 48.85 2.60E-05 K AVAEAEQKAFEVIATER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6477.6477.3.dta 27 IPI00021473.1 MTG16 48 59566 2 2 2 2 1308 1980 1 0 1 449.732 897.4494 2 897.4491 0.0003 0 25.18 0.022 R ELLHCAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2726.2726.2.dta 27 IPI00021473.1 MTG16 48 59566 2 2 2 2 1491 4950 1 0 1 462.7849 923.5553 2 923.5552 0.0001 0 43.7 0.00025 K ANLPLLQR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5962.5962.2.dta 28 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 344 71082 13 13 12 12 1365 763 1 1 0 302.4925 904.4556 3 904.4549 0.0007 1 27.26 0.022 R LRTACER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1408.1408.3.dta 28 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 344 71082 13 13 12 12 2216 1652 1 1 0 509.2874 1016.5602 2 1016.5614 -0.0012 1 43.91 0.00099 K ITITNDKGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2371.2371.2.dta 28 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 344 71082 13 13 12 12 3472 1772 1 1 1 590.8133 1179.612 2 1179.6135 -0.0015 1 42.6 0.00013 K VQVEYKGETK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2501.2501.2.dta 28 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 344 71082 13 13 12 12 3473 1782 1 1 1 394.2115 1179.6126 3 1179.6135 -0.0009 1 16.56 0.028 K VQVEYKGETK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2512.2512.3.dta 28 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 344 71082 13 13 12 12 3627 5805 1 1 1 600.3403 1198.666 2 1198.667 -0.001 0 77.74 2.70E-07 K DAGTIAGLNVLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6817.6817.2.dta 28 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 344 71082 13 13 12 12 4115 6195 1 1 1 627.3116 1252.6086 2 1252.6088 -0.0002 0 65 6.20E-06 R FEELNADLFR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7206.7206.2.dta 28 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 344 71082 13 13 12 12 4564 5384 1 1 1 652.3031 1302.5916 2 1302.5914 0.0002 0 72.79 1.50E-07 K NSLESYAFNMK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6400.6400.2.dta 28 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 344 71082 13 13 12 12 5963 5670 1 1 1 740.8794 1479.7442 2 1479.747 -0.0028 1 21.34 0.046 R ARFEELNADLFR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6683.6683.2.dta 28 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 344 71082 13 13 12 12 5971 4224 1 1 1 494.6071 1480.7993 3 1480.7998 -0.0005 0 36.35 0.00051 K SQIHDIVLVGGSTR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5183.5183.3.dta 28 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 344 71082 13 13 12 12 5994 4584 1 1 0 744.3537 1486.6928 2 1486.694 -0.0012 0 62.83 1.30E-06 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5572.5572.2.dta 28 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 344 71082 13 13 12 12 6920 4656 1 1 1 825.3997 1648.7849 2 1648.7879 -0.003 0 57.02 8.80E-06 K NQVAMNPTNTVFDAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5650.5650.2.dta 28 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 344 71082 13 13 12 12 7160 2991 1 1 1 564.5796 1690.7169 3 1690.7183 -0.0014 0 32.07 0.0024 K STAGDTHLGGEDFDNR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3842.3842.3.dta 28 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 344 71082 13 13 12 12 7557 5199 1 1 1 596.6678 1786.9817 3 1786.9828 -0.0011 1 22.61 0.032 R IINEPTAAAIAYGLDKK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6217.6217.3.dta 28 2 IPI00304925.4 Heat shock 70 kDa protein 1 286 70280 8 8 8 8 1365 763 1 0 0 302.4925 904.4556 3 904.4549 0.0007 1 27.26 0.022 R LRTACER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1408.1408.3.dta 28 2 IPI00304925.4 Heat shock 70 kDa protein 1 286 70280 8 8 8 8 2216 1652 1 0 0 509.2874 1016.5602 2 1016.5614 -0.0012 1 43.91 0.00099 K ITITNDKGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2371.2371.2.dta 28 2 IPI00304925.4 Heat shock 70 kDa protein 1 286 70280 8 8 8 8 3618 6288 1 0 1 599.3514 1196.6883 2 1196.6877 0.0006 0 84.47 3.80E-08 K DAGVIAGLNVLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7298.7298.2.dta 28 2 IPI00304925.4 Heat shock 70 kDa protein 1 286 70280 8 8 8 8 4644 6165 1 0 1 658.3021 1314.5897 2 1314.5914 -0.0017 0 31.15 0.0012 R FEELCSDLFR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7176.7176.2.dta 28 2 IPI00304925.4 Heat shock 70 kDa protein 1 286 70280 8 8 8 8 5994 4584 1 0 0 744.3537 1486.6928 2 1486.694 -0.0012 0 62.83 1.30E-06 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5572.5572.2.dta 28 2 IPI00304925.4 Heat shock 70 kDa protein 1 286 70280 8 8 8 8 6966 4766 1 0 1 829.9281 1657.8416 2 1657.8424 -0.0007 0 64.61 8.70E-07 K NQVALNPQNTVFDAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5768.5768.2.dta 28 2 IPI00304925.4 Heat shock 70 kDa protein 1 286 70280 8 8 8 8 7075 3018 1 0 1 559.2473 1674.7199 3 1674.7234 -0.0035 0 27.57 0.0087 K ATAGDTHLGGEDFDNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3871.3871.3.dta 28 2 IPI00304925.4 Heat shock 70 kDa protein 1 286 70280 8 8 8 8 7145 5973 1 0 1 844.454 1686.8934 2 1686.894 -0.0006 0 81.16 2.50E-08 R IINEPTAAAIAYGLDR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6985.6985.2.dta 28 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 270 53598 11 11 10 10 1365 763 1 0 0 302.4925 904.4556 3 904.4549 0.0007 1 27.26 0.022 R LRTACER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1408.1408.3.dta 28 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 270 53598 11 11 10 10 3472 1772 1 0 1 590.8133 1179.612 2 1179.6135 -0.0015 1 42.6 0.00013 K VQVEYKGETK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2501.2501.2.dta 28 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 270 53598 11 11 10 10 3473 1782 1 0 1 394.2115 1179.6126 3 1179.6135 -0.0009 1 16.56 0.028 K VQVEYKGETK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2512.2512.3.dta 28 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 270 53598 11 11 10 10 3627 5805 1 0 1 600.3403 1198.666 2 1198.667 -0.001 0 77.74 2.70E-07 K DAGTIAGLNVLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6817.6817.2.dta 28 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 270 53598 11 11 10 10 4115 6195 1 0 1 627.3116 1252.6086 2 1252.6088 -0.0002 0 65 6.20E-06 R FEELNADLFR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7206.7206.2.dta 28 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 270 53598 11 11 10 10 5963 5670 1 0 1 740.8794 1479.7442 2 1479.747 -0.0028 1 21.34 0.046 R ARFEELNADLFR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6683.6683.2.dta 28 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 270 53598 11 11 10 10 5971 4224 1 0 1 494.6071 1480.7993 3 1480.7998 -0.0005 0 36.35 0.00051 K SQIHDIVLVGGSTR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5183.5183.3.dta 28 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 270 53598 11 11 10 10 5994 4584 1 0 0 744.3537 1486.6928 2 1486.694 -0.0012 0 62.83 1.30E-06 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5572.5572.2.dta 28 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 270 53598 11 11 10 10 6920 4656 1 0 1 825.3997 1648.7849 2 1648.7879 -0.003 0 57.02 8.80E-06 K NQVAMNPTNTVFDAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5650.5650.2.dta 28 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 270 53598 11 11 10 10 7160 2991 1 0 1 564.5796 1690.7169 3 1690.7183 -0.0014 0 32.07 0.0024 K STAGDTHLGGEDFDNR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3842.3842.3.dta 28 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 270 53598 11 11 10 10 7557 5199 1 0 1 596.6678 1786.9817 3 1786.9828 -0.0011 1 22.61 0.032 R IINEPTAAAIAYGLDKK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6217.6217.3.dta 28 IPI00792459.1 23 kDa protein 189 23238 6 6 5 5 3472 1772 1 0 1 590.8133 1179.612 2 1179.6135 -0.0015 1 42.6 0.00013 K VQVEYKGETK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2501.2501.2.dta 28 IPI00792459.1 23 kDa protein 189 23238 6 6 5 5 3473 1782 1 0 1 394.2115 1179.6126 3 1179.6135 -0.0009 1 16.56 0.028 K VQVEYKGETK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2512.2512.3.dta 28 IPI00792459.1 23 kDa protein 189 23238 6 6 5 5 3627 5805 1 0 1 600.3403 1198.666 2 1198.667 -0.001 0 77.74 2.70E-07 K DAGTIAGLNVLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6817.6817.2.dta 28 IPI00792459.1 23 kDa protein 189 23238 6 6 5 5 5994 4584 1 0 0 744.3537 1486.6928 2 1486.694 -0.0012 0 62.83 1.30E-06 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5572.5572.2.dta 28 IPI00792459.1 23 kDa protein 189 23238 6 6 5 5 6920 4656 1 0 1 825.3997 1648.7849 2 1648.7879 -0.003 0 57.02 8.80E-06 K NQVAMNPTNTVFDAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5650.5650.2.dta 28 IPI00792459.1 23 kDa protein 189 23238 6 6 5 5 7557 5199 1 0 1 596.6678 1786.9817 3 1786.9828 -0.0011 1 22.61 0.032 R IINEPTAAAIAYGLDKK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6217.6217.3.dta 28 IPI00797523.1 20 kDa protein 186 20413 5 5 4 4 3472 1772 1 0 1 590.8133 1179.612 2 1179.6135 -0.0015 1 42.6 0.00013 K VQVEYKGETK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2501.2501.2.dta 28 IPI00797523.1 20 kDa protein 186 20413 5 5 4 4 3473 1782 1 0 1 394.2115 1179.6126 3 1179.6135 -0.0009 1 16.56 0.028 K VQVEYKGETK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2512.2512.3.dta 28 IPI00797523.1 20 kDa protein 186 20413 5 5 4 4 3627 5805 1 0 1 600.3403 1198.666 2 1198.667 -0.001 0 77.74 2.70E-07 K DAGTIAGLNVLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6817.6817.2.dta 28 IPI00797523.1 20 kDa protein 186 20413 5 5 4 4 5994 4584 1 0 0 744.3537 1486.6928 2 1486.694 -0.0012 0 62.83 1.30E-06 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5572.5572.2.dta 28 IPI00797523.1 20 kDa protein 186 20413 5 5 4 4 6920 4656 1 0 1 825.3997 1648.7849 2 1648.7879 -0.003 0 57.02 8.80E-06 K NQVAMNPTNTVFDAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5650.5650.2.dta 28 IPI00339269.1 Heat shock 70 kDa protein 6 176 71440 6 6 6 6 1365 763 1 0 0 302.4925 904.4556 3 904.4549 0.0007 1 27.26 0.022 R LRTACER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1408.1408.3.dta 28 IPI00339269.1 Heat shock 70 kDa protein 6 176 71440 6 6 6 6 2216 1652 1 0 0 509.2874 1016.5602 2 1016.5614 -0.0012 1 43.91 0.00099 K ITITNDKGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2371.2371.2.dta 28 IPI00339269.1 Heat shock 70 kDa protein 6 176 71440 6 6 6 6 4644 6165 1 0 1 658.3021 1314.5897 2 1314.5914 -0.0017 0 31.15 0.0012 R FEELCSDLFR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7176.7176.2.dta 28 IPI00339269.1 Heat shock 70 kDa protein 6 176 71440 6 6 6 6 5994 4584 1 0 0 744.3537 1486.6928 2 1486.694 -0.0012 0 62.83 1.30E-06 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5572.5572.2.dta 28 IPI00339269.1 Heat shock 70 kDa protein 6 176 71440 6 6 6 6 7075 3018 1 0 1 559.2473 1674.7199 3 1674.7234 -0.0035 0 27.57 0.0087 K ATAGDTHLGGEDFDNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3871.3871.3.dta 28 IPI00339269.1 Heat shock 70 kDa protein 6 176 71440 6 6 6 6 7145 5973 1 0 1 844.454 1686.8934 2 1686.894 -0.0006 0 81.16 2.50E-08 R IINEPTAAAIAYGLDR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6985.6985.2.dta 28 IPI00007702.1 Heat shock-related 70 kDa protein 2 176 70263 9 9 8 8 1365 763 1 0 0 302.4925 904.4556 3 904.4549 0.0007 1 27.26 0.022 R LRTACER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1408.1408.3.dta 28 IPI00007702.1 Heat shock-related 70 kDa protein 2 176 70263 9 9 8 8 2216 1652 1 0 0 509.2874 1016.5602 2 1016.5614 -0.0012 1 43.91 0.00099 K ITITNDKGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2371.2371.2.dta 28 IPI00007702.1 Heat shock-related 70 kDa protein 2 176 70263 9 9 8 8 3472 1772 1 0 1 590.8133 1179.612 2 1179.6135 -0.0015 1 42.6 0.00013 K VQVEYKGETK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2501.2501.2.dta 28 IPI00007702.1 Heat shock-related 70 kDa protein 2 176 70263 9 9 8 8 3473 1782 1 0 1 394.2115 1179.6126 3 1179.6135 -0.0009 1 16.56 0.028 K VQVEYKGETK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2512.2512.3.dta 28 IPI00007702.1 Heat shock-related 70 kDa protein 2 176 70263 9 9 8 8 4115 6195 1 0 1 627.3116 1252.6086 2 1252.6088 -0.0002 0 65 6.20E-06 R FEELNADLFR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7206.7206.2.dta 28 IPI00007702.1 Heat shock-related 70 kDa protein 2 176 70263 9 9 8 8 5963 5670 1 0 1 740.8794 1479.7442 2 1479.747 -0.0028 1 21.34 0.046 R ARFEELNADLFR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6683.6683.2.dta 28 IPI00007702.1 Heat shock-related 70 kDa protein 2 176 70263 9 9 8 8 5994 4584 1 0 0 744.3537 1486.6928 2 1486.694 -0.0012 0 62.83 1.30E-06 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5572.5572.2.dta 28 IPI00007702.1 Heat shock-related 70 kDa protein 2 176 70263 9 9 8 8 7160 2991 1 0 1 564.5796 1690.7169 3 1690.7183 -0.0014 0 32.07 0.0024 K STAGDTHLGGEDFDNR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3842.3842.3.dta 28 IPI00007702.1 Heat shock-related 70 kDa protein 2 176 70263 9 9 8 8 7557 5199 1 0 1 596.6678 1786.9817 3 1786.9828 -0.0011 1 22.61 0.032 R IINEPTAAAIAYGLDKK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6217.6217.3.dta 28 IPI00301277.1 Heat shock 70 kDa protein 1L 160 70730 5 5 5 5 1365 763 1 0 0 302.4925 904.4556 3 904.4549 0.0007 1 27.26 0.022 R LRTACER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1408.1408.3.dta 28 IPI00301277.1 Heat shock 70 kDa protein 1L 160 70730 5 5 5 5 2216 1652 1 0 0 509.2874 1016.5602 2 1016.5614 -0.0012 1 43.91 0.00099 K ITITNDKGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2371.2371.2.dta 28 IPI00301277.1 Heat shock 70 kDa protein 1L 160 70730 5 5 5 5 3618 6288 1 0 1 599.3514 1196.6883 2 1196.6877 0.0006 0 84.47 3.80E-08 K DAGVIAGLNVLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7298.7298.2.dta 28 IPI00301277.1 Heat shock 70 kDa protein 1L 160 70730 5 5 5 5 5994 4584 1 0 0 744.3537 1486.6928 2 1486.694 -0.0012 0 62.83 1.30E-06 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5572.5572.2.dta 28 IPI00301277.1 Heat shock 70 kDa protein 1L 160 70730 5 5 5 5 7075 3018 1 0 1 559.2473 1674.7199 3 1674.7234 -0.0035 0 27.57 0.0087 K ATAGDTHLGGEDFDNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3871.3871.3.dta 28 IPI00797951.1 16 kDa protein 130 15671 4 4 3 3 3472 1772 1 0 1 590.8133 1179.612 2 1179.6135 -0.0015 1 42.6 0.00013 K VQVEYKGETK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2501.2501.2.dta 28 IPI00797951.1 16 kDa protein 130 15671 4 4 3 3 3473 1782 1 0 1 394.2115 1179.6126 3 1179.6135 -0.0009 1 16.56 0.028 K VQVEYKGETK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2512.2512.3.dta 28 IPI00797951.1 16 kDa protein 130 15671 4 4 3 3 5994 4584 1 0 0 744.3537 1486.6928 2 1486.694 -0.0012 0 62.83 1.30E-06 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5572.5572.2.dta 28 IPI00797951.1 16 kDa protein 130 15671 4 4 3 3 6920 4656 1 0 1 825.3997 1648.7849 2 1648.7879 -0.003 0 57.02 8.80E-06 K NQVAMNPTNTVFDAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5650.5650.2.dta 28 IPI00793644.1 17 kDa protein 104 16567 4 4 3 3 3472 1772 1 0 1 590.8133 1179.612 2 1179.6135 -0.0015 1 42.6 0.00013 K VQVEYKGETK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2501.2501.2.dta 28 IPI00793644.1 17 kDa protein 104 16567 4 4 3 3 3473 1782 1 0 1 394.2115 1179.6126 3 1179.6135 -0.0009 1 16.56 0.028 K VQVEYKGETK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2512.2512.3.dta 28 IPI00793644.1 17 kDa protein 104 16567 4 4 3 3 3627 5805 1 0 1 600.3403 1198.666 2 1198.667 -0.001 0 77.74 2.70E-07 K DAGTIAGLNVLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6817.6817.2.dta 28 IPI00793644.1 17 kDa protein 104 16567 4 4 3 3 7557 5199 1 0 1 596.6678 1786.9817 3 1786.9828 -0.0011 1 22.61 0.032 R IINEPTAAAIAYGLDKK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6217.6217.3.dta 28 IPI00791608.1 20 kDa protein 82 19783 3 3 3 3 4115 6195 1 0 1 627.3116 1252.6086 2 1252.6088 -0.0002 0 65 6.20E-06 R FEELNADLFR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7206.7206.2.dta 28 IPI00791608.1 20 kDa protein 82 19783 3 3 3 3 5963 5670 1 0 1 740.8794 1479.7442 2 1479.747 -0.0028 1 21.34 0.046 R ARFEELNADLFR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6683.6683.2.dta 28 IPI00791608.1 20 kDa protein 82 19783 3 3 3 3 5971 4224 1 0 1 494.6071 1480.7993 3 1480.7998 -0.0005 0 36.35 0.00051 K SQIHDIVLVGGSTR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5183.5183.3.dta 28 IPI00011134.1 Heat shock 70 kDa protein 7 (Fragment) 72 27004 2 2 2 2 5994 4584 1 0 0 744.3537 1486.6928 2 1486.694 -0.0012 0 62.83 1.30E-06 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5572.5572.2.dta 28 IPI00011134.1 Heat shock 70 kDa protein 7 (Fragment) 72 27004 2 2 2 2 7075 3018 1 0 1 559.2473 1674.7199 3 1674.7234 -0.0035 0 27.57 0.0087 K ATAGDTHLGGEDFDNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3871.3871.3.dta 28 IPI00647012.1 Heat shock 70kDa protein 1A 68 52200 4 4 4 4 1365 763 1 0 0 302.4925 904.4556 3 904.4549 0.0007 1 27.26 0.022 R LRTACER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1408.1408.3.dta 28 IPI00647012.1 Heat shock 70kDa protein 1A 68 52200 4 4 4 4 2216 1652 1 0 0 509.2874 1016.5602 2 1016.5614 -0.0012 1 43.91 0.00099 K ITITNDKGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2371.2371.2.dta 28 IPI00647012.1 Heat shock 70kDa protein 1A 68 52200 4 4 4 4 4644 6165 1 0 1 658.3021 1314.5897 2 1314.5914 -0.0017 0 31.15 0.0012 R FEELCSDLFR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7176.7176.2.dta 28 IPI00647012.1 Heat shock 70kDa protein 1A 68 52200 4 4 4 4 7075 3018 1 0 1 559.2473 1674.7199 3 1674.7234 -0.0035 0 27.57 0.0087 K ATAGDTHLGGEDFDNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3871.3871.3.dta 28 IPI00796149.1 10 kDa protein 63 9794 1 1 1 1 5994 4584 1 0 0 744.3537 1486.6928 2 1486.694 -0.0012 0 62.83 1.30E-06 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5572.5572.2.dta 29 1 IPI00064931.2 Isoform 2 of E1A-binding protein p400 326 341196 11 11 11 11 203 1009 1 1 0 329.7159 657.4173 2 657.4173 -0.0001 1 33.13 0.02 R LLKER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1674.1674.2.dta 29 1 IPI00064931.2 Isoform 2 of E1A-binding protein p400 326 341196 11 11 11 11 1439 6583 1 1 1 458.2681 914.5216 2 914.5225 -0.0009 0 35.77 0.0072 K IGLDWLAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7589.7589.2.dta 29 1 IPI00064931.2 Isoform 2 of E1A-binding protein p400 326 341196 11 11 11 11 1869 5133 1 1 1 487.2952 972.5758 2 972.5757 0.0001 0 28.47 0.0021 R VTQPFILR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6149.6149.2.dta 29 1 IPI00064931.2 Isoform 2 of E1A-binding protein p400 326 341196 11 11 11 11 2203 6243 1 1 1 508.3004 1014.5862 2 1014.5862 0 0 44.46 0.00062 R LLQFPELR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7252.7252.2.dta 29 1 IPI00064931.2 Isoform 2 of E1A-binding protein p400 326 341196 11 11 11 11 4224 4892 1 1 1 631.8403 1261.6661 2 1261.6666 -0.0005 0 28.29 0.02 R LDQIYLVNER R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5902.5902.2.dta 29 1 IPI00064931.2 Isoform 2 of E1A-binding protein p400 326 341196 11 11 11 11 5802 4661 1 1 1 731.897 1461.7795 2 1461.7827 -0.0032 0 63.17 1.20E-06 K TQFLTTPISQAQK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5655.5655.2.dta 29 1 IPI00064931.2 Isoform 2 of E1A-binding protein p400 326 341196 11 11 11 11 5982 3115 1 1 1 742.9097 1483.8048 2 1483.7995 0.0053 0 21.89 0.0088 K ITAQQITTPGAQQK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3979.3979.2.dta 29 1 IPI00064931.2 Isoform 2 of E1A-binding protein p400 326 341196 11 11 11 11 6109 3044 1 1 1 755.403 1508.7914 2 1508.7947 -0.0033 0 92.55 2.30E-09 R TAAPTTASAAPQGPLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3900.3900.2.dta 29 1 IPI00064931.2 Isoform 2 of E1A-binding protein p400 326 341196 11 11 11 11 6783 3218 1 1 1 816.4088 1630.8031 2 1630.8063 -0.0032 0 96.85 4.30E-09 K AAAAPFQTSQASASAPR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4093.4093.2.dta 29 1 IPI00064931.2 Isoform 2 of E1A-binding protein p400 326 341196 11 11 11 11 7321 838 1 1 1 572.6201 1714.8385 3 1714.8387 -0.0001 0 28.16 0.0034 R HQPASASSTAASPAHPAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1489.1489.3.dta 29 1 IPI00064931.2 Isoform 2 of E1A-binding protein p400 326 341196 11 11 11 11 7371 4765 1 1 1 865.4586 1728.9026 2 1728.9047 -0.0021 0 58.64 3.20E-06 R VAQPETPVTLQFQGSK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5767.5767.2.dta 29 IPI00782937.1 333 kDa protein 243 334548 9 9 9 9 203 1009 1 0 0 329.7159 657.4173 2 657.4173 -0.0001 1 33.13 0.02 R LLKER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1674.1674.2.dta 29 IPI00782937.1 333 kDa protein 243 334548 9 9 9 9 1439 6583 1 0 1 458.2681 914.5216 2 914.5225 -0.0009 0 35.77 0.0072 K IGLDWLAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7589.7589.2.dta 29 IPI00782937.1 333 kDa protein 243 334548 9 9 9 9 1869 5133 1 0 1 487.2952 972.5758 2 972.5757 0.0001 0 28.47 0.0021 R VTQPFILR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6149.6149.2.dta 29 IPI00782937.1 333 kDa protein 243 334548 9 9 9 9 2203 6243 1 0 1 508.3004 1014.5862 2 1014.5862 0 0 44.46 0.00062 R LLQFPELR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7252.7252.2.dta 29 IPI00782937.1 333 kDa protein 243 334548 9 9 9 9 4224 4892 1 0 1 631.8403 1261.6661 2 1261.6666 -0.0005 0 28.29 0.02 R LDQIYLVNER R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5902.5902.2.dta 29 IPI00782937.1 333 kDa protein 243 334548 9 9 9 9 5802 4661 1 0 1 731.897 1461.7795 2 1461.7827 -0.0032 0 63.17 1.20E-06 K TQFLTTPISQAQK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5655.5655.2.dta 29 IPI00782937.1 333 kDa protein 243 334548 9 9 9 9 5982 3115 1 0 1 742.9097 1483.8048 2 1483.7995 0.0053 0 21.89 0.0088 K ITAQQITTPGAQQK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3979.3979.2.dta 29 IPI00782937.1 333 kDa protein 243 334548 9 9 9 9 6109 3044 1 0 1 755.403 1508.7914 2 1508.7947 -0.0033 0 92.55 2.30E-09 R TAAPTTASAAPQGPLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3900.3900.2.dta 29 IPI00782937.1 333 kDa protein 243 334548 9 9 9 9 7371 4765 1 0 1 865.4586 1728.9026 2 1728.9047 -0.0021 0 58.64 3.20E-06 R VAQPETPVTLQFQGSK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5767.5767.2.dta 29 IPI00798339.1 21 kDa protein 70 20766 2 2 2 2 5802 4661 1 0 1 731.897 1461.7795 2 1461.7827 -0.0032 0 63.17 1.20E-06 K TQFLTTPISQAQK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5655.5655.2.dta 29 IPI00798339.1 21 kDa protein 70 20766 2 2 2 2 5982 3115 1 0 1 742.9097 1483.8048 2 1483.7995 0.0053 0 21.89 0.0088 K ITAQQITTPGAQQK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3979.3979.2.dta 29 IPI00797959.1 19 kDa protein 44 19433 1 1 1 1 2203 6243 1 0 1 508.3004 1014.5862 2 1014.5862 0 0 44.46 0.00062 R LLQFPELR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7252.7252.2.dta 30 1 IPI00004233.2 Isoform Long of Antigen KI-67 313 360698 10 10 10 10 2957 6747 1 1 1 558.8109 1115.6073 2 1115.6074 -0.0001 0 62.93 3.90E-06 R DIVEELSALK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7751.7751.2.dta 30 1 IPI00004233.2 Isoform Long of Antigen KI-67 313 360698 10 10 10 10 3044 6042 1 1 1 563.8266 1125.6386 2 1125.6394 -0.0007 0 41.47 0.00014 K LDLLGNLPGSK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7054.7054.2.dta 30 1 IPI00004233.2 Isoform Long of Antigen KI-67 313 360698 10 10 10 10 3297 3661 1 1 1 580.3194 1158.6242 2 1158.6244 -0.0002 0 73.59 1.40E-06 R SGASEANLIVAK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4574.4574.2.dta 30 1 IPI00004233.2 Isoform Long of Antigen KI-67 313 360698 10 10 10 10 3543 4691 1 1 1 595.8167 1189.6189 2 1189.619 -0.0001 0 72.08 1.70E-07 K LDLTENLTGSK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5688.5688.2.dta 30 1 IPI00004233.2 Isoform Long of Antigen KI-67 313 360698 10 10 10 10 4020 4350 1 1 1 414.5869 1240.7387 3 1240.7391 -0.0003 1 42.5 0.00012 K VGVKEELLAVGK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5318.5318.3.dta 30 1 IPI00004233.2 Isoform Long of Antigen KI-67 313 360698 10 10 10 10 4023 2237 1 1 1 621.8247 1241.6349 2 1241.6364 -0.0016 0 14.13 0.047 K QTPAPAASVTGSR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3004.3004.2.dta 30 1 IPI00004233.2 Isoform Long of Antigen KI-67 313 360698 10 10 10 10 4455 6607 1 1 1 646.3298 1290.645 2 1290.6456 -0.0006 0 61.31 1.60E-05 K ADVEEEFLALR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7612.7612.2.dta 30 1 IPI00004233.2 Isoform Long of Antigen KI-67 313 360698 10 10 10 10 4733 6763 1 1 1 663.3214 1324.6283 2 1324.6299 -0.0016 0 29.51 0.0017 K ADVEEEFLAFR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7767.7767.2.dta 30 1 IPI00004233.2 Isoform Long of Antigen KI-67 313 360698 10 10 10 10 4800 5615 1 1 1 666.8609 1331.7073 2 1331.7085 -0.0013 0 54.29 8.40E-05 K DINTFLGTPVQK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6628.6628.2.dta 30 1 IPI00004233.2 Isoform Long of Antigen KI-67 313 360698 10 10 10 10 5477 5754 1 1 1 473.9206 1418.7399 3 1418.7405 -0.0007 1 39.89 0.0016 R KADVEEEFLALR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6766.6766.3.dta 31 1 IPI00186290.6 Elongation factor 2 283 96246 11 11 11 11 537 2162 1 1 1 377.7086 753.4026 2 753.4021 0.0005 0 42.99 0.0003 K NPADLPK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2923.2923.2.dta 31 1 IPI00186290.6 Elongation factor 2 283 96246 11 11 11 11 1271 4183 1 1 1 445.7585 889.5025 2 889.5022 0.0003 0 31.67 0.0028 K FSVSPVVR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5139.5139.2.dta 31 1 IPI00186290.6 Elongation factor 2 283 96246 11 11 11 11 1471 2817 1 1 1 461.7354 921.4562 2 921.4556 0.0006 0 30.58 0.02 K SDPVVSYR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3648.3648.2.dta 31 1 IPI00186290.6 Elongation factor 2 283 96246 11 11 11 11 1831 3203 1 1 0 485.2767 968.5388 2 968.5403 -0.0015 0 30.66 0.0024 R GGGQIIPTAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4077.4077.2.dta 31 1 IPI00186290.6 Elongation factor 2 283 96246 11 11 11 11 2880 5169 1 1 1 554.3235 1106.6325 2 1106.6336 -0.001 0 61.54 4.50E-06 R VFSGLVSTGLK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6185.6185.2.dta 31 1 IPI00186290.6 Elongation factor 2 283 96246 11 11 11 11 3022 4148 1 1 1 562.2866 1122.5587 2 1122.5591 -0.0004 0 55.3 2.70E-05 K STLTDSLVCK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5101.5101.2.dta 31 1 IPI00186290.6 Elongation factor 2 283 96246 11 11 11 11 4962 2795 1 1 1 451.2579 1350.7519 3 1350.7507 0.0012 1 29.45 0.0017 R VAVEAKNPADLPK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3622.3622.3.dta 31 1 IPI00186290.6 Elongation factor 2 283 96246 11 11 11 11 5164 5012 1 1 1 689.8597 1377.7049 2 1377.7075 -0.0025 0 53.24 1.00E-05 R CLYASVLTAQPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6026.6026.2.dta 31 1 IPI00186290.6 Elongation factor 2 283 96246 11 11 11 11 5371 3357 1 1 1 468.2716 1401.7931 3 1401.798 -0.0049 1 27.09 0.0038 K KEDLYLKPIQR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4245.4245.3.dta 31 1 IPI00186290.6 Elongation factor 2 283 96246 11 11 11 11 5573 2474 1 1 1 477.5842 1429.7308 3 1429.7314 -0.0006 1 23.5 0.021 K FAAKGEGQLGPAER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3261.3261.3.dta 31 1 IPI00186290.6 Elongation factor 2 283 96246 11 11 11 11 6606 4639 1 1 1 797.8836 1593.7527 2 1593.7556 -0.0029 0 87.74 1.10E-08 R ETVSEESNVLCLSK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5632.5632.2.dta 31 2 IPI00003519.1 116 kDa U5 small nuclear ribonucleoprotein component 94 110336 3 3 3 3 1831 3203 1 0 0 485.2767 968.5388 2 968.5403 -0.0015 0 30.66 0.0024 R GGGQIIPTAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4077.4077.2.dta 31 2 IPI00003519.1 116 kDa U5 small nuclear ribonucleoprotein component 94 110336 3 3 3 3 3013 6487 1 0 1 561.7827 1121.5509 2 1121.5505 0.0003 0 35.07 0.00051 K YDWDLLAAR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7493.7493.2.dta 31 2 IPI00003519.1 116 kDa U5 small nuclear ribonucleoprotein component 94 110336 3 3 3 3 5287 4724 1 0 1 696.8894 1391.7643 2 1391.766 -0.0018 0 65.32 3.70E-06 K IAVEPVNPSELPK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5724.5724.2.dta 31 IPI00440662.1 Antigen MLAA-42 (Fragment) 95 17032 2 2 2 2 1471 2817 1 0 1 461.7354 921.4562 2 921.4556 0.0006 0 30.58 0.02 K SDPVVSYR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3648.3648.2.dta 31 IPI00440662.1 Antigen MLAA-42 (Fragment) 95 17032 2 2 2 2 6606 4639 1 0 1 797.8836 1593.7527 2 1593.7556 -0.0029 0 87.74 1.10E-08 R ETVSEESNVLCLSK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5632.5632.2.dta 32 1 IPI00305267.2 Isoform 1 of Golgin subfamily A member 3 281 167765 12 12 12 12 367 2147 1 0 0 352.6953 703.376 2 703.3752 0.0008 0 32.5 0.017 R LDSELK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2907.2907.2.dta 32 1 IPI00305267.2 Isoform 1 of Golgin subfamily A member 3 281 167765 12 12 12 12 2072 2114 1 1 1 500.3006 998.5867 2 998.5872 -0.0005 1 36.52 0.0016 R RLQEALAAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2871.2871.2.dta 32 1 IPI00305267.2 Isoform 1 of Golgin subfamily A member 3 281 167765 12 12 12 12 3415 4001 1 1 1 586.7983 1171.5821 2 1171.5833 -0.0012 0 43.54 0.00053 K EAADAELGQLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4941.4941.2.dta 32 1 IPI00305267.2 Isoform 1 of Golgin subfamily A member 3 281 167765 12 12 12 12 3565 4825 1 1 1 596.8195 1191.6244 2 1191.6248 -0.0004 0 46.79 0.0005 K AYENAVGILSR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5831.5831.2.dta 32 1 IPI00305267.2 Isoform 1 of Golgin subfamily A member 3 281 167765 12 12 12 12 3763 3402 1 1 1 607.3481 1212.6817 2 1212.6826 -0.0009 0 50.21 0.00014 K TLLQQNQQLK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4294.4294.2.dta 32 1 IPI00305267.2 Isoform 1 of Golgin subfamily A member 3 281 167765 12 12 12 12 4290 4149 1 1 1 636.3321 1270.6496 2 1270.6517 -0.0021 0 55.22 8.00E-06 K LQAEADDLQIR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5102.5102.2.dta 32 1 IPI00305267.2 Isoform 1 of Golgin subfamily A member 3 281 167765 12 12 12 12 5142 3819 1 1 1 688.3621 1374.7096 2 1374.7103 -0.0007 0 58.59 1.30E-05 K ASQAEISSLQSVR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4744.4744.2.dta 32 1 IPI00305267.2 Isoform 1 of Golgin subfamily A member 3 281 167765 12 12 12 12 5769 5268 1 1 1 730.3661 1458.7176 2 1458.7202 -0.0025 0 88.94 8.40E-09 K VLELEDELQESR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6285.6285.2.dta 32 1 IPI00305267.2 Isoform 1 of Golgin subfamily A member 3 281 167765 12 12 12 12 6749 5410 1 1 1 541.9612 1622.8617 3 1622.8627 -0.001 0 29.21 0.0021 R IQALEAELQAVSHSK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6426.6426.3.dta 32 1 IPI00305267.2 Isoform 1 of Golgin subfamily A member 3 281 167765 12 12 12 12 7501 2945 1 1 1 589.6536 1765.9389 3 1765.9322 0.0066 1 17.73 0.022 K SGQVEHLQQETAALKK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3792.3792.3.dta 32 1 IPI00305267.2 Isoform 1 of Golgin subfamily A member 3 281 167765 12 12 12 12 7800 4168 1 1 1 628.3238 1881.9495 3 1881.9544 -0.0049 0 23.98 0.0056 K LENVSLSQQLTETQHR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5122.5122.3.dta 32 1 IPI00305267.2 Isoform 1 of Golgin subfamily A member 3 281 167765 12 12 12 12 8075 4673 1 1 1 672.991 2015.9511 3 2015.9548 -0.0037 0 16.15 0.031 R EQSLDALQTHYDELQAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5668.5668.3.dta 33 1 IPI00001159.9 GCN1-like protein 1 280 295139 10 10 10 10 2005 3575 1 1 1 496.2878 990.5611 2 990.561 0.0001 0 21.9 0.0088 R HLDQIIPR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4481.4481.2.dta 33 1 IPI00001159.9 GCN1-like protein 1 280 295139 10 10 10 10 2284 5991 1 1 1 514.3316 1026.6487 2 1026.6478 0.0009 0 30.33 0.0038 R VVLPYLVPK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7003.7003.2.dta 33 1 IPI00001159.9 GCN1-like protein 1 280 295139 10 10 10 10 2401 5030 1 1 1 521.8163 1041.618 2 1041.6182 -0.0002 0 63.44 3.60E-06 K AIITALGVER R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6044.6044.2.dta 33 1 IPI00001159.9 GCN1-like protein 1 280 295139 10 10 10 10 3595 5477 1 1 1 598.3376 1194.6607 2 1194.6608 -0.0001 0 32.34 0.00093 K ASLLDPVPEVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6492.6492.2.dta 33 1 IPI00001159.9 GCN1-like protein 1 280 295139 10 10 10 10 4698 6144 1 1 1 660.8519 1319.6892 2 1319.6907 -0.0016 0 48.25 0.00013 K YLLDSCAPLLR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7156.7156.2.dta 33 1 IPI00001159.9 GCN1-like protein 1 280 295139 10 10 10 10 4811 6498 1 1 1 667.869 1333.7234 2 1333.7241 -0.0008 0 85.11 5.10E-08 R AYSDQAIVNLLK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7505.7505.2.dta 33 1 IPI00001159.9 GCN1-like protein 1 280 295139 10 10 10 10 4889 1517 1 1 1 448.9054 1343.6944 3 1343.6946 -0.0002 0 43.02 0.00052 R HHIETGGGQLPAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2224.2224.3.dta 33 1 IPI00001159.9 GCN1-like protein 1 280 295139 10 10 10 10 4997 5245 1 1 1 678.3704 1354.7262 2 1354.7279 -0.0017 0 36.06 0.0015 K QLSSCLPNIVPK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6262.6262.2.dta 33 1 IPI00001159.9 GCN1-like protein 1 280 295139 10 10 10 10 6125 4126 1 1 1 757.3666 1512.7187 2 1512.7209 -0.0021 0 50.25 6.80E-05 R VISESPPDQWEAR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5077.5077.2.dta 33 1 IPI00001159.9 GCN1-like protein 1 280 295139 10 10 10 10 7990 5591 1 1 1 651.3526 1951.036 3 1951.0374 -0.0014 0 45.69 5.20E-05 R ALQAAIQQLAEAQPEATAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6604.6604.3.dta 33 IPI00788818.1 16 kDa protein 104 15698 2 2 2 2 4811 6498 1 0 1 667.869 1333.7234 2 1333.7241 -0.0008 0 85.11 5.10E-08 R AYSDQAIVNLLK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7505.7505.2.dta 33 IPI00788818.1 16 kDa protein 104 15698 2 2 2 2 4889 1517 1 0 1 448.9054 1343.6944 3 1343.6946 -0.0002 0 43.02 0.00052 R HHIETGGGQLPAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2224.2224.3.dta 34 1 IPI00479786.3 KH-type splicing regulatory protein 276 73355 10 10 10 10 2006 3611 1 1 1 496.7429 991.4712 2 991.4723 -0.0011 0 49.41 0.00024 K DAFADAVQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4520.4520.2.dta 34 1 IPI00479786.3 KH-type splicing regulatory protein 276 73355 10 10 10 10 2673 5574 1 1 1 540.2649 1078.5152 2 1078.5151 0.0001 0 46.34 0.00035 K MMLDDIVSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6588.6588.2.dta 34 1 IPI00479786.3 KH-type splicing regulatory protein 276 73355 10 10 10 10 2681 4616 1 1 1 540.314 1078.6135 2 1078.6135 0 0 75.58 2.10E-07 R IGGGIDVPVPR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5607.5607.2.dta 34 1 IPI00479786.3 KH-type splicing regulatory protein 276 73355 10 10 10 10 3497 6416 1 1 1 592.8533 1183.692 2 1183.6924 -0.0004 0 73.05 5.50E-07 R IINDLLQSLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7423.7423.2.dta 34 1 IPI00479786.3 KH-type splicing regulatory protein 276 73355 10 10 10 10 4156 2482 1 1 0 629.8397 1257.6648 2 1257.6677 -0.0029 1 46.51 0.00044 K GGETIKQLQER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3270.3270.2.dta 34 1 IPI00479786.3 KH-type splicing regulatory protein 276 73355 10 10 10 10 4553 3338 1 1 1 651.8474 1301.6803 2 1301.6827 -0.0024 0 44.28 0.00019 R SVSLTGAPESVQK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4224.4224.2.dta 34 1 IPI00479786.3 KH-type splicing regulatory protein 276 73355 10 10 10 10 4991 3627 1 1 1 677.8503 1353.6861 2 1353.6888 -0.0027 0 65.6 2.80E-06 K VQISPDSGGLPER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4537.4537.2.dta 34 1 IPI00479786.3 KH-type splicing regulatory protein 276 73355 10 10 10 10 8114 3803 1 1 1 686.6934 2057.0584 3 2057.0575 0.0009 0 16.98 0.034 K MILIQDGSQNTNVDKPLR I Oxidation (M) 0.100000000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4727.4727.3.dta 34 1 IPI00479786.3 KH-type splicing regulatory protein 276 73355 10 10 10 10 8252 2654 1 1 1 757.3626 2269.066 3 2269.0585 0.0075 0 26.89 0.0032 R GGGGPGGGGPGGGSAGGPSQPPGGGGPGIR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3458.3458.3.dta 34 1 IPI00479786.3 KH-type splicing regulatory protein 276 73355 10 10 10 10 8265 4523 1 1 1 770.7075 2309.1007 3 2309.1037 -0.0029 1 14.36 0.045 K IGGDAATTVNNSTPDFGFGGQKR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5506.5506.3.dta 34 2 IPI00375441.2 Isoform 1 of Far upstream element-binding protein 1 179 67690 8 8 8 8 200 2375 1 0 0 329.6979 657.3812 2 657.381 0.0003 0 34.9 0.011 R IELQR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3154.3154.2.dta 34 2 IPI00375441.2 Isoform 1 of Far upstream element-binding protein 1 179 67690 8 8 8 8 354 3875 1 0 1 351.2328 700.4511 2 700.4483 0.0028 0 40.85 0.0017 K TGLIIGK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4805.4805.2.dta 34 2 IPI00375441.2 Isoform 1 of Far upstream element-binding protein 1 179 67690 8 8 8 8 1562 848 1 0 1 467.2411 932.4677 2 932.4675 0.0001 0 42.25 0.0016 K SISQQSGAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1500.1500.2.dta 34 2 IPI00375441.2 Isoform 1 of Far upstream element-binding protein 1 179 67690 8 8 8 8 2926 4121 1 0 1 557.3344 1112.6543 2 1112.6553 -0.0011 1 29.11 0.013 K RLLDQIVEK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5071.5071.2.dta 34 2 IPI00375441.2 Isoform 1 of Far upstream element-binding protein 1 179 67690 8 8 8 8 3204 2689 1 0 1 574.7869 1147.5593 2 1147.5622 -0.0029 0 50.09 3.40E-05 R GTPQQIDYAR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3496.3496.2.dta 34 2 IPI00375441.2 Isoform 1 of Far upstream element-binding protein 1 179 67690 8 8 8 8 4156 2482 1 0 0 629.8397 1257.6648 2 1257.6677 -0.0029 1 46.51 0.00044 K GGETIKQLQER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3270.3270.2.dta 34 2 IPI00375441.2 Isoform 1 of Far upstream element-binding protein 1 179 67690 8 8 8 8 4827 5023 1 0 1 668.864 1335.7134 2 1335.7147 -0.0013 0 64.97 4.20E-06 R IGGNEGIDVPIPR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6037.6037.2.dta 34 2 IPI00375441.2 Isoform 1 of Far upstream element-binding protein 1 179 67690 8 8 8 8 6068 2955 1 0 1 501.9222 1502.7446 3 1502.7365 0.0081 0 38.79 0.0011 R IQFKPDDGTTPER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3803.3803.3.dta 34 IPI00298363.2 Far upstream element-binding protein 2 264 73063 8 8 8 8 2006 3611 1 0 1 496.7429 991.4712 2 991.4723 -0.0011 0 49.41 0.00024 K DAFADAVQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4520.4520.2.dta 34 IPI00298363.2 Far upstream element-binding protein 2 264 73063 8 8 8 8 2673 5574 1 0 1 540.2649 1078.5152 2 1078.5151 0.0001 0 46.34 0.00035 K MMLDDIVSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6588.6588.2.dta 34 IPI00298363.2 Far upstream element-binding protein 2 264 73063 8 8 8 8 2681 4616 1 0 1 540.314 1078.6135 2 1078.6135 0 0 75.58 2.10E-07 R IGGGIDVPVPR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5607.5607.2.dta 34 IPI00298363.2 Far upstream element-binding protein 2 264 73063 8 8 8 8 3497 6416 1 0 1 592.8533 1183.692 2 1183.6924 -0.0004 0 73.05 5.50E-07 R IINDLLQSLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7423.7423.2.dta 34 IPI00298363.2 Far upstream element-binding protein 2 264 73063 8 8 8 8 4156 2482 1 0 0 629.8397 1257.6648 2 1257.6677 -0.0029 1 46.51 0.00044 K GGETIKQLQER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3270.3270.2.dta 34 IPI00298363.2 Far upstream element-binding protein 2 264 73063 8 8 8 8 4553 3338 1 0 1 651.8474 1301.6803 2 1301.6827 -0.0024 0 44.28 0.00019 R SVSLTGAPESVQK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4224.4224.2.dta 34 IPI00298363.2 Far upstream element-binding protein 2 264 73063 8 8 8 8 4991 3627 1 0 1 677.8503 1353.6861 2 1353.6888 -0.0027 0 65.6 2.80E-06 K VQISPDSGGLPER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4537.4537.2.dta 34 IPI00298363.2 Far upstream element-binding protein 2 264 73063 8 8 8 8 8114 3803 1 0 1 686.6934 2057.0584 3 2057.0575 0.0009 0 16.98 0.034 K MILIQDGSQNTNVDKPLR I Oxidation (M) 0.100000000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4727.4727.3.dta 34 IPI00063245.1 Isoform 2 of Far upstream element-binding protein 3 47 28645 1 1 1 1 4156 2482 1 0 0 629.8397 1257.6648 2 1257.6677 -0.0029 1 46.51 0.00044 R GGETIKQLQER T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3270.3270.2.dta 34 IPI00641948.1 24 kDa protein 29 24143 1 1 1 1 2926 4121 1 0 1 557.3344 1112.6543 2 1112.6553 -0.0011 1 29.11 0.013 K RLLDQIVEK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5071.5071.2.dta 35 1 IPI00004671.1 Golgin subfamily B member 1 266 377273 6 6 5 5 3417 2201 1 1 1 586.8166 1171.6186 2 1171.6197 -0.0011 0 56.56 5.10E-06 K AQTEVQLQQK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2965.2965.2.dta 35 1 IPI00004671.1 Golgin subfamily B member 1 266 377273 6 6 5 5 3455 4860 1 1 1 589.3188 1176.6231 2 1176.6251 -0.002 0 59.16 8.70E-06 K GLTAQIQSFGR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5868.5868.2.dta 35 1 IPI00004671.1 Golgin subfamily B member 1 266 377273 6 6 5 5 4666 3421 1 1 1 659.3354 1316.6562 2 1316.6572 -0.001 0 64.18 9.60E-07 K VLLDDTQSEAAR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4314.4314.2.dta 35 1 IPI00004671.1 Golgin subfamily B member 1 266 377273 6 6 5 5 4948 3902 1 1 1 675.3399 1348.6653 2 1348.6623 0.003 0 48.95 0.00021 R IVGDYQQLEER H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4834.4834.2.dta 35 1 IPI00004671.1 Golgin subfamily B member 1 266 377273 6 6 5 5 6623 5556 1 1 1 800.4194 1598.8243 2 1598.8264 -0.002 0 87.83 7.20E-09 R VAAENALSVAEEQIR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6570.6570.2.dta 35 1 IPI00004671.1 Golgin subfamily B member 1 266 377273 6 6 5 5 6624 5557 1 1 1 533.9493 1598.8262 3 1598.8264 -0.0002 0 51.77 0.00013 R VAAENALSVAEEQIR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6571.6571.3.dta 35 IPI00447990.1 Hypothetical protein (Fragment) 64 37182 1 1 1 1 4666 3421 1 0 1 659.3354 1316.6562 2 1316.6572 -0.001 0 64.18 9.60E-07 K VLLDDTQSEAAR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4314.4314.2.dta 36 1 IPI00013933.2 Isoform DPI of Desmoplakin 260 334021 11 11 11 11 1120 2747 1 1 1 431.7537 861.4928 2 861.492 0.0008 0 23.23 0.0066 K ISTISSVR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3560.3560.2.dta 36 1 IPI00013933.2 Isoform DPI of Desmoplakin 260 334021 11 11 11 11 2414 3154 1 1 1 522.7874 1043.5602 2 1043.5611 -0.001 0 34.74 0.00055 R VLLQEEGTR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4024.4024.2.dta 36 1 IPI00013933.2 Isoform DPI of Desmoplakin 260 334021 11 11 11 11 2621 1860 1 1 1 537.2827 1072.5508 2 1072.5513 -0.0005 0 64.21 9.50E-07 R GAGSIAGASASPK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2596.2596.2.dta 36 1 IPI00013933.2 Isoform DPI of Desmoplakin 260 334021 11 11 11 11 3062 5174 1 1 1 565.3077 1128.6009 2 1128.6026 -0.0017 0 37.13 0.0039 K IEVLEEELR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6191.6191.2.dta 36 1 IPI00013933.2 Isoform DPI of Desmoplakin 260 334021 11 11 11 11 3139 1452 1 1 1 380.8759 1139.606 3 1139.6047 0.0013 1 15.24 0.037 K NLHSEISGKR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2154.2154.3.dta 36 1 IPI00013933.2 Isoform DPI of Desmoplakin 260 334021 11 11 11 11 3386 1676 1 1 1 585.7726 1169.5306 2 1169.5313 -0.0007 0 69.75 1.20E-06 R YEVTSGGGGTSR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2397.2397.2.dta 36 1 IPI00013933.2 Isoform DPI of Desmoplakin 260 334021 11 11 11 11 4123 5792 1 1 1 627.8029 1253.5913 2 1253.5928 -0.0016 0 39.15 0.00031 K AITGFDDPFSGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6804.6804.2.dta 36 1 IPI00013933.2 Isoform DPI of Desmoplakin 260 334021 11 11 11 11 4210 1868 1 1 1 631.3009 1260.5873 2 1260.5881 -0.0008 0 48.73 0.00019 K NQCTQVVQER E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2605.2605.2.dta 36 1 IPI00013933.2 Isoform DPI of Desmoplakin 260 334021 11 11 11 11 4298 1421 1 1 1 636.8302 1271.6458 2 1271.647 -0.0011 1 52.71 0.00012 R RVEEDIQQQK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2120.2120.2.dta 36 1 IPI00013933.2 Isoform DPI of Desmoplakin 260 334021 11 11 11 11 4388 3408 1 1 1 429.233 1284.6773 3 1284.6786 -0.0013 1 29.75 0.0076 R LQRLEDELNR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4300.4300.3.dta 36 1 IPI00013933.2 Isoform DPI of Desmoplakin 260 334021 11 11 11 11 6637 6770 1 1 1 802.4217 1602.8288 2 1602.8253 0.0035 0 37.67 0.00029 K SVEEVASEIQPFLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7773.7773.2.dta 36 IPI00217182.4 Isoform DPII of Desmoplakin 233 262166 10 10 10 10 1120 2747 1 0 1 431.7537 861.4928 2 861.492 0.0008 0 23.23 0.0066 K ISTISSVR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3560.3560.2.dta 36 IPI00217182.4 Isoform DPII of Desmoplakin 233 262166 10 10 10 10 2414 3154 1 0 1 522.7874 1043.5602 2 1043.5611 -0.001 0 34.74 0.00055 R VLLQEEGTR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4024.4024.2.dta 36 IPI00217182.4 Isoform DPII of Desmoplakin 233 262166 10 10 10 10 2621 1860 1 0 1 537.2827 1072.5508 2 1072.5513 -0.0005 0 64.21 9.50E-07 R GAGSIAGASASPK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2596.2596.2.dta 36 IPI00217182.4 Isoform DPII of Desmoplakin 233 262166 10 10 10 10 3062 5174 1 0 1 565.3077 1128.6009 2 1128.6026 -0.0017 0 37.13 0.0039 K IEVLEEELR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6191.6191.2.dta 36 IPI00217182.4 Isoform DPII of Desmoplakin 233 262166 10 10 10 10 3139 1452 1 0 1 380.8759 1139.606 3 1139.6047 0.0013 1 15.24 0.037 K NLHSEISGKR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2154.2154.3.dta 36 IPI00217182.4 Isoform DPII of Desmoplakin 233 262166 10 10 10 10 3386 1676 1 0 1 585.7726 1169.5306 2 1169.5313 -0.0007 0 69.75 1.20E-06 R YEVTSGGGGTSR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2397.2397.2.dta 36 IPI00217182.4 Isoform DPII of Desmoplakin 233 262166 10 10 10 10 4123 5792 1 0 1 627.8029 1253.5913 2 1253.5928 -0.0016 0 39.15 0.00031 K AITGFDDPFSGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6804.6804.2.dta 36 IPI00217182.4 Isoform DPII of Desmoplakin 233 262166 10 10 10 10 4210 1868 1 0 1 631.3009 1260.5873 2 1260.5881 -0.0008 0 48.73 0.00019 K NQCTQVVQER E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2605.2605.2.dta 36 IPI00217182.4 Isoform DPII of Desmoplakin 233 262166 10 10 10 10 4388 3408 1 0 1 429.233 1284.6773 3 1284.6786 -0.0013 1 29.75 0.0076 R LQRLEDELNR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4300.4300.3.dta 36 IPI00217182.4 Isoform DPII of Desmoplakin 233 262166 10 10 10 10 6637 6770 1 0 1 802.4217 1602.8288 2 1602.8253 0.0035 0 37.67 0.00029 K SVEEVASEIQPFLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7773.7773.2.dta 37 1 IPI00013214.1 DNA replication licensing factor MCM3 255 91551 9 9 9 9 94 648 1 1 1 312.6828 623.3511 2 623.3503 0.0008 0 46.54 0.00017 K AGIHAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1283.1283.2.dta 37 1 IPI00013214.1 DNA replication licensing factor MCM3 255 91551 9 9 9 9 1040 4716 1 1 1 423.2584 844.5022 2 844.5018 0.0004 0 45.54 0.00053 R TLETLIR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5715.5715.2.dta 37 1 IPI00013214.1 DNA replication licensing factor MCM3 255 91551 9 9 9 9 1561 6974 1 1 1 466.7817 931.5489 2 931.5491 -0.0002 0 39.64 0.00021 K VALLDVFR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7975.7975.2.dta 37 1 IPI00013214.1 DNA replication licensing factor MCM3 255 91551 9 9 9 9 1903 3339 1 1 1 490.254 978.4934 2 978.4957 -0.0022 0 40.42 0.00068 R YVLCTAPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4225.4225.2.dta 37 1 IPI00013214.1 DNA replication licensing factor MCM3 255 91551 9 9 9 9 2488 5224 1 1 1 528.314 1054.6135 2 1054.6135 0 0 40.74 0.00021 R LIVNVNDLR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6240.6240.2.dta 37 1 IPI00013214.1 DNA replication licensing factor MCM3 255 91551 9 9 9 9 3122 3322 1 1 1 569.2789 1136.5432 2 1136.5462 -0.003 0 40.58 0.00016 R ELISDNQYR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4207.4207.2.dta 37 1 IPI00013214.1 DNA replication licensing factor MCM3 255 91551 9 9 9 9 3340 4815 1 1 1 388.8802 1163.6189 3 1163.6186 0.0003 1 42.36 0.0011 R SKDIFDQLAK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5820.5820.3.dta 37 1 IPI00013214.1 DNA replication licensing factor MCM3 255 91551 9 9 9 9 5687 5914 1 1 1 723.3712 1444.7279 2 1444.7297 -0.0018 0 57.1 3.60E-05 R SVDVILDDDLVDK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6924.6924.2.dta 37 1 IPI00013214.1 DNA replication licensing factor MCM3 255 91551 9 9 9 9 6202 6771 1 1 1 762.9346 1523.8546 2 1523.8559 -0.0013 0 61.15 1.80E-06 R GDINILLIGDPSVAK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7774.7774.2.dta 37 IPI00385434.2 MCM3 minichromosome maintenance deficient 3 46 37995 1 1 1 1 1040 4716 1 0 1 423.2584 844.5022 2 844.5018 0.0004 0 45.54 0.00053 R TLETLIR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5715.5715.2.dta 38 1 IPI00022228.1 Vigilin 248 141979 11 11 10 10 463 911 1 1 1 366.1938 730.3731 2 730.3722 0.0009 0 45.57 0.00071 K SGANINR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1568.1568.2.dta 38 1 IPI00022228.1 Vigilin 248 141979 11 11 10 10 728 922 1 1 1 397.7241 793.4336 2 793.4334 0.0002 1 36.59 0.0027 R IKDQYK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1580.1580.2.dta 38 1 IPI00022228.1 Vigilin 248 141979 11 11 10 10 1105 3255 1 1 1 429.7497 857.4848 2 857.4858 -0.0011 0 57.09 2.40E-05 K LSVTVDPK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4133.4133.2.dta 38 1 IPI00022228.1 Vigilin 248 141979 11 11 10 10 1543 4811 1 1 1 465.7664 929.5182 2 929.5182 0.0001 0 44.92 0.00026 R ELLELASR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5816.5816.2.dta 38 1 IPI00022228.1 Vigilin 248 141979 11 11 10 10 1832 3670 2 1 1 485.2899 968.5653 2 968.5655 -0.0001 0 20.78 0.038 R SGLVPQQIK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4584.4584.2.dta 38 1 IPI00022228.1 Vigilin 248 141979 11 11 10 10 2090 1486 1 1 1 501.2903 1000.5661 2 1000.5665 -0.0004 1 27.42 0.0067 R TIIGQKGER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2191.2191.2.dta 38 1 IPI00022228.1 Vigilin 248 141979 11 11 10 10 2647 1368 1 1 1 538.3025 1074.5904 2 1074.5921 -0.0016 1 31.78 0.0091 K ITGTKEGIEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2063.2063.2.dta 38 1 IPI00022228.1 Vigilin 248 141979 11 11 10 10 3287 5635 1 1 1 579.8078 1157.601 2 1157.604 -0.003 0 64.96 8.40E-06 K GNSLQEILER T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6649.6649.2.dta 38 1 IPI00022228.1 Vigilin 248 141979 11 11 10 10 4273 1824 1 1 1 635.3243 1268.634 2 1268.6361 -0.0021 0 51.25 7.10E-05 R IEGDPQGVQQAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2557.2557.2.dta 38 1 IPI00022228.1 Vigilin 248 141979 11 11 10 10 4884 1609 1 1 1 672.8408 1343.667 2 1343.6681 -0.0011 1 38.8 0.00023 R VKELQAEQEDR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2324.2324.2.dta 38 1 IPI00022228.1 Vigilin 248 141979 11 11 10 10 4886 1604 1 1 1 448.8967 1343.6683 3 1343.6681 0.0002 1 42.39 0.00011 R VKELQAEQEDR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2319.2319.3.dta 38 IPI00443983.1 "CDNA FLJ45936 fis, clone PLACE7004103, highly similar to Vigilin" 200 95244 8 8 7 7 463 911 1 0 1 366.1938 730.3731 2 730.3722 0.0009 0 45.57 0.00071 K SGANINR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1568.1568.2.dta 38 IPI00443983.1 "CDNA FLJ45936 fis, clone PLACE7004103, highly similar to Vigilin" 200 95244 8 8 7 7 728 922 1 0 1 397.7241 793.4336 2 793.4334 0.0002 1 36.59 0.0027 R IKDQYK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1580.1580.2.dta 38 IPI00443983.1 "CDNA FLJ45936 fis, clone PLACE7004103, highly similar to Vigilin" 200 95244 8 8 7 7 1105 3255 1 0 1 429.7497 857.4848 2 857.4858 -0.0011 0 57.09 2.40E-05 K LSVTVDPK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4133.4133.2.dta 38 IPI00443983.1 "CDNA FLJ45936 fis, clone PLACE7004103, highly similar to Vigilin" 200 95244 8 8 7 7 1543 4811 1 0 1 465.7664 929.5182 2 929.5182 0.0001 0 44.92 0.00026 R ELLELASR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5816.5816.2.dta 38 IPI00443983.1 "CDNA FLJ45936 fis, clone PLACE7004103, highly similar to Vigilin" 200 95244 8 8 7 7 2090 1486 1 0 1 501.2903 1000.5661 2 1000.5665 -0.0004 1 27.42 0.0067 R TIIGQKGER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2191.2191.2.dta 38 IPI00443983.1 "CDNA FLJ45936 fis, clone PLACE7004103, highly similar to Vigilin" 200 95244 8 8 7 7 4273 1824 1 0 1 635.3243 1268.634 2 1268.6361 -0.0021 0 51.25 7.10E-05 R IEGDPQGVQQAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2557.2557.2.dta 38 IPI00443983.1 "CDNA FLJ45936 fis, clone PLACE7004103, highly similar to Vigilin" 200 95244 8 8 7 7 4884 1609 1 0 1 672.8408 1343.667 2 1343.6681 -0.0011 1 38.8 0.00023 R VKELQAEQEDR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2324.2324.2.dta 38 IPI00443983.1 "CDNA FLJ45936 fis, clone PLACE7004103, highly similar to Vigilin" 200 95244 8 8 7 7 4886 1604 1 0 1 448.8967 1343.6683 3 1343.6681 0.0002 1 42.39 0.00011 R VKELQAEQEDR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2319.2319.3.dta 38 IPI00442135.1 "CDNA FLJ16432 fis, clone BRACE3010076, highly similar to Vigilin" 27 64727 1 1 1 1 2090 1486 1 0 1 501.2903 1000.5661 2 1000.5665 -0.0004 1 27.42 0.0067 R TIIGQKGER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2191.2191.2.dta 39 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 248 90261 12 12 12 12 228 1880 1 1 1 335.2006 668.3866 2 668.3857 0.0009 0 37.4 0.0011 R APGPLSK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2618.2618.2.dta 39 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 248 90261 12 12 12 12 333 597 1 1 1 349.2036 696.3926 2 696.3919 0.0008 0 30.44 0.0071 K HATLQK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1228.1228.2.dta 39 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 248 90261 12 12 12 12 336 3177 1 1 0 350.1775 698.3404 2 698.3388 0.0016 0 21.45 0.043 R FFETR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4049.4049.2.dta 39 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 248 90261 12 12 12 12 492 4528 2 1 1 372.2549 742.4952 2 742.4953 0 0 22.63 0.043 K LLASLVK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5511.5511.2.dta 39 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 248 90261 12 12 12 12 1756 645 1 1 1 320.5145 958.5216 3 958.5196 0.002 1 19.84 0.039 R QVSDVQKR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1280.1280.3.dta 39 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 248 90261 12 12 12 12 2232 464 1 1 1 510.2667 1018.5188 2 1018.5196 -0.0008 1 39.21 0.00058 K YTKDHTVR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1085.1085.2.dta 39 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 248 90261 12 12 12 12 2904 1090 1 1 1 555.8163 1109.6181 2 1109.6193 -0.0012 1 48.76 0.0002 R LGDKHATLQK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1762.1762.2.dta 39 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 248 90261 12 12 12 12 3505 6149 1 1 1 593.7816 1185.5486 2 1185.5488 -0.0003 0 38.46 0.0013 K DIVENYFMR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7160.7160.2.dta 39 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 248 90261 12 12 12 12 3626 5227 1 1 1 600.34 1198.6655 2 1198.667 -0.0015 0 54.79 5.20E-05 K ADVQSIIGLQR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6244.6244.2.dta 39 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 248 90261 12 12 12 12 7551 4910 1 1 1 595.9944 1784.9613 3 1784.9632 -0.0019 1 54.64 2.40E-05 K LTEDKADVQSIIGLQR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5921.5921.3.dta 39 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 248 90261 12 12 12 12 7791 5277 1 1 1 939.453 1876.8915 2 1876.8955 -0.0041 0 61.4 2.40E-06 K LSPPYSSPQEFAQDVGR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6293.6293.2.dta 39 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 248 90261 12 12 12 12 8091 2332 1 1 1 679.0175 2034.0305 3 2034.0316 -0.0011 0 41.36 0.00014 K IVAERPGTNSTGPAPMAPPR A Oxidation (M) 0.00000000000000010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3107.3107.3.dta 39 IPI00438230.3 Isoform 2 of Transcription intermediary factor 1-beta 211 80621 10 10 10 10 228 1880 1 0 1 335.2006 668.3866 2 668.3857 0.0009 0 37.4 0.0011 R APGPLSK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2618.2618.2.dta 39 IPI00438230.3 Isoform 2 of Transcription intermediary factor 1-beta 211 80621 10 10 10 10 333 597 1 0 1 349.2036 696.3926 2 696.3919 0.0008 0 30.44 0.0071 K HATLQK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1228.1228.2.dta 39 IPI00438230.3 Isoform 2 of Transcription intermediary factor 1-beta 211 80621 10 10 10 10 336 3177 1 0 0 350.1775 698.3404 2 698.3388 0.0016 0 21.45 0.043 R FFETR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4049.4049.2.dta 39 IPI00438230.3 Isoform 2 of Transcription intermediary factor 1-beta 211 80621 10 10 10 10 492 4528 2 0 1 372.2549 742.4952 2 742.4953 0 0 22.63 0.043 K LLASLVK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5511.5511.2.dta 39 IPI00438230.3 Isoform 2 of Transcription intermediary factor 1-beta 211 80621 10 10 10 10 1756 645 1 0 1 320.5145 958.5216 3 958.5196 0.002 1 19.84 0.039 R QVSDVQKR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1280.1280.3.dta 39 IPI00438230.3 Isoform 2 of Transcription intermediary factor 1-beta 211 80621 10 10 10 10 2904 1090 1 0 1 555.8163 1109.6181 2 1109.6193 -0.0012 1 48.76 0.0002 R LGDKHATLQK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1762.1762.2.dta 39 IPI00438230.3 Isoform 2 of Transcription intermediary factor 1-beta 211 80621 10 10 10 10 3626 5227 1 0 1 600.34 1198.6655 2 1198.667 -0.0015 0 54.79 5.20E-05 K ADVQSIIGLQR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6244.6244.2.dta 39 IPI00438230.3 Isoform 2 of Transcription intermediary factor 1-beta 211 80621 10 10 10 10 7551 4910 1 0 1 595.9944 1784.9613 3 1784.9632 -0.0019 1 54.64 2.40E-05 K LTEDKADVQSIIGLQR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5921.5921.3.dta 39 IPI00438230.3 Isoform 2 of Transcription intermediary factor 1-beta 211 80621 10 10 10 10 7791 5277 1 0 1 939.453 1876.8915 2 1876.8955 -0.0041 0 61.4 2.40E-06 K LSPPYSSPQEFAQDVGR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6293.6293.2.dta 39 IPI00438230.3 Isoform 2 of Transcription intermediary factor 1-beta 211 80621 10 10 10 10 8091 2332 1 0 1 679.0175 2034.0305 3 2034.0316 -0.0011 0 41.36 0.00014 K IVAERPGTNSTGPAPMAPPR A Oxidation (M) 0.00000000000000010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3107.3107.3.dta 40 1 IPI00465022.6 similar to SMC hinge domain containing 1 243 218195 8 8 8 8 1833 4912 1 1 1 485.3024 968.5902 2 968.5906 -0.0004 0 27.19 0.0057 K SIIEGPIIK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5923.5923.2.dta 40 1 IPI00465022.6 similar to SMC hinge domain containing 1 243 218195 8 8 8 8 1912 1660 1 1 1 491.2352 980.4558 2 980.4563 -0.0005 0 37.27 0.0025 R IYDETQGR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2379.2379.2.dta 40 1 IPI00465022.6 similar to SMC hinge domain containing 1 243 218195 8 8 8 8 3207 5188 1 1 1 574.8187 1147.6229 2 1147.6237 -0.0008 0 54.73 1.90E-05 R LQIFSVEGQK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6205.6205.2.dta 40 1 IPI00465022.6 similar to SMC hinge domain containing 1 243 218195 8 8 8 8 3559 4020 1 1 1 596.7917 1191.5688 2 1191.5706 -0.0018 0 47.17 3.80E-05 R GLAPIECYNR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4962.4962.2.dta 40 1 IPI00465022.6 similar to SMC hinge domain containing 1 243 218195 8 8 8 8 3738 4994 1 1 1 605.3213 1208.6281 2 1208.6302 -0.0021 0 67.76 4.50E-07 K QAVFFVGQSAR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6009.6009.2.dta 40 1 IPI00465022.6 similar to SMC hinge domain containing 1 243 218195 8 8 8 8 4345 7405 1 1 1 639.3531 1276.6917 2 1276.6928 -0.0011 0 25.08 0.0044 R ANLGVFSVFAPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8402.8402.2.dta 40 1 IPI00465022.6 similar to SMC hinge domain containing 1 243 218195 8 8 8 8 6064 7040 1 1 1 751.8609 1501.7073 2 1501.7089 -0.0017 0 23.25 0.0089 R DSTEYFIVFEPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8040.8040.2.dta 40 1 IPI00465022.6 similar to SMC hinge domain containing 1 243 218195 8 8 8 8 6115 3706 1 1 1 755.8788 1509.743 2 1509.7423 0.0007 0 83.24 1.60E-08 K TTFQENTQSISVR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4622.4622.2.dta 40 IPI00742909.1 Conserved hypothetical protein 68 31470 1 1 1 1 3738 4994 1 0 1 605.3213 1208.6281 2 1208.6302 -0.0021 0 67.76 4.50E-07 K QAVFFVGQSAR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6009.6009.2.dta 40 IPI00644749.1 25 kDa protein 55 25625 1 1 1 1 3207 5188 1 0 1 574.8187 1147.6229 2 1147.6237 -0.0008 0 54.73 1.90E-05 R LQIFSVEGQK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6205.6205.2.dta 40 IPI00645162.2 17 kDa protein 23 16623 1 1 1 1 6064 7040 1 0 1 751.8609 1501.7073 2 1501.7089 -0.0017 0 23.25 0.0089 R DSTEYFIVFEPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8040.8040.2.dta 41 1 IPI00021290.5 ATP-citrate synthase 243 121674 8 8 8 8 1341 1641 1 1 1 451.7507 901.4868 2 901.4869 -0.0001 0 56.11 8.90E-05 R LGQEATVGK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2359.2359.2.dta 41 1 IPI00021290.5 ATP-citrate synthase 243 121674 8 8 8 8 1575 5983 1 1 1 467.7728 933.5311 2 933.5317 -0.0006 0 32.71 0.0023 K TILSLMTR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6995.6995.2.dta 41 1 IPI00021290.5 ATP-citrate synthase 243 121674 8 8 8 8 3259 3287 1 1 1 578.2734 1154.5323 2 1154.5278 0.0046 0 58.45 4.00E-06 K VDATADYICK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4169.4169.2.dta 41 1 IPI00021290.5 ATP-citrate synthase 243 121674 8 8 8 8 3330 6117 1 1 1 582.3187 1162.6228 2 1162.6234 -0.0006 0 47.5 3.50E-05 K DGVYVLDLAAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7129.7129.2.dta 41 1 IPI00021290.5 ATP-citrate synthase 243 121674 8 8 8 8 6024 5408 1 1 1 746.3622 1490.7099 2 1490.7147 -0.0048 0 78.1 2.50E-07 R SGGMSNELNNIISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6423.6423.2.dta 41 1 IPI00021290.5 ATP-citrate synthase 243 121674 8 8 8 8 6410 6846 1 1 1 784.3941 1566.7737 2 1566.7752 -0.0016 0 16.89 0.048 K AFDSGIIPMEFVNK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7849.7849.2.dta 41 1 IPI00021290.5 ATP-citrate synthase 243 121674 8 8 8 8 6414 6908 1 1 1 784.4565 1566.8984 2 1566.8981 0.0003 0 50.29 5.20E-05 R TIAIIAEGIPEALTR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7910.7910.2.dta 41 1 IPI00021290.5 ATP-citrate synthase 243 121674 8 8 8 8 7242 5814 1 1 1 849.3975 1696.7805 2 1696.7831 -0.0026 0 38.14 0.00027 R EAYPEEAYIADLDAK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6825.6825.2.dta 41 IPI00794404.1 23 kDa protein 106 23080 2 2 2 2 6024 5408 1 0 1 746.3622 1490.7099 2 1490.7147 -0.0048 0 78.1 2.50E-07 R SGGMSNELNNIISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6423.6423.2.dta 41 IPI00794404.1 23 kDa protein 106 23080 2 2 2 2 6414 6908 1 0 1 784.4565 1566.8984 2 1566.8981 0.0003 0 50.29 5.20E-05 R TIAIIAEGIPEALTR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7910.7910.2.dta 42 1 IPI00449049.5 Poly [ADP-ribose] polymerase 1 241 113811 5 5 5 5 583 505 1 1 1 381.2295 760.4445 2 760.4443 0.0002 1 44.81 0.00054 K SGAALSKK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1128.1128.2.dta 42 1 IPI00449049.5 Poly [ADP-ribose] polymerase 1 241 113811 5 5 5 5 654 6259 1 1 1 390.2117 778.4088 2 778.4086 0.0003 0 41.76 0.0011 K HASHISK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.727.727.2.dta 42 1 IPI00449049.5 Poly [ADP-ribose] polymerase 1 241 113811 5 5 5 5 3499 4997 1 1 1 593.2925 1184.5704 2 1184.5713 -0.0009 0 54.3 8.10E-06 K TLGDFAAEYAK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6011.6011.2.dta 42 1 IPI00449049.5 Poly [ADP-ribose] polymerase 1 241 113811 5 5 5 5 5152 6510 1 1 1 689.3774 1376.7403 2 1376.7412 -0.0009 0 98.36 2.70E-09 R TTNFAGILSQGLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7517.7517.2.dta 42 1 IPI00449049.5 Poly [ADP-ribose] polymerase 1 241 113811 5 5 5 5 6754 5781 1 1 1 812.9059 1623.7972 2 1623.7992 -0.002 0 94.34 6.80E-09 R VVSEDFLQDVSASTK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6793.6793.2.dta 43 1 IPI00026970.4 FACT complex subunit SPT16 229 120409 9 9 9 9 183 3795 1 1 1 325.6974 649.3803 2 649.3799 0.0004 0 30.5 0.014 K IGVFSK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4718.4718.2.dta 43 1 IPI00026970.4 FACT complex subunit SPT16 229 120409 9 9 9 9 3773 3274 1 1 1 608.314 1214.6134 2 1214.6142 -0.0009 0 47.9 0.00026 K ELAAQLNEEAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4155.4155.2.dta 43 1 IPI00026970.4 FACT complex subunit SPT16 229 120409 9 9 9 9 4476 6567 1 1 1 647.8187 1293.6228 2 1293.6241 -0.0013 0 35.6 0.00046 K EELEFEVPFR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7573.7573.2.dta 43 1 IPI00026970.4 FACT complex subunit SPT16 229 120409 9 9 9 9 4987 5285 1 1 1 677.8318 1353.649 2 1353.6499 -0.0009 0 48.13 3.10E-05 R INFYCPGSALGR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6301.6301.2.dta 43 1 IPI00026970.4 FACT complex subunit SPT16 229 120409 9 9 9 9 5529 4799 1 1 1 713.3533 1424.692 2 1424.6936 -0.0016 0 66.5 1.40E-06 K YTEGVQSLNWTK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5803.5803.2.dta 43 1 IPI00026970.4 FACT complex subunit SPT16 229 120409 9 9 9 9 5567 1321 1 1 1 715.3862 1428.7578 2 1428.7572 0.0006 1 58.4 2.20E-05 R LTEQKGEQQIQK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2012.2012.2.dta 43 1 IPI00026970.4 FACT complex subunit SPT16 229 120409 9 9 9 9 6750 6465 1 1 1 812.4431 1622.8717 2 1622.874 -0.0023 0 17.72 0.022 K GNENANGAPAITLLIR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7471.7471.2.dta 43 1 IPI00026970.4 FACT complex subunit SPT16 229 120409 9 9 9 9 7080 5971 1 1 1 838.9159 1675.8172 2 1675.8206 -0.0033 0 50.4 0.00016 R NEGNIFPNPEATFVK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6982.6982.2.dta 43 1 IPI00026970.4 FACT complex subunit SPT16 229 120409 9 9 9 9 7646 6241 1 1 1 913.4805 1824.9465 2 1824.9482 -0.0017 0 31.74 0.0011 K APGEQTVPALNLQNAFR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7250.7250.2.dta 44 1 IPI00411559.2 Isoform 1 of Structural maintenance of chromosomes protein 4 222 147775 10 10 10 10 480 5503 1 1 1 367.7262 733.4378 2 733.4374 0.0004 0 29.06 0.006 R LFDLVK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6518.6518.2.dta 44 1 IPI00411559.2 Isoform 1 of Structural maintenance of chromosomes protein 4 222 147775 10 10 10 10 671 5454 1 1 1 392.7374 783.4602 2 783.4603 0 1 25.62 0.021 K LKHATSK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.647.647.2.dta 44 1 IPI00411559.2 Isoform 1 of Structural maintenance of chromosomes protein 4 222 147775 10 10 10 10 1102 5345 1 1 1 429.2583 856.5021 2 856.5018 0.0003 0 37.73 0.0025 R NLLQELK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6361.6361.2.dta 44 1 IPI00411559.2 Isoform 1 of Structural maintenance of chromosomes protein 4 222 147775 10 10 10 10 2296 4461 1 1 1 514.8043 1027.594 2 1027.5913 0.0026 0 32.67 0.0099 K VLDAIIQEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5440.5440.2.dta 44 1 IPI00411559.2 Isoform 1 of Structural maintenance of chromosomes protein 4 222 147775 10 10 10 10 2825 1910 1 1 1 549.7981 1097.5816 2 1097.5829 -0.0013 0 53.85 8.90E-06 R HNTAVSQLTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2650.2650.2.dta 44 1 IPI00411559.2 Isoform 1 of Structural maintenance of chromosomes protein 4 222 147775 10 10 10 10 3321 1786 1 1 1 388.5231 1162.5474 3 1162.5479 -0.0005 0 20.56 0.035 R SHGIDLDHNR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2516.2516.3.dta 44 1 IPI00411559.2 Isoform 1 of Structural maintenance of chromosomes protein 4 222 147775 10 10 10 10 3764 4302 1 1 1 607.3603 1212.706 2 1212.7078 -0.0017 1 46.27 0.00019 R GKVLDAIIQEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5266.5266.2.dta 44 1 IPI00411559.2 Isoform 1 of Structural maintenance of chromosomes protein 4 222 147775 10 10 10 10 4220 3169 1 1 1 631.8202 1261.6258 2 1261.6262 -0.0004 0 62.65 1.20E-05 K SNNIINETTTR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4040.4040.2.dta 44 1 IPI00411559.2 Isoform 1 of Structural maintenance of chromosomes protein 4 222 147775 10 10 10 10 4826 3841 1 1 1 668.8593 1335.704 2 1335.7034 0.0006 1 23.96 0.0057 R VAELDKITYER D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4768.4768.2.dta 44 1 IPI00411559.2 Isoform 1 of Structural maintenance of chromosomes protein 4 222 147775 10 10 10 10 5800 5667 1 1 1 731.8784 1461.7423 2 1461.7464 -0.0041 0 79.28 2.60E-07 K FTQLDLEDVQVR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6680.6680.2.dta 44 IPI00328298.6 Isoform 2 of Structural maintenance of chromosomes protein 4 208 140875 9 9 9 9 480 5503 1 0 1 367.7262 733.4378 2 733.4374 0.0004 0 29.06 0.006 R LFDLVK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6518.6518.2.dta 44 IPI00328298.6 Isoform 2 of Structural maintenance of chromosomes protein 4 208 140875 9 9 9 9 671 5454 1 0 1 392.7374 783.4602 2 783.4603 0 1 25.62 0.021 K LKHATSK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.647.647.2.dta 44 IPI00328298.6 Isoform 2 of Structural maintenance of chromosomes protein 4 208 140875 9 9 9 9 2296 4461 1 0 1 514.8043 1027.594 2 1027.5913 0.0026 0 32.67 0.0099 K VLDAIIQEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5440.5440.2.dta 44 IPI00328298.6 Isoform 2 of Structural maintenance of chromosomes protein 4 208 140875 9 9 9 9 2825 1910 1 0 1 549.7981 1097.5816 2 1097.5829 -0.0013 0 53.85 8.90E-06 R HNTAVSQLTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2650.2650.2.dta 44 IPI00328298.6 Isoform 2 of Structural maintenance of chromosomes protein 4 208 140875 9 9 9 9 3321 1786 1 0 1 388.5231 1162.5474 3 1162.5479 -0.0005 0 20.56 0.035 R SHGIDLDHNR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2516.2516.3.dta 44 IPI00328298.6 Isoform 2 of Structural maintenance of chromosomes protein 4 208 140875 9 9 9 9 3764 4302 1 0 1 607.3603 1212.706 2 1212.7078 -0.0017 1 46.27 0.00019 R GKVLDAIIQEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5266.5266.2.dta 44 IPI00328298.6 Isoform 2 of Structural maintenance of chromosomes protein 4 208 140875 9 9 9 9 4220 3169 1 0 1 631.8202 1261.6258 2 1261.6262 -0.0004 0 62.65 1.20E-05 K SNNIINETTTR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4040.4040.2.dta 44 IPI00328298.6 Isoform 2 of Structural maintenance of chromosomes protein 4 208 140875 9 9 9 9 4826 3841 1 0 1 668.8593 1335.704 2 1335.7034 0.0006 1 23.96 0.0057 R VAELDKITYER D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4768.4768.2.dta 44 IPI00328298.6 Isoform 2 of Structural maintenance of chromosomes protein 4 208 140875 9 9 9 9 5800 5667 1 0 1 731.8784 1461.7423 2 1461.7464 -0.0041 0 79.28 2.60E-07 K FTQLDLEDVQVR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6680.6680.2.dta 44 IPI00745048.1 106 kDa protein 199 106342 8 8 8 8 480 5503 1 0 1 367.7262 733.4378 2 733.4374 0.0004 0 29.06 0.006 R LFDLVK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6518.6518.2.dta 44 IPI00745048.1 106 kDa protein 199 106342 8 8 8 8 671 5454 1 0 1 392.7374 783.4602 2 783.4603 0 1 25.62 0.021 K LKHATSK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.647.647.2.dta 44 IPI00745048.1 106 kDa protein 199 106342 8 8 8 8 2296 4461 1 0 1 514.8043 1027.594 2 1027.5913 0.0026 0 32.67 0.0099 K VLDAIIQEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5440.5440.2.dta 44 IPI00745048.1 106 kDa protein 199 106342 8 8 8 8 2825 1910 1 0 1 549.7981 1097.5816 2 1097.5829 -0.0013 0 53.85 8.90E-06 R HNTAVSQLTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2650.2650.2.dta 44 IPI00745048.1 106 kDa protein 199 106342 8 8 8 8 3321 1786 1 0 1 388.5231 1162.5474 3 1162.5479 -0.0005 0 20.56 0.035 R SHGIDLDHNR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2516.2516.3.dta 44 IPI00745048.1 106 kDa protein 199 106342 8 8 8 8 3764 4302 1 0 1 607.3603 1212.706 2 1212.7078 -0.0017 1 46.27 0.00019 R GKVLDAIIQEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5266.5266.2.dta 44 IPI00745048.1 106 kDa protein 199 106342 8 8 8 8 4220 3169 1 0 1 631.8202 1261.6258 2 1261.6262 -0.0004 0 62.65 1.20E-05 K SNNIINETTTR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4040.4040.2.dta 44 IPI00745048.1 106 kDa protein 199 106342 8 8 8 8 5800 5667 1 0 1 731.8784 1461.7423 2 1461.7464 -0.0041 0 79.28 2.60E-07 K FTQLDLEDVQVR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6680.6680.2.dta 44 IPI00794838.1 Hypothetical protein (Fragment) 82 48491 3 3 3 3 671 5454 1 0 1 392.7374 783.4602 2 783.4603 0 1 25.62 0.021 K LKHATSK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.647.647.2.dta 44 IPI00794838.1 Hypothetical protein (Fragment) 82 48491 3 3 3 3 3321 1786 1 0 1 388.5231 1162.5474 3 1162.5479 -0.0005 0 20.56 0.035 R SHGIDLDHNR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2516.2516.3.dta 44 IPI00794838.1 Hypothetical protein (Fragment) 82 48491 3 3 3 3 5800 5667 1 0 1 731.8784 1461.7423 2 1461.7464 -0.0041 0 79.28 2.60E-07 K FTQLDLEDVQVR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6680.6680.2.dta 44 IPI00793575.1 14 kDa protein 54 13566 1 1 1 1 2825 1910 1 0 1 549.7981 1097.5816 2 1097.5829 -0.0013 0 53.85 8.90E-06 R HNTAVSQLTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2650.2650.2.dta 45 1 IPI00026089.3 Splicing factor 3B subunit 1 221 146464 7 7 7 7 2086 3156 1 1 1 501.2722 1000.5298 2 1000.5301 -0.0003 0 31.27 0.0012 R QQAADLISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4026.4026.2.dta 45 1 IPI00026089.3 Splicing factor 3B subunit 1 221 146464 7 7 7 7 4144 2757 1 1 1 628.8572 1255.6999 2 1255.6997 0.0003 1 31.04 0.0034 K VRQQAADLISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3573.3573.2.dta 45 1 IPI00026089.3 Splicing factor 3B subunit 1 221 146464 7 7 7 7 4405 789 1 1 1 644.33 1286.6455 2 1286.6466 -0.0012 1 49.72 6.00E-05 R AKGSETPGATPGSK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1436.1436.2.dta 45 1 IPI00026089.3 Splicing factor 3B subunit 1 221 146464 7 7 7 7 4545 4194 1 1 1 651.8264 1301.6383 2 1301.6398 -0.0015 0 69.2 3.20E-07 K VQENCIDLVGR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5151.5151.2.dta 45 1 IPI00026089.3 Splicing factor 3B subunit 1 221 146464 7 7 7 7 4783 4369 1 1 1 665.8636 1329.7126 2 1329.714 -0.0014 0 46.68 7.90E-05 R QLVDTTVELANK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5339.5339.2.dta 45 1 IPI00026089.3 Splicing factor 3B subunit 1 221 146464 7 7 7 7 5125 2380 1 1 1 687.3306 1372.6467 2 1372.647 -0.0003 0 56.97 4.60E-06 R GGDSIGETPTPGASK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3159.3159.2.dta 45 1 IPI00026089.3 Splicing factor 3B subunit 1 221 146464 7 7 7 7 7385 764 1 1 1 578.6025 1732.7858 3 1732.7878 -0.002 0 41.54 0.00031 R GDTPGHATPGHGGATSSAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1409.1409.3.dta 46 1 IPI00291939.1 Structural maintenance of chromosomes protein 1A 219 143771 9 9 9 9 563 993 1 1 1 379.7297 757.4449 2 757.4446 0.0003 1 33.45 0.014 R INDIKR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1657.1657.2.dta 46 1 IPI00291939.1 Structural maintenance of chromosomes protein 1A 219 143771 9 9 9 9 2119 5278 1 1 1 503.2846 1004.5547 2 1004.5542 0.0005 0 36.39 0.003 K LIEIENFK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6295.6295.2.dta 46 1 IPI00291939.1 Structural maintenance of chromosomes protein 1A 219 143771 9 9 9 9 2160 3649 1 1 1 506.2666 1010.5187 2 1010.5185 0.0002 0 17.65 0.039 R LYPGSVYGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4561.4561.2.dta 46 1 IPI00291939.1 Structural maintenance of chromosomes protein 1A 219 143771 9 9 9 9 2560 5330 1 1 1 533.2825 1064.5504 2 1064.5502 0.0002 0 55.18 9.30E-06 R TALFEEISR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6347.6347.2.dta 46 1 IPI00291939.1 Structural maintenance of chromosomes protein 1A 219 143771 9 9 9 9 3770 2930 1 1 1 607.8271 1213.6397 2 1213.6415 -0.0017 0 77.78 2.80E-07 K LNEQQSVLQR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3776.3776.2.dta 46 1 IPI00291939.1 Structural maintenance of chromosomes protein 1A 219 143771 9 9 9 9 3774 4113 1 1 1 608.3233 1214.6321 2 1214.6329 -0.0008 0 28.46 0.0022 R LIDLCQPTQK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5063.5063.2.dta 46 1 IPI00291939.1 Structural maintenance of chromosomes protein 1A 219 143771 9 9 9 9 4480 2287 1 1 1 648.3144 1294.6142 2 1294.6153 -0.0011 1 34.53 0.00099 R SGELAQEYDKR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3059.3059.2.dta 46 1 IPI00291939.1 Structural maintenance of chromosomes protein 1A 219 143771 9 9 9 9 5696 4954 1 1 1 483.2563 1446.7469 3 1446.7467 0.0003 1 57.18 1.20E-05 K SKLESELANFGPR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5966.5966.3.dta 46 1 IPI00291939.1 Structural maintenance of chromosomes protein 1A 219 143771 9 9 9 9 8181 5863 1 1 1 726.0218 2175.0435 3 2175.0484 -0.0049 1 37.34 0.00058 K VLTFDLTKYPDANPNPNEQ - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6874.6874.3.dta 46 IPI00553151.2 Structural maintenance of chromosomes 1A 73 33648 2 2 2 2 2560 5330 1 0 1 533.2825 1064.5504 2 1064.5502 0.0002 0 55.18 9.30E-06 R TALFEEISR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6347.6347.2.dta 46 IPI00553151.2 Structural maintenance of chromosomes 1A 73 33648 2 2 2 2 4480 2287 1 0 1 648.3144 1294.6142 2 1294.6153 -0.0011 1 34.53 0.00099 R SGELAQEYDKR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3059.3059.2.dta 46 IPI00385082.1 MSTP142 50 23442 2 2 2 2 2119 5278 1 0 1 503.2846 1004.5547 2 1004.5542 0.0005 0 36.39 0.003 K LIEIENFK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6295.6295.2.dta 46 IPI00385082.1 MSTP142 50 23442 2 2 2 2 4480 2287 1 0 1 648.3144 1294.6142 2 1294.6153 -0.0011 1 34.53 0.00099 R SGELAQEYDKR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3059.3059.2.dta 47 1 IPI00644079.2 heterogeneous nuclear ribonucleoprotein U isoform a 214 91269 10 10 10 10 632 1362 1 1 1 387.2025 772.3905 2 772.3902 0.0003 0 35.49 0.0062 R APQCLGK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2057.2057.2.dta 47 1 IPI00644079.2 heterogeneous nuclear ribonucleoprotein U isoform a 214 91269 10 10 10 10 1624 2175 1 1 1 314.531 940.5713 3 940.5706 0.0007 1 24.7 0.015 K VTEKIPVR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2937.2937.3.dta 47 1 IPI00644079.2 heterogeneous nuclear ribonucleoprotein U isoform a 214 91269 10 10 10 10 2048 3212 1 1 1 498.7574 995.5003 2 995.5036 -0.0033 0 31.38 0.01 K DIDIHEVR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4087.4087.2.dta 47 1 IPI00644079.2 heterogeneous nuclear ribonucleoprotein U isoform a 214 91269 10 10 10 10 2248 5153 1 1 1 511.7651 1021.5157 2 1021.5166 -0.0008 1 37.35 0.00031 K RPREDHGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.617.617.2.dta 47 1 IPI00644079.2 heterogeneous nuclear ribonucleoprotein U isoform a 214 91269 10 10 10 10 3183 5547 1 1 1 573.2649 1144.5152 2 1144.5158 -0.0005 0 26.48 0.0033 K MCLFAGFQR K Oxidation (M) 0.100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6561.6561.2.dta 47 1 IPI00644079.2 heterogeneous nuclear ribonucleoprotein U isoform a 214 91269 10 10 10 10 5193 5601 1 1 1 691.8519 1381.6893 2 1381.6911 -0.0018 0 36.69 0.0024 K YNILGTNTIMDK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6614.6614.2.dta 47 1 IPI00644079.2 heterogeneous nuclear ribonucleoprotein U isoform a 214 91269 10 10 10 10 6908 5036 1 1 1 824.4256 1646.8366 2 1646.8376 -0.001 0 111.64 1.70E-10 R NFILDQTNVSAAAQR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6051.6051.2.dta 47 1 IPI00644079.2 heterogeneous nuclear ribonucleoprotein U isoform a 214 91269 10 10 10 10 7241 4889 1 1 1 566.5982 1696.7728 3 1696.7733 -0.0005 1 34.41 0.00059 R GYFEYIEENKYSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5899.5899.3.dta 47 1 IPI00644079.2 heterogeneous nuclear ribonucleoprotein U isoform a 214 91269 10 10 10 10 7315 6171 1 1 1 857.9588 1713.9031 2 1713.905 -0.0019 0 33.99 0.0019 K SSGPTSLFAVTVAPPGAR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7182.7182.2.dta 47 1 IPI00644079.2 heterogeneous nuclear ribonucleoprotein U isoform a 214 91269 10 10 10 10 8084 845 1 1 1 675.6625 2023.9658 3 2023.9671 -0.0014 1 17.45 0.026 K AEGGGGGGRPGAPAAGDGKTEQK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1496.1496.3.dta 47 IPI00479217.1 Isoform Short of Heterogeneous nuclear ribonucleoprotein U 211 89665 9 9 9 9 632 1362 1 0 1 387.2025 772.3905 2 772.3902 0.0003 0 35.49 0.0062 R APQCLGK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2057.2057.2.dta 47 IPI00479217.1 Isoform Short of Heterogeneous nuclear ribonucleoprotein U 211 89665 9 9 9 9 1624 2175 1 0 1 314.531 940.5713 3 940.5706 0.0007 1 24.7 0.015 K VTEKIPVR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2937.2937.3.dta 47 IPI00479217.1 Isoform Short of Heterogeneous nuclear ribonucleoprotein U 211 89665 9 9 9 9 2048 3212 1 0 1 498.7574 995.5003 2 995.5036 -0.0033 0 31.38 0.01 K DIDIHEVR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4087.4087.2.dta 47 IPI00479217.1 Isoform Short of Heterogeneous nuclear ribonucleoprotein U 211 89665 9 9 9 9 2248 5153 1 0 1 511.7651 1021.5157 2 1021.5166 -0.0008 1 37.35 0.00031 K RPREDHGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.617.617.2.dta 47 IPI00479217.1 Isoform Short of Heterogeneous nuclear ribonucleoprotein U 211 89665 9 9 9 9 3183 5547 1 0 1 573.2649 1144.5152 2 1144.5158 -0.0005 0 26.48 0.0033 K MCLFAGFQR K Oxidation (M) 0.100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6561.6561.2.dta 47 IPI00479217.1 Isoform Short of Heterogeneous nuclear ribonucleoprotein U 211 89665 9 9 9 9 5193 5601 1 0 1 691.8519 1381.6893 2 1381.6911 -0.0018 0 36.69 0.0024 K YNILGTNTIMDK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6614.6614.2.dta 47 IPI00479217.1 Isoform Short of Heterogeneous nuclear ribonucleoprotein U 211 89665 9 9 9 9 6908 5036 1 0 1 824.4256 1646.8366 2 1646.8376 -0.001 0 111.64 1.70E-10 R NFILDQTNVSAAAQR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6051.6051.2.dta 47 IPI00479217.1 Isoform Short of Heterogeneous nuclear ribonucleoprotein U 211 89665 9 9 9 9 7241 4889 1 0 1 566.5982 1696.7728 3 1696.7733 -0.0005 1 34.41 0.00059 R GYFEYIEENKYSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5899.5899.3.dta 47 IPI00479217.1 Isoform Short of Heterogeneous nuclear ribonucleoprotein U 211 89665 9 9 9 9 7315 6171 1 0 1 857.9588 1713.9031 2 1713.905 -0.0019 0 33.99 0.0019 K SSGPTSLFAVTVAPPGAR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7182.7182.2.dta 47 IPI00644224.1 Heterogeneous nuclear ribonucleoprotein U 156 62395 6 6 6 6 632 1362 1 0 1 387.2025 772.3905 2 772.3902 0.0003 0 35.49 0.0062 R APQCLGK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2057.2057.2.dta 47 IPI00644224.1 Heterogeneous nuclear ribonucleoprotein U 156 62395 6 6 6 6 1624 2175 1 0 1 314.531 940.5713 3 940.5706 0.0007 1 24.7 0.015 K VTEKIPVR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2937.2937.3.dta 47 IPI00644224.1 Heterogeneous nuclear ribonucleoprotein U 156 62395 6 6 6 6 2048 3212 1 0 1 498.7574 995.5003 2 995.5036 -0.0033 0 31.38 0.01 K DIDIHEVR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4087.4087.2.dta 47 IPI00644224.1 Heterogeneous nuclear ribonucleoprotein U 156 62395 6 6 6 6 3183 5547 1 0 1 573.2649 1144.5152 2 1144.5158 -0.0005 0 26.48 0.0033 K MCLFAGFQR K Oxidation (M) 0.100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6561.6561.2.dta 47 IPI00644224.1 Heterogeneous nuclear ribonucleoprotein U 156 62395 6 6 6 6 5193 5601 1 0 1 691.8519 1381.6893 2 1381.6911 -0.0018 0 36.69 0.0024 K YNILGTNTIMDK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6614.6614.2.dta 47 IPI00644224.1 Heterogeneous nuclear ribonucleoprotein U 156 62395 6 6 6 6 6908 5036 1 0 1 824.4256 1646.8366 2 1646.8376 -0.001 0 111.64 1.70E-10 R NFILDQTNVSAAAQR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6051.6051.2.dta 47 IPI00640106.1 Heterogeneous nuclear ribonucleoprotein U 73 27900 4 4 4 4 1624 2175 1 0 1 314.531 940.5713 3 940.5706 0.0007 1 24.7 0.015 K VTEKIPVR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2937.2937.3.dta 47 IPI00640106.1 Heterogeneous nuclear ribonucleoprotein U 73 27900 4 4 4 4 2048 3212 1 0 1 498.7574 995.5003 2 995.5036 -0.0033 0 31.38 0.01 K DIDIHEVR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4087.4087.2.dta 47 IPI00640106.1 Heterogeneous nuclear ribonucleoprotein U 73 27900 4 4 4 4 2248 5153 1 0 1 511.7651 1021.5157 2 1021.5166 -0.0008 1 37.35 0.00031 K RPREDHGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.617.617.2.dta 47 IPI00640106.1 Heterogeneous nuclear ribonucleoprotein U 73 27900 4 4 4 4 7241 4889 1 0 1 566.5982 1696.7728 3 1696.7733 -0.0005 1 34.41 0.00059 R GYFEYIEENKYSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5899.5899.3.dta 48 1 IPI00328753.1 Isoform 1 of Kinectin 212 156464 5 5 5 5 4049 4131 1 1 1 622.8452 1243.6758 2 1243.6772 -0.0014 0 66.01 4.90E-06 K AQQSLELIQSK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5082.5082.2.dta 48 1 IPI00328753.1 Isoform 1 of Kinectin 212 156464 5 5 5 5 4414 5569 1 1 1 644.3607 1286.7069 2 1286.7082 -0.0013 0 84.16 3.00E-08 K SVLAETEGILQK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6583.6583.2.dta 48 1 IPI00328753.1 Isoform 1 of Kinectin 212 156464 5 5 5 5 5409 3202 1 1 1 703.8405 1405.6665 2 1405.6685 -0.002 0 59.16 2.00E-05 R DAVSNTTNQLESK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4076.4076.2.dta 48 1 IPI00328753.1 Isoform 1 of Kinectin 212 156464 5 5 5 5 6343 1385 1 1 1 778.3699 1554.7252 2 1554.7274 -0.0022 0 53.87 8.90E-06 R TAEHEAAQQDLQSK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2081.2081.2.dta 48 1 IPI00328753.1 Isoform 1 of Kinectin 212 156464 5 5 5 5 7639 5506 1 1 1 608.675 1823.0031 3 1823.004 -0.0009 0 34.83 0.002 R EVIDLLKPDQVEGIQK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6520.6520.3.dta 49 1 IPI00396171.3 Isoform 1 of Microtubule-associated protein 4 209 121457 8 8 8 8 1636 1721 1 1 1 472.2638 942.513 2 942.5134 -0.0004 0 38.25 0.0019 K TAGPIASAQK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2445.2445.2.dta 49 1 IPI00396171.3 Isoform 1 of Microtubule-associated protein 4 209 121457 8 8 8 8 1866 510 1 1 1 487.2687 972.5229 2 972.524 -0.0011 0 40.89 0.0012 R KPESNAVTK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1134.1134.2.dta 49 1 IPI00396171.3 Isoform 1 of Microtubule-associated protein 4 209 121457 8 8 8 8 3071 2806 1 1 1 565.8059 1129.5973 2 1129.5979 -0.0006 0 56.92 1.20E-05 R LATNTSAPDLK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3635.3635.2.dta 49 1 IPI00396171.3 Isoform 1 of Microtubule-associated protein 4 209 121457 8 8 8 8 3267 1231 1 1 1 578.34 1154.6654 2 1154.6659 -0.0005 0 30.56 0.0014 K TKPLATTQPAK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1915.1915.2.dta 49 1 IPI00396171.3 Isoform 1 of Microtubule-associated protein 4 209 121457 8 8 8 8 3605 3323 1 1 1 598.8339 1195.6533 2 1195.6561 -0.0028 0 22.76 0.018 K QPAPTTIGGLNK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4208.4208.2.dta 49 1 IPI00396171.3 Isoform 1 of Microtubule-associated protein 4 209 121457 8 8 8 8 3865 794 1 1 1 613.8275 1225.6404 2 1225.6415 -0.0011 0 18.98 0.017 R ASPSKPASAPASR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1441.1441.2.dta 49 1 IPI00396171.3 Isoform 1 of Microtubule-associated protein 4 209 121457 8 8 8 8 5151 2019 1 1 1 689.351 1376.6875 2 1376.6896 -0.0021 0 56.27 4.80E-05 K TTTAAAVASTGPSSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2768.2768.2.dta 49 1 IPI00396171.3 Isoform 1 of Microtubule-associated protein 4 209 121457 8 8 8 8 6568 3681 1 1 1 793.4329 1584.8512 2 1584.8472 0.004 0 83.11 1.60E-08 K TTTLSGTAPAAGVVPSR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4595.4595.2.dta 49 IPI00220113.1 Isoform 2 of Microtubule-associated protein 4 189 103241 6 6 6 6 1636 1721 1 0 1 472.2638 942.513 2 942.5134 -0.0004 0 38.25 0.0019 K TAGPIASAQK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2445.2445.2.dta 49 IPI00220113.1 Isoform 2 of Microtubule-associated protein 4 189 103241 6 6 6 6 1866 510 1 0 1 487.2687 972.5229 2 972.524 -0.0011 0 40.89 0.0012 R KPESNAVTK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1134.1134.2.dta 49 IPI00220113.1 Isoform 2 of Microtubule-associated protein 4 189 103241 6 6 6 6 3071 2806 1 0 1 565.8059 1129.5973 2 1129.5979 -0.0006 0 56.92 1.20E-05 R LATNTSAPDLK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3635.3635.2.dta 49 IPI00220113.1 Isoform 2 of Microtubule-associated protein 4 189 103241 6 6 6 6 3865 794 1 0 1 613.8275 1225.6404 2 1225.6415 -0.0011 0 18.98 0.017 R ASPSKPASAPASR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1441.1441.2.dta 49 IPI00220113.1 Isoform 2 of Microtubule-associated protein 4 189 103241 6 6 6 6 5151 2019 1 0 1 689.351 1376.6875 2 1376.6896 -0.0021 0 56.27 4.80E-05 K TTTAAAVASTGPSSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2768.2768.2.dta 49 IPI00220113.1 Isoform 2 of Microtubule-associated protein 4 189 103241 6 6 6 6 6568 3681 1 0 1 793.4329 1584.8512 2 1584.8472 0.004 0 83.11 1.60E-08 K TTTLSGTAPAAGVVPSR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4595.4595.2.dta 49 IPI00470852.1 Microtubule-associated protein (Fragment) 177 50935 6 6 6 6 3071 2806 1 0 1 565.8059 1129.5973 2 1129.5979 -0.0006 0 56.92 1.20E-05 R LATNTSAPDLK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3635.3635.2.dta 49 IPI00470852.1 Microtubule-associated protein (Fragment) 177 50935 6 6 6 6 3267 1231 1 0 1 578.34 1154.6654 2 1154.6659 -0.0005 0 30.56 0.0014 K TKPLATTQPAK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1915.1915.2.dta 49 IPI00470852.1 Microtubule-associated protein (Fragment) 177 50935 6 6 6 6 3605 3323 1 0 1 598.8339 1195.6533 2 1195.6561 -0.0028 0 22.76 0.018 K QPAPTTIGGLNK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4208.4208.2.dta 49 IPI00470852.1 Microtubule-associated protein (Fragment) 177 50935 6 6 6 6 3865 794 1 0 1 613.8275 1225.6404 2 1225.6415 -0.0011 0 18.98 0.017 R ASPSKPASAPASR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1441.1441.2.dta 49 IPI00470852.1 Microtubule-associated protein (Fragment) 177 50935 6 6 6 6 5151 2019 1 0 1 689.351 1376.6875 2 1376.6896 -0.0021 0 56.27 4.80E-05 K TTTAAAVASTGPSSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2768.2768.2.dta 49 IPI00470852.1 Microtubule-associated protein (Fragment) 177 50935 6 6 6 6 6568 3681 1 0 1 793.4329 1584.8512 2 1584.8472 0.004 0 83.11 1.60E-08 K TTTLSGTAPAAGVVPSR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4595.4595.2.dta 49 IPI00333281.2 Microtubule-associated protein (Fragment) 57 19251 1 1 1 1 3071 2806 1 0 1 565.8059 1129.5973 2 1129.5979 -0.0006 0 56.92 1.20E-05 R LATNTSAPDLK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3635.3635.2.dta 50 1 IPI00005614.6 "Isoform Long of Spectrin beta chain, brain 1" 205 275237 9 9 9 9 269 4206 6 1 1 339.2213 676.428 2 676.4272 0.0008 0 19.59 0.042 R IIYIR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5164.5164.2.dta 50 1 IPI00005614.6 "Isoform Long of Spectrin beta chain, brain 1" 205 275237 9 9 9 9 1391 4936 1 1 1 454.2294 906.4442 2 906.4447 -0.0005 0 31.67 0.0078 R IDDIFER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5948.5948.2.dta 50 1 IPI00005614.6 "Isoform Long of Spectrin beta chain, brain 1" 205 275237 9 9 9 9 3514 6619 1 1 1 593.8553 1185.696 2 1185.6969 -0.0009 0 81.42 4.50E-08 R LTTLELLEVR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7624.7624.2.dta 50 1 IPI00005614.6 "Isoform Long of Spectrin beta chain, brain 1" 205 275237 9 9 9 9 3698 2750 1 1 1 602.3016 1202.5887 2 1202.5891 -0.0004 0 51.84 4.30E-05 R DQNTVETLQR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3563.3563.2.dta 50 1 IPI00005614.6 "Isoform Long of Spectrin beta chain, brain 1" 205 275237 9 9 9 9 4227 5335 1 1 1 632.3502 1262.6858 2 1262.687 -0.0013 0 40.75 0.0013 K QALQDTLALYK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6351.6351.2.dta 50 1 IPI00005614.6 "Isoform Long of Spectrin beta chain, brain 1" 205 275237 9 9 9 9 5091 3619 1 1 1 684.3847 1366.7549 2 1366.7568 -0.002 0 54.15 4.30E-05 K TALPAQSAATLPAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4529.4529.2.dta 50 1 IPI00005614.6 "Isoform Long of Spectrin beta chain, brain 1" 205 275237 9 9 9 9 5184 7192 1 1 1 691.3226 1380.6307 2 1380.631 -0.0003 0 19.87 0.014 R DLDDFQSWLSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8191.8191.2.dta 50 1 IPI00005614.6 "Isoform Long of Spectrin beta chain, brain 1" 205 275237 9 9 9 9 5410 5709 1 1 1 703.8528 1405.6911 2 1405.6911 0 0 18.04 0.031 K FMELLEPLNER K Oxidation (M) 0.01000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6721.6721.2.dta 50 1 IPI00005614.6 "Isoform Long of Spectrin beta chain, brain 1" 205 275237 9 9 9 9 5768 6793 1 1 1 730.3571 1458.6996 2 1458.6991 0.0005 0 50.66 0.00015 R DVEDEILWVGER M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7797.7797.2.dta 50 IPI00328230.2 "Isoform Short of Spectrin beta chain, brain 1" 174 253618 8 8 8 8 269 4206 6 0 1 339.2213 676.428 2 676.4272 0.0008 0 19.59 0.042 R IIYIR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5164.5164.2.dta 50 IPI00328230.2 "Isoform Short of Spectrin beta chain, brain 1" 174 253618 8 8 8 8 1391 4936 1 0 1 454.2294 906.4442 2 906.4447 -0.0005 0 31.67 0.0078 R IDDIFER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5948.5948.2.dta 50 IPI00328230.2 "Isoform Short of Spectrin beta chain, brain 1" 174 253618 8 8 8 8 3514 6619 1 0 1 593.8553 1185.696 2 1185.6969 -0.0009 0 81.42 4.50E-08 R LTTLELLEVR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7624.7624.2.dta 50 IPI00328230.2 "Isoform Short of Spectrin beta chain, brain 1" 174 253618 8 8 8 8 3698 2750 1 0 1 602.3016 1202.5887 2 1202.5891 -0.0004 0 51.84 4.30E-05 R DQNTVETLQR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3563.3563.2.dta 50 IPI00328230.2 "Isoform Short of Spectrin beta chain, brain 1" 174 253618 8 8 8 8 4227 5335 1 0 1 632.3502 1262.6858 2 1262.687 -0.0013 0 40.75 0.0013 K QALQDTLALYK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6351.6351.2.dta 50 IPI00328230.2 "Isoform Short of Spectrin beta chain, brain 1" 174 253618 8 8 8 8 5184 7192 1 0 1 691.3226 1380.6307 2 1380.631 -0.0003 0 19.87 0.014 R DLDDFQSWLSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8191.8191.2.dta 50 IPI00328230.2 "Isoform Short of Spectrin beta chain, brain 1" 174 253618 8 8 8 8 5410 5709 1 0 1 703.8528 1405.6911 2 1405.6911 0 0 18.04 0.031 K FMELLEPLNER K Oxidation (M) 0.01000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6721.6721.2.dta 50 IPI00328230.2 "Isoform Short of Spectrin beta chain, brain 1" 174 253618 8 8 8 8 5768 6793 1 0 1 730.3571 1458.6996 2 1458.6991 0.0005 0 50.66 0.00015 R DVEDEILWVGER M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7797.7797.2.dta 51 1 IPI00215637.5 ATP-dependent RNA helicase DDX3X 202 73597 6 6 6 6 745 3221 1 1 1 399.6976 797.3806 2 797.382 -0.0015 0 40.89 0.001 R FSGGFGAR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4096.4096.2.dta 51 1 IPI00215637.5 ATP-dependent RNA helicase DDX3X 202 73597 6 6 6 6 2774 1343 1 1 1 363.8731 1088.5974 3 1088.5978 -0.0004 0 22.17 0.025 R YTRPTPVQK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2036.2036.3.dta 51 1 IPI00215637.5 ATP-dependent RNA helicase DDX3X 202 73597 6 6 6 6 3326 1654 1 1 1 582.2979 1162.5813 2 1162.583 -0.0017 0 76.22 5.60E-07 R VGSTSENITQK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2373.2373.2.dta 51 1 IPI00215637.5 ATP-dependent RNA helicase DDX3X 202 73597 6 6 6 6 5015 6406 1 1 1 679.3954 1356.7763 2 1356.7765 -0.0002 0 26.93 0.003 K QYPISLVLAPTR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7414.7414.2.dta 51 1 IPI00215637.5 ATP-dependent RNA helicase DDX3X 202 73597 6 6 6 6 5040 1602 1 1 1 681.2996 1360.5847 2 1360.5855 -0.0008 0 83.9 1.90E-08 R QSSGASSSSFSSSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2317.2317.2.dta 51 1 IPI00215637.5 ATP-dependent RNA helicase DDX3X 202 73597 6 6 6 6 6200 6702 1 1 1 762.8923 1523.7701 2 1523.7732 -0.0031 0 49.11 2.50E-05 R VGNLGLATSFFNER N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7706.7706.2.dta 51 IPI00293616.3 ATP-dependent RNA helicase DDX3Y 105 73564 4 4 4 4 745 3221 1 0 1 399.6976 797.3806 2 797.382 -0.0015 0 40.89 0.001 R FSGGFGAR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4096.4096.2.dta 51 IPI00293616.3 ATP-dependent RNA helicase DDX3Y 105 73564 4 4 4 4 2774 1343 1 0 1 363.8731 1088.5974 3 1088.5978 -0.0004 0 22.17 0.025 R YTRPTPVQK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2036.2036.3.dta 51 IPI00293616.3 ATP-dependent RNA helicase DDX3Y 105 73564 4 4 4 4 3326 1654 1 0 1 582.2979 1162.5813 2 1162.583 -0.0017 0 76.22 5.60E-07 R VGSTSENITQK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2373.2373.2.dta 51 IPI00293616.3 ATP-dependent RNA helicase DDX3Y 105 73564 4 4 4 4 5015 6406 1 0 1 679.3954 1356.7763 2 1356.7765 -0.0002 0 26.93 0.003 K QYPISLVLAPTR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7414.7414.2.dta 51 IPI00646152.1 28 kDa protein 22 27893 1 1 1 1 2774 1343 1 0 1 363.8731 1088.5974 3 1088.5978 -0.0004 0 22.17 0.025 R YTRPTPVQK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2036.2036.3.dta 52 1 IPI00140420.4 Staphylococcal nuclease domain-containing protein 1 198 102618 8 8 8 8 24 905 1 1 1 301.1746 600.3347 2 600.3343 0.0004 0 41.06 0.0016 R AGNLAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1561.1561.2.dta 52 1 IPI00140420.4 Staphylococcal nuclease domain-containing protein 1 198 102618 8 8 8 8 351 5047 1 1 1 351.2086 700.4026 2 700.402 0.0005 0 33.01 0.02 R LNLWR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6062.6062.2.dta 52 1 IPI00140420.4 Staphylococcal nuclease domain-containing protein 1 198 102618 8 8 8 8 1729 4222 1 1 1 479.2771 956.5397 2 956.5403 -0.0006 0 19.74 0.043 R QINLSNIR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5181.5181.2.dta 52 1 IPI00140420.4 Staphylococcal nuclease domain-containing protein 1 198 102618 8 8 8 8 2335 1703 1 1 1 517.2612 1032.5078 2 1032.5088 -0.001 0 35.9 0.0012 R VADISGDTQK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2426.2426.2.dta 52 1 IPI00140420.4 Staphylococcal nuclease domain-containing protein 1 198 102618 8 8 8 8 2447 6662 1 1 1 524.8002 1047.5859 2 1047.5865 -0.0006 0 35.32 0.00097 K QFLPFLQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7667.7667.2.dta 52 1 IPI00140420.4 Staphylococcal nuclease domain-containing protein 1 198 102618 8 8 8 8 2596 4871 1 1 1 536.2481 1070.4817 2 1070.4821 -0.0005 0 23.81 0.022 K FVDGEWYR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5880.5880.2.dta 52 1 IPI00140420.4 Staphylococcal nuclease domain-containing protein 1 198 102618 8 8 8 8 5562 5883 1 1 1 715.3511 1428.6877 2 1428.6885 -0.0008 0 81.99 7.00E-08 R SEAVVEYVFSGSR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6894.6894.2.dta 52 1 IPI00140420.4 Staphylococcal nuclease domain-containing protein 1 198 102618 8 8 8 8 5821 4198 1 1 1 733.3791 1464.7437 2 1464.746 -0.0022 0 76.42 6.80E-08 K VITEYLNAQESAK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5155.5155.2.dta 53 1 IPI00013174.2 Isoform 1 of RNA-binding protein 14 198 69620 6 6 6 6 3707 3541 1 1 1 603.316 1204.6175 2 1204.62 -0.0025 0 52.07 2.60E-05 R AQPSASLGVGYR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4444.4444.2.dta 53 1 IPI00013174.2 Isoform 1 of RNA-binding protein 14 198 69620 6 6 6 6 3991 4096 1 1 1 619.2771 1236.5396 2 1236.5411 -0.0014 0 53.66 3.60E-05 R YSGSYNDYLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5044.5044.2.dta 53 1 IPI00013174.2 Isoform 1 of RNA-binding protein 14 198 69620 6 6 6 6 4055 3970 1 1 1 623.3322 1244.6499 2 1244.6513 -0.0014 0 39.15 0.003 R AQPSVSLGAPYR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4908.4908.2.dta 53 1 IPI00013174.2 Isoform 1 of RNA-binding protein 14 198 69620 6 6 6 6 4850 1853 1 1 1 670.8156 1339.6167 2 1339.619 -0.0024 0 19.16 0.016 R TQPMTAQAASYR A Oxidation (M) 0.000100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2588.2588.2.dta 53 1 IPI00013174.2 Isoform 1 of RNA-binding protein 14 198 69620 6 6 6 6 6651 4425 1 1 1 804.9215 1607.8285 2 1607.8307 -0.0023 0 39.72 0.0017 R ASYVAPLTAQPATYR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5400.5400.2.dta 53 1 IPI00013174.2 Isoform 1 of RNA-binding protein 14 198 69620 6 6 6 6 7454 4674 1 1 1 876.4392 1750.8639 2 1750.8672 -0.0034 0 102.1 1.00E-09 K IFVGNVSAACTSQELR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5669.5669.2.dta 53 IPI00644837.1 Isoform 2 of RNA-binding protein 14 102 17277 1 1 1 1 7454 4674 1 0 1 876.4392 1750.8639 2 1750.8672 -0.0034 0 102.1 1.00E-09 K IFVGNVSAACTSQELR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5669.5669.2.dta 53 IPI00556514.1 RNA binding motif protein 14 variant (Fragment) 88 55824 4 4 4 4 3707 3541 1 0 1 603.316 1204.6175 2 1204.62 -0.0025 0 52.07 2.60E-05 R AQPSASLGVGYR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4444.4444.2.dta 53 IPI00556514.1 RNA binding motif protein 14 variant (Fragment) 88 55824 4 4 4 4 4055 3970 1 0 1 623.3322 1244.6499 2 1244.6513 -0.0014 0 39.15 0.003 R AQPSVSLGAPYR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4908.4908.2.dta 53 IPI00556514.1 RNA binding motif protein 14 variant (Fragment) 88 55824 4 4 4 4 4850 1853 1 0 1 670.8156 1339.6167 2 1339.619 -0.0024 0 19.16 0.016 R TQPMTAQAASYR A Oxidation (M) 0.000100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2588.2588.2.dta 53 IPI00556514.1 RNA binding motif protein 14 variant (Fragment) 88 55824 4 4 4 4 6651 4425 1 0 1 804.9215 1607.8285 2 1607.8307 -0.0023 0 39.72 0.0017 R ASYVAPLTAQPATYR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5400.5400.2.dta 54 1 IPI00010740.1 "Isoform Long of Splicing factor, proline- and glutamine-rich" 195 76216 8 8 8 8 403 2765 1 1 1 358.2217 714.4288 2 714.4276 0.0013 0 45.48 0.00045 R ALAEIAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3583.3583.2.dta 54 1 IPI00010740.1 "Isoform Long of Splicing factor, proline- and glutamine-rich" 195 76216 8 8 8 8 727 864 1 1 1 397.7116 793.4087 2 793.4083 0.0004 0 38.67 0.00073 K QGPGPGGPK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1517.1517.2.dta 54 1 IPI00010740.1 "Isoform Long of Splicing factor, proline- and glutamine-rich" 195 76216 8 8 8 8 1259 3222 1 1 0 443.7532 885.4919 2 885.492 -0.0001 0 35.97 0.0026 R AVVIVDDR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4098.4098.2.dta 54 1 IPI00010740.1 "Isoform Long of Splicing factor, proline- and glutamine-rich" 195 76216 8 8 8 8 2831 2596 1 1 1 550.3137 1098.6129 2 1098.6146 -0.0017 1 42.81 9.70E-05 R AVVIVDDRGR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3396.3396.2.dta 54 1 IPI00010740.1 "Isoform Long of Splicing factor, proline- and glutamine-rich" 195 76216 8 8 8 8 3169 3101 1 1 1 381.881 1142.6212 3 1142.6196 0.0016 0 41.66 0.00029 R FATHAAALSVR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3964.3964.3.dta 54 1 IPI00010740.1 "Isoform Long of Splicing factor, proline- and glutamine-rich" 195 76216 8 8 8 8 4057 3588 1 1 1 623.3502 1244.6858 2 1244.6877 -0.0019 0 54.05 3.60E-05 K GIVEFASKPAAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4495.4495.2.dta 54 1 IPI00010740.1 "Isoform Long of Splicing factor, proline- and glutamine-rich" 195 76216 8 8 8 8 4108 4500 1 1 1 626.8126 1251.6107 2 1251.6135 -0.0028 0 50.23 3.30E-05 K YGEPGEVFINK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5481.5481.2.dta 54 1 IPI00010740.1 "Isoform Long of Splicing factor, proline- and glutamine-rich" 195 76216 8 8 8 8 5647 3836 1 1 1 479.9177 1436.7313 3 1436.73 0.0013 1 26.88 0.0098 K YGEPGEVFINKGK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4763.4763.3.dta 54 2 IPI00304596.3 Non-POU domain-containing octamer-binding protein 161 54311 9 9 8 8 505 2939 1 0 0 373.2286 744.4427 2 744.4381 0.0045 0 30.12 0.045 R TLAEIAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3786.3786.2.dta 54 2 IPI00304596.3 Non-POU domain-containing octamer-binding protein 161 54311 9 9 8 8 528 3410 1 0 0 376.2029 750.3913 2 750.3912 0.0001 0 27.45 0.042 K TFNLEK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4302.4302.2.dta 54 2 IPI00304596.3 Non-POU domain-containing octamer-binding protein 161 54311 9 9 8 8 1259 3222 1 0 0 443.7532 885.4919 2 885.492 -0.0001 0 35.97 0.0026 R AVVIVDDR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4098.4098.2.dta 54 2 IPI00304596.3 Non-POU domain-containing octamer-binding protein 161 54311 9 9 8 8 1325 2699 1 0 1 450.7503 899.486 2 899.4865 -0.0005 0 58.94 2.60E-05 K AGEVFIHK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3507.3507.2.dta 54 2 IPI00304596.3 Non-POU domain-containing octamer-binding protein 161 54311 9 9 8 8 2606 2899 1 0 1 536.7744 1071.5342 2 1071.5349 -0.0007 0 21.72 0.022 R AAPGAEFAPNK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3742.3742.2.dta 54 2 IPI00304596.3 Non-POU domain-containing octamer-binding protein 161 54311 9 9 8 8 3874 2413 1 0 1 614.8243 1227.6341 2 1227.636 -0.0019 1 25.96 0.0037 R AAPGAEFAPNKR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3195.3195.2.dta 54 2 IPI00304596.3 Non-POU domain-containing octamer-binding protein 161 54311 9 9 8 8 3912 3343 1 0 1 616.3413 1230.6681 2 1230.6721 -0.004 0 54.34 2.70E-05 K GIVEFSGKPAAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4230.4230.2.dta 54 2 IPI00304596.3 Non-POU domain-containing octamer-binding protein 161 54311 9 9 8 8 3913 3336 1 0 1 411.2316 1230.6729 3 1230.6721 0.0008 0 34.32 0.0019 K GIVEFSGKPAAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4222.4222.3.dta 54 2 IPI00304596.3 Non-POU domain-containing octamer-binding protein 161 54311 9 9 8 8 7234 5459 1 0 1 848.3751 1694.7357 2 1694.7399 -0.0042 0 42.79 9.70E-05 R FAQPGSFEYEYAMR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6474.6474.2.dta 54 3 IPI00103525.1 paraspeckle protein 1 40 58820 3 3 3 3 505 2939 1 0 0 373.2286 744.4427 2 744.4381 0.0045 0 30.12 0.045 R TLAEIAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3786.3786.2.dta 54 3 IPI00103525.1 paraspeckle protein 1 40 58820 3 3 3 3 2770 6917 1 0 1 545.2748 1088.535 2 1088.5363 -0.0013 1 25.61 0.02 K TQQYHKER E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.792.792.2.dta 54 3 IPI00103525.1 paraspeckle protein 1 40 58820 3 3 3 3 4619 4622 1 0 1 655.8206 1309.6266 2 1309.6302 -0.0037 0 28.06 0.0028 R YGEPSEVFINR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5613.5613.2.dta 54 IPI00644848.1 Protein 142 28341 5 5 4 4 1259 3222 1 0 0 443.7532 885.4919 2 885.492 -0.0001 0 35.97 0.0026 R AVVIVDDR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4098.4098.2.dta 54 IPI00644848.1 Protein 142 28341 5 5 4 4 1325 2699 1 0 1 450.7503 899.486 2 899.4865 -0.0005 0 58.94 2.60E-05 K AGEVFIHK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3507.3507.2.dta 54 IPI00644848.1 Protein 142 28341 5 5 4 4 3912 3343 1 0 1 616.3413 1230.6681 2 1230.6721 -0.004 0 54.34 2.70E-05 K GIVEFSGKPAAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4230.4230.2.dta 54 IPI00644848.1 Protein 142 28341 5 5 4 4 3913 3336 1 0 1 411.2316 1230.6729 3 1230.6721 0.0008 0 34.32 0.0019 K GIVEFSGKPAAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4222.4222.3.dta 54 IPI00644848.1 Protein 142 28341 5 5 4 4 7234 5459 1 0 1 848.3751 1694.7357 2 1694.7399 -0.0042 0 42.79 9.70E-05 R FAQPGSFEYEYAMR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6474.6474.2.dta 54 IPI00645966.1 24 kDa protein 120 23715 6 6 5 5 505 2939 1 0 0 373.2286 744.4427 2 744.4381 0.0045 0 30.12 0.045 R TLAEIAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3786.3786.2.dta 54 IPI00645966.1 24 kDa protein 120 23715 6 6 5 5 528 3410 1 0 0 376.2029 750.3913 2 750.3912 0.0001 0 27.45 0.042 K TFNLEK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4302.4302.2.dta 54 IPI00645966.1 24 kDa protein 120 23715 6 6 5 5 1259 3222 1 0 0 443.7532 885.4919 2 885.492 -0.0001 0 35.97 0.0026 R AVVIVDDR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4098.4098.2.dta 54 IPI00645966.1 24 kDa protein 120 23715 6 6 5 5 1325 2699 1 0 1 450.7503 899.486 2 899.4865 -0.0005 0 58.94 2.60E-05 K AGEVFIHK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3507.3507.2.dta 54 IPI00645966.1 24 kDa protein 120 23715 6 6 5 5 3912 3343 1 0 1 616.3413 1230.6681 2 1230.6721 -0.004 0 54.34 2.70E-05 K GIVEFSGKPAAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4230.4230.2.dta 54 IPI00645966.1 24 kDa protein 120 23715 6 6 5 5 3913 3336 1 0 1 411.2316 1230.6729 3 1230.6721 0.0008 0 34.32 0.0019 K GIVEFSGKPAAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4222.4222.3.dta 54 IPI00645010.1 30 kDa protein 87 29660 4 4 4 4 505 2939 1 0 0 373.2286 744.4427 2 744.4381 0.0045 0 30.12 0.045 R TLAEIAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3786.3786.2.dta 54 IPI00645010.1 30 kDa protein 87 29660 4 4 4 4 528 3410 1 0 0 376.2029 750.3913 2 750.3912 0.0001 0 27.45 0.042 K TFNLEK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4302.4302.2.dta 54 IPI00645010.1 30 kDa protein 87 29660 4 4 4 4 1325 2699 1 0 1 450.7503 899.486 2 899.4865 -0.0005 0 58.94 2.60E-05 K AGEVFIHK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3507.3507.2.dta 54 IPI00645010.1 30 kDa protein 87 29660 4 4 4 4 7234 5459 1 0 1 848.3751 1694.7357 2 1694.7399 -0.0042 0 42.79 9.70E-05 R FAQPGSFEYEYAMR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6474.6474.2.dta 54 IPI00642315.1 Paraspeckle component 1 36 27371 2 2 2 2 505 2939 1 0 0 373.2286 744.4427 2 744.4381 0.0045 0 30.12 0.045 R TLAEIAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3786.3786.2.dta 54 IPI00642315.1 Paraspeckle component 1 36 27371 2 2 2 2 4619 4622 1 0 1 655.8206 1309.6266 2 1309.6302 -0.0037 0 28.06 0.0028 R YGEPSEVFINR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5613.5613.2.dta 54 IPI00646520.1 15 kDa protein 30 14519 2 2 2 2 505 2939 1 0 0 373.2286 744.4427 2 744.4381 0.0045 0 30.12 0.045 R TLAEIAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3786.3786.2.dta 54 IPI00646520.1 15 kDa protein 30 14519 2 2 2 2 528 3410 1 0 0 376.2029 750.3913 2 750.3912 0.0001 0 27.45 0.042 K TFNLEK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4302.4302.2.dta 55 1 IPI00016610.2 Poly(rC)-binding protein 1 191 37987 5 5 5 5 342 1162 1 1 1 350.709 699.4034 2 699.4028 0.0007 0 40.92 0.00086 K LNQVAR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1840.1840.2.dta 55 1 IPI00016610.2 Poly(rC)-binding protein 1 191 37987 5 5 5 5 2188 2821 1 1 1 507.77 1013.5255 2 1013.5254 0.0001 0 51.96 7.90E-05 R QGANINEIR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3652.3652.2.dta 55 1 IPI00016610.2 Poly(rC)-binding protein 1 191 37987 5 5 5 5 4429 2707 1 1 0 644.8004 1287.5863 2 1287.5877 -0.0014 0 67.36 6.30E-07 R INISEGNCPER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3516.3516.2.dta 55 1 IPI00016610.2 Poly(rC)-binding protein 1 191 37987 5 5 5 5 5254 6324 1 1 1 694.9103 1387.8061 2 1387.8075 -0.0014 0 58.35 3.40E-06 R IITLTGPTNAIFK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7332.7332.2.dta 55 1 IPI00016610.2 Poly(rC)-binding protein 1 191 37987 5 5 5 5 5674 4672 1 1 1 721.9044 1441.7943 2 1441.7963 -0.002 0 56.06 3.90E-05 R LVVPATQCGSLIGK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5667.5667.2.dta 55 2 IPI00012066.2 poly(rC)-binding protein 2 isoform b 76 38597 2 2 2 2 4429 2707 1 0 0 644.8004 1287.5863 2 1287.5877 -0.0014 0 67.36 6.30E-07 R INISEGNCPER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3516.3516.2.dta 55 2 IPI00012066.2 poly(rC)-binding protein 2 isoform b 76 38597 2 2 2 2 5559 4524 1 0 1 714.8966 1427.7787 2 1427.7806 -0.002 0 28.56 0.01 R LVVPASQCGSLIGK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5507.5507.2.dta 56 1 IPI00011654.2 Tubulin beta chain 189 50095 5 5 3 3 3170 5965 1 1 0 572.3209 1142.6273 2 1142.627 0.0003 0 67.16 1.60E-06 K LAVNMVPFPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6976.6976.2.dta 56 1 IPI00011654.2 Tubulin beta chain 189 50095 5 5 3 3 3296 5017 1 1 0 580.3174 1158.6202 2 1158.6219 -0.0017 0 58.08 9.90E-06 K LAVNMVPFPR L Oxidation (M) 0.0000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6030.6030.2.dta 56 1 IPI00011654.2 Tubulin beta chain 189 50095 5 5 3 3 6673 6145 1 1 1 808.4205 1614.8264 2 1614.8287 -0.0023 0 61.37 7.90E-06 R AILVDLEPGTMDSVR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7157.7157.2.dta 56 1 IPI00011654.2 Tubulin beta chain 189 50095 5 5 3 3 6784 5551 1 1 1 816.4177 1630.8208 2 1630.8236 -0.0028 0 59.41 3.90E-06 R AILVDLEPGTMDSVR S Oxidation (M) 0.000000000010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6565.6565.2.dta 56 1 IPI00011654.2 Tubulin beta chain 189 50095 5 5 3 3 7240 6611 1 1 0 848.9202 1695.8258 2 1695.8257 0.0001 0 21.54 0.0095 K NSSYFVEWIPNNVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7616.7616.2.dta 56 2 IPI00007752.1 Tubulin beta-2C chain 148 50255 5 5 4 4 3170 5965 1 0 0 572.3209 1142.6273 2 1142.627 0.0003 0 67.16 1.60E-06 K LAVNMVPFPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6976.6976.2.dta 56 2 IPI00007752.1 Tubulin beta-2C chain 148 50255 5 5 4 4 3296 5017 1 0 0 580.3174 1158.6202 2 1158.6219 -0.0017 0 58.08 9.90E-06 K LAVNMVPFPR L Oxidation (M) 0.0000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6030.6030.2.dta 56 2 IPI00007752.1 Tubulin beta-2C chain 148 50255 5 5 4 4 4756 3677 1 0 1 664.8277 1327.6408 2 1327.6408 0 0 33.99 0.00065 R INVYYNEATGGK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4590.4590.2.dta 56 2 IPI00007752.1 Tubulin beta-2C chain 148 50255 5 5 4 4 6628 5835 1 0 1 801.4117 1600.8089 2 1600.8131 -0.0041 0 45.61 0.00057 R AVLVDLEPGTMDSVR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6846.6846.2.dta 56 2 IPI00007752.1 Tubulin beta-2C chain 148 50255 5 5 4 4 7240 6611 1 0 0 848.9202 1695.8258 2 1695.8257 0.0001 0 21.54 0.0095 K NSSYFVEWIPNNVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7616.7616.2.dta 56 IPI00023598.2 Tubulin beta-4 chain 130 50010 4 4 3 3 3170 5965 1 0 0 572.3209 1142.6273 2 1142.627 0.0003 0 67.16 1.60E-06 K LAVNMVPFPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6976.6976.2.dta 56 IPI00023598.2 Tubulin beta-4 chain 130 50010 4 4 3 3 3296 5017 1 0 0 580.3174 1158.6202 2 1158.6219 -0.0017 0 58.08 9.90E-06 K LAVNMVPFPR L Oxidation (M) 0.0000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6030.6030.2.dta 56 IPI00023598.2 Tubulin beta-4 chain 130 50010 4 4 3 3 6628 5835 1 0 1 801.4117 1600.8089 2 1600.8131 -0.0041 0 45.61 0.00057 R AVLVDLEPGTMDSVR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6846.6846.2.dta 56 IPI00023598.2 Tubulin beta-4 chain 130 50010 4 4 3 3 7240 6611 1 0 0 848.9202 1695.8258 2 1695.8257 0.0001 0 21.54 0.0095 K NSSYFVEWIPNNVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7616.7616.2.dta 56 IPI00018511.1 Tubulin beta-4q chain 125 48917 3 3 2 2 3170 5965 1 0 0 572.3209 1142.6273 2 1142.627 0.0003 0 67.16 1.60E-06 K LAVNMVPFPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6976.6976.2.dta 56 IPI00018511.1 Tubulin beta-4q chain 125 48917 3 3 2 2 3296 5017 1 0 0 580.3174 1158.6202 2 1158.6219 -0.0017 0 58.08 9.90E-06 K LAVNMVPFPR L Oxidation (M) 0.0000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6030.6030.2.dta 56 IPI00018511.1 Tubulin beta-4q chain 125 48917 3 3 2 2 6628 5835 1 0 1 801.4117 1600.8089 2 1600.8131 -0.0041 0 45.61 0.00057 R AVLVDLEPGTMDSVR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6846.6846.2.dta 56 IPI00640115.1 TUBB3 protein 109 42804 3 3 2 2 3170 5965 1 0 0 572.3209 1142.6273 2 1142.627 0.0003 0 67.16 1.60E-06 K LAVNMVPFPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6976.6976.2.dta 56 IPI00640115.1 TUBB3 protein 109 42804 3 3 2 2 3296 5017 1 0 0 580.3174 1158.6202 2 1158.6219 -0.0017 0 58.08 9.90E-06 K LAVNMVPFPR L Oxidation (M) 0.0000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6030.6030.2.dta 56 IPI00640115.1 TUBB3 protein 109 42804 3 3 2 2 7240 6611 1 0 0 848.9202 1695.8258 2 1695.8257 0.0001 0 21.54 0.0095 K NSSYFVEWIPNNVK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7616.7616.2.dta 56 IPI00006510.1 Tubulin beta-1 chain 104 50865 2 2 1 1 3170 5965 1 0 0 572.3209 1142.6273 2 1142.627 0.0003 0 67.16 1.60E-06 K LAVNMVPFPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6976.6976.2.dta 56 IPI00006510.1 Tubulin beta-1 chain 104 50865 2 2 1 1 3296 5017 1 0 0 580.3174 1158.6202 2 1158.6219 -0.0017 0 58.08 9.90E-06 K LAVNMVPFPR L Oxidation (M) 0.0000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6030.6030.2.dta 56 IPI00398982.1 "similar to tubulin, beta 5" 22 12210 1 1 1 1 7240 6611 1 0 0 848.9202 1695.8258 2 1695.8257 0.0001 0 21.54 0.0095 K NSSYFVEWIPNNVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7616.7616.2.dta 57 1 IPI00054042.1 Isoform 1 of General transcription factor II-I 189 112859 9 9 9 9 757 2493 1 1 1 400.2433 798.4721 2 798.4712 0.0009 0 35.16 0.0027 K IIQVGNR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3283.3283.2.dta 57 1 IPI00054042.1 Isoform 1 of General transcription factor II-I 189 112859 9 9 9 9 2277 3579 1 1 1 513.7663 1025.518 2 1025.5182 -0.0002 1 21.81 0.025 K DFQKDFVK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4485.4485.2.dta 57 1 IPI00054042.1 Isoform 1 of General transcription factor II-I 189 112859 9 9 9 9 2352 5090 1 1 1 518.2899 1034.5653 2 1034.5648 0.0005 0 58.64 6.20E-06 R ILDSAEFIK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6106.6106.2.dta 57 1 IPI00054042.1 Isoform 1 of General transcription factor II-I 189 112859 9 9 9 9 2449 4652 1 1 1 525.2668 1048.519 2 1048.5189 0.0001 0 33.23 0.0096 K QVEELFER K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5646.5646.2.dta 57 1 IPI00054042.1 Isoform 1 of General transcription factor II-I 189 112859 9 9 9 9 2525 6216 1 1 1 530.7822 1059.5499 2 1059.5502 -0.0003 0 50.28 0.00027 R SPTWFGIPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7226.7226.2.dta 57 1 IPI00054042.1 Isoform 1 of General transcription factor II-I 189 112859 9 9 9 9 2876 4706 1 1 1 554.275 1106.5354 2 1106.5356 -0.0003 0 28.93 0.017 R EQVNDLFSR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5704.5704.2.dta 57 1 IPI00054042.1 Isoform 1 of General transcription factor II-I 189 112859 9 9 9 9 2976 3997 1 1 1 559.8077 1117.6009 2 1117.6019 -0.001 0 34.41 0.005 K STVVPVPYEK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4937.4937.2.dta 57 1 IPI00054042.1 Isoform 1 of General transcription factor II-I 189 112859 9 9 9 9 3021 3204 1 1 1 562.284 1122.5534 2 1122.5557 -0.0022 0 81.98 1.20E-07 K FAEALGSTEAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4078.4078.2.dta 57 1 IPI00054042.1 Isoform 1 of General transcription factor II-I 189 112859 9 9 9 9 3871 6072 1 1 1 614.7848 1227.555 2 1227.556 -0.001 0 21.47 0.0097 R EFSFEAWNAK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7084.7084.2.dta 57 IPI00737506.2 Similar to General transcription factor II-I 167 68761 6 6 6 6 757 2493 1 0 1 400.2433 798.4721 2 798.4712 0.0009 0 35.16 0.0027 K IIQVGNR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3283.3283.2.dta 57 IPI00737506.2 Similar to General transcription factor II-I 167 68761 6 6 6 6 2352 5090 1 0 1 518.2899 1034.5653 2 1034.5648 0.0005 0 58.64 6.20E-06 R ILDSAEFIK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6106.6106.2.dta 57 IPI00737506.2 Similar to General transcription factor II-I 167 68761 6 6 6 6 2525 6216 1 0 1 530.7822 1059.5499 2 1059.5502 -0.0003 0 50.28 0.00027 R SPTWFGIPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7226.7226.2.dta 57 IPI00737506.2 Similar to General transcription factor II-I 167 68761 6 6 6 6 2876 4706 1 0 1 554.275 1106.5354 2 1106.5356 -0.0003 0 28.93 0.017 R EQVNDLFSR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5704.5704.2.dta 57 IPI00737506.2 Similar to General transcription factor II-I 167 68761 6 6 6 6 3021 3204 1 0 1 562.284 1122.5534 2 1122.5557 -0.0022 0 81.98 1.20E-07 K FAEALGSTEAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4078.4078.2.dta 57 IPI00737506.2 Similar to General transcription factor II-I 167 68761 6 6 6 6 3871 6072 1 0 1 614.7848 1227.555 2 1227.556 -0.001 0 21.47 0.0097 R EFSFEAWNAK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7084.7084.2.dta 57 IPI00737306.2 Similar to General transcription factor II-I 66 16564 2 2 2 2 2352 5090 1 0 1 518.2899 1034.5653 2 1034.5648 0.0005 0 58.64 6.20E-06 R ILDSAEFIK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6106.6106.2.dta 57 IPI00737306.2 Similar to General transcription factor II-I 66 16564 2 2 2 2 2876 4706 1 0 1 554.275 1106.5354 2 1106.5356 -0.0003 0 28.93 0.017 R EQVNDLFSR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5704.5704.2.dta 57 IPI00398199.2 GTF2I repeat domain containing 2B 29 108533 1 1 1 1 2876 4706 1 0 1 554.275 1106.5354 2 1106.5356 -0.0003 0 28.93 0.017 R EQVNDLFSR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5704.5704.2.dta 58 1 IPI00641384.2 hypothetical protein LOC9919 189 253334 9 9 8 8 2144 5788 1 1 1 337.1653 1008.4742 3 1008.4737 0.0005 0 39.67 0.0017 R SVHSEHSAR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.680.680.3.dta 58 1 IPI00641384.2 hypothetical protein LOC9919 189 253334 9 9 8 8 2590 1919 1 1 1 535.7648 1069.515 2 1069.5152 -0.0002 0 33.01 0.0008 K DAQGQPGLER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2660.2660.2.dta 58 1 IPI00641384.2 hypothetical protein LOC9919 189 253334 9 9 8 8 2922 1303 1 1 1 557.2853 1112.5561 2 1112.5574 -0.0013 0 41.18 0.00018 R NPSSAAPVQSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1993.1993.2.dta 58 1 IPI00641384.2 hypothetical protein LOC9919 189 253334 9 9 8 8 3348 1213 1 1 1 389.2076 1164.6008 3 1164.5999 0.0009 0 34.27 0.0019 R SLHSAHSLASR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1895.1895.3.dta 58 1 IPI00641384.2 hypothetical protein LOC9919 189 253334 9 9 8 8 3814 2598 1 1 1 610.3185 1218.6225 2 1218.6244 -0.0019 0 46.12 0.00037 R GLANPEPAPEPK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3398.3398.2.dta 58 1 IPI00641384.2 hypothetical protein LOC9919 189 253334 9 9 8 8 4569 2950 1 1 1 652.3488 1302.6831 2 1302.6779 0.0052 0 34.84 0.00054 R QALQSTPLGSSSK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3797.3797.2.dta 58 1 IPI00641384.2 hypothetical protein LOC9919 189 253334 9 9 8 8 7425 4069 1 1 1 581.96 1742.8581 3 1742.8588 -0.0007 1 24 0.0056 K DDTHKVDVINFAQNK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5015.5015.3.dta 58 1 IPI00641384.2 hypothetical protein LOC9919 189 253334 9 9 8 8 7834 5349 1 1 1 951.0263 1900.0381 2 1900.0418 -0.0037 0 41.76 0.00012 R LLPSAPQTLPDGPLASPAR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6365.6365.2.dta 58 1 IPI00641384.2 hypothetical protein LOC9919 189 253334 9 9 8 8 7835 5365 1 1 1 634.354 1900.0402 3 1900.0418 -0.0016 0 34.57 0.00057 R LLPSAPQTLPDGPLASPAR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6380.6380.3.dta 58 IPI00166487.3 Isoform 3 of Uncharacterized protein KIAA0310 169 232534 8 8 7 7 2144 5788 1 0 1 337.1653 1008.4742 3 1008.4737 0.0005 0 39.67 0.0017 R SVHSEHSAR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.680.680.3.dta 58 IPI00166487.3 Isoform 3 of Uncharacterized protein KIAA0310 169 232534 8 8 7 7 2590 1919 1 0 1 535.7648 1069.515 2 1069.5152 -0.0002 0 33.01 0.0008 K DAQGQPGLER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2660.2660.2.dta 58 IPI00166487.3 Isoform 3 of Uncharacterized protein KIAA0310 169 232534 8 8 7 7 2922 1303 1 0 1 557.2853 1112.5561 2 1112.5574 -0.0013 0 41.18 0.00018 R NPSSAAPVQSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1993.1993.2.dta 58 IPI00166487.3 Isoform 3 of Uncharacterized protein KIAA0310 169 232534 8 8 7 7 3348 1213 1 0 1 389.2076 1164.6008 3 1164.5999 0.0009 0 34.27 0.0019 R SLHSAHSLASR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1895.1895.3.dta 58 IPI00166487.3 Isoform 3 of Uncharacterized protein KIAA0310 169 232534 8 8 7 7 3814 2598 1 0 1 610.3185 1218.6225 2 1218.6244 -0.0019 0 46.12 0.00037 R GLANPEPAPEPK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3398.3398.2.dta 58 IPI00166487.3 Isoform 3 of Uncharacterized protein KIAA0310 169 232534 8 8 7 7 7425 4069 1 0 1 581.96 1742.8581 3 1742.8588 -0.0007 1 24 0.0056 K DDTHKVDVINFAQNK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5015.5015.3.dta 58 IPI00166487.3 Isoform 3 of Uncharacterized protein KIAA0310 169 232534 8 8 7 7 7834 5349 1 0 1 951.0263 1900.0381 2 1900.0418 -0.0037 0 41.76 0.00012 R LLPSAPQTLPDGPLASPAR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6365.6365.2.dta 58 IPI00166487.3 Isoform 3 of Uncharacterized protein KIAA0310 169 232534 8 8 7 7 7835 5365 1 0 1 634.354 1900.0402 3 1900.0418 -0.0016 0 34.57 0.00057 R LLPSAPQTLPDGPLASPAR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6380.6380.3.dta 58 IPI00647549.3 KIAA0310 protein (Fragment) 86 56651 3 3 2 2 3814 2598 1 0 1 610.3185 1218.6225 2 1218.6244 -0.0019 0 46.12 0.00037 R GLANPEPAPEPK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3398.3398.2.dta 58 IPI00647549.3 KIAA0310 protein (Fragment) 86 56651 3 3 2 2 7834 5349 1 0 1 951.0263 1900.0381 2 1900.0418 -0.0037 0 41.76 0.00012 R LLPSAPQTLPDGPLASPAR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6365.6365.2.dta 58 IPI00647549.3 KIAA0310 protein (Fragment) 86 56651 3 3 2 2 7835 5365 1 0 1 634.354 1900.0402 3 1900.0418 -0.0016 0 34.57 0.00057 R LLPSAPQTLPDGPLASPAR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6380.6380.3.dta 58 IPI00031242.7 KIAA0310 75 54299 3 3 3 3 2144 5788 1 0 1 337.1653 1008.4742 3 1008.4737 0.0005 0 39.67 0.0017 R SVHSEHSAR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.680.680.3.dta 58 IPI00031242.7 KIAA0310 75 54299 3 3 3 3 3348 1213 1 0 1 389.2076 1164.6008 3 1164.5999 0.0009 0 34.27 0.0019 R SLHSAHSLASR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1895.1895.3.dta 58 IPI00031242.7 KIAA0310 75 54299 3 3 3 3 3814 2598 1 0 1 610.3185 1218.6225 2 1218.6244 -0.0019 0 46.12 0.00037 R GLANPEPAPEPK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3398.3398.2.dta 58 IPI00167711.3 "CDNA FLJ37437 fis, clone BRAWH2003025" 46 41303 1 1 1 1 3814 2598 1 0 1 610.3185 1218.6225 2 1218.6244 -0.0019 0 46.12 0.00037 R GLANPEPAPEPK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3398.3398.2.dta 59 1 IPI00332936.1 Isoform 2 of Zinc finger CCCH type antiviral protein 1 188 79336 3 3 3 3 5362 4671 1 1 1 701.3452 1400.6758 2 1400.6783 -0.0026 0 49.86 0.00015 R ASLEDAPVDDLTR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5666.5666.2.dta 59 1 IPI00332936.1 Isoform 2 of Zinc finger CCCH type antiviral protein 1 188 79336 3 3 3 3 5713 1686 1 1 1 725.3495 1448.6845 2 1448.6856 -0.001 0 117.04 1.40E-11 K ATDLGGTSQAGTSQR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2408.2408.2.dta 59 1 IPI00332936.1 Isoform 2 of Zinc finger CCCH type antiviral protein 1 188 79336 3 3 3 3 6301 4227 1 1 1 773.9058 1545.797 2 1545.7998 -0.0029 0 65.59 2.60E-06 R SSLGSLQTPEAVTTR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5186.5186.2.dta 60 1 IPI00171903.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein M 188 77749 9 9 9 9 408 1326 1 1 1 359.1981 716.3816 2 716.3817 -0.0001 0 43.24 0.0017 R IGSGVER M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2018.2018.2.dta 60 1 IPI00171903.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein M 188 77749 9 9 9 9 497 2341 1 1 1 373.1872 744.3598 2 744.3589 0.001 0 28.24 0.01 R MGPGIDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3117.3117.2.dta 60 1 IPI00171903.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein M 188 77749 9 9 9 9 713 1899 1 1 1 395.6978 789.3811 2 789.3803 0.0008 0 42 0.0014 R LGGAGMER M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2638.2638.2.dta 60 1 IPI00171903.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein M 188 77749 9 9 9 9 2936 5097 1 1 1 557.8261 1113.6377 2 1113.6393 -0.0017 0 55.26 3.70E-05 R INEILSNALK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6113.6113.2.dta 60 1 IPI00171903.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein M 188 77749 9 9 9 9 4233 6537 1 1 1 632.85 1263.6855 2 1263.6863 -0.0008 0 33.18 0.0066 R AFITNIPFDVK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7544.7544.2.dta 60 1 IPI00171903.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein M 188 77749 9 9 9 9 4373 2740 1 1 1 642.818 1283.6214 2 1283.6219 -0.0004 0 82.53 1.90E-08 K QGGGGGGGSVPGIER M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3553.3553.2.dta 60 1 IPI00171903.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein M 188 77749 9 9 9 9 5538 5740 1 1 1 713.8896 1425.7646 2 1425.7504 0.0142 0 25.81 0.032 R LGSTVFVANLDYK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6752.6752.2.dta 60 1 IPI00171903.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein M 188 77749 9 9 9 9 5543 4938 1 1 1 714.3584 1426.7022 2 1426.7061 -0.0038 0 32.36 0.0096 R MGPAMGPALGAGIER M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5950.5950.2.dta 60 1 IPI00171903.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein M 188 77749 9 9 9 9 6987 3851 1 1 1 555.2756 1662.8051 3 1662.8036 0.0015 1 24.74 0.0048 K GCGVVKFESPEVAER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4779.4779.3.dta 61 1 IPI00027834.3 heterogeneous nuclear ribonucleoprotein L isoform a 186 64720 8 8 8 8 79 3855 1 1 0 310.6925 619.3704 2 619.3693 0.0011 0 26.57 0.021 R LNVFK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4783.4783.2.dta 61 1 IPI00027834.3 heterogeneous nuclear ribonucleoprotein L isoform a 186 64720 8 8 8 8 1404 976 1 1 1 455.2429 908.4712 2 908.4716 -0.0004 1 33.64 0.0022 K VFSGKSER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1638.1638.2.dta 61 1 IPI00027834.3 heterogeneous nuclear ribonucleoprotein L isoform a 186 64720 8 8 8 8 1893 2246 1 1 1 489.7478 977.481 2 977.4818 -0.0008 0 22.72 0.025 R FSTPEQAAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3014.3014.2.dta 61 1 IPI00027834.3 heterogeneous nuclear ribonucleoprotein L isoform a 186 64720 8 8 8 8 2092 1428 1 1 1 501.718 1001.4214 2 1001.4203 0.0011 0 45.7 8.20E-05 R YYGGGSEGGR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2128.2128.2.dta 61 1 IPI00027834.3 heterogeneous nuclear ribonucleoprotein L isoform a 186 64720 8 8 8 8 2994 3366 1 1 1 561.2551 1120.4956 2 1120.4971 -0.0016 0 39.71 0.00019 K LCFSTAQHAS - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4255.4255.2.dta 61 1 IPI00027834.3 heterogeneous nuclear ribonucleoprotein L isoform a 186 64720 8 8 8 8 3702 1066 1 1 1 602.7812 1203.5478 2 1203.548 -0.0002 0 24.32 0.0084 K ISRPGDSDDSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1736.1736.2.dta 61 1 IPI00027834.3 heterogeneous nuclear ribonucleoprotein L isoform a 186 64720 8 8 8 8 3833 5238 1 1 1 611.8008 1221.587 2 1221.5877 -0.0007 0 72.3 1.20E-06 R SSSGLLEWESK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6256.6256.2.dta 61 1 IPI00027834.3 heterogeneous nuclear ribonucleoprotein L isoform a 186 64720 8 8 8 8 4505 1354 1 1 1 649.8103 1297.6061 2 1297.6051 0.001 1 58.02 1.00E-05 R YYGGGSEGGRAPK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2048.2048.2.dta 61 IPI00465225.1 heterogeneous nuclear ribonucleoprotein L isoform b 121 51156 6 6 6 6 79 3855 1 0 0 310.6925 619.3704 2 619.3693 0.0011 0 26.57 0.021 R LNVFK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4783.4783.2.dta 61 IPI00465225.1 heterogeneous nuclear ribonucleoprotein L isoform b 121 51156 6 6 6 6 1404 976 1 0 1 455.2429 908.4712 2 908.4716 -0.0004 1 33.64 0.0022 K VFSGKSER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1638.1638.2.dta 61 IPI00465225.1 heterogeneous nuclear ribonucleoprotein L isoform b 121 51156 6 6 6 6 1893 2246 1 0 1 489.7478 977.481 2 977.4818 -0.0008 0 22.72 0.025 R FSTPEQAAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3014.3014.2.dta 61 IPI00465225.1 heterogeneous nuclear ribonucleoprotein L isoform b 121 51156 6 6 6 6 2994 3366 1 0 1 561.2551 1120.4956 2 1120.4971 -0.0016 0 39.71 0.00019 K LCFSTAQHAS - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4255.4255.2.dta 61 IPI00465225.1 heterogeneous nuclear ribonucleoprotein L isoform b 121 51156 6 6 6 6 3702 1066 1 0 1 602.7812 1203.5478 2 1203.548 -0.0002 0 24.32 0.0084 K ISRPGDSDDSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1736.1736.2.dta 61 IPI00465225.1 heterogeneous nuclear ribonucleoprotein L isoform b 121 51156 6 6 6 6 3833 5238 1 0 1 611.8008 1221.587 2 1221.5877 -0.0007 0 72.3 1.20E-06 R SSSGLLEWESK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6256.6256.2.dta 61 IPI00647473.1 19 kDa protein 85 19045 3 3 3 3 1404 976 1 0 1 455.2429 908.4712 2 908.4716 -0.0004 1 33.64 0.0022 K VFSGKSER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1638.1638.2.dta 61 IPI00647473.1 19 kDa protein 85 19045 3 3 3 3 1893 2246 1 0 1 489.7478 977.481 2 977.4818 -0.0008 0 22.72 0.025 R FSTPEQAAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3014.3014.2.dta 61 IPI00647473.1 19 kDa protein 85 19045 3 3 3 3 3833 5238 1 0 1 611.8008 1221.587 2 1221.5877 -0.0007 0 72.3 1.20E-06 R SSSGLLEWESK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6256.6256.2.dta 62 1 IPI00220365.5 EIF4G1 variant protein (Fragment) 185 178843 10 10 10 10 836 3314 1 1 1 408.2126 814.4107 2 814.4086 0.0022 0 23.68 0.016 R GSNWVPR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4198.4198.2.dta 62 1 IPI00220365.5 EIF4G1 variant protein (Fragment) 185 178843 10 10 10 10 1090 5988 2 1 1 427.2446 852.4746 2 852.4745 0.0001 0 35.32 0.0043 K FIGELFK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7000.7000.2.dta 62 1 IPI00220365.5 EIF4G1 variant protein (Fragment) 185 178843 10 10 10 10 1570 2581 1 1 1 467.7585 933.5025 2 933.5032 -0.0007 0 35.3 0.004 R GGPPGPPISR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3379.3379.2.dta 62 1 IPI00220365.5 EIF4G1 variant protein (Fragment) 185 178843 10 10 10 10 1969 1008 1 1 1 494.7621 987.5097 2 987.5098 -0.0001 0 37.5 0.0036 K GSRPIDTSR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1673.1673.2.dta 62 1 IPI00220365.5 EIF4G1 variant protein (Fragment) 185 178843 10 10 10 10 2282 1887 1 1 1 514.2615 1026.5085 2 1026.5094 -0.0009 0 33.48 0.0066 R HGVESTLER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2625.2625.2.dta 62 1 IPI00220365.5 EIF4G1 variant protein (Fragment) 185 178843 10 10 10 10 2339 7125 1 1 1 517.3 1032.5854 2 1032.5855 -0.0001 0 39.81 0.0013 K GVIDLIFEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8125.8125.2.dta 62 1 IPI00220365.5 EIF4G1 variant protein (Fragment) 185 178843 10 10 10 10 3454 7076 1 1 1 589.3085 1176.6024 2 1176.6026 -0.0003 0 41.08 0.00014 K EAVGDLLDAFK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8076.8076.2.dta 62 1 IPI00220365.5 EIF4G1 variant protein (Fragment) 185 178843 10 10 10 10 7504 6413 1 1 1 884.467 1766.9194 2 1766.9203 -0.0009 0 50.75 1.70E-05 R GLPLVDDGGWNTVPISK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7420.7420.2.dta 62 1 IPI00220365.5 EIF4G1 variant protein (Fragment) 185 178843 10 10 10 10 7938 3734 1 1 1 640.657 1918.9493 3 1918.9497 -0.0004 1 45.78 0.00013 R FSALQQAVPTESTDNRR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4652.4652.3.dta 62 1 IPI00220365.5 EIF4G1 variant protein (Fragment) 185 178843 10 10 10 10 8022 4136 1 1 1 658.0118 1971.0137 3 1971.0174 -0.0037 0 25.72 0.0046 K ITKPGSIDSNNQLFAPGGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5088.5088.3.dta 62 IPI00791833.1 24 kDa protein 111 24098 5 5 5 5 836 3314 1 0 1 408.2126 814.4107 2 814.4086 0.0022 0 23.68 0.016 R GSNWVPR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4198.4198.2.dta 62 IPI00791833.1 24 kDa protein 111 24098 5 5 5 5 1570 2581 1 0 1 467.7585 933.5025 2 933.5032 -0.0007 0 35.3 0.004 R GGPPGPPISR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3379.3379.2.dta 62 IPI00791833.1 24 kDa protein 111 24098 5 5 5 5 1969 1008 1 0 1 494.7621 987.5097 2 987.5098 -0.0001 0 37.5 0.0036 K GSRPIDTSR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1673.1673.2.dta 62 IPI00791833.1 24 kDa protein 111 24098 5 5 5 5 7504 6413 1 0 1 884.467 1766.9194 2 1766.9203 -0.0009 0 50.75 1.70E-05 R GLPLVDDGGWNTVPISK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7420.7420.2.dta 62 IPI00791833.1 24 kDa protein 111 24098 5 5 5 5 7938 3734 1 0 1 640.657 1918.9493 3 1918.9497 -0.0004 1 45.78 0.00013 R FSALQQAVPTESTDNRR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4652.4652.3.dta 62 IPI00442069.1 Isoform 2 of Eukaryotic translation initiation factor 4 gamma 1 33 50243 1 1 1 1 2282 1887 1 0 1 514.2615 1026.5085 2 1026.5094 -0.0009 0 33.48 0.0066 R HGVESTLER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2625.2625.2.dta 63 1 IPI00013881.6 Heterogeneous nuclear ribonucleoprotein H 180 49484 5 5 5 5 2066 7211 1 1 1 500.243 998.4714 2 998.4716 -0.0002 1 17.34 0.024 K DKANMQHR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.821.821.2.dta 63 1 IPI00013881.6 Heterogeneous nuclear ribonucleoprotein H 180 49484 5 5 5 5 2788 3407 1 1 1 364.8646 1091.572 3 1091.5724 -0.0004 0 19.62 0.014 R VHIEIGPDGR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4299.4299.3.dta 63 1 IPI00013881.6 Heterogeneous nuclear ribonucleoprotein H 180 49484 5 5 5 5 6073 4810 1 1 1 752.8452 1503.6758 2 1503.6776 -0.0019 0 69.93 3.90E-07 R GLPWSCSADEVQR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5815.5815.2.dta 63 1 IPI00013881.6 Heterogeneous nuclear ribonucleoprotein H 180 49484 5 5 5 5 7133 2719 1 1 1 562.2603 1683.7591 3 1683.7601 -0.001 0 66.06 1.30E-06 K HTGPNSPDTANDGFVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3529.3529.3.dta 63 1 IPI00013881.6 Heterogeneous nuclear ribonucleoprotein H 180 49484 5 5 5 5 7699 6446 1 1 1 921.4483 1840.8821 2 1840.8843 -0.0022 0 73.88 1.50E-07 R STGEAFVQFASQEIAEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7453.7453.2.dta 63 IPI00026230.1 Heterogeneous nuclear ribonucleoprotein H~ 127 49517 4 4 4 4 2066 7211 1 0 1 500.243 998.4714 2 998.4716 -0.0002 1 17.34 0.024 K DKANMQHR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.821.821.2.dta 63 IPI00026230.1 Heterogeneous nuclear ribonucleoprotein H~ 127 49517 4 4 4 4 2788 3407 1 0 1 364.8646 1091.572 3 1091.5724 -0.0004 0 19.62 0.014 R VHIEIGPDGR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4299.4299.3.dta 63 IPI00026230.1 Heterogeneous nuclear ribonucleoprotein H~ 127 49517 4 4 4 4 7133 2719 1 0 1 562.2603 1683.7591 3 1683.7601 -0.001 0 66.06 1.30E-06 K HTGPNSPDTANDGFVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3529.3529.3.dta 63 IPI00026230.1 Heterogeneous nuclear ribonucleoprotein H~ 127 49517 4 4 4 4 7699 6446 1 0 1 921.4483 1840.8821 2 1840.8843 -0.0022 0 73.88 1.50E-07 R STGEAFVQFASQEIAEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7453.7453.2.dta 63 IPI00003881.5 Heterogeneous nuclear ribonucleoprotein F 25 45985 2 2 2 2 747 4643 1 0 1 399.7235 797.4324 2 797.4323 0.0001 0 23.86 0.046 R YIEVFK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5636.5636.2.dta 63 IPI00003881.5 Heterogeneous nuclear ribonucleoprotein F 25 45985 2 2 2 2 2788 3407 1 0 1 364.8646 1091.572 3 1091.5724 -0.0004 0 19.62 0.014 R VHIEIGPDGR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4299.4299.3.dta 64 1 IPI00290770.3 "chaperonin containing TCP1, subunit 3 isoform b" 179 60994 5 5 5 5 2085 1264 1 1 1 501.272 1000.5295 2 1000.5301 -0.0007 0 22.68 0.045 K VQSGNINAAK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1950.1950.2.dta 64 1 IPI00290770.3 "chaperonin containing TCP1, subunit 3 isoform b" 179 60994 5 5 5 5 3358 5127 1 1 1 583.8477 1165.6809 2 1165.6819 -0.001 0 63.7 1.50E-06 R AVAQALEVIPR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6143.6143.2.dta 64 1 IPI00290770.3 "chaperonin containing TCP1, subunit 3 isoform b" 179 60994 5 5 5 5 3503 6538 1 1 1 593.363 1184.7114 2 1184.7129 -0.0015 0 80.59 3.80E-08 K TAVETAVLLLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7545.7545.2.dta 64 1 IPI00290770.3 "chaperonin containing TCP1, subunit 3 isoform b" 179 60994 5 5 5 5 4128 6861 1 1 1 627.8575 1253.7004 2 1253.702 -0.0015 0 22.47 0.027 K ELGIWEPLAVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7863.7863.2.dta 64 1 IPI00290770.3 "chaperonin containing TCP1, subunit 3 isoform b" 179 60994 5 5 5 5 4802 3479 1 1 1 667.3466 1332.6787 2 1332.682 -0.0033 0 66.73 1.10E-06 R TLIQNCGASTIR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4377.4377.2.dta 64 IPI00513703.1 "Chaperonin containing TCP1, subunit 3" 23 17700 1 1 1 1 2085 1264 1 0 1 501.272 1000.5295 2 1000.5301 -0.0007 0 22.68 0.045 K VQSGNINAAK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1950.1950.2.dta 65 1 IPI00218753.1 Isoform 3 of DNA topoisomerase 2-alpha 176 179398 9 9 9 9 108 2377 1 1 0 314.7108 627.4071 2 627.4068 0.0003 0 34.58 0.0049 K VLIQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3156.3156.2.dta 65 1 IPI00218753.1 Isoform 3 of DNA topoisomerase 2-alpha 176 179398 9 9 9 9 1412 2800 1 1 1 455.7356 909.4566 2 909.4556 0.001 0 47.34 0.00011 K FTVETASR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3628.3628.2.dta 65 1 IPI00218753.1 Isoform 3 of DNA topoisomerase 2-alpha 176 179398 9 9 9 9 2702 2015 1 1 1 541.2853 1080.5561 2 1080.5564 -0.0002 1 22.61 0.0076 R RAYDIAGSTK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2764.2764.2.dta 65 1 IPI00218753.1 Isoform 3 of DNA topoisomerase 2-alpha 176 179398 9 9 9 9 3032 203 1 1 1 562.7936 1123.5726 2 1123.5734 -0.0008 1 24.78 0.0047 R LHGGKDSASPR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1034.1034.2.dta 65 1 IPI00218753.1 Isoform 3 of DNA topoisomerase 2-alpha 176 179398 9 9 9 9 3238 5705 1 1 0 576.8171 1151.6196 2 1151.6227 -0.0031 0 17.31 0.042 R EVTFVPGLYK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6718.6718.2.dta 65 1 IPI00218753.1 Isoform 3 of DNA topoisomerase 2-alpha 176 179398 9 9 9 9 4026 3027 1 1 1 622.2835 1242.5525 2 1242.5551 -0.0026 0 45.24 0.00013 K SFGSTCQLSEK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3881.3881.2.dta 65 1 IPI00218753.1 Isoform 3 of DNA topoisomerase 2-alpha 176 179398 9 9 9 9 4820 7042 1 1 1 668.3815 1334.7484 2 1334.7486 -0.0002 0 30.91 0.0043 R FLEEFITPIVK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8042.8042.2.dta 65 1 IPI00218753.1 Isoform 3 of DNA topoisomerase 2-alpha 176 179398 9 9 9 9 5238 3589 1 1 1 694.363 1386.7115 2 1386.7143 -0.0028 0 25.56 0.004 R HVDYVADQIVTK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4496.4496.2.dta 65 1 IPI00218753.1 Isoform 3 of DNA topoisomerase 2-alpha 176 179398 9 9 9 9 5791 5995 1 1 0 731.3818 1460.7491 2 1460.7511 -0.002 0 70.83 5.10E-07 K IFDEILVNAADNK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7007.7007.2.dta 65 2 IPI00027280.2 Isoform Beta-2 of DNA topoisomerase 2-beta 101 184122 5 5 5 5 344 4464 2 0 1 350.7345 699.4544 2 699.4531 0.0014 0 19.66 0.036 K LIEVVK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5443.5443.2.dta 65 2 IPI00027280.2 Isoform Beta-2 of DNA topoisomerase 2-beta 101 184122 5 5 5 5 2527 8278 1 0 1 530.7849 1059.5553 2 1059.556 -0.0008 0 29.88 0.0035 K TPTSSGKPSAK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.960.960.2.dta 65 2 IPI00027280.2 Isoform Beta-2 of DNA topoisomerase 2-beta 101 184122 5 5 5 5 2947 7296 1 0 1 558.3154 1114.6163 2 1114.6169 -0.0005 0 35.69 0.0011 K DLIQMLVQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8294.8294.2.dta 65 2 IPI00027280.2 Isoform Beta-2 of DNA topoisomerase 2-beta 101 184122 5 5 5 5 3238 5705 1 0 0 576.8171 1151.6196 2 1151.6227 -0.0031 0 17.31 0.042 R EVTFVPGLYK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6718.6718.2.dta 65 2 IPI00027280.2 Isoform Beta-2 of DNA topoisomerase 2-beta 101 184122 5 5 5 5 5791 5995 1 0 0 731.3818 1460.7491 2 1460.7511 -0.002 0 70.83 5.10E-07 K IFDEILVNAADNK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7007.7007.2.dta 65 IPI00178667.4 183 kDa protein 150 184260 8 8 8 8 108 2377 1 0 0 314.7108 627.4071 2 627.4068 0.0003 0 34.58 0.0049 K VLIQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3156.3156.2.dta 65 IPI00178667.4 183 kDa protein 150 184260 8 8 8 8 1412 2800 1 0 1 455.7356 909.4566 2 909.4556 0.001 0 47.34 0.00011 K FTVETASR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3628.3628.2.dta 65 IPI00178667.4 183 kDa protein 150 184260 8 8 8 8 2702 2015 1 0 1 541.2853 1080.5561 2 1080.5564 -0.0002 1 22.61 0.0076 R RAYDIAGSTK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2764.2764.2.dta 65 IPI00178667.4 183 kDa protein 150 184260 8 8 8 8 3032 203 1 0 1 562.7936 1123.5726 2 1123.5734 -0.0008 1 24.78 0.0047 R LHGGKDSASPR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1034.1034.2.dta 65 IPI00178667.4 183 kDa protein 150 184260 8 8 8 8 3238 5705 1 0 0 576.8171 1151.6196 2 1151.6227 -0.0031 0 17.31 0.042 R EVTFVPGLYK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6718.6718.2.dta 65 IPI00178667.4 183 kDa protein 150 184260 8 8 8 8 4820 7042 1 0 1 668.3815 1334.7484 2 1334.7486 -0.0002 0 30.91 0.0043 R FLEEFITPIVK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8042.8042.2.dta 65 IPI00178667.4 183 kDa protein 150 184260 8 8 8 8 5238 3589 1 0 1 694.363 1386.7115 2 1386.7143 -0.0028 0 25.56 0.004 R HVDYVADQIVTK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4496.4496.2.dta 65 IPI00178667.4 183 kDa protein 150 184260 8 8 8 8 5791 5995 1 0 0 731.3818 1460.7491 2 1460.7511 -0.002 0 70.83 5.10E-07 K IFDEILVNAADNK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7007.7007.2.dta 66 1 IPI00643920.2 Transketolase 174 68519 7 7 6 6 519 3122 1 1 1 375.2007 748.3869 2 748.3868 0.0002 0 32.68 0.016 R AFDQIR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3988.3988.2.dta 66 1 IPI00643920.2 Transketolase 174 68519 7 7 6 6 542 32 1 1 1 378.1955 754.3764 2 754.3722 0.0042 0 43.52 0.00059 K LGHASDR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1006.1006.2.dta 66 1 IPI00643920.2 Transketolase 174 68519 7 7 6 6 1448 2317 1 1 1 458.7586 915.5027 2 915.5025 0.0002 0 30.73 0.0062 K AVELAANTK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3091.3091.2.dta 66 1 IPI00643920.2 Transketolase 174 68519 7 7 6 6 7805 4775 1 1 1 942.9636 1883.9126 2 1883.9153 -0.0027 0 25.16 0.0044 R SVPTSTVFYPSDGVATEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5778.5778.2.dta 66 1 IPI00643920.2 Transketolase 174 68519 7 7 6 6 8080 5439 1 1 1 674.028 2019.0622 3 2019.0636 -0.0014 0 39.41 0.0002 K ILATPPQEDAPSVDIANIR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6455.6455.3.dta 66 1 IPI00643920.2 Transketolase 174 68519 7 7 6 6 8081 5453 1 1 1 1010.5386 2019.0626 2 2019.0636 -0.001 0 83.98 1.30E-08 K ILATPPQEDAPSVDIANIR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6469.6469.2.dta 66 1 IPI00643920.2 Transketolase 174 68519 7 7 6 6 8394 4272 1 1 1 836.7415 2507.2025 3 2507.204 -0.0015 0 39.49 0.0011 R TSRPENAIIYNNNEDFQVGQAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5235.5235.3.dta 66 IPI00789310.1 37 kDa protein 85 37045 5 5 5 5 519 3122 1 0 1 375.2007 748.3869 2 748.3868 0.0002 0 32.68 0.016 R AFDQIR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3988.3988.2.dta 66 IPI00789310.1 37 kDa protein 85 37045 5 5 5 5 542 32 1 0 1 378.1955 754.3764 2 754.3722 0.0042 0 43.52 0.00059 K LGHASDR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1006.1006.2.dta 66 IPI00789310.1 37 kDa protein 85 37045 5 5 5 5 1448 2317 1 0 1 458.7586 915.5027 2 915.5025 0.0002 0 30.73 0.0062 K AVELAANTK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3091.3091.2.dta 66 IPI00789310.1 37 kDa protein 85 37045 5 5 5 5 7805 4775 1 0 1 942.9636 1883.9126 2 1883.9153 -0.0027 0 25.16 0.0044 R SVPTSTVFYPSDGVATEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5778.5778.2.dta 66 IPI00789310.1 37 kDa protein 85 37045 5 5 5 5 8394 4272 1 0 1 836.7415 2507.2025 3 2507.204 -0.0015 0 39.49 0.0011 R TSRPENAIIYNNNEDFQVGQAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5235.5235.3.dta 67 1 IPI00218342.10 "C-1-tetrahydrofolate synthase, cytoplasmic" 172 102180 4 4 4 4 1328 5049 1 1 1 450.7795 899.5445 2 899.544 0.0005 0 54.09 3.70E-05 K VLLSALER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6064.6064.2.dta 67 1 IPI00218342.10 "C-1-tetrahydrofolate synthase, cytoplasmic" 172 102180 4 4 4 4 5159 5096 1 1 1 689.8373 1377.66 2 1377.6623 -0.0023 0 57.39 3.00E-05 K TDTESELDLISR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6111.6111.2.dta 67 1 IPI00218342.10 "C-1-tetrahydrofolate synthase, cytoplasmic" 172 102180 4 4 4 4 5992 6035 1 1 1 743.8813 1485.748 2 1485.7464 0.0017 0 58.75 3.40E-06 R LDIDPETITWQR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7047.7047.2.dta 67 1 IPI00218342.10 "C-1-tetrahydrofolate synthase, cytoplasmic" 172 102180 4 4 4 4 6781 5382 1 1 1 815.9543 1629.894 2 1629.8978 -0.0038 0 61.45 1.70E-06 K YVVVTGITPTPLGEGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6397.6397.2.dta 68 1 IPI00178150.5 Isoform 1 of Chromosome-associated kinesin KIF4A 169 141390 7 7 6 6 2827 4386 1 1 1 549.8284 1097.6422 2 1097.6444 -0.0023 0 44.26 0.00037 K ILAQDVAQLK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5357.5357.2.dta 68 1 IPI00178150.5 Isoform 1 of Chromosome-associated kinesin KIF4A 169 141390 7 7 6 6 2890 5742 1 1 1 554.8146 1107.6146 2 1107.6176 -0.003 0 28.28 0.0074 K YLIGELVSSK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6754.6754.2.dta 68 1 IPI00178150.5 Isoform 1 of Chromosome-associated kinesin KIF4A 169 141390 7 7 6 6 4410 6922 1 1 1 644.3503 1286.686 2 1286.687 -0.001 0 34.25 0.00061 R WENIATILEAK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7924.7924.2.dta 68 1 IPI00178150.5 Isoform 1 of Chromosome-associated kinesin KIF4A 169 141390 7 7 6 6 4754 6146 1 1 1 664.3765 1326.7385 2 1326.7394 -0.0009 0 43.26 0.00028 K ELELEVINLQK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7158.7158.2.dta 68 1 IPI00178150.5 Isoform 1 of Chromosome-associated kinesin KIF4A 169 141390 7 7 6 6 4845 1937 1 1 1 670.3168 1338.6191 2 1338.6198 -0.0007 0 41.24 0.00024 R TVASTAMNSQSSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2679.2679.2.dta 68 1 IPI00178150.5 Isoform 1 of Chromosome-associated kinesin KIF4A 169 141390 7 7 6 6 4992 1072 1 1 1 678.3146 1354.6146 2 1354.6147 -0.0001 0 35.01 0.0026 R TVASTAMNSQSSR S Oxidation (M) 0.0000001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1742.1742.2.dta 68 1 IPI00178150.5 Isoform 1 of Chromosome-associated kinesin KIF4A 169 141390 7 7 6 6 6376 5001 1 1 1 781.3843 1560.7541 2 1560.7566 -0.0025 0 58.62 6.40E-06 R GLSEAAGQTAQMLER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6015.6015.2.dta 68 IPI00175193.4 KIF4B (Fragment) 65 136382 3 3 2 2 2890 5742 1 0 1 554.8146 1107.6146 2 1107.6176 -0.003 0 28.28 0.0074 K YLIGELVSSK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6754.6754.2.dta 68 IPI00175193.4 KIF4B (Fragment) 65 136382 3 3 2 2 4845 1937 1 0 1 670.3168 1338.6191 2 1338.6198 -0.0007 0 41.24 0.00024 R TVASTAMNSQSSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2679.2679.2.dta 68 IPI00175193.4 KIF4B (Fragment) 65 136382 3 3 2 2 4992 1072 1 0 1 678.3146 1354.6146 2 1354.6147 -0.0001 0 35.01 0.0026 R TVASTAMNSQSSR S Oxidation (M) 0.0000001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1742.1742.2.dta 69 1 IPI00384938.1 Hypothetical protein DKFZp686N02209 167 53503 10 10 3 3 929 4033 1 1 1 418.2212 834.4279 2 834.4269 0.001 0 37.8 0.0047 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4976.4976.2.dta 69 1 IPI00384938.1 Hypothetical protein DKFZp686N02209 167 53503 10 10 3 3 930 4508 1 1 1 418.2214 834.4283 2 834.4269 0.0013 0 36.63 0.0062 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5490.5490.2.dta 69 1 IPI00384938.1 Hypothetical protein DKFZp686N02209 167 53503 10 10 3 3 933 2527 1 1 1 418.7408 835.4671 2 835.4664 0.0007 1 34.91 0.0047 K GRFTISR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3321.3321.2.dta 69 1 IPI00384938.1 Hypothetical protein DKFZp686N02209 167 53503 10 10 3 3 1063 3224 1 1 1 426.2178 850.421 2 850.4218 -0.0008 0 46.02 0.00045 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4100.4100.2.dta 69 1 IPI00384938.1 Hypothetical protein DKFZp686N02209 167 53503 10 10 3 3 1064 3374 1 1 1 426.2178 850.4211 2 850.4218 -0.0007 0 32.43 0.01 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4263.4263.2.dta 69 1 IPI00384938.1 Hypothetical protein DKFZp686N02209 167 53503 10 10 3 3 1069 7140 1 1 1 426.2181 850.4216 2 850.4218 -0.0002 0 31.15 0.02 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8140.8140.2.dta 69 1 IPI00384938.1 Hypothetical protein DKFZp686N02209 167 53503 10 10 3 3 1075 3542 1 1 1 426.2182 850.4219 2 850.4218 0.0001 0 34.19 0.01 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4445.4445.2.dta 69 1 IPI00384938.1 Hypothetical protein DKFZp686N02209 167 53503 10 10 3 3 1079 3047 1 1 1 426.2185 850.4224 2 850.4218 0.0006 0 38.59 0.0037 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3904.3904.2.dta 69 1 IPI00384938.1 Hypothetical protein DKFZp686N02209 167 53503 10 10 3 3 1080 3080 1 1 1 426.2196 850.4247 2 850.4218 0.0028 0 47.92 0.00039 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3942.3942.2.dta 69 1 IPI00384938.1 Hypothetical protein DKFZp686N02209 167 53503 10 10 3 3 4261 3867 1 1 1 634.3838 1266.753 2 1266.7547 -0.0017 1 55.96 1.10E-05 K ALPAPIEKTISK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4796.4796.2.dta 69 IPI00168728.1 FLJ00385 protein (Fragment) 156 57272 9 9 2 2 929 4033 1 0 1 418.2212 834.4279 2 834.4269 0.001 0 37.8 0.0047 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4976.4976.2.dta 69 IPI00168728.1 FLJ00385 protein (Fragment) 156 57272 9 9 2 2 930 4508 1 0 1 418.2214 834.4283 2 834.4269 0.0013 0 36.63 0.0062 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5490.5490.2.dta 69 IPI00168728.1 FLJ00385 protein (Fragment) 156 57272 9 9 2 2 1063 3224 1 0 1 426.2178 850.421 2 850.4218 -0.0008 0 46.02 0.00045 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4100.4100.2.dta 69 IPI00168728.1 FLJ00385 protein (Fragment) 156 57272 9 9 2 2 1064 3374 1 0 1 426.2178 850.4211 2 850.4218 -0.0007 0 32.43 0.01 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4263.4263.2.dta 69 IPI00168728.1 FLJ00385 protein (Fragment) 156 57272 9 9 2 2 1069 7140 1 0 1 426.2181 850.4216 2 850.4218 -0.0002 0 31.15 0.02 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8140.8140.2.dta 69 IPI00168728.1 FLJ00385 protein (Fragment) 156 57272 9 9 2 2 1075 3542 1 0 1 426.2182 850.4219 2 850.4218 0.0001 0 34.19 0.01 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4445.4445.2.dta 69 IPI00168728.1 FLJ00385 protein (Fragment) 156 57272 9 9 2 2 1079 3047 1 0 1 426.2185 850.4224 2 850.4218 0.0006 0 38.59 0.0037 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3904.3904.2.dta 69 IPI00168728.1 FLJ00385 protein (Fragment) 156 57272 9 9 2 2 1080 3080 1 0 1 426.2196 850.4247 2 850.4218 0.0028 0 47.92 0.00039 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3942.3942.2.dta 69 IPI00168728.1 FLJ00385 protein (Fragment) 156 57272 9 9 2 2 4261 3867 1 0 1 634.3838 1266.753 2 1266.7547 -0.0017 1 55.96 1.10E-05 K ALPAPIEKTISK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4796.4796.2.dta 69 IPI00426051.3 Hypothetical protein DKFZp686C15213 131 51864 9 9 2 2 929 4033 1 0 1 418.2212 834.4279 2 834.4269 0.001 0 37.8 0.0047 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4976.4976.2.dta 69 IPI00426051.3 Hypothetical protein DKFZp686C15213 131 51864 9 9 2 2 930 4508 1 0 1 418.2214 834.4283 2 834.4269 0.0013 0 36.63 0.0062 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5490.5490.2.dta 69 IPI00426051.3 Hypothetical protein DKFZp686C15213 131 51864 9 9 2 2 933 2527 1 0 1 418.7408 835.4671 2 835.4664 0.0007 1 34.91 0.0047 K GRFTISR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3321.3321.2.dta 69 IPI00426051.3 Hypothetical protein DKFZp686C15213 131 51864 9 9 2 2 1063 3224 1 0 1 426.2178 850.421 2 850.4218 -0.0008 0 46.02 0.00045 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4100.4100.2.dta 69 IPI00426051.3 Hypothetical protein DKFZp686C15213 131 51864 9 9 2 2 1064 3374 1 0 1 426.2178 850.4211 2 850.4218 -0.0007 0 32.43 0.01 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4263.4263.2.dta 69 IPI00426051.3 Hypothetical protein DKFZp686C15213 131 51864 9 9 2 2 1069 7140 1 0 1 426.2181 850.4216 2 850.4218 -0.0002 0 31.15 0.02 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8140.8140.2.dta 69 IPI00426051.3 Hypothetical protein DKFZp686C15213 131 51864 9 9 2 2 1075 3542 1 0 1 426.2182 850.4219 2 850.4218 0.0001 0 34.19 0.01 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4445.4445.2.dta 69 IPI00426051.3 Hypothetical protein DKFZp686C15213 131 51864 9 9 2 2 1079 3047 1 0 1 426.2185 850.4224 2 850.4218 0.0006 0 38.59 0.0037 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3904.3904.2.dta 69 IPI00426051.3 Hypothetical protein DKFZp686C15213 131 51864 9 9 2 2 1080 3080 1 0 1 426.2196 850.4247 2 850.4218 0.0028 0 47.92 0.00039 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3942.3942.2.dta 69 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 120 46716 8 8 1 1 929 4033 1 0 1 418.2212 834.4279 2 834.4269 0.001 0 37.8 0.0047 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4976.4976.2.dta 69 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 120 46716 8 8 1 1 930 4508 1 0 1 418.2214 834.4283 2 834.4269 0.0013 0 36.63 0.0062 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5490.5490.2.dta 69 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 120 46716 8 8 1 1 1063 3224 1 0 1 426.2178 850.421 2 850.4218 -0.0008 0 46.02 0.00045 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4100.4100.2.dta 69 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 120 46716 8 8 1 1 1064 3374 1 0 1 426.2178 850.4211 2 850.4218 -0.0007 0 32.43 0.01 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4263.4263.2.dta 69 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 120 46716 8 8 1 1 1069 7140 1 0 1 426.2181 850.4216 2 850.4218 -0.0002 0 31.15 0.02 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8140.8140.2.dta 69 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 120 46716 8 8 1 1 1075 3542 1 0 1 426.2182 850.4219 2 850.4218 0.0001 0 34.19 0.01 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4445.4445.2.dta 69 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 120 46716 8 8 1 1 1079 3047 1 0 1 426.2185 850.4224 2 850.4218 0.0006 0 38.59 0.0037 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3904.3904.2.dta 69 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 120 46716 8 8 1 1 1080 3080 1 0 1 426.2196 850.4247 2 850.4218 0.0028 0 47.92 0.00039 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3942.3942.2.dta 69 IPI00748998.1 Single-chain Fv (Fragment) 51 25782 2 2 2 2 181 4074 1 0 1 325.2176 648.4207 2 648.421 -0.0003 0 36.44 0.00056 K LLIYK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5021.5021.2.dta 69 IPI00748998.1 Single-chain Fv (Fragment) 51 25782 2 2 2 2 933 2527 1 0 1 418.7408 835.4671 2 835.4664 0.0007 1 34.91 0.0047 K GRFTISR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3321.3321.2.dta 70 1 IPI00216049.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein K 166 51230 7 7 7 7 353 2990 2 1 1 351.2315 700.4485 2 700.4483 0.0002 0 26.54 0.045 R ILLQSK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3841.3841.2.dta 70 1 IPI00216049.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein K 166 51230 7 7 7 7 449 1773 1 1 1 365.2173 728.42 2 728.4181 0.0019 0 49.82 0.00018 K NAGAVIGK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2502.2502.2.dta 70 1 IPI00216049.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein K 166 51230 7 7 7 7 1205 4800 1 1 1 437.2557 872.4969 2 872.4967 0.0002 0 40.48 0.0024 K DLAGSIIGK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5804.5804.2.dta 70 1 IPI00216049.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein K 166 51230 7 7 7 7 2868 3989 1 1 1 553.7607 1105.5068 2 1105.5074 -0.0005 0 56.03 3.20E-05 R NTDEMVELR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4928.4928.2.dta 70 1 IPI00216049.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein K 166 51230 7 7 7 7 3586 4240 1 1 1 597.8531 1193.6916 2 1193.6921 -0.0004 0 15.72 0.034 R NLPLPPPPPPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5200.5200.2.dta 70 1 IPI00216049.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein K 166 51230 7 7 7 7 4855 7014 1 1 1 670.9045 1339.7944 2 1339.7962 -0.0018 0 50.3 4.60E-05 K IILDLISESPIK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8015.8015.2.dta 70 1 IPI00216049.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein K 166 51230 7 7 7 7 7538 3390 1 1 1 890.902 1779.7895 2 1779.7911 -0.0016 0 56.28 5.30E-06 R TDYNASVSVPDSSGPER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4281.4281.2.dta 70 IPI00647717.1 Heterogeneous nuclear ribonucleoprotein K 151 42009 6 6 6 6 353 2990 2 0 1 351.2315 700.4485 2 700.4483 0.0002 0 26.54 0.045 R ILLQSK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3841.3841.2.dta 70 IPI00647717.1 Heterogeneous nuclear ribonucleoprotein K 151 42009 6 6 6 6 449 1773 1 0 1 365.2173 728.42 2 728.4181 0.0019 0 49.82 0.00018 K NAGAVIGK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2502.2502.2.dta 70 IPI00647717.1 Heterogeneous nuclear ribonucleoprotein K 151 42009 6 6 6 6 2868 3989 1 0 1 553.7607 1105.5068 2 1105.5074 -0.0005 0 56.03 3.20E-05 R NTDEMVELR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4928.4928.2.dta 70 IPI00647717.1 Heterogeneous nuclear ribonucleoprotein K 151 42009 6 6 6 6 3586 4240 1 0 1 597.8531 1193.6916 2 1193.6921 -0.0004 0 15.72 0.034 R NLPLPPPPPPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5200.5200.2.dta 70 IPI00647717.1 Heterogeneous nuclear ribonucleoprotein K 151 42009 6 6 6 6 4855 7014 1 0 1 670.9045 1339.7944 2 1339.7962 -0.0018 0 50.3 4.60E-05 K IILDLISESPIK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8015.8015.2.dta 70 IPI00647717.1 Heterogeneous nuclear ribonucleoprotein K 151 42009 6 6 6 6 7538 3390 1 0 1 890.902 1779.7895 2 1779.7911 -0.0016 0 56.28 5.30E-06 R TDYNASVSVPDSSGPER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4281.4281.2.dta 70 IPI00514561.1 Heterogeneous nuclear ribonucleoprotein K 140 47756 6 6 6 6 353 2990 2 0 1 351.2315 700.4485 2 700.4483 0.0002 0 26.54 0.045 R ILLQSK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3841.3841.2.dta 70 IPI00514561.1 Heterogeneous nuclear ribonucleoprotein K 140 47756 6 6 6 6 1205 4800 1 0 1 437.2557 872.4969 2 872.4967 0.0002 0 40.48 0.0024 K DLAGSIIGK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5804.5804.2.dta 70 IPI00514561.1 Heterogeneous nuclear ribonucleoprotein K 140 47756 6 6 6 6 2868 3989 1 0 1 553.7607 1105.5068 2 1105.5074 -0.0005 0 56.03 3.20E-05 R NTDEMVELR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4928.4928.2.dta 70 IPI00514561.1 Heterogeneous nuclear ribonucleoprotein K 140 47756 6 6 6 6 3586 4240 1 0 1 597.8531 1193.6916 2 1193.6921 -0.0004 0 15.72 0.034 R NLPLPPPPPPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5200.5200.2.dta 70 IPI00514561.1 Heterogeneous nuclear ribonucleoprotein K 140 47756 6 6 6 6 4855 7014 1 0 1 670.9045 1339.7944 2 1339.7962 -0.0018 0 50.3 4.60E-05 K IILDLISESPIK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8015.8015.2.dta 70 IPI00514561.1 Heterogeneous nuclear ribonucleoprotein K 140 47756 6 6 6 6 7538 3390 1 0 1 890.902 1779.7895 2 1779.7911 -0.0016 0 56.28 5.30E-06 R TDYNASVSVPDSSGPER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4281.4281.2.dta 70 IPI00796697.1 42 kDa protein 62 42582 3 3 3 3 449 1773 1 0 1 365.2173 728.42 2 728.4181 0.0019 0 49.82 0.00018 K NAGAVIGK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2502.2502.2.dta 70 IPI00796697.1 42 kDa protein 62 42582 3 3 3 3 1205 4800 1 0 1 437.2557 872.4969 2 872.4967 0.0002 0 40.48 0.0024 K DLAGSIIGK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5804.5804.2.dta 70 IPI00796697.1 42 kDa protein 62 42582 3 3 3 3 3586 4240 1 0 1 597.8531 1193.6916 2 1193.6921 -0.0004 0 15.72 0.034 R NLPLPPPPPPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5200.5200.2.dta 70 IPI00640296.1 Heterogeneous nuclear ribonucleoprotein K 50 34354 2 2 2 2 3586 4240 1 0 1 597.8531 1193.6916 2 1193.6921 -0.0004 0 15.72 0.034 R NLPLPPPPPPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5200.5200.2.dta 70 IPI00640296.1 Heterogeneous nuclear ribonucleoprotein K 50 34354 2 2 2 2 4855 7014 1 0 1 670.9045 1339.7944 2 1339.7962 -0.0018 0 50.3 4.60E-05 K IILDLISESPIK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8015.8015.2.dta 71 1 IPI00029012.1 Eukaryotic translation initiation factor 3 subunit 10 165 166867 11 11 11 11 117 2294 1 1 0 315.6948 629.375 2 629.3748 0.0002 0 28.11 0.05 R LEQIK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3066.3066.2.dta 71 1 IPI00029012.1 Eukaryotic translation initiation factor 3 subunit 10 165 166867 11 11 11 11 686 4686 1 1 1 393.7346 785.4547 2 785.4548 -0.0001 0 26.98 0.038 K VLNWVR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5682.5682.2.dta 71 1 IPI00029012.1 Eukaryotic translation initiation factor 3 subunit 10 165 166867 11 11 11 11 921 2152 1 1 1 417.7197 833.4248 2 833.4243 0.0005 0 63.52 1.20E-05 R LGDSSLSR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2912.2912.2.dta 71 1 IPI00029012.1 Eukaryotic translation initiation factor 3 subunit 10 165 166867 11 11 11 11 1509 1793 1 1 1 464.2268 926.4391 2 926.4392 -0.0001 0 36.78 0.0022 R HCDLQVR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2523.2523.2.dta 71 1 IPI00029012.1 Eukaryotic translation initiation factor 3 subunit 10 165 166867 11 11 11 11 1684 1911 1 1 1 475.2582 948.5019 2 948.5029 -0.0009 1 22.99 0.023 K LKQFEER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2651.2651.2.dta 71 1 IPI00029012.1 Eukaryotic translation initiation factor 3 subunit 10 165 166867 11 11 11 11 1834 6723 1 1 1 485.3101 968.6057 2 968.6059 -0.0002 0 20.95 0.018 R LLLTPWVK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7728.7728.2.dta 71 1 IPI00029012.1 Eukaryotic translation initiation factor 3 subunit 10 165 166867 11 11 11 11 1835 3491 1 1 1 485.7529 969.4913 2 969.492 -0.0007 1 30.21 0.0081 K KIDYFER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4390.4390.2.dta 71 1 IPI00029012.1 Eukaryotic translation initiation factor 3 subunit 10 165 166867 11 11 11 11 1859 3743 1 1 1 486.7767 971.5389 2 971.54 -0.0011 0 40.87 0.0025 R LESLNIQR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4662.4662.2.dta 71 1 IPI00029012.1 Eukaryotic translation initiation factor 3 subunit 10 165 166867 11 11 11 11 1990 1928 1 1 1 495.7698 989.525 2 989.5254 -0.0004 1 47.67 0.00056 R RLGDSSLSR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2670.2670.2.dta 71 1 IPI00029012.1 Eukaryotic translation initiation factor 3 subunit 10 165 166867 11 11 11 11 2011 1996 1 1 1 496.8033 991.592 2 991.5927 -0.0007 1 23.25 0.014 R RVPPPALSR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2743.2743.2.dta 71 1 IPI00029012.1 Eukaryotic translation initiation factor 3 subunit 10 165 166867 11 11 11 11 4056 6159 1 1 1 623.3417 1244.6689 2 1244.6686 0.0003 0 54.11 3.70E-05 R LLDMDGIIVEK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7170.7170.2.dta 71 IPI00386403.1 EIF3S10 protein (Fragment) 84 48587 2 2 2 2 921 2152 1 0 1 417.7197 833.4248 2 833.4243 0.0005 0 63.52 1.20E-05 R LGDSSLSR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2912.2912.2.dta 71 IPI00386403.1 EIF3S10 protein (Fragment) 84 48587 2 2 2 2 1990 1928 1 0 1 495.7698 989.525 2 989.5254 -0.0004 1 47.67 0.00056 R RLGDSSLSR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2670.2670.2.dta 71 IPI00419721.1 Isoform 1 of EPM2A-interacting protein 1 23 70952 1 1 1 1 1684 1911 1 0 1 475.2582 948.5019 2 948.5029 -0.0009 1 22.99 0.023 R LQKEFER H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2651.2651.2.dta 72 1 IPI00298994.5 271 kDa protein 164 273171 8 8 7 7 21 2186 3 0 1 300.6952 599.3758 2 599.3755 0.0003 0 28 0.046 K LAQIR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2949.2949.2.dta 72 1 IPI00298994.5 271 kDa protein 164 273171 8 8 7 7 1199 2095 1 1 1 436.7511 871.4876 2 871.4875 0.0001 0 36.3 0.0027 K AVTQALNR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2851.2851.2.dta 72 1 IPI00298994.5 271 kDa protein 164 273171 8 8 7 7 3615 3444 1 1 1 599.3265 1196.6384 2 1196.6401 -0.0017 0 52.34 2.60E-05 K ALSTDPAAPNLK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4339.4339.2.dta 72 1 IPI00298994.5 271 kDa protein 164 273171 8 8 7 7 4032 2045 1 1 1 622.3347 1242.6549 2 1242.6568 -0.0019 0 40.36 0.00016 K VLVQNAAGSQEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2796.2796.2.dta 72 1 IPI00298994.5 271 kDa protein 164 273171 8 8 7 7 5755 3923 1 1 1 728.3842 1454.7538 2 1454.7551 -0.0014 0 44.29 7.00E-05 K ASAGPQPLLVQSCK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4857.4857.2.dta 72 1 IPI00298994.5 271 kDa protein 164 273171 8 8 7 7 6026 6296 1 1 1 746.9453 1491.8761 2 1491.8773 -0.0012 0 28.59 0.0037 K AVAEQIPLLVQGVR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7305.7305.2.dta 72 1 IPI00298994.5 271 kDa protein 164 273171 8 8 7 7 6027 6310 1 1 1 498.2998 1491.8776 3 1491.8773 0.0003 0 29.14 0.0033 K AVAEQIPLLVQGVR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7319.7319.3.dta 72 1 IPI00298994.5 271 kDa protein 164 273171 8 8 7 7 8165 5007 1 1 1 714.0386 2139.0941 3 2139.0994 -0.0053 0 34.89 0.00053 K VVAPTISSPVCQEQLVEAGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6020.6020.3.dta 73 1 IPI00021439.1 "Actin, cytoplasmic 1" 164 42052 7 7 6 6 161 4589 1 1 0 322.7205 643.4264 2 643.4268 -0.0004 0 21.75 0.042 R GILTLK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5577.5577.2.dta 73 1 IPI00021439.1 "Actin, cytoplasmic 1" 164 42052 7 7 6 6 3080 3573 1 1 1 566.7654 1131.5163 2 1131.5197 -0.0033 0 56.26 7.30E-06 R GYSFTTTAER E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4479.4479.2.dta 73 1 IPI00021439.1 "Actin, cytoplasmic 1" 164 42052 7 7 6 6 3313 4180 1 1 1 581.3125 1160.6104 2 1160.6111 -0.0006 0 32.52 0.002 K EITALAPSTMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5135.5135.2.dta 73 1 IPI00021439.1 "Actin, cytoplasmic 1" 164 42052 7 7 6 6 4985 1706 1 1 1 677.8146 1353.6147 2 1353.6161 -0.0013 1 33 0.0008 K DSYVGDEAQSKR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2429.2429.2.dta 73 1 IPI00021439.1 "Actin, cytoplasmic 1" 164 42052 7 7 6 6 7562 5905 1 1 0 895.9489 1789.8833 2 1789.8846 -0.0014 0 58.39 2.40E-05 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6915.6915.2.dta 73 1 IPI00021439.1 "Actin, cytoplasmic 1" 164 42052 7 7 6 6 7563 5928 1 1 0 597.6357 1789.8852 3 1789.8846 0.0006 0 26.97 0.0076 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6939.6939.3.dta 73 1 IPI00021439.1 "Actin, cytoplasmic 1" 164 42052 7 7 6 6 7994 4834 2 1 1 652.0259 1953.0558 3 1953.0571 -0.0013 0 50.89 6.10E-05 R VAPEEHPVLLTEAPLNPK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5841.5841.3.dta 73 2 IPI00003269.1 hypothetical protein LOC345651 97 42318 3 3 2 2 7562 5905 1 0 0 895.9489 1789.8833 2 1789.8846 -0.0014 0 58.39 2.40E-05 R SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6915.6915.2.dta 73 2 IPI00003269.1 hypothetical protein LOC345651 97 42318 3 3 2 2 7563 5928 1 0 0 597.6357 1789.8852 3 1789.8846 0.0006 0 26.97 0.0076 R SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6939.6939.3.dta 73 2 IPI00003269.1 hypothetical protein LOC345651 97 42318 3 3 2 2 7994 4834 1 0 1 652.0259 1953.0558 3 1953.0571 -0.0013 0 54.72 2.50E-05 R VAPDEHPILLTEAPLNPK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5841.5841.3.dta 73 IPI00794523.2 ACTG1 protein 116 28478 4 4 3 3 3080 3573 1 0 1 566.7654 1131.5163 2 1131.5197 -0.0033 0 56.26 7.30E-06 R GYSFTTTAER E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4479.4479.2.dta 73 IPI00794523.2 ACTG1 protein 116 28478 4 4 3 3 3313 4180 1 0 1 581.3125 1160.6104 2 1160.6111 -0.0006 0 32.52 0.002 K EITALAPSTMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5135.5135.2.dta 73 IPI00794523.2 ACTG1 protein 116 28478 4 4 3 3 7562 5905 1 0 0 895.9489 1789.8833 2 1789.8846 -0.0014 0 58.39 2.40E-05 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6915.6915.2.dta 73 IPI00794523.2 ACTG1 protein 116 28478 4 4 3 3 7563 5928 1 0 0 597.6357 1789.8852 3 1789.8846 0.0006 0 26.97 0.0076 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6939.6939.3.dta 73 IPI00008603.1 "Actin, aortic smooth muscle" 95 42381 5 5 4 4 161 4589 1 0 0 322.7205 643.4264 2 643.4268 -0.0004 0 21.75 0.042 R GILTLK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5577.5577.2.dta 73 IPI00008603.1 "Actin, aortic smooth muscle" 95 42381 5 5 4 4 3313 4180 1 0 1 581.3125 1160.6104 2 1160.6111 -0.0006 0 32.52 0.002 K EITALAPSTMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5135.5135.2.dta 73 IPI00008603.1 "Actin, aortic smooth muscle" 95 42381 5 5 4 4 4985 1706 1 0 1 677.8146 1353.6147 2 1353.6161 -0.0013 1 33 0.0008 K DSYVGDEAQSKR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2429.2429.2.dta 73 IPI00008603.1 "Actin, aortic smooth muscle" 95 42381 5 5 4 4 7562 5905 1 0 0 895.9489 1789.8833 2 1789.8846 -0.0014 0 58.39 2.40E-05 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6915.6915.2.dta 73 IPI00008603.1 "Actin, aortic smooth muscle" 95 42381 5 5 4 4 7563 5928 1 0 0 597.6357 1789.8852 3 1789.8846 0.0006 0 26.97 0.0076 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6939.6939.3.dta 73 IPI00816229.1 ACTA2 protein (Fragment) 78 37125 4 4 3 3 161 4589 1 0 0 322.7205 643.4264 2 643.4268 -0.0004 0 21.75 0.042 R GILTLK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5577.5577.2.dta 73 IPI00816229.1 ACTA2 protein (Fragment) 78 37125 4 4 3 3 3313 4180 1 0 1 581.3125 1160.6104 2 1160.6111 -0.0006 0 32.52 0.002 K EITALAPSTMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5135.5135.2.dta 73 IPI00816229.1 ACTA2 protein (Fragment) 78 37125 4 4 3 3 7562 5905 1 0 0 895.9489 1789.8833 2 1789.8846 -0.0014 0 58.39 2.40E-05 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6915.6915.2.dta 73 IPI00816229.1 ACTA2 protein (Fragment) 78 37125 4 4 3 3 7563 5928 1 0 0 597.6357 1789.8852 3 1789.8846 0.0006 0 26.97 0.0076 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6939.6939.3.dta 73 IPI00790339.1 22 kDa protein 68 22189 3 3 3 3 161 4589 1 0 0 322.7205 643.4264 2 643.4268 -0.0004 0 21.75 0.042 R GILTLK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5577.5577.2.dta 73 IPI00790339.1 22 kDa protein 68 22189 3 3 3 3 4985 1706 1 0 1 677.8146 1353.6147 2 1353.6161 -0.0013 1 33 0.0008 K DSYVGDEAQSKR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2429.2429.2.dta 73 IPI00790339.1 22 kDa protein 68 22189 3 3 3 3 7994 4834 2 0 1 652.0259 1953.0558 3 1953.0571 -0.0013 0 50.89 6.10E-05 R VAPEEHPVLLTEAPLNPK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5841.5841.3.dta 73 IPI00739539.2 "similar to Prostate, ovary, testis expressed protein on chromosome 2" 64 123020 3 3 2 2 161 4589 1 0 0 322.7205 643.4264 2 643.4268 -0.0004 0 21.75 0.042 R GILTLK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5577.5577.2.dta 73 IPI00739539.2 "similar to Prostate, ovary, testis expressed protein on chromosome 2" 64 123020 3 3 2 2 7562 5905 1 0 0 895.9489 1789.8833 2 1789.8846 -0.0014 0 58.39 2.40E-05 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6915.6915.2.dta 73 IPI00739539.2 "similar to Prostate, ovary, testis expressed protein on chromosome 2" 64 123020 3 3 2 2 7563 5928 1 0 0 597.6357 1789.8852 3 1789.8846 0.0006 0 26.97 0.0076 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6939.6939.3.dta 73 IPI00414057.2 Actin alpha 1 skeletal muscle protein 51 28454 3 3 3 3 161 4589 1 0 0 322.7205 643.4264 2 643.4268 -0.0004 0 21.75 0.042 R GILTLK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5577.5577.2.dta 73 IPI00414057.2 Actin alpha 1 skeletal muscle protein 51 28454 3 3 3 3 3313 4180 1 0 1 581.3125 1160.6104 2 1160.6111 -0.0006 0 32.52 0.002 K EITALAPSTMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5135.5135.2.dta 73 IPI00414057.2 Actin alpha 1 skeletal muscle protein 51 28454 3 3 3 3 4985 1706 1 0 1 677.8146 1353.6147 2 1353.6161 -0.0013 1 33 0.0008 K DSYVGDEAQSKR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2429.2429.2.dta 73 IPI00444605.1 "CDNA FLJ45296 fis, clone BRHIP3003340, moderately similar to Actin, alpha skeletal muscle 2" 33 23821 1 1 1 1 3313 4180 1 0 1 581.3125 1160.6104 2 1160.6111 -0.0006 0 32.52 0.002 K EITALAPSTMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5135.5135.2.dta 74 1 IPI00026219.4 Cleavage and polyadenylation specificity factor subunit 1 158 162036 5 5 5 5 413 5577 1 1 1 359.7468 717.479 2 717.4789 0.0001 0 14.05 0.039 R LVFLVK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6590.6590.2.dta 74 1 IPI00026219.4 Cleavage and polyadenylation specificity factor subunit 1 158 162036 5 5 5 5 770 1898 1 1 1 401.2326 800.4506 2 800.4504 0.0002 0 24.05 0.024 R TLQNAVR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2637.2637.2.dta 74 1 IPI00026219.4 Cleavage and polyadenylation specificity factor subunit 1 158 162036 5 5 5 5 2504 6032 1 1 1 528.8247 1055.6349 2 1055.6339 0.001 0 54.24 2.80E-05 K EVLLVALGSR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7044.7044.2.dta 74 1 IPI00026219.4 Cleavage and polyadenylation specificity factor subunit 1 158 162036 5 5 5 5 6114 2829 1 1 1 755.8694 1509.7243 2 1509.7246 -0.0002 0 66.86 5.40E-07 K VYAVATSTNTPCAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3662.3662.2.dta 74 1 IPI00026219.4 Cleavage and polyadenylation specificity factor subunit 1 158 162036 5 5 5 5 7568 4234 1 1 1 896.4465 1790.8785 2 1790.8799 -0.0014 0 68.91 3.70E-07 R VLVDSSFGQPTTQGEAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5194.5194.2.dta 75 1 IPI00215965.2 Isoform A1-B of Heterogeneous nuclear ribonucleoprotein A1 154 38936 4 4 3 3 442 743 1 1 0 364.2272 726.4399 2 726.4388 0.0011 1 26.81 0.022 R VVEPKR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1386.1386.2.dta 75 1 IPI00215965.2 Isoform A1-B of Heterogeneous nuclear ribonucleoprotein A1 154 38936 4 4 3 3 6768 3299 1 1 1 543.5983 1627.7732 3 1627.7743 -0.0012 0 22.53 0.025 R SSGPYGGGGQYFAKPR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4182.4182.3.dta 75 1 IPI00215965.2 Isoform A1-B of Heterogeneous nuclear ribonucleoprotein A1 154 38936 4 4 3 3 6769 3312 1 1 1 814.8961 1627.7776 2 1627.7743 0.0033 0 53.11 1.00E-05 R SSGPYGGGGQYFAKPR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4196.4196.2.dta 75 1 IPI00215965.2 Isoform A1-B of Heterogeneous nuclear ribonucleoprotein A1 154 38936 4 4 3 3 7226 1635 1 1 1 847.853 1693.6914 2 1693.6928 -0.0014 0 106.8 4.00E-11 R NQGGYGGSSSSSSYGSGR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2352.2352.2.dta 75 IPI00399037.4 similar to Heterogeneous nuclear ribonucleoprotein A1 115 30004 2 2 2 2 442 743 1 0 0 364.2272 726.4399 2 726.4388 0.0011 1 26.81 0.022 R VVEPKR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1386.1386.2.dta 75 IPI00399037.4 similar to Heterogeneous nuclear ribonucleoprotein A1 115 30004 2 2 2 2 7226 1635 1 0 1 847.853 1693.6914 2 1693.6928 -0.0014 0 106.8 4.00E-11 R NQGGYGGSSSSSSYGSGR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2352.2352.2.dta 75 IPI00478539.2 similar to Heterogeneous nuclear ribonucleoprotein A1 64 32532 3 3 2 2 442 743 1 0 0 364.2272 726.4399 2 726.4388 0.0011 1 26.81 0.022 R VVEPKR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1386.1386.2.dta 75 IPI00478539.2 similar to Heterogeneous nuclear ribonucleoprotein A1 64 32532 3 3 2 2 6768 3299 1 0 1 543.5983 1627.7732 3 1627.7743 -0.0012 0 22.53 0.025 R SSGPYGGGGQYFAKPR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4182.4182.3.dta 75 IPI00478539.2 similar to Heterogeneous nuclear ribonucleoprotein A1 64 32532 3 3 2 2 6769 3312 1 0 1 814.8961 1627.7776 2 1627.7743 0.0033 0 53.11 1.00E-05 R SSGPYGGGGQYFAKPR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4196.4196.2.dta 76 1 IPI00291175.7 Isoform 1 of Vinculin 154 117220 3 3 3 3 2975 3183 1 1 1 559.8058 1117.5971 2 1117.5979 -0.0008 0 65.73 2.30E-06 K STVEGIQASVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4055.4055.2.dta 76 1 IPI00291175.7 Isoform 1 of Vinculin 154 117220 3 3 3 3 4275 3144 1 1 1 635.3425 1268.6704 2 1268.6725 -0.0021 0 63.25 1.40E-06 K AVAGNISDPGLQK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4013.4013.2.dta 76 1 IPI00291175.7 Isoform 1 of Vinculin 154 117220 3 3 3 3 5759 4778 1 1 1 729.4005 1456.7864 2 1456.7886 -0.0022 0 61.92 1.70E-06 K AQQVSQGLDVLTAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5781.5781.2.dta 77 1 IPI00012074.3 Heterogeneous nuclear ribonucleoprotein R 153 71184 6 6 6 6 1115 4680 1 1 0 430.7654 859.5163 2 859.5167 -0.0004 0 28.88 0.011 R LFVGSIPK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5676.5676.2.dta 77 1 IPI00012074.3 Heterogeneous nuclear ribonucleoprotein R 153 71184 6 6 6 6 1511 5753 1 1 0 464.2557 926.4969 2 926.4974 -0.0005 0 53.97 6.80E-05 K AGPIWDLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6765.6765.2.dta 77 1 IPI00012074.3 Heterogeneous nuclear ribonucleoprotein R 153 71184 6 6 6 6 2884 6188 1 1 1 554.78 1107.5455 2 1107.5448 0.0007 0 26.36 0.017 K ENILEEFSK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7199.7199.2.dta 77 1 IPI00012074.3 Heterogeneous nuclear ribonucleoprotein R 153 71184 6 6 6 6 4624 3971 1 1 0 656.3298 1310.645 2 1310.6467 -0.0017 0 51.54 1.50E-05 R TGYTLDVTTGQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4909.4909.2.dta 77 1 IPI00012074.3 Heterogeneous nuclear ribonucleoprotein R 153 71184 6 6 6 6 5779 7064 1 1 1 730.8949 1459.7752 2 1459.777 -0.0017 0 61.05 5.00E-06 R NLATTVTEEILEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8064.8064.2.dta 77 1 IPI00012074.3 Heterogeneous nuclear ribonucleoprotein R 153 71184 6 6 6 6 6652 7505 1 1 1 805.4029 1608.7912 2 1608.7923 -0.001 0 32.19 0.0014 R DLYEDELVPLFEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8501.8501.2.dta 77 2 IPI00018140.3 Isoform 1 of Heterogeneous nuclear ribonucleoprotein Q 126 69788 4 4 4 4 1115 4680 1 0 0 430.7654 859.5163 2 859.5167 -0.0004 0 28.88 0.011 R LFVGSIPK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5676.5676.2.dta 77 2 IPI00018140.3 Isoform 1 of Heterogeneous nuclear ribonucleoprotein Q 126 69788 4 4 4 4 1511 5753 1 0 0 464.2557 926.4969 2 926.4974 -0.0005 0 53.97 6.80E-05 K AGPIWDLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6765.6765.2.dta 77 2 IPI00018140.3 Isoform 1 of Heterogeneous nuclear ribonucleoprotein Q 126 69788 4 4 4 4 4624 3971 1 0 0 656.3298 1310.645 2 1310.6467 -0.0017 0 51.54 1.50E-05 R TGYTLDVTTGQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4909.4909.2.dta 77 2 IPI00018140.3 Isoform 1 of Heterogeneous nuclear ribonucleoprotein Q 126 69788 4 4 4 4 5866 6439 1 0 1 737.3929 1472.7713 2 1472.7722 -0.0009 0 50.97 1.70E-05 R NLANTVTEEILEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7446.7446.2.dta 77 IPI00402185.4 Isoform 5 of Heterogeneous nuclear ribonucleoprotein Q 92 46470 3 3 3 3 1115 4680 1 0 0 430.7654 859.5163 2 859.5167 -0.0004 0 28.88 0.011 R LFVGSIPK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5676.5676.2.dta 77 IPI00402185.4 Isoform 5 of Heterogeneous nuclear ribonucleoprotein Q 92 46470 3 3 3 3 1511 5753 1 0 0 464.2557 926.4969 2 926.4974 -0.0005 0 53.97 6.80E-05 K AGPIWDLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6765.6765.2.dta 77 IPI00402185.4 Isoform 5 of Heterogeneous nuclear ribonucleoprotein Q 92 46470 3 3 3 3 5866 6439 1 0 1 737.3929 1472.7713 2 1472.7722 -0.0009 0 50.97 1.70E-05 R NLANTVTEEILEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7446.7446.2.dta 77 IPI00746866.1 OTTHUMP00000016817 52 20301 1 1 1 1 4624 3971 1 0 0 656.3298 1310.645 2 1310.6467 -0.0017 0 51.54 1.50E-05 R TGYTLDVTTGQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4909.4909.2.dta 78 1 IPI00402391.3 Isoform 3 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 151 84903 4 4 4 4 2784 655 1 1 1 364.5249 1090.553 3 1090.5519 0.0011 1 29.85 0.01 R KRPYEENR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1291.1291.3.dta 78 1 IPI00402391.3 Isoform 3 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 151 84903 4 4 4 4 4856 5041 1 1 1 671.3035 1340.5924 2 1340.5932 -0.0008 0 56.19 5.40E-06 K NCAVEFNFGQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6056.6056.2.dta 78 1 IPI00402391.3 Isoform 3 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 151 84903 4 4 4 4 6897 4036 1 1 1 548.9465 1643.8178 3 1643.8189 -0.0011 1 32.72 0.00085 K AIVICPTDEDLKDR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4979.4979.3.dta 78 1 IPI00402391.3 Isoform 3 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 151 84903 4 4 4 4 7416 4731 1 1 1 871.428 1740.8415 2 1740.8431 -0.0016 0 89.72 1.40E-08 R NYILDQTNVYGSAQR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5731.5731.2.dta 79 1 IPI00011569.2 Acetyl-CoA carboxylase 1 150 267095 8 8 8 8 1634 6617 1 1 1 471.7973 941.5801 2 941.5797 0.0004 0 22.91 0.02 R LLLEDLVK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7622.7622.2.dta 79 1 IPI00011569.2 Acetyl-CoA carboxylase 1 150 267095 8 8 8 8 4905 5270 1 1 1 673.3712 1344.7278 2 1344.7289 -0.0011 0 22.94 0.012 R ILNVPQELYEK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6287.6287.2.dta 79 1 IPI00011569.2 Acetyl-CoA carboxylase 1 150 267095 8 8 8 8 5088 5597 1 1 1 683.9059 1365.7973 2 1365.798 -0.0007 0 54.43 2.20E-05 R LGGIPVGVVAVETR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6610.6610.2.dta 79 1 IPI00011569.2 Acetyl-CoA carboxylase 1 150 267095 8 8 8 8 5285 5979 1 1 1 696.3797 1390.7448 2 1390.7456 -0.0008 0 32.98 0.0081 R DIIVIGNDITYR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6991.6991.2.dta 79 1 IPI00011569.2 Acetyl-CoA carboxylase 1 150 267095 8 8 8 8 5496 6330 1 1 1 711.3437 1420.6729 2 1420.6735 -0.0006 0 62.33 9.10E-06 K VNNADDFPNLFR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7339.7339.2.dta 79 1 IPI00011569.2 Acetyl-CoA carboxylase 1 150 267095 8 8 8 8 6313 5641 1 1 1 517.2632 1548.7677 3 1548.7685 -0.0008 1 23.57 0.036 R KVNNADDFPNLFR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6655.6655.3.dta 79 1 IPI00011569.2 Acetyl-CoA carboxylase 1 150 267095 8 8 8 8 6593 7359 1 1 1 796.4272 1590.8398 2 1590.8406 -0.0008 0 38.02 0.00027 R IGSFGPQEDLLFLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8356.8356.2.dta 79 1 IPI00011569.2 Acetyl-CoA carboxylase 1 150 267095 8 8 8 8 7781 5582 1 1 1 935.4744 1868.9343 2 1868.9367 -0.0024 0 33.44 0.0028 R TVELSIPADPANLDSEAK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6596.6596.2.dta 80 1 IPI00021048.1 Isoform 1 of Myoferlin 150 236100 5 5 5 5 3218 2283 1 1 1 575.7876 1149.5606 2 1149.5626 -0.0019 0 55.09 7.50E-06 K DLTQTASSTAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3054.3054.2.dta 80 1 IPI00021048.1 Isoform 1 of Myoferlin 150 236100 5 5 5 5 4155 5083 1 1 1 629.8349 1257.6552 2 1257.6565 -0.0012 0 30.6 0.0013 K VGETIIDLENR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6098.6098.2.dta 80 1 IPI00021048.1 Isoform 1 of Myoferlin 150 236100 5 5 5 5 4374 3564 1 1 1 642.8458 1283.6771 2 1283.6834 -0.0063 0 68.69 3.60E-07 K GPVGTVSEAQLAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4469.4469.2.dta 80 1 IPI00021048.1 Isoform 1 of Myoferlin 150 236100 5 5 5 5 6162 7141 1 1 1 761.4001 1520.7856 2 1520.7875 -0.0019 0 22.18 0.017 K NLVDPFVEVSFAGK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8141.8141.2.dta 80 1 IPI00021048.1 Isoform 1 of Myoferlin 150 236100 5 5 5 5 6979 6368 1 1 1 831.4036 1660.7927 2 1660.7944 -0.0017 0 36.2 0.0004 K WLLLNDPEDTSSGSK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7376.7376.2.dta 80 IPI00385318.1 FER1L3 protein 133 180294 4 4 4 4 3218 2283 1 0 1 575.7876 1149.5606 2 1149.5626 -0.0019 0 55.09 7.50E-06 K DLTQTASSTAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3054.3054.2.dta 80 IPI00385318.1 FER1L3 protein 133 180294 4 4 4 4 4374 3564 1 0 1 642.8458 1283.6771 2 1283.6834 -0.0063 0 68.69 3.60E-07 K GPVGTVSEAQLAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4469.4469.2.dta 80 IPI00385318.1 FER1L3 protein 133 180294 4 4 4 4 6162 7141 1 0 1 761.4001 1520.7856 2 1520.7875 -0.0019 0 22.18 0.017 K NLVDPFVEVSFAGK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8141.8141.2.dta 80 IPI00385318.1 FER1L3 protein 133 180294 4 4 4 4 6979 6368 1 0 1 831.4036 1660.7927 2 1660.7944 -0.0017 0 36.2 0.0004 K WLLLNDPEDTSSGSK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7376.7376.2.dta 80 IPI00020210.2 Dysferlin_v1 22 239397 1 1 1 1 6162 7141 1 0 1 761.4001 1520.7856 2 1520.7875 -0.0019 0 22.18 0.017 K NLVDPFVEVSFAGK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8141.8141.2.dta 81 1 IPI00302925.3 "Chaperonin containing TCP1, subunit 8 (Theta) variant" 145 60311 3 3 3 3 3191 6079 1 1 1 573.8035 1145.5924 2 1145.5928 -0.0004 0 59.26 2.40E-05 R DIDEVSSLLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7091.7091.2.dta 81 1 IPI00302925.3 "Chaperonin containing TCP1, subunit 8 (Theta) variant" 145 60311 3 3 3 3 3221 5337 1 1 1 575.7974 1149.5802 2 1149.5818 -0.0017 0 75.76 5.00E-07 K FAEAFEAIPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6353.6353.2.dta 81 1 IPI00302925.3 "Chaperonin containing TCP1, subunit 8 (Theta) variant" 145 60311 3 3 3 3 4803 5937 1 1 1 667.377 1332.7395 2 1332.7401 -0.0007 0 59.44 1.40E-05 K LFVTNDAATILR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6948.6948.2.dta 81 IPI00797206.1 Protein 94 35913 2 2 2 2 3191 6079 1 0 1 573.8035 1145.5924 2 1145.5928 -0.0004 0 59.26 2.40E-05 R DIDEVSSLLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7091.7091.2.dta 81 IPI00797206.1 Protein 94 35913 2 2 2 2 4803 5937 1 0 1 667.377 1332.7395 2 1332.7401 -0.0007 0 59.44 1.40E-05 K LFVTNDAATILR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6948.6948.2.dta 82 1 IPI00011062.1 "Isoform 1 of Carbamoyl-phosphate synthase [ammonia], mitochondrial precursor" 145 165975 3 3 3 3 3839 6275 1 1 1 611.8447 1221.6748 2 1221.6757 -0.001 0 37.86 0.00034 K ATGYPLAFIAAK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7285.7285.2.dta 82 1 IPI00011062.1 "Isoform 1 of Carbamoyl-phosphate synthase [ammonia], mitochondrial precursor" 145 165975 3 3 3 3 4738 3762 1 1 1 663.3613 1324.708 2 1324.7099 -0.0019 0 69.2 1.70E-06 R GQNQPVLNITNK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4683.4683.2.dta 82 1 IPI00011062.1 "Isoform 1 of Carbamoyl-phosphate synthase [ammonia], mitochondrial precursor" 145 165975 3 3 3 3 5475 5923 1 1 1 710.377 1418.7394 2 1418.7405 -0.0012 0 77.03 9.50E-08 K AVNTLNEALEFAK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6934.6934.2.dta 82 IPI00397498.1 "Isoform 2 of Carbamoyl-phosphate synthase [ammonia], mitochondrial precursor" 97 117048 2 2 2 2 3839 6275 1 0 1 611.8447 1221.6748 2 1221.6757 -0.001 0 37.86 0.00034 K ATGYPLAFIAAK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7285.7285.2.dta 82 IPI00397498.1 "Isoform 2 of Carbamoyl-phosphate synthase [ammonia], mitochondrial precursor" 97 117048 2 2 2 2 5475 5923 1 0 1 710.377 1418.7394 2 1418.7405 -0.0012 0 77.03 9.50E-08 K AVNTLNEALEFAK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6934.6934.2.dta 83 1 IPI00478292.3 "Isoform 1 of Spectrin alpha chain, brain" 144 286161 8 8 8 8 203 1009 1 0 0 329.7159 657.4173 2 657.4173 -0.0001 1 33.13 0.02 K IIKER E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1674.1674.2.dta 83 1 IPI00478292.3 "Isoform 1 of Spectrin alpha chain, brain" 144 286161 8 8 8 8 1991 3952 1 1 1 495.7724 989.5302 2 989.5294 0.0008 0 46.5 0.00069 K LFGAAEVQR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4888.4888.2.dta 83 1 IPI00478292.3 "Isoform 1 of Spectrin alpha chain, brain" 144 286161 8 8 8 8 2622 3861 1 1 1 537.2827 1072.5509 2 1072.5513 -0.0004 0 46.48 0.0005 R SLQQLAEER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4790.4790.2.dta 83 1 IPI00478292.3 "Isoform 1 of Spectrin alpha chain, brain" 144 286161 8 8 8 8 2678 4678 1 1 1 540.298 1078.5815 2 1078.5811 0.0004 0 20.19 0.013 R QGFVPAAYVK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5674.5674.2.dta 83 1 IPI00478292.3 "Isoform 1 of Spectrin alpha chain, brain" 144 286161 8 8 8 8 4217 1523 1 1 1 631.7968 1261.579 2 1261.5799 -0.001 0 41.5 0.00058 R EANQQQQFNR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2231.2231.2.dta 83 1 IPI00478292.3 "Isoform 1 of Spectrin alpha chain, brain" 144 286161 8 8 8 8 4547 3277 1 1 1 651.8319 1301.6493 2 1301.6463 0.003 0 29.15 0.0018 K VLETAEDIQER R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4158.4158.2.dta 83 1 IPI00478292.3 "Isoform 1 of Spectrin alpha chain, brain" 144 286161 8 8 8 8 6058 5821 1 1 1 751.367 1500.7195 2 1500.7208 -0.0014 0 41.09 0.00041 R EANELQQWINEK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6832.6832.2.dta 83 1 IPI00478292.3 "Isoform 1 of Spectrin alpha chain, brain" 144 286161 8 8 8 8 6575 6840 1 1 1 794.3865 1586.7584 2 1586.7617 -0.0033 0 32.45 0.00091 R ELPTAFDYVEFTR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7843.7843.2.dta 84 1 IPI00387144.4 Tubulin alpha-ubiquitous chain 144 50804 6 6 6 6 2201 4347 1 1 1 508.2926 1014.5706 2 1014.5709 -0.0003 0 54.83 3.80E-05 K DVNAAIATIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5315.5315.2.dta 84 1 IPI00387144.4 Tubulin alpha-ubiquitous chain 144 50804 6 6 6 6 2738 6622 1 1 1 543.3132 1084.6118 2 1084.6128 -0.001 0 49.86 2.10E-05 K EIIDLVLDR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7627.7627.2.dta 84 1 IPI00387144.4 Tubulin alpha-ubiquitous chain 144 50804 6 6 6 6 6558 6744 1 1 1 792.8785 1583.7424 2 1583.7443 -0.0019 0 15.13 0.038 R SIQFVDWCPTGFK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7748.7748.2.dta 84 1 IPI00387144.4 Tubulin alpha-ubiquitous chain 144 50804 6 6 6 6 7264 6800 1 1 1 851.4568 1700.899 2 1700.8985 0.0005 0 40.09 0.00026 R AVFVDLEPTVIDEVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7804.7804.2.dta 84 1 IPI00387144.4 Tubulin alpha-ubiquitous chain 144 50804 6 6 6 6 7338 4116 1 1 1 573.6317 1717.8733 3 1717.8747 -0.0014 0 21.16 0.023 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5066.5066.3.dta 84 1 IPI00387144.4 Tubulin alpha-ubiquitous chain 144 50804 6 6 6 6 7643 5175 1 1 1 912.9955 1823.9764 2 1823.9782 -0.0018 0 46.78 4.10E-05 K VGINYQPPTVVPGGDLAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6192.6192.2.dta 84 IPI00180675.4 Tubulin alpha-3 chain 142 50788 5 5 5 5 2201 4347 1 0 1 508.2926 1014.5706 2 1014.5709 -0.0003 0 54.83 3.80E-05 K DVNAAIATIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5315.5315.2.dta 84 IPI00180675.4 Tubulin alpha-3 chain 142 50788 5 5 5 5 2738 6622 1 0 1 543.3132 1084.6118 2 1084.6128 -0.001 0 49.86 2.10E-05 K EIIDLVLDR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7627.7627.2.dta 84 IPI00180675.4 Tubulin alpha-3 chain 142 50788 5 5 5 5 7264 6800 1 0 1 851.4568 1700.899 2 1700.8985 0.0005 0 40.09 0.00026 R AVFVDLEPTVIDEVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7804.7804.2.dta 84 IPI00180675.4 Tubulin alpha-3 chain 142 50788 5 5 5 5 7338 4116 1 0 1 573.6317 1717.8733 3 1717.8747 -0.0014 0 21.16 0.023 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5066.5066.3.dta 84 IPI00180675.4 Tubulin alpha-3 chain 142 50788 5 5 5 5 7643 5175 1 0 1 912.9955 1823.9764 2 1823.9782 -0.0018 0 46.78 4.10E-05 K VGINYQPPTVVPGGDLAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6192.6192.2.dta 84 IPI00166768.2 TUBA6 protein 138 37681 4 4 4 4 2201 4347 1 0 1 508.2926 1014.5706 2 1014.5709 -0.0003 0 54.83 3.80E-05 K DVNAAIATIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5315.5315.2.dta 84 IPI00166768.2 TUBA6 protein 138 37681 4 4 4 4 2738 6622 1 0 1 543.3132 1084.6118 2 1084.6128 -0.001 0 49.86 2.10E-05 K EIIDLVLDR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7627.7627.2.dta 84 IPI00166768.2 TUBA6 protein 138 37681 4 4 4 4 7264 6800 1 0 1 851.4568 1700.899 2 1700.8985 0.0005 0 40.09 0.00026 R AVFVDLEPTVIDEVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7804.7804.2.dta 84 IPI00166768.2 TUBA6 protein 138 37681 4 4 4 4 7643 5175 1 0 1 912.9955 1823.9764 2 1823.9782 -0.0018 0 46.78 4.10E-05 K VGINYQPPTVVPGGDLAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6192.6192.2.dta 84 IPI00793930.1 K-ALPHA-1 protein 106 37707 4 4 4 4 2201 4347 1 0 1 508.2926 1014.5706 2 1014.5709 -0.0003 0 54.83 3.80E-05 K DVNAAIATIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5315.5315.2.dta 84 IPI00793930.1 K-ALPHA-1 protein 106 37707 4 4 4 4 6558 6744 1 0 1 792.8785 1583.7424 2 1583.7443 -0.0019 0 15.13 0.038 R SIQFVDWCPTGFK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7748.7748.2.dta 84 IPI00793930.1 K-ALPHA-1 protein 106 37707 4 4 4 4 7264 6800 1 0 1 851.4568 1700.899 2 1700.8985 0.0005 0 40.09 0.00026 R AVFVDLEPTVIDEVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7804.7804.2.dta 84 IPI00793930.1 K-ALPHA-1 protein 106 37707 4 4 4 4 7643 5175 1 0 1 912.9955 1823.9764 2 1823.9782 -0.0018 0 46.78 4.10E-05 K VGINYQPPTVVPGGDLAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6192.6192.2.dta 84 IPI00179709.4 Isoform 1 of Tubulin alpha-2 chain 86 50612 3 3 3 3 2201 4347 1 0 1 508.2926 1014.5706 2 1014.5709 -0.0003 0 54.83 3.80E-05 K DVNAAIATIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5315.5315.2.dta 84 IPI00179709.4 Isoform 1 of Tubulin alpha-2 chain 86 50612 3 3 3 3 7338 4116 1 0 1 573.6317 1717.8733 3 1717.8747 -0.0014 0 21.16 0.023 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5066.5066.3.dta 84 IPI00179709.4 Isoform 1 of Tubulin alpha-2 chain 86 50612 3 3 3 3 7643 5175 1 0 1 912.9955 1823.9764 2 1823.9782 -0.0018 0 46.78 4.10E-05 K VGINYQPPTVVPGGDLAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6192.6192.2.dta 84 IPI00784332.1 Similar to Tubulin alpha-2 chain 83 17148 2 2 2 2 2201 4347 1 0 1 508.2926 1014.5706 2 1014.5709 -0.0003 0 54.83 3.80E-05 K DVNAAIATIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5315.5315.2.dta 84 IPI00784332.1 Similar to Tubulin alpha-2 chain 83 17148 2 2 2 2 7643 5175 1 0 1 912.9955 1823.9764 2 1823.9782 -0.0018 0 46.78 4.10E-05 K VGINYQPPTVVPGGDLAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6192.6192.2.dta 84 IPI00478908.3 29 kDa protein 78 28716 3 3 3 3 2738 6622 1 0 1 543.3132 1084.6118 2 1084.6128 -0.001 0 49.86 2.10E-05 K EIIDLVLDR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7627.7627.2.dta 84 IPI00478908.3 29 kDa protein 78 28716 3 3 3 3 7264 6800 1 0 1 851.4568 1700.899 2 1700.8985 0.0005 0 40.09 0.00026 R AVFVDLEPTVIDEVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7804.7804.2.dta 84 IPI00478908.3 29 kDa protein 78 28716 3 3 3 3 7338 4116 1 0 1 573.6317 1717.8733 3 1717.8747 -0.0014 0 21.16 0.023 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5066.5066.3.dta 84 IPI00795002.1 19 kDa protein 73 19479 2 2 2 2 2738 6622 1 0 1 543.3132 1084.6118 2 1084.6128 -0.001 0 49.86 2.10E-05 K EIIDLVLDR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7627.7627.2.dta 84 IPI00795002.1 19 kDa protein 73 19479 2 2 2 2 7264 6800 1 0 1 851.4568 1700.899 2 1700.8985 0.0005 0 40.09 0.00026 R AVFVDLEPTVIDEVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7804.7804.2.dta 84 IPI00414274.3 similar to Tubulin alpha-3 chain 56 23560 2 2 2 2 2201 4347 1 0 1 508.2926 1014.5706 2 1014.5709 -0.0003 0 54.83 3.80E-05 K DVNAAIATIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5315.5315.2.dta 84 IPI00414274.3 similar to Tubulin alpha-3 chain 56 23560 2 2 2 2 7338 4116 1 0 1 573.6317 1717.8733 3 1717.8747 -0.0014 0 21.16 0.023 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5066.5066.3.dta 84 IPI00007750.1 Tubulin alpha-1 chain 53 50634 3 3 3 3 6558 6744 1 0 1 792.8785 1583.7424 2 1583.7443 -0.0019 0 15.13 0.038 R SIQFVDWCPTGFK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7748.7748.2.dta 84 IPI00007750.1 Tubulin alpha-1 chain 53 50634 3 3 3 3 7338 4116 1 0 1 573.6317 1717.8733 3 1717.8747 -0.0014 0 21.16 0.023 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5066.5066.3.dta 84 IPI00007750.1 Tubulin alpha-1 chain 53 50634 3 3 3 3 7643 5175 1 0 1 912.9955 1823.9764 2 1823.9782 -0.0018 0 46.78 4.10E-05 K VGINYQPPTVVPGGDLAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6192.6192.2.dta 84 IPI00646909.2 Tubulin alpha-8 chain 52 50746 2 2 2 2 7338 4116 1 0 1 573.6317 1717.8733 3 1717.8747 -0.0014 0 21.16 0.023 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5066.5066.3.dta 84 IPI00646909.2 Tubulin alpha-8 chain 52 50746 2 2 2 2 7643 5175 1 0 1 912.9955 1823.9764 2 1823.9782 -0.0018 0 46.78 4.10E-05 K VGINYQPPTVVPGGDLAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6192.6192.2.dta 84 IPI00017454.3 Tubulin alpha-4 chain 21 27757 1 1 1 1 7338 4116 1 0 1 573.6317 1717.8733 3 1717.8747 -0.0014 0 21.16 0.023 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5066.5066.3.dta 85 1 IPI00472675.2 228 kDa protein 143 230398 3 3 3 3 338 1848 1 1 1 350.2112 698.4079 2 698.4075 0.0004 0 40.73 0.0013 R TGPVAVR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2583.2583.2.dta 85 1 IPI00472675.2 228 kDa protein 143 230398 3 3 3 3 3146 5517 1 1 1 570.8404 1139.6662 2 1139.6662 0 0 71.39 6.90E-07 K IQQGALELLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6531.6531.2.dta 85 1 IPI00472675.2 228 kDa protein 143 230398 3 3 3 3 6066 2305 1 1 1 751.88 1501.7455 2 1501.7485 -0.003 0 73.76 1.60E-07 K ASTEGVAIQGQQGTR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3078.3078.2.dta 86 1 IPI00396378.3 Isoform B1 of Heterogeneous nuclear ribonucleoproteins A2/B1 142 37464 6 6 6 6 442 743 1 0 0 364.2272 726.4399 2 726.4388 0.0011 1 26.81 0.022 R VVEPKR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1386.1386.2.dta 86 1 IPI00396378.3 Isoform B1 of Heterogeneous nuclear ribonucleoproteins A2/B1 142 37464 6 6 6 6 2172 3963 1 1 1 507.2249 1012.4352 2 1012.4363 -0.0011 0 39.81 0.00049 R GGNFGFGDSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4900.4900.2.dta 86 1 IPI00396378.3 Isoform B1 of Heterogeneous nuclear ribonucleoproteins A2/B1 142 37464 6 6 6 6 3526 5605 1 1 1 594.8264 1187.6383 2 1187.6398 -0.0015 0 59.44 3.50E-06 K IDTIEIITDR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6618.6618.2.dta 86 1 IPI00396378.3 Isoform B1 of Heterogeneous nuclear ribonucleoproteins A2/B1 142 37464 6 6 6 6 4839 1083 1 1 1 669.8535 1337.6924 2 1337.6939 -0.0016 0 23.34 0.0065 R EESGKPGAHVTVK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1754.1754.2.dta 86 1 IPI00396378.3 Isoform B1 of Heterogeneous nuclear ribonucleoproteins A2/B1 142 37464 6 6 6 6 5147 3684 1 1 1 689.32 1376.6255 2 1376.6222 0.0033 0 46.1 4.80E-05 R GGGGNFGPGPGSNFR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4598.4598.2.dta 86 1 IPI00396378.3 Isoform B1 of Heterogeneous nuclear ribonucleoproteins A2/B1 142 37464 6 6 6 6 5833 766 1 1 1 489.6034 1465.7883 3 1465.7889 -0.0006 1 33.14 0.0011 R EESGKPGAHVTVKK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1411.1411.3.dta 86 IPI00386854.5 HNRPA2B1 protein 90 28451 4 4 4 4 442 743 1 0 0 364.2272 726.4399 2 726.4388 0.0011 1 26.81 0.022 R VVEPKR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1386.1386.2.dta 86 IPI00386854.5 HNRPA2B1 protein 90 28451 4 4 4 4 3526 5605 1 0 1 594.8264 1187.6383 2 1187.6398 -0.0015 0 59.44 3.50E-06 K IDTIEIITDR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6618.6618.2.dta 86 IPI00386854.5 HNRPA2B1 protein 90 28451 4 4 4 4 4839 1083 1 0 1 669.8535 1337.6924 2 1337.6939 -0.0016 0 23.34 0.0065 R EESGKPGAHVTVK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1754.1754.2.dta 86 IPI00386854.5 HNRPA2B1 protein 90 28451 4 4 4 4 5833 766 1 0 1 489.6034 1465.7883 3 1465.7889 -0.0006 1 33.14 0.0011 R EESGKPGAHVTVKK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1411.1411.3.dta 87 1 IPI00746934.1 retinoblastoma-associated factor 600 141 580633 5 5 5 5 3054 3926 1 1 1 564.8213 1127.628 2 1127.6299 -0.0018 0 36.48 0.0016 R IQIGTQAIER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4860.4860.2.dta 87 1 IPI00746934.1 retinoblastoma-associated factor 600 141 580633 5 5 5 5 3237 6212 1 1 1 576.806 1151.5974 2 1151.5975 -0.0001 0 54.47 7.40E-05 R APSYIEIFGR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7222.7222.2.dta 87 1 IPI00746934.1 retinoblastoma-associated factor 600 141 580633 5 5 5 5 3490 6094 1 1 1 592.3427 1182.6709 2 1182.6721 -0.0012 0 37.02 0.00038 R SNPSVLQGLLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7106.7106.2.dta 87 1 IPI00746934.1 retinoblastoma-associated factor 600 141 580633 5 5 5 5 3623 7799 1 1 1 600.3042 1198.5938 2 1198.5942 -0.0003 1 29.2 0.0018 R HASTSSPADKAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.884.884.2.dta 87 1 IPI00746934.1 retinoblastoma-associated factor 600 141 580633 5 5 5 5 5465 5402 1 1 1 709.3694 1416.7242 2 1416.7249 -0.0007 0 57.89 3.70E-06 R ILGPAESDEFLAR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6418.6418.2.dta 87 IPI00180305.6 "Zinc finger, UBR1 type 1" 120 187723 4 4 4 4 3054 3926 1 0 1 564.8213 1127.628 2 1127.6299 -0.0018 0 36.48 0.0016 R IQIGTQAIER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4860.4860.2.dta 87 IPI00180305.6 "Zinc finger, UBR1 type 1" 120 187723 4 4 4 4 3237 6212 1 0 1 576.806 1151.5974 2 1151.5975 -0.0001 0 54.47 7.40E-05 R APSYIEIFGR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7222.7222.2.dta 87 IPI00180305.6 "Zinc finger, UBR1 type 1" 120 187723 4 4 4 4 3623 7799 1 0 1 600.3042 1198.5938 2 1198.5942 -0.0003 1 29.2 0.0018 R HASTSSPADKAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.884.884.2.dta 87 IPI00180305.6 "Zinc finger, UBR1 type 1" 120 187723 4 4 4 4 5465 5402 1 0 1 709.3694 1416.7242 2 1416.7249 -0.0007 0 57.89 3.70E-06 R ILGPAESDEFLAR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6418.6418.2.dta 87 IPI00607837.1 ZUBR1 protein (Fragment) 37 91885 1 1 1 1 3490 6094 1 0 1 592.3427 1182.6709 2 1182.6721 -0.0012 0 37.02 0.00038 R SNPSVLQGLLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7106.7106.2.dta 88 1 IPI00020985.3 Histone acetyltransferase p300 137 266881 8 8 8 8 1144 5879 1 1 0 434.2613 866.508 2 866.5086 -0.0006 1 19.91 0.014 K RVVQHTK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.689.689.2.dta 88 1 IPI00020985.3 Histone acetyltransferase p300 137 266881 8 8 8 8 1251 2031 2 1 0 442.192 882.3694 2 882.3694 0 0 21.09 0.033 R YHFCEK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2781.2781.2.dta 88 1 IPI00020985.3 Histone acetyltransferase p300 137 266881 8 8 8 8 1685 4481 1 1 1 475.2589 948.5033 2 948.5029 0.0004 0 46.19 0.00053 R LGTFLENR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5461.5461.2.dta 88 1 IPI00020985.3 Histone acetyltransferase p300 137 266881 8 8 8 8 2407 1100 1 1 1 522.2773 1042.5401 2 1042.5407 -0.0006 0 41.39 0.00028 R TQAAGPVSQGK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1773.1773.2.dta 88 1 IPI00020985.3 Histone acetyltransferase p300 137 266881 8 8 8 8 4216 808 1 1 1 631.7714 1261.5282 2 1261.5292 -0.001 0 23.91 0.017 K SCQVAHCASSR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1456.1456.2.dta 88 1 IPI00020985.3 Histone acetyltransferase p300 137 266881 8 8 8 8 4346 1828 1 1 0 639.7808 1277.5471 2 1277.5492 -0.0021 0 48.93 7.30E-05 R NANCSLPSCQK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2561.2561.2.dta 88 1 IPI00020985.3 Histone acetyltransferase p300 137 266881 8 8 8 8 4356 3011 1 1 1 640.7791 1279.5437 2 1279.5469 -0.0032 0 41.39 0.00013 R DATYYSYQNR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3864.3864.2.dta 88 1 IPI00020985.3 Histone acetyltransferase p300 137 266881 8 8 8 8 4966 1610 1 1 1 451.5566 1351.6481 3 1351.648 0.0001 0 27.41 0.013 R QNHPESGEVTVR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2325.2325.3.dta 88 2 IPI00023339.2 CREB-binding protein 64 268033 5 5 5 5 416 46 1 0 1 360.7127 719.4108 2 719.4079 0.003 0 20.17 0.023 R SHLVHK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1010.1010.2.dta 88 2 IPI00023339.2 CREB-binding protein 64 268033 5 5 5 5 1144 5879 1 0 0 434.2613 866.508 2 866.5086 -0.0006 1 19.91 0.014 K RVVQHTK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.689.689.2.dta 88 2 IPI00023339.2 CREB-binding protein 64 268033 5 5 5 5 1251 2031 2 0 0 442.192 882.3694 2 882.3694 0 0 21.09 0.033 R YHFCEK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2781.2781.2.dta 88 2 IPI00023339.2 CREB-binding protein 64 268033 5 5 5 5 4092 3006 1 0 1 625.774 1249.5334 2 1249.5363 -0.0029 0 22.51 0.014 R DAAYYSYQNR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3858.3858.2.dta 88 2 IPI00023339.2 CREB-binding protein 64 268033 5 5 5 5 4346 1828 1 0 0 639.7808 1277.5471 2 1277.5492 -0.0021 0 48.93 7.30E-05 R NANCSLPSCQK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2561.2561.2.dta 88 IPI00155855.2 CBP 52 109582 2 2 2 2 1144 5879 1 0 0 434.2613 866.508 2 866.5086 -0.0006 1 19.91 0.014 K RVVQHTK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.689.689.2.dta 88 IPI00155855.2 CBP 52 109582 2 2 2 2 4346 1828 1 0 0 639.7808 1277.5471 2 1277.5492 -0.0021 0 48.93 7.30E-05 R NANCSLPSCQK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2561.2561.2.dta 89 1 IPI00413895.2 "Golgi autoantigen, golgin subfamily A member 2" 136 113644 3 3 3 3 2328 1929 1 1 1 516.788 1031.5614 2 1031.5611 0.0003 0 58.31 1.90E-05 R ALSAVSTQQK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2671.2671.2.dta 89 1 IPI00413895.2 "Golgi autoantigen, golgin subfamily A member 2" 136 113644 3 3 3 3 3858 7290 1 1 1 613.3784 1224.7422 2 1224.7441 -0.002 0 50.16 3.70E-05 K LLELQELVLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8289.8289.2.dta 89 1 IPI00413895.2 "Golgi autoantigen, golgin subfamily A member 2" 136 113644 3 3 3 3 5240 5562 1 1 1 694.3743 1386.734 2 1386.7354 -0.0014 0 72.48 1.10E-06 R VQELETSLAELR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6576.6576.2.dta 89 IPI00470416.2 "Isoform 2 of Poly(A) RNA polymerase, mitochondrial precursor" 50 79639 1 1 1 1 3858 7290 1 0 1 613.3784 1224.7422 2 1224.7441 -0.002 0 50.16 3.70E-05 K LLELQELVLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8289.8289.2.dta 90 1 IPI00216773.4 ALB protein 129 46442 3 3 2 2 2179 5906 1 1 1 507.303 1012.5915 2 1012.5917 -0.0002 0 58.24 1.20E-05 K LVAASQAALGL - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6916.6916.2.dta 90 1 IPI00216773.4 ALB protein 129 46442 3 3 2 2 6886 4293 1 1 1 547.3166 1638.9279 3 1638.9305 -0.0025 1 51.92 2.70E-05 K KVPQVSTPTLVEVSR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5258.5258.3.dta 90 1 IPI00216773.4 ALB protein 129 46442 3 3 2 2 6887 4324 1 1 1 820.472 1638.9295 2 1638.9305 -0.0009 1 59 5.70E-06 K KVPQVSTPTLVEVSR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5290.5290.2.dta 90 IPI00022434.2 ALB protein 92 73881 2 2 1 1 6886 4293 1 0 1 547.3166 1638.9279 3 1638.9305 -0.0025 1 51.92 2.70E-05 K KVPQVSTPTLVEVSR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5258.5258.3.dta 90 IPI00022434.2 ALB protein 92 73881 2 2 1 1 6887 4324 1 0 1 820.472 1638.9295 2 1638.9305 -0.0009 1 59 5.70E-06 K KVPQVSTPTLVEVSR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5290.5290.2.dta 91 1 IPI00026625.1 Isoform 1 of Nuclear pore complex protein Nup155 129 156697 4 4 4 4 2262 1582 1 1 1 512.7689 1023.5232 2 1023.5236 -0.0005 1 28.08 0.0043 R ESLKEYQK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2295.2295.2.dta 91 1 IPI00026625.1 Isoform 1 of Nuclear pore complex protein Nup155 129 156697 4 4 4 4 4255 6932 1 1 1 634.3501 1266.6856 2 1266.686 -0.0003 0 49.5 0.00015 R LLEVYDQLFK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7934.7934.2.dta 91 1 IPI00026625.1 Isoform 1 of Nuclear pore complex protein Nup155 129 156697 4 4 4 4 6912 6658 1 1 1 824.913 1647.8115 2 1647.8138 -0.0023 0 28.94 0.0033 K CITDTLQELVNQSK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7663.7663.2.dta 91 1 IPI00026625.1 Isoform 1 of Nuclear pore complex protein Nup155 129 156697 4 4 4 4 7500 4424 1 1 1 883.9255 1765.8365 2 1765.8417 -0.0052 0 78.42 4.40E-08 K ISNQVDLSNVCAQYR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5399.5399.2.dta 92 1 IPI00217975.4 Lamin-B1 127 66653 4 4 4 4 2820 2213 1 1 1 549.2945 1096.5744 2 1096.5764 -0.002 1 27.34 0.0027 R KIGDTSVSYK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2978.2978.2.dta 92 1 IPI00217975.4 Lamin-B1 127 66653 4 4 4 4 3250 2934 1 1 1 577.811 1153.6074 2 1153.6091 -0.0018 0 39.85 0.00018 R AGGPTTPLSPTR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3780.3780.2.dta 92 1 IPI00217975.4 Lamin-B1 127 66653 4 4 4 4 3400 5992 1 1 1 586.332 1170.6494 2 1170.6496 -0.0002 0 51.67 0.00014 R IQELEDLLAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7004.7004.2.dta 92 1 IPI00217975.4 Lamin-B1 127 66653 4 4 4 4 4107 4359 1 1 1 626.3135 1250.6124 2 1250.6142 -0.0018 0 68.1 3.00E-06 K ALYETELADAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5328.5328.2.dta 92 IPI00790831.1 LMNB1 protein 116 44787 3 3 3 3 3250 2934 1 0 1 577.811 1153.6074 2 1153.6091 -0.0018 0 39.85 0.00018 R AGGPTTPLSPTR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3780.3780.2.dta 92 IPI00790831.1 LMNB1 protein 116 44787 3 3 3 3 3400 5992 1 0 1 586.332 1170.6494 2 1170.6496 -0.0002 0 51.67 0.00014 R IQELEDLLAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7004.7004.2.dta 92 IPI00790831.1 LMNB1 protein 116 44787 3 3 3 3 4107 4359 1 0 1 626.3135 1250.6124 2 1250.6142 -0.0018 0 68.1 3.00E-06 K ALYETELADAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5328.5328.2.dta 93 1 IPI00025491.1 Eukaryotic initiation factor 4A-I 127 46353 2 2 2 2 2940 6018 1 1 1 557.845 1113.6755 2 1113.6758 -0.0002 0 62.43 3.70E-06 R VLITTDLLAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7030.7030.2.dta 93 1 IPI00025491.1 Eukaryotic initiation factor 4A-I 127 46353 2 2 2 2 5298 3722 1 1 1 697.8495 1393.6845 2 1393.6838 0.0008 0 83.6 1.50E-08 K GYDVIAQAQSGTGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4639.4639.2.dta 93 IPI00555602.1 CD68 antigen variant (Fragment) 84 42846 1 1 1 1 5298 3722 1 0 1 697.8495 1393.6845 2 1393.6838 0.0008 0 83.6 1.50E-08 K GYDVIAQAQSGTGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4639.4639.2.dta 93 IPI00030296.6 BM-010 62 36301 1 1 1 1 2940 6018 1 0 1 557.845 1113.6755 2 1113.6758 -0.0002 0 62.43 3.70E-06 R VLITTDLLAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7030.7030.2.dta 94 1 IPI00296099.6 Thrombospondin-1 precursor 126 133291 6 6 6 6 2145 3188 1 1 1 505.269 1008.5235 2 1008.524 -0.0005 0 25.59 0.031 R AQGYSGLSVK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4061.4061.2.dta 94 1 IPI00296099.6 Thrombospondin-1 precursor 126 133291 6 6 6 6 4915 815 1 1 1 449.5363 1345.587 3 1345.5867 0.0003 1 32.61 0.0025 R TCHIQECDKR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1464.1464.3.dta 94 1 IPI00296099.6 Thrombospondin-1 precursor 126 133291 6 6 6 6 5120 4013 1 1 1 686.8324 1371.6502 2 1371.6531 -0.0029 0 37.5 0.0012 K GTSQNDPNWVVR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4954.4954.2.dta 94 1 IPI00296099.6 Thrombospondin-1 precursor 126 133291 6 6 6 6 5302 6733 1 1 1 697.869 1393.7235 2 1393.7242 -0.0007 0 39.9 0.0004 R FVFGTTPEDILR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7738.7738.2.dta 94 1 IPI00296099.6 Thrombospondin-1 precursor 126 133291 6 6 6 6 6677 5480 1 1 1 808.9097 1615.8049 2 1615.8067 -0.0018 0 53.29 6.60E-05 K GGVNDNFQGVLQNVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6495.6495.2.dta 94 1 IPI00296099.6 Thrombospondin-1 precursor 126 133291 6 6 6 6 8017 1689 1 1 1 657.2863 1968.8371 3 1968.8378 -0.0007 1 40 0.00038 R SCDSLNNRCEGSSVQTR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2411.2411.3.dta 95 1 IPI00291802.3 Isoform 3 of LIM domain only protein 7 126 154616 2 2 2 2 4576 6477 1 1 1 652.8639 1303.7132 2 1303.7136 -0.0003 0 56.16 8.20E-06 K AFENLLGQALTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7483.7483.2.dta 95 1 IPI00291802.3 Isoform 3 of LIM domain only protein 7 126 154616 2 2 2 2 6076 1921 1 1 1 752.8833 1503.752 2 1503.7529 -0.0009 0 87.52 6.20E-09 K TSTTGVATTQSPTPR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2662.2662.2.dta 96 1 IPI00184330.5 DNA replication licensing factor MCM2 126 102516 3 3 3 3 2243 6673 1 1 1 511.2786 1020.5426 2 1020.5426 -0.0001 0 48.4 0.00029 R FDILCVVR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7678.7678.2.dta 96 1 IPI00184330.5 DNA replication licensing factor MCM2 126 102516 3 3 3 3 3419 6761 1 1 1 586.8372 1171.6599 2 1171.6601 -0.0002 0 71.6 7.10E-07 R GLALALFGGEPK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7765.7765.2.dta 96 1 IPI00184330.5 DNA replication licensing factor MCM2 126 102516 3 3 3 3 5946 5578 1 1 1 739.8768 1477.739 2 1477.7412 -0.0023 0 48.97 2.60E-05 R ESLVVNYEDLAAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6591.6591.2.dta 96 IPI00795155.1 13 kDa protein 48 12883 1 1 1 1 2243 6673 1 0 1 511.2786 1020.5426 2 1020.5426 -0.0001 0 48.4 0.00029 R FDILCVVR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7678.7678.2.dta 97 1 IPI00009771.6 Lamin B2 125 70020 1 1 1 1 4264 1572 1 1 1 634.8068 1267.599 2 1267.6004 -0.0014 0 124.99 4.80E-12 R ATSSSSGSLSATGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2284.2284.2.dta 98 1 IPI00013234.2 IARS protein 125 121576 4 4 4 4 2098 6211 1 1 1 501.8083 1001.602 2 1001.6022 -0.0002 0 43.4 0.00024 R FLIQNVLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7221.7221.2.dta 98 1 IPI00013234.2 IARS protein 125 121576 4 4 4 4 3428 5612 1 1 1 587.3522 1172.6898 2 1172.6917 -0.0019 0 47.05 8.40E-05 R LYLINSPVVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6625.6625.2.dta 98 1 IPI00013234.2 IARS protein 125 121576 4 4 4 4 5442 7344 1 1 1 706.8687 1411.7228 2 1411.7235 -0.0008 0 19.78 0.014 K TVYVSVLPTTADF - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8341.8341.2.dta 98 1 IPI00013234.2 IARS protein 125 121576 4 4 4 4 5818 4428 1 1 1 733.3611 1464.7076 2 1464.7096 -0.002 0 66.94 5.30E-07 K QLSSEELEQFQK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5403.5403.2.dta 99 1 IPI00022774.3 Transitional endoplasmic reticulum ATPase 121 89950 5 5 5 5 2452 6233 1 1 1 525.2789 1048.5433 2 1048.5441 -0.0008 0 38.01 0.0011 K DVDLEFLAK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7242.7242.2.dta 99 1 IPI00022774.3 Transitional endoplasmic reticulum ATPase 121 89950 5 5 5 5 2642 2222 1 1 1 538.2723 1074.53 2 1074.5305 -0.0005 0 39.73 0.0027 K LAGESESNLR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2988.2988.2.dta 99 1 IPI00022774.3 Transitional endoplasmic reticulum ATPase 121 89950 5 5 5 5 3418 5215 1 1 1 586.8369 1171.6592 2 1171.6601 -0.001 0 38.74 0.00023 R GILLYGPPGTGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6232.6232.2.dta 99 1 IPI00022774.3 Transitional endoplasmic reticulum ATPase 121 89950 5 5 5 5 6281 5026 1 1 1 770.9045 1539.7945 2 1539.7967 -0.0022 0 48.5 5.10E-05 R LGDVISIQPCPDVK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6040.6040.2.dta 99 1 IPI00022774.3 Transitional endoplasmic reticulum ATPase 121 89950 5 5 5 5 6357 6920 1 1 1 778.9312 1555.8478 2 1555.8497 -0.002 0 35.54 0.0013 R LDQLIYIPLPDEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7922.7922.2.dta 99 IPI00021416.2 40 kDa protein 39 40804 1 1 1 1 3418 5215 1 0 1 586.8369 1171.6592 2 1171.6601 -0.001 0 38.74 0.00023 K GLLLYGPPGTGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6232.6232.2.dta 100 1 IPI00022970.4 Nucleoprotein TPR 121 266106 4 4 4 4 2896 4380 1 1 1 555.295 1108.5755 2 1108.5764 -0.0009 0 52.76 6.30E-05 K ISTQLDFASK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5351.5351.2.dta 100 1 IPI00022970.4 Nucleoprotein TPR 121 266106 4 4 4 4 3512 3961 1 1 1 593.8238 1185.633 2 1185.6353 -0.0023 0 35.04 0.00052 R IQQLTEEIGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4898.4898.2.dta 100 1 IPI00022970.4 Nucleoprotein TPR 121 266106 4 4 4 4 4314 4480 1 1 1 637.8307 1273.6468 2 1273.6514 -0.0045 0 27.53 0.0098 K SLESQVENLQK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5460.5460.2.dta 100 1 IPI00022970.4 Nucleoprotein TPR 121 266106 4 4 4 4 4322 1632 1 1 1 638.3171 1274.6197 2 1274.6215 -0.0017 0 67.74 2.90E-06 R ASTALSNEQQAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2349.2349.2.dta 101 1 IPI00163505.2 Isoform 1 of RNA-binding protein 39 120 59628 3 3 3 3 4287 7203 1 1 1 636.311 1270.6074 2 1270.6081 -0.0007 0 50.65 0.00015 R DLEEFFSTVGK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8202.8202.2.dta 101 1 IPI00163505.2 Isoform 1 of RNA-binding protein 39 120 59628 3 3 3 3 6331 6097 1 1 1 517.975 1550.9031 3 1550.9032 -0.0001 0 23.86 0.0058 R VLGVPIIVQASQAEK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7109.7109.3.dta 101 1 IPI00163505.2 Isoform 1 of RNA-binding protein 39 120 59628 3 3 3 3 7654 5341 1 1 1 915.4041 1828.7936 2 1828.7963 -0.0027 0 83.99 1.50E-08 R TDASSASSFLDSDELER T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6357.6357.2.dta 101 IPI00647282.1 RNA binding motif protein 39 55 27122 2 2 2 2 4287 7203 1 0 1 636.311 1270.6074 2 1270.6081 -0.0007 0 50.65 0.00015 R DLEEFFSTVGK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8202.8202.2.dta 101 IPI00647282.1 RNA binding motif protein 39 55 27122 2 2 2 2 6331 6097 1 0 1 517.975 1550.9031 3 1550.9032 -0.0001 0 23.86 0.0058 R VLGVPIIVQASQAEK - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7109.7109.3.dta 101 IPI00514831.1 RNA binding motif protein 39 51 24079 1 1 1 1 4287 7203 1 0 1 636.311 1270.6074 2 1270.6081 -0.0007 0 50.65 0.00015 R DLEEFFSTVGK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8202.8202.2.dta 102 1 IPI00219420.3 Structural maintenance of chromosomes protein 3 120 141853 7 7 7 7 203 1009 1 0 0 329.7159 657.4173 2 657.4173 -0.0001 1 33.13 0.02 R LLKER Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1674.1674.2.dta 102 1 IPI00219420.3 Structural maintenance of chromosomes protein 3 120 141853 7 7 7 7 468 2170 2 1 1 366.237 730.4594 2 730.4589 0.0006 1 26.94 0.029 R TKLELK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2932.2932.2.dta 102 1 IPI00219420.3 Structural maintenance of chromosomes protein 3 120 141853 7 7 7 7 566 1593 2 0 1 379.7426 757.4706 2 757.4698 0.0008 1 31.29 0.016 R QKLLEK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2307.2307.2.dta 102 1 IPI00219420.3 Structural maintenance of chromosomes protein 3 120 141853 7 7 7 7 1213 6179 1 1 1 438.2403 874.4661 2 874.4661 0 1 51.53 0.00019 K YSHVNKK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.719.719.2.dta 102 1 IPI00219420.3 Structural maintenance of chromosomes protein 3 120 141853 7 7 7 7 4925 1345 1 1 1 674.3183 1346.622 2 1346.6248 -0.0028 0 35.87 0.0013 K INQMATAPDSQR L Oxidation (M) 0.000100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2038.2038.2.dta 102 1 IPI00219420.3 Structural maintenance of chromosomes protein 3 120 141853 7 7 7 7 4930 4964 1 1 1 674.3416 1346.6686 2 1346.6718 -0.0032 0 26.37 0.0034 R ELGSLPQEAFEK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5977.5977.2.dta 102 1 IPI00219420.3 Structural maintenance of chromosomes protein 3 120 141853 7 7 7 7 7736 5182 1 1 1 928.9542 1855.8938 2 1855.8952 -0.0014 0 48.86 2.60E-05 R ALEYTIYNQELNETR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6199.6199.2.dta 103 1 IPI00291755.5 206 kDa protein 120 206380 5 5 5 5 1041 5787 1 1 1 423.2657 844.5168 2 844.5171 -0.0003 0 22.18 0.014 K VLLPFTR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6799.6799.2.dta 103 1 IPI00291755.5 206 kDa protein 120 206380 5 5 5 5 2811 5399 1 1 1 548.3298 1094.645 2 1094.6448 0.0002 0 60.89 4.00E-06 R VGQALELPLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6415.6415.2.dta 103 1 IPI00291755.5 206 kDa protein 120 206380 5 5 5 5 5695 4745 1 1 1 724.3798 1446.7451 2 1446.7467 -0.0016 0 51.48 4.70E-05 K AVDPTSGQLYGLAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5746.5746.2.dta 103 1 IPI00291755.5 206 kDa protein 120 206380 5 5 5 5 5705 6333 1 1 1 724.8793 1447.7441 2 1447.7446 -0.0005 0 36.79 0.0011 R ELYLEDSPLELK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7341.7341.2.dta 103 1 IPI00291755.5 206 kDa protein 120 206380 5 5 5 5 6292 6856 1 1 1 772.421 1542.8275 2 1542.8293 -0.0019 0 20.43 0.012 R VFGAPEVLENLEVK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7859.7859.2.dta 103 IPI00745795.2 Isoform 2 of Nuclear pore membrane glycoprotein 210 precursor 83 106371 3 3 3 3 1041 5787 1 0 1 423.2657 844.5168 2 844.5171 -0.0003 0 22.18 0.014 K VLLPFTR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6799.6799.2.dta 103 IPI00745795.2 Isoform 2 of Nuclear pore membrane glycoprotein 210 precursor 83 106371 3 3 3 3 2811 5399 1 0 1 548.3298 1094.645 2 1094.6448 0.0002 0 60.89 4.00E-06 R VGQALELPLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6415.6415.2.dta 103 IPI00745795.2 Isoform 2 of Nuclear pore membrane glycoprotein 210 precursor 83 106371 3 3 3 3 5705 6333 1 0 1 724.8793 1447.7441 2 1447.7446 -0.0005 0 36.79 0.0011 R ELYLEDSPLELK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7341.7341.2.dta 104 1 IPI00023649.2 Strawberry notch homolog 1 119 154772 3 3 3 3 3314 5235 1 1 1 581.316 1160.6174 2 1160.619 -0.0016 0 50.88 0.00018 R AGFLIGDGAGVGK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6252.6252.2.dta 104 1 IPI00023649.2 Strawberry notch homolog 1 119 154772 3 3 3 3 4598 2488 1 1 1 654.3317 1306.6489 2 1306.6517 -0.0028 0 68.91 3.50E-07 R VVYASATGASEPR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3277.3277.2.dta 104 1 IPI00023649.2 Strawberry notch homolog 1 119 154772 3 3 3 3 5973 6452 1 1 1 741.9156 1481.8166 2 1481.8202 -0.0036 0 38.33 0.00025 R QGLIGVGLINVEDR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7459.7459.2.dta 104 IPI00024900.2 R31180_1 98 153148 2 2 2 2 3314 5235 1 0 1 581.316 1160.6174 2 1160.619 -0.0016 0 50.88 0.00018 R AGFLIGDGAGVGK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6252.6252.2.dta 104 IPI00024900.2 R31180_1 98 153148 2 2 2 2 4598 2488 1 0 1 654.3317 1306.6489 2 1306.6517 -0.0028 0 68.91 3.50E-07 R VVYASATGASEPR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3277.3277.2.dta 105 1 IPI00465430.5 70 kDa protein 119 70111 3 3 3 3 810 1825 1 1 1 405.709 809.4034 2 809.4032 0.0003 0 33.31 0.007 R SQIYGSR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2558.2558.2.dta 105 1 IPI00465430.5 70 kDa protein 119 70111 3 3 3 3 3723 6799 1 1 1 604.3318 1206.649 2 1206.6496 -0.0006 0 48.96 3.50E-05 R DSLIFLVDASK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7803.7803.2.dta 105 1 IPI00465430.5 70 kDa protein 119 70111 3 3 3 3 6492 6086 1 1 1 787.4139 1572.8132 2 1572.8147 -0.0015 0 81.69 1.40E-07 K NIYVLQELDNPGAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7098.7098.2.dta 106 1 IPI00022744.5 Isoform 1 of Exportin-2 119 111145 4 4 4 4 1709 5435 2 1 1 477.3051 952.5957 2 952.5957 0 0 21.3 0.017 K IIIPEIQK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6451.6451.2.dta 106 1 IPI00022744.5 Isoform 1 of Exportin-2 119 111145 4 4 4 4 1986 5775 1 1 1 495.2918 988.5691 2 988.5705 -0.0015 0 46.08 0.00028 R LLQAFLER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6787.6787.2.dta 106 1 IPI00022744.5 Isoform 1 of Exportin-2 119 111145 4 4 4 4 2436 2244 1 1 1 349.5418 1045.6036 3 1045.6032 0.0004 0 36.32 0.0017 K IHLAQSLHK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3012.3012.3.dta 106 1 IPI00022744.5 Isoform 1 of Exportin-2 119 111145 4 4 4 4 7605 5602 1 1 1 906.4267 1810.8388 2 1810.8407 -0.0019 0 73.02 1.40E-07 K NLFEDQNTLTSICEK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6615.6615.2.dta 107 1 IPI00328550.3 Thrombospondin-4 precursor 118 108482 3 3 3 3 2271 3858 1 1 1 513.3028 1024.591 2 1024.5917 -0.0006 0 45.82 0.00018 R AVAEPGIQLK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4787.4787.2.dta 107 1 IPI00328550.3 Thrombospondin-4 precursor 118 108482 3 3 3 3 2484 2242 1 1 1 528.2045 1054.3945 2 1054.3961 -0.0016 0 36.11 0.00024 R CDSNPCFR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3010.3010.2.dta 107 1 IPI00328550.3 Thrombospondin-4 precursor 118 108482 3 3 3 3 6957 5499 1 1 1 828.3936 1654.7726 2 1654.774 -0.0014 0 70.09 2.70E-07 K QTEQTYWQATPFR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6513.6513.2.dta 107 IPI00329535.2 Thrombospondin-3 precursor 70 106872 1 1 1 1 6957 5499 1 0 1 828.3936 1654.7726 2 1654.774 -0.0014 0 70.09 2.70E-07 K QTEQTYWQATPFR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6513.6513.2.dta 107 IPI00028030.3 Cartilage oligomeric matrix protein precursor 46 85402 1 1 1 1 2271 3858 1 0 1 513.3028 1024.591 2 1024.5917 -0.0006 0 45.82 0.00018 R AVAEPGIQLK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4787.4787.2.dta 108 1 IPI00163496.11 136 kDa protein 117 136607 2 2 2 2 2635 3465 1 1 1 537.7795 1073.5445 2 1073.5465 -0.002 0 93.44 1.50E-08 R VGSGSLDNLGR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4362.4362.2.dta 108 1 IPI00163496.11 136 kDa protein 117 136607 2 2 2 2 5901 4754 1 1 1 737.8846 1473.7546 2 1473.7576 -0.003 0 45.21 5.80E-05 R GLAAGSAETLPANFR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5756.5756.2.dta 109 1 IPI00024364.2 Transportin 1 (Importin beta-)2 116 103771 3 3 3 3 906 5389 1 1 1 415.7711 829.5276 2 829.5273 0.0003 0 17.94 0.042 R SLSGLILK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6405.6405.2.dta 109 1 IPI00024364.2 Transportin 1 (Importin beta-)2 116 103771 3 3 3 3 4355 6670 1 1 1 640.3479 1278.6812 2 1278.682 -0.0007 0 59.67 1.20E-05 R QSSFALLGDLTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7675.7675.2.dta 109 1 IPI00024364.2 Transportin 1 (Importin beta-)2 116 103771 3 3 3 3 4544 5417 1 1 1 651.3745 1300.7345 2 1300.735 -0.0006 0 80.81 8.90E-08 K TLLENTAITIGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6432.6432.2.dta 109 IPI00164417.6 Isoform 2 of Transportin-2 58 101877 2 2 2 2 906 5389 1 0 1 415.7711 829.5276 2 829.5273 0.0003 0 17.94 0.042 R SLSGLILK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6405.6405.2.dta 109 IPI00164417.6 Isoform 2 of Transportin-2 58 101877 2 2 2 2 4355 6670 1 0 1 640.3479 1278.6812 2 1278.682 -0.0007 0 59.67 1.20E-05 R QSSFALLGDLTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7675.7675.2.dta 110 1 IPI00221106.5 splicing factor 3B subunit 2 116 100279 7 7 7 7 606 1598 1 1 1 384.2061 766.3976 2 766.3973 0.0003 0 17.19 0.04 R LQSYTR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2312.2312.2.dta 110 1 IPI00221106.5 splicing factor 3B subunit 2 116 100279 7 7 7 7 750 2675 1 1 1 399.7394 797.4642 2 797.4647 -0.0005 0 27.24 0.014 K IPQALEK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3481.3481.2.dta 110 1 IPI00221106.5 splicing factor 3B subunit 2 116 100279 7 7 7 7 2293 3716 1 1 1 514.7903 1027.5661 2 1027.5662 0 0 52.28 9.90E-05 R AAVLLEQER Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4633.4633.2.dta 110 1 IPI00221106.5 splicing factor 3B subunit 2 116 100279 7 7 7 7 3058 3254 1 1 1 565.2962 1128.5779 2 1128.5775 0.0004 0 47.83 0.00039 K KPGDLSDELR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4132.4132.2.dta 110 1 IPI00221106.5 splicing factor 3B subunit 2 116 100279 7 7 7 7 4638 3584 1 1 1 657.8297 1313.6448 2 1313.6463 -0.0015 0 57.03 3.30E-05 R VGEPVALSEEER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4491.4491.2.dta 110 1 IPI00221106.5 splicing factor 3B subunit 2 116 100279 7 7 7 7 7358 3550 1 1 1 575.9864 1724.9373 3 1724.942 -0.0047 1 15.32 0.039 R AAVLLEQERQQEIAK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4454.4454.3.dta 110 1 IPI00221106.5 splicing factor 3B subunit 2 116 100279 7 7 7 7 8043 4321 1 1 1 665.3599 1993.0579 3 1993.0592 -0.0013 1 22.62 0.016 K LAEIGAPIQGNREELVER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5287.5287.3.dta 110 IPI00477803.3 Hypothetical protein DKFZp781L0540 110 90764 6 6 6 6 606 1598 1 0 1 384.2061 766.3976 2 766.3973 0.0003 0 17.19 0.04 R LQSYTR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2312.2312.2.dta 110 IPI00477803.3 Hypothetical protein DKFZp781L0540 110 90764 6 6 6 6 2293 3716 1 0 1 514.7903 1027.5661 2 1027.5662 0 0 52.28 9.90E-05 R AAVLLEQER Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4633.4633.2.dta 110 IPI00477803.3 Hypothetical protein DKFZp781L0540 110 90764 6 6 6 6 3058 3254 1 0 1 565.2962 1128.5779 2 1128.5775 0.0004 0 47.83 0.00039 K KPGDLSDELR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4132.4132.2.dta 110 IPI00477803.3 Hypothetical protein DKFZp781L0540 110 90764 6 6 6 6 4638 3584 1 0 1 657.8297 1313.6448 2 1313.6463 -0.0015 0 57.03 3.30E-05 R VGEPVALSEEER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4491.4491.2.dta 110 IPI00477803.3 Hypothetical protein DKFZp781L0540 110 90764 6 6 6 6 7358 3550 1 0 1 575.9864 1724.9373 3 1724.942 -0.0047 1 15.32 0.039 R AAVLLEQERQQEIAK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4454.4454.3.dta 110 IPI00477803.3 Hypothetical protein DKFZp781L0540 110 90764 6 6 6 6 8043 4321 1 0 1 665.3599 1993.0579 3 1993.0592 -0.0013 1 22.62 0.016 K LAEIGAPIQGNREELVER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5287.5287.3.dta 111 1 IPI00018349.5 DNA replication licensing factor MCM4 114 97068 2 2 2 2 1966 2591 1 1 1 494.7469 987.4793 2 987.4808 -0.0014 0 47.15 0.00036 R IAEPSVCGR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3390.3390.2.dta 111 1 IPI00018349.5 DNA replication licensing factor MCM4 114 97068 2 2 2 2 5077 5693 1 1 1 683.3475 1364.6805 2 1364.6824 -0.0019 0 88.66 4.90E-09 R ALADDDFLTVTGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6706.6706.2.dta 111 IPI00795318.1 20 kDa protein 89 20079 1 1 1 1 5077 5693 1 0 1 683.3475 1364.6805 2 1364.6824 -0.0019 0 88.66 4.90E-09 R ALADDDFLTVTGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6706.6706.2.dta 112 1 IPI00221325.3 E3 SUMO-protein ligase RanBP2 113 362365 4 4 4 4 1884 629 1 1 1 488.7079 975.4013 2 975.4015 -0.0001 0 28.93 0.0059 K CAACQNPR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1262.1262.2.dta 112 1 IPI00221325.3 E3 SUMO-protein ligase RanBP2 113 362365 4 4 4 4 5102 6236 1 1 1 685.3714 1368.7282 2 1368.7289 -0.0007 0 15.91 0.035 K NSIPEPIDPLFK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7246.7246.2.dta 112 1 IPI00221325.3 E3 SUMO-protein ligase RanBP2 113 362365 4 4 4 4 6104 5077 1 1 1 754.833 1507.6515 2 1507.6548 -0.0033 0 56.95 4.60E-06 K EGQWDCSVCLVR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6092.6092.2.dta 112 1 IPI00221325.3 E3 SUMO-protein ligase RanBP2 113 362365 4 4 4 4 6613 6564 1 1 1 799.4453 1596.8761 2 1596.8763 -0.0002 0 63.86 2.80E-06 K ELVGPPLAETVFTPK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7570.7570.2.dta 112 IPI00100787.2 RANBP2-like and GRIP domain-containing protein 7 16 104295 1 1 1 1 5102 6236 1 0 1 685.3714 1368.7282 2 1368.7289 -0.0007 0 15.91 0.035 K NSIPEPIDPLFK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7246.7246.2.dta 113 1 IPI00221354.1 Isoform Short of RNA-binding protein FUS 113 53551 4 4 4 4 240 3728 1 1 0 336.2269 670.4392 2 670.4377 0.0014 0 24.16 0.045 K QIGIIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4646.4646.2.dta 113 1 IPI00221354.1 Isoform Short of RNA-binding protein FUS 113 53551 4 4 4 4 275 2638 1 1 0 340.69 679.3655 2 679.3653 0.0001 0 33.37 0.0024 K VSFATR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3441.3441.2.dta 113 1 IPI00221354.1 Isoform Short of RNA-binding protein FUS 113 53551 4 4 4 4 5480 3705 1 1 0 710.8336 1419.6527 2 1419.6518 0.0009 0 77.31 1.10E-07 K GEATVSFDDPPSAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4621.4621.2.dta 113 1 IPI00221354.1 Isoform Short of RNA-binding protein FUS 113 53551 4 4 4 4 6981 3506 1 1 1 554.6166 1660.8281 3 1660.8308 -0.0027 1 37.06 0.00045 K LKGEATVSFDDPPSAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4406.4406.3.dta 113 2 IPI00020194.1 Isoform Short of TATA-binding protein-associated factor 2N 101 61749 4 4 4 4 240 3728 1 0 0 336.2269 670.4392 2 670.4377 0.0014 0 24.16 0.045 K QIGIIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4646.4646.2.dta 113 2 IPI00020194.1 Isoform Short of TATA-binding protein-associated factor 2N 101 61749 4 4 4 4 275 2638 1 0 0 340.69 679.3655 2 679.3653 0.0001 0 33.37 0.0024 K VSFATR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3441.3441.2.dta 113 2 IPI00020194.1 Isoform Short of TATA-binding protein-associated factor 2N 101 61749 4 4 4 4 5480 3705 1 0 0 710.8336 1419.6527 2 1419.6518 0.0009 0 77.31 1.10E-07 K GEATVSFDDPPSAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4621.4621.2.dta 113 2 IPI00020194.1 Isoform Short of TATA-binding protein-associated factor 2N 101 61749 4 4 4 4 7443 1416 1 0 1 583.5785 1747.7136 3 1747.7146 -0.001 1 26.65 0.0059 R SGGGYGGDRSSGGGYSGDR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2115.2115.3.dta 114 1 IPI00215884.4 "Isoform ASF-1 of Splicing factor, arginine/serine-rich 1" 112 27842 5 5 5 5 267 1546 1 1 1 338.6748 675.3351 2 675.334 0.001 0 25.81 0.012 R YGPPSR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2256.2256.2.dta 114 1 IPI00215884.4 "Isoform ASF-1 of Splicing factor, arginine/serine-rich 1" 112 27842 5 5 5 5 2668 4863 1 1 1 539.7797 1077.5448 2 1077.5455 -0.0007 0 62.96 4.70E-06 R DGTGVVEFVR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5871.5871.2.dta 114 1 IPI00215884.4 "Isoform ASF-1 of Splicing factor, arginine/serine-rich 1" 112 27842 5 5 5 5 3315 2119 1 1 1 581.7776 1161.5407 2 1161.5414 -0.0007 0 22.4 0.043 R SHEGETAYIR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2877.2877.2.dta 114 1 IPI00215884.4 "Isoform ASF-1 of Splicing factor, arginine/serine-rich 1" 112 27842 5 5 5 5 3332 3973 1 1 1 388.5521 1162.6345 3 1162.6346 -0.0001 1 25.78 0.045 K YGAIRDIDLK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4911.4911.3.dta 114 1 IPI00215884.4 "Isoform ASF-1 of Splicing factor, arginine/serine-rich 1" 112 27842 5 5 5 5 4143 4986 1 1 1 628.8528 1255.691 2 1255.6925 -0.0014 0 62.38 5.70E-06 R IYVGNLPPDIR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6000.6000.2.dta 114 IPI00218591.2 "Isoform ASF-2 of Splicing factor, arginine/serine-rich 1" 111 32321 4 4 4 4 267 1546 1 0 1 338.6748 675.3351 2 675.334 0.001 0 25.81 0.012 R YGPPSR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2256.2256.2.dta 114 IPI00218591.2 "Isoform ASF-2 of Splicing factor, arginine/serine-rich 1" 111 32321 4 4 4 4 2668 4863 1 0 1 539.7797 1077.5448 2 1077.5455 -0.0007 0 62.96 4.70E-06 R DGTGVVEFVR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5871.5871.2.dta 114 IPI00218591.2 "Isoform ASF-2 of Splicing factor, arginine/serine-rich 1" 111 32321 4 4 4 4 3332 3973 1 0 1 388.5521 1162.6345 3 1162.6346 -0.0001 1 25.78 0.045 K YGAIRDIDLK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4911.4911.3.dta 114 IPI00218591.2 "Isoform ASF-2 of Splicing factor, arginine/serine-rich 1" 111 32321 4 4 4 4 4143 4986 1 0 1 628.8528 1255.691 2 1255.6925 -0.0014 0 62.38 5.70E-06 R IYVGNLPPDIR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6000.6000.2.dta 115 1 IPI00009104.7 RuvB-like 2 111 51296 3 3 3 3 1269 4298 1 1 1 444.7611 887.5077 2 887.5076 0.0001 0 36.43 0.00053 R IGLETSLR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5262.5262.2.dta 115 1 IPI00009104.7 RuvB-like 2 111 51296 3 3 3 3 3261 5229 1 1 1 578.303 1154.5914 2 1154.5931 -0.0017 0 68.35 2.30E-06 R GLGLDDALEPR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6246.6246.2.dta 115 1 IPI00009104.7 RuvB-like 2 111 51296 3 3 3 3 3872 6041 1 1 1 614.8145 1227.6145 2 1227.6135 0.0009 0 45.9 0.00013 R VYSLFLDESR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7053.7053.2.dta 116 1 IPI00177817.4 Isoform SERCA2A of Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 111 111103 2 2 2 2 5422 5294 1 1 1 704.8506 1407.6867 2 1407.6882 -0.0014 0 42.63 0.00015 R IGIFGQDEDVTSK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6310.6310.2.dta 116 1 IPI00177817.4 Isoform SERCA2A of Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 111 111103 2 2 2 2 6690 5651 1 1 1 810.9099 1619.8052 2 1619.8076 -0.0025 0 89.53 1.90E-08 K VGEATETALTCLVEK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6665.6665.2.dta 116 IPI00004092.2 Isoform SERCA3B of Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 90 115444 1 1 1 1 6690 5651 1 0 1 810.9099 1619.8052 2 1619.8076 -0.0025 0 89.53 1.90E-08 K VGEATETALTCLVEK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6665.6665.2.dta 117 1 IPI00024425.4 Putative eukaryotic translation initiation factor 3 subunit 111 148003 5 5 5 5 1580 5532 1 1 1 468.2636 934.5126 2 934.5123 0.0003 0 27.11 0.028 R YLELLER T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6546.6546.2.dta 117 1 IPI00024425.4 Putative eukaryotic translation initiation factor 3 subunit 111 148003 5 5 5 5 1827 768 1 1 1 484.7489 967.4833 2 967.4835 -0.0003 0 34.68 0.0015 R HQLQEASR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1413.1413.2.dta 117 1 IPI00024425.4 Putative eukaryotic translation initiation factor 3 subunit 111 148003 5 5 5 5 1850 5763 1 1 1 486.2974 970.5802 2 970.5811 -0.0009 0 46.36 0.00015 K IGIGELITR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6774.6774.2.dta 117 1 IPI00024425.4 Putative eukaryotic translation initiation factor 3 subunit 111 148003 5 5 5 5 4308 4250 1 1 1 637.34 1272.6655 2 1272.6674 -0.0019 0 36.76 0.00057 R SVEGLQEGSVLR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5211.5211.2.dta 117 1 IPI00024425.4 Putative eukaryotic translation initiation factor 3 subunit 111 148003 5 5 5 5 4718 5248 1 1 1 662.351 1322.6874 2 1322.683 0.0043 0 48.59 0.00012 K AVGSISSTAFDIR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6265.6265.2.dta 117 IPI00748426.1 99 kDa protein 96 100312 4 4 4 4 1580 5532 1 0 1 468.2636 934.5126 2 934.5123 0.0003 0 27.11 0.028 R YLELLER T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6546.6546.2.dta 117 IPI00748426.1 99 kDa protein 96 100312 4 4 4 4 1850 5763 1 0 1 486.2974 970.5802 2 970.5811 -0.0009 0 46.36 0.00015 K IGIGELITR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6774.6774.2.dta 117 IPI00748426.1 99 kDa protein 96 100312 4 4 4 4 4308 4250 1 0 1 637.34 1272.6655 2 1272.6674 -0.0019 0 36.76 0.00057 R SVEGLQEGSVLR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5211.5211.2.dta 117 IPI00748426.1 99 kDa protein 96 100312 4 4 4 4 4718 5248 1 0 1 662.351 1322.6874 2 1322.683 0.0043 0 48.59 0.00012 K AVGSISSTAFDIR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6265.6265.2.dta 118 1 IPI00641743.2 Isoform 3 of Host cell factor 111 215338 3 3 3 3 4810 6440 1 1 1 667.8397 1333.6648 2 1333.6667 -0.0019 0 17.77 0.022 K ENQWFDVGVIK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7447.7447.2.dta 118 1 IPI00641743.2 Isoform 3 of Host cell factor 111 215338 3 3 3 3 4894 5681 1 1 1 672.8784 1343.7423 2 1343.7449 -0.0026 0 52.2 7.90E-05 R SPAFVQLAPLSSK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6694.6694.2.dta 118 1 IPI00641743.2 Isoform 3 of Host cell factor 111 215338 3 3 3 3 5369 4236 1 1 1 701.8807 1401.7468 2 1401.7463 0.0005 0 77.41 5.50E-08 R ISVATGALEAAQGSK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5196.5196.2.dta 118 IPI00019848.1 Isoform 1 of Host cell factor 51 210707 2 2 2 2 4810 6440 1 0 1 667.8397 1333.6648 2 1333.6667 -0.0019 0 17.77 0.022 K ENQWFDVGVIK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7447.7447.2.dta 118 IPI00019848.1 Isoform 1 of Host cell factor 51 210707 2 2 2 2 4894 5681 1 0 1 672.8784 1343.7423 2 1343.7449 -0.0026 0 52.2 7.90E-05 R SPAFVQLAPLSSK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6694.6694.2.dta 119 1 IPI00031517.1 DNA replication licensing factor MCM6 109 93801 4 4 4 4 248 4285 1 1 1 336.7238 671.433 2 671.433 0 0 37.96 0.0028 R IGLLTR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5249.5249.2.dta 119 1 IPI00031517.1 DNA replication licensing factor MCM6 109 93801 4 4 4 4 2073 2196 1 1 1 500.7458 999.4771 2 999.4774 -0.0002 0 37.9 0.00028 K HVEEFSPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2960.2960.2.dta 119 1 IPI00031517.1 DNA replication licensing factor MCM6 109 93801 4 4 4 4 5227 4795 1 1 1 693.8243 1385.634 2 1385.6351 -0.0011 0 62.88 1.30E-06 K ESEDFIVEQYK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5798.5798.2.dta 119 1 IPI00031517.1 DNA replication licensing factor MCM6 109 93801 4 4 4 4 5857 6638 1 1 1 736.3633 1470.7121 2 1470.7143 -0.0022 0 29.65 0.011 K DFYVAFQDLPTR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7642.7642.2.dta 120 1 IPI00013508.5 Alpha-actinin-1 109 103563 3 3 3 3 1131 4729 1 1 1 432.7448 863.475 2 863.4752 -0.0002 0 31.2 0.0044 K ALDFIASK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5729.5729.2.dta 120 1 IPI00013508.5 Alpha-actinin-1 109 103563 3 3 3 3 3432 6448 1 1 1 587.8051 1173.5957 2 1173.5965 -0.0008 0 47.67 0.00041 K EGLLLWCQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7455.7455.2.dta 120 1 IPI00013508.5 Alpha-actinin-1 109 103563 3 3 3 3 5565 4959 1 1 1 715.3841 1428.7536 2 1428.7572 -0.0036 0 77.89 3.30E-07 R TINEVENQILTR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5972.5972.2.dta 120 IPI00793285.1 39 kDa protein 78 39035 1 1 1 1 5565 4959 1 0 1 715.3841 1428.7536 2 1428.7572 -0.0036 0 77.89 3.30E-07 R TINEVENQILTR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5972.5972.2.dta 120 IPI00032137.1 Alpha-actinin-3 56 103913 2 2 2 2 1131 4729 1 0 1 432.7448 863.475 2 863.4752 -0.0002 0 31.2 0.0044 K ALDFIASK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5729.5729.2.dta 120 IPI00032137.1 Alpha-actinin-3 56 103913 2 2 2 2 3432 6448 1 0 1 587.8051 1173.5957 2 1173.5965 -0.0008 0 47.67 0.00041 K EGLLLWCQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7455.7455.2.dta 120 IPI00019884.1 Alpha-actinin-2 48 104358 1 1 1 1 3432 6448 1 0 1 587.8051 1173.5957 2 1173.5965 -0.0008 0 47.67 0.00041 K EGLLLWCQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7455.7455.2.dta 121 1 IPI00006196.2 Isoform 2 of Nuclear mitotic apparatus protein 1 104 237471 3 3 3 3 1961 1775 1 0 1 494.2646 986.5147 2 986.5145 0.0003 0 48.5 0.00032 R SAPASQASLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2504.2504.2.dta 121 1 IPI00006196.2 Isoform 2 of Nuclear mitotic apparatus protein 1 104 237471 3 3 3 3 2242 1472 1 0 1 511.267 1020.5194 2 1020.52 -0.0006 0 84.19 8.10E-08 R ATSSTQSLAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2176.2176.2.dta 121 1 IPI00006196.2 Isoform 2 of Nuclear mitotic apparatus protein 1 104 237471 3 3 3 3 4451 1492 1 0 1 646.315 1290.6155 2 1290.6164 -0.001 0 15.14 0.038 R DSAQTSVTQAQR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2197.2197.2.dta 121 IPI00030136.1 NUMA1 protein 107 109896 2 2 2 2 1961 1775 1 0 1 494.2646 986.5147 2 986.5145 0.0003 0 48.5 0.00032 R SAPASQASLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2504.2504.2.dta 121 IPI00030136.1 NUMA1 protein 107 109896 2 2 2 2 2242 1472 1 0 1 511.267 1020.5194 2 1020.52 -0.0006 0 84.19 8.10E-08 R ATSSTQSLAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2176.2176.2.dta 122 1 IPI00292059.1 Nuclear pore complex protein Nup153 106 155391 6 6 6 6 3575 5131 1 1 1 597.8035 1193.5925 2 1193.5928 -0.0003 0 23.76 0.024 R SGIDITDFQAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6147.6147.2.dta 122 1 IPI00292059.1 Nuclear pore complex protein Nup153 106 155391 6 6 6 6 3602 4856 1 1 1 598.8109 1195.6072 2 1195.6085 -0.0013 0 26.96 0.0037 K SSFNLGTIETK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5863.5863.2.dta 122 1 IPI00292059.1 Nuclear pore complex protein Nup153 106 155391 6 6 6 6 4796 4261 1 1 1 666.8111 1331.6076 2 1331.6106 -0.003 0 47.81 0.00011 K NVFSSSGTSFSGR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5223.5223.2.dta 122 1 IPI00292059.1 Nuclear pore complex protein Nup153 106 155391 6 6 6 6 5327 4646 1 1 1 698.8386 1395.6627 2 1395.6671 -0.0044 0 36.64 0.00058 K TSQLGDSPFYPGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5639.5639.2.dta 122 1 IPI00292059.1 Nuclear pore complex protein Nup153 106 155391 6 6 6 6 6346 3196 1 1 1 778.3887 1554.7629 2 1554.7638 -0.0009 0 18.32 0.019 K QLSAQSYGVTSSTAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4069.4069.2.dta 122 1 IPI00292059.1 Nuclear pore complex protein Nup153 106 155391 6 6 6 6 6607 5892 1 1 1 797.9424 1593.8703 2 1593.8726 -0.0023 0 37.5 0.0003 R IPSIVSSPLNSPLDR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6902.6902.2.dta 123 1 IPI00065931.3 A-kinase anchor protein 13 isoform 1 104 310733 3 3 3 3 1788 1889 1 1 1 482.259 962.5034 2 962.5033 0.0001 0 27.35 0.0065 R SQQSVSLSK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2627.2627.2.dta 123 1 IPI00065931.3 A-kinase anchor protein 13 isoform 1 104 310733 3 3 3 3 6782 1259 1 1 1 816.3842 1630.7538 2 1630.7547 -0.0009 0 48.76 2.70E-05 K GPEGQSQAPASTSASTR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1945.1945.2.dta 123 1 IPI00065931.3 A-kinase anchor protein 13 isoform 1 104 310733 3 3 3 3 7441 5179 1 1 1 874.433 1746.8515 2 1746.8537 -0.0021 0 61.54 1.70E-06 R IGDVLVNQFSGENAER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6196.6196.2.dta 123 IPI00382689.1 LBC oncogene 62 49307 1 1 1 1 7441 5179 1 0 1 874.433 1746.8515 2 1746.8537 -0.0021 0 61.54 1.70E-06 R IGDVLVNQFSGENAER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6196.6196.2.dta 124 1 IPI00479186.5 Isoform M2 of Pyruvate kinase isozymes M1/M2 103 58470 4 4 4 4 617 7680 1 1 1 384.7093 767.4041 2 767.4038 0.0003 0 39.72 0.00028 R SAHQVAR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.870.870.2.dta 124 1 IPI00479186.5 Isoform M2 of Pyruvate kinase isozymes M1/M2 103 58470 4 4 4 4 2386 675 1 1 1 520.7772 1039.5398 2 1039.541 -0.0013 1 28.98 0.0025 R KASDVHEVR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1312.1312.2.dta 124 1 IPI00479186.5 Isoform M2 of Pyruvate kinase isozymes M1/M2 103 58470 4 4 4 4 2974 1873 1 1 1 559.8058 1117.5971 2 1117.5979 -0.0007 1 15.44 0.038 K GSGTAEVELKK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2610.2610.2.dta 124 1 IPI00479186.5 Isoform M2 of Pyruvate kinase isozymes M1/M2 103 58470 4 4 4 4 3829 4710 1 1 1 611.3195 1220.6245 2 1220.6257 -0.0012 0 66.57 5.70E-07 K CCSGAIIVLTK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5708.5708.2.dta 124 IPI00220644.8 Isoform M1 of Pyruvate kinase isozymes M1/M2 53 58538 3 3 3 3 617 7680 1 0 1 384.7093 767.4041 2 767.4038 0.0003 0 39.72 0.00028 R SAHQVAR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.870.870.2.dta 124 IPI00220644.8 Isoform M1 of Pyruvate kinase isozymes M1/M2 53 58538 3 3 3 3 2386 675 1 0 1 520.7772 1039.5398 2 1039.541 -0.0013 1 28.98 0.0025 R KASDVHEVR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1312.1312.2.dta 124 IPI00220644.8 Isoform M1 of Pyruvate kinase isozymes M1/M2 53 58538 3 3 3 3 2974 1873 1 0 1 559.8058 1117.5971 2 1117.5979 -0.0007 1 15.44 0.038 K GSGTAEVELKK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2610.2610.2.dta 124 IPI00604528.2 PKM2 protein 52 40882 2 2 2 2 617 7680 1 0 1 384.7093 767.4041 2 767.4038 0.0003 0 39.72 0.00028 R SAHQVAR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.870.870.2.dta 124 IPI00604528.2 PKM2 protein 52 40882 2 2 2 2 2386 675 1 0 1 520.7772 1039.5398 2 1039.541 -0.0013 1 28.98 0.0025 R KASDVHEVR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1312.1312.2.dta 124 IPI00607698.1 PKM2 protein 15 30540 1 1 1 1 2974 1873 1 0 1 559.8058 1117.5971 2 1117.5979 -0.0007 1 15.44 0.038 K GSGTAEVELKK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2610.2610.2.dta 125 1 IPI00465439.5 Fructose-bisphosphate aldolase A 103 39851 4 4 4 4 773 2691 1 1 1 401.245 800.4755 2 800.4756 -0.0001 0 32.37 0.013 R ALQASALK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3498.3498.2.dta 125 1 IPI00465439.5 Fructose-bisphosphate aldolase A 103 39851 4 4 4 4 3082 2845 1 1 1 566.7914 1131.5683 2 1131.5706 -0.0023 0 51.39 0.00015 R ALANSLACQGK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3680.3680.2.dta 125 1 IPI00465439.5 Fructose-bisphosphate aldolase A 103 39851 4 4 4 4 4798 3939 1 1 1 666.853 1331.6915 2 1331.6932 -0.0017 0 62.31 1.70E-06 K GILAADESTGSIAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4874.4874.2.dta 125 1 IPI00465439.5 Fructose-bisphosphate aldolase A 103 39851 4 4 4 4 7827 4281 1 1 1 633.3566 1897.0479 3 1897.052 -0.0041 1 18.8 0.017 R IVAPGKGILAADESTGSIAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5245.5245.3.dta 125 IPI00791070.1 23 kDa protein 66 23062 2 2 2 2 4798 3939 1 0 1 666.853 1331.6915 2 1331.6932 -0.0017 0 62.31 1.70E-06 K GILAADESTGSIAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4874.4874.2.dta 125 IPI00791070.1 23 kDa protein 66 23062 2 2 2 2 7827 4281 1 0 1 633.3566 1897.0479 3 1897.052 -0.0041 1 18.8 0.017 R IVAPGKGILAADESTGSIAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5245.5245.3.dta 125 IPI00789118.1 Protein 32 23121 1 1 1 1 773 2691 1 0 1 401.245 800.4755 2 800.4756 -0.0001 0 32.37 0.013 R ALQASALK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3498.3498.2.dta 126 1 IPI00012345.2 "Isoform SRP55-1 of Splicing factor, arginine/serine-rich 6" 102 39677 4 4 4 4 898 4853 1 1 1 415.2551 828.4957 2 828.4957 0.0001 0 28.76 0.017 R LLEVDLK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5860.5860.2.dta 126 1 IPI00012345.2 "Isoform SRP55-1 of Splicing factor, arginine/serine-rich 6" 102 39677 4 4 4 4 1156 1340 1 1 1 435.7554 869.4963 2 869.497 -0.0007 0 40.17 0.00064 R LIEDKPR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2033.2033.2.dta 126 1 IPI00012345.2 "Isoform SRP55-1 of Splicing factor, arginine/serine-rich 6" 102 39677 4 4 4 4 2320 4110 1 1 1 515.7984 1029.5823 2 1029.5818 0.0004 0 50.62 0.0001 R LIVENLSSR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5060.5060.2.dta 126 1 IPI00012345.2 "Isoform SRP55-1 of Splicing factor, arginine/serine-rich 6" 102 39677 4 4 4 4 2550 4440 1 1 1 532.7718 1063.5291 2 1063.5298 -0.0007 0 53.31 0.00011 R TNEGVIEFR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5416.5416.2.dta 126 IPI00000015.2 "Splicing factor, arginine/serine-rich 4" 56 56759 2 2 2 2 898 4853 1 0 1 415.2551 828.4957 2 828.4957 0.0001 0 28.76 0.017 K ILEVDLK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5860.5860.2.dta 126 IPI00000015.2 "Splicing factor, arginine/serine-rich 4" 56 56759 2 2 2 2 2320 4110 1 0 1 515.7984 1029.5823 2 1029.5818 0.0004 0 50.62 0.0001 R LIVENLSSR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5060.5060.2.dta 126 IPI00012341.1 "Isoform SRP40-1 of Splicing factor, arginine/serine-rich 5" 51 31359 1 1 1 1 2320 4110 1 0 1 515.7984 1029.5823 2 1029.5818 0.0004 0 50.62 0.0001 R LIVENLSSR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5060.5060.2.dta 126 IPI00018203.1 "Isoform SRP55-2 of Splicing factor, arginine/serine-rich 6" 29 15717 1 1 1 1 898 4853 1 0 1 415.2551 828.4957 2 828.4957 0.0001 0 28.76 0.017 R LLEVDLK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5860.5860.2.dta 127 1 IPI00249982.4 Isoform 1 of Death-inducer obliterator 1 99 130526 3 3 3 3 2658 5243 1 1 1 538.8091 1075.6036 2 1075.6026 0.001 0 50.71 0.00012 R VEQFLTIAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6260.6260.2.dta 127 1 IPI00249982.4 Isoform 1 of Death-inducer obliterator 1 99 130526 3 3 3 3 3747 1648 1 1 1 606.3215 1210.6284 2 1210.6306 -0.0022 0 65.67 7.00E-07 R QAGPAPAAATAASK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2366.2366.2.dta 127 1 IPI00249982.4 Isoform 1 of Death-inducer obliterator 1 99 130526 3 3 3 3 7460 6740 1 1 1 878.4803 1754.9461 2 1754.9454 0.0007 0 22.21 0.026 K DLYLIPLSAQDPVPSK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7744.7744.2.dta 127 IPI00794032.1 98 kDa protein 70 99346 2 2 2 2 3747 1648 1 0 1 606.3215 1210.6284 2 1210.6306 -0.0022 0 65.67 7.00E-07 R QAGPAPAAATAASK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2366.2366.2.dta 127 IPI00794032.1 98 kDa protein 70 99346 2 2 2 2 7460 6740 1 0 1 878.4803 1754.9461 2 1754.9454 0.0007 0 22.21 0.026 K DLYLIPLSAQDPVPSK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7744.7744.2.dta 127 IPI00183350.1 Isoform 3 of Death-inducer obliterator 1 51 62513 1 1 1 1 2658 5243 1 0 1 538.8091 1075.6036 2 1075.6026 0.001 0 50.71 0.00012 R VEQFLTIAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6260.6260.2.dta 128 1 IPI00018009.2 Enhancer of mRNA decapping protein 3 97 56784 4 4 4 4 1252 5342 1 1 1 442.2555 882.4964 2 882.4963 0 0 22.02 0.0086 K FVIPLHSA - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6358.6358.2.dta 128 1 IPI00018009.2 Enhancer of mRNA decapping protein 3 97 56784 4 4 4 4 2645 1829 1 1 1 538.2902 1074.5659 2 1074.5669 -0.001 0 23.86 0.0058 K TQGQQVSSLK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2562.2562.2.dta 128 1 IPI00018009.2 Enhancer of mRNA decapping protein 3 97 56784 4 4 4 4 5435 1587 1 1 1 706.3796 1410.7447 2 1410.7467 -0.0019 0 74.97 1.30E-07 K KPASSSSAPQNIPK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2300.2300.2.dta 128 1 IPI00018009.2 Enhancer of mRNA decapping protein 3 97 56784 4 4 4 4 7154 1780 1 1 1 845.3982 1688.7818 2 1688.7788 0.003 0 22.14 0.0084 K SQDVAVSPQQQQCSK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2509.2509.2.dta 129 1 IPI00003377.1 "Isoform 1 of Splicing factor, arginine/serine-rich 7" 97 27578 4 4 4 4 2620 5075 1 1 1 537.2744 1072.5342 2 1072.5342 0 0 42.6 0.00061 R AFSYYGPLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6090.6090.2.dta 129 1 IPI00003377.1 "Isoform 1 of Splicing factor, arginine/serine-rich 7" 97 27578 4 4 4 4 3457 1202 1 1 1 393.4981 1177.4726 3 1177.4723 0.0003 0 44.75 5.70E-05 K GHYAYDCHR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1883.1883.3.dta 129 1 IPI00003377.1 "Isoform 1 of Splicing factor, arginine/serine-rich 7" 97 27578 4 4 4 4 6696 6758 1 1 0 811.3857 1620.7568 2 1620.7573 -0.0004 0 31.88 0.001 R NPPGFAFVEFEDPR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7761.7761.2.dta 129 1 IPI00003377.1 "Isoform 1 of Splicing factor, arginine/serine-rich 7" 97 27578 4 4 4 4 7341 3682 1 1 1 573.9738 1718.8994 3 1718.8951 0.0043 1 27.82 0.0032 K VYVGNLGTGAGKGELER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4596.4596.3.dta 129 2 IPI00010204.1 "Splicing factor, arginine/serine-rich 3" 55 19546 3 3 3 3 599 1197 1 0 1 383.6708 765.3271 2 765.3262 0.0009 0 22.31 0.035 R TLCGCR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1878.1878.2.dta 129 2 IPI00010204.1 "Splicing factor, arginine/serine-rich 3" 55 19546 3 3 3 3 2405 5161 1 0 1 522.269 1042.5235 2 1042.5236 -0.0001 0 37.53 0.0012 R AFGYYGPLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6178.6178.2.dta 129 2 IPI00010204.1 "Splicing factor, arginine/serine-rich 3" 55 19546 3 3 3 3 6696 6758 1 0 0 811.3857 1620.7568 2 1620.7573 -0.0004 0 31.88 0.001 R NPPGFAFVEFEDPR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7761.7761.2.dta 129 IPI00332419.6 "CDNA FLJ34106 fis, clone FCBBF3008073, highly similar to SPLICING FACTOR, ARGININE/SERINE-RICH 7" 80 16080 3 3 3 3 2620 5075 1 0 1 537.2744 1072.5342 2 1072.5342 0 0 42.6 0.00061 R AFSYYGPLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6090.6090.2.dta 129 IPI00332419.6 "CDNA FLJ34106 fis, clone FCBBF3008073, highly similar to SPLICING FACTOR, ARGININE/SERINE-RICH 7" 80 16080 3 3 3 3 3457 1202 1 0 1 393.4981 1177.4726 3 1177.4723 0.0003 0 44.75 5.70E-05 K GHYAYDCHR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1883.1883.3.dta 129 IPI00332419.6 "CDNA FLJ34106 fis, clone FCBBF3008073, highly similar to SPLICING FACTOR, ARGININE/SERINE-RICH 7" 80 16080 3 3 3 3 7341 3682 1 0 1 573.9738 1718.8994 3 1718.8951 0.0043 1 27.82 0.0032 K VYVGNLGTGAGKGELER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4596.4596.3.dta 129 IPI00744364.1 11 kDa protein 28 11331 1 1 1 1 7341 3682 1 0 1 573.9738 1718.8994 3 1718.8951 0.0043 1 27.82 0.0032 - VYVGNLGTGAGKGELER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4596.4596.3.dta 130 1 IPI00306369.3 NOL1/NOP2/Sun domain family 2 protein 97 87214 2 2 2 2 1956 2135 1 1 1 494.2459 986.4773 2 986.4781 -0.0008 0 81.9 7.50E-08 R GAEQLAEGGR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2894.2894.2.dta 130 1 IPI00306369.3 NOL1/NOP2/Sun domain family 2 protein 97 87214 2 2 2 2 4017 1502 1 1 1 621.322 1240.6294 2 1240.6299 -0.0005 1 35.65 0.0011 R KLSSETYSQAK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2208.2208.2.dta 131 1 IPI00026320.1 Ubiquitin-protein ligase EDD1 96 312352 3 3 3 3 1573 6545 1 1 1 467.7713 933.528 2 933.5284 -0.0004 0 31.85 0.001 R LSLELFGR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7551.7551.2.dta 131 1 IPI00026320.1 Ubiquitin-protein ligase EDD1 96 312352 3 3 3 3 6011 6363 1 1 1 745.4166 1488.8187 2 1488.8188 -0.0001 0 52.25 1.30E-05 R AYPAAITILETAQK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7370.7370.2.dta 131 1 IPI00026320.1 Ubiquitin-protein ligase EDD1 96 312352 3 3 3 3 7406 6568 1 1 1 870.4139 1738.8132 2 1738.8162 -0.003 0 42.27 0.00011 R TSDSPWFLSGSETLGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7574.7574.2.dta 132 1 IPI00220834.8 ATP-dependent DNA helicase 2 subunit 2 96 83222 7 7 7 7 629 2625 1 1 1 386.7325 771.4504 2 771.449 0.0014 0 38.32 0.0023 K SQIPLSK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3427.3427.2.dta 132 1 IPI00220834.8 ATP-dependent DNA helicase 2 subunit 2 96 83222 7 7 7 7 700 4526 2 0 1 394.2317 786.4488 2 786.4487 0.0001 0 30.34 0.018 K EGLEIVK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5509.5509.2.dta 132 1 IPI00220834.8 ATP-dependent DNA helicase 2 subunit 2 96 83222 7 7 7 7 1462 4118 1 1 1 460.2479 918.4812 2 918.4811 0.0001 0 24.36 0.047 K TWTVVDAK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5068.5068.2.dta 132 1 IPI00220834.8 ATP-dependent DNA helicase 2 subunit 2 96 83222 7 7 7 7 2918 4839 1 1 1 556.7845 1111.5545 2 1111.555 -0.0004 0 19.5 0.031 R YGSDIVPFSK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5846.5846.2.dta 132 1 IPI00220834.8 ATP-dependent DNA helicase 2 subunit 2 96 83222 7 7 7 7 2961 6051 1 1 1 559.2617 1116.5089 2 1116.5096 -0.0008 0 41.55 0.00018 K CFSVLGFCK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7063.7063.2.dta 132 1 IPI00220834.8 ATP-dependent DNA helicase 2 subunit 2 96 83222 7 7 7 7 4670 5132 1 1 1 659.3431 1316.6717 2 1316.6725 -0.0007 0 32.25 0.0018 R HIEIFTDLSSR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6148.6148.2.dta 132 1 IPI00220834.8 ATP-dependent DNA helicase 2 subunit 2 96 83222 7 7 7 7 5179 6386 1 1 1 690.8483 1379.682 2 1379.682 -0.0001 0 38.62 0.0028 K TDTLEDLFPTTK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7394.7394.2.dta 132 IPI00792121.1 Protein 44 20578 2 2 2 2 2918 4839 1 0 1 556.7845 1111.5545 2 1111.555 -0.0004 0 19.5 0.031 R YGSDIVPFSK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5846.5846.2.dta 132 IPI00792121.1 Protein 44 20578 2 2 2 2 2961 6051 1 0 1 559.2617 1116.5089 2 1116.5096 -0.0008 0 41.55 0.00018 K CFSVLGFCK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7063.7063.2.dta 132 IPI00791570.1 Hypothetical protein XRCC5 (Fragment) 32 18434 1 1 1 1 4670 5132 1 0 1 659.3431 1316.6717 2 1316.6725 -0.0007 0 32.25 0.0018 R HIEIFTDLSSR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6148.6148.2.dta 133 1 IPI00305068.5 Pre-mRNA-processing factor 6 96 107656 4 4 4 4 2515 5885 1 1 1 529.7957 1057.5769 2 1057.5767 0.0001 0 44.41 0.00084 R ESLEALLQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6896.6896.2.dta 133 1 IPI00305068.5 Pre-mRNA-processing factor 6 96 107656 4 4 4 4 2965 6789 1 1 1 559.3068 1116.599 2 1116.6001 -0.0012 0 47.23 0.0001 K AEVLWLMGAK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7793.7793.2.dta 133 1 IPI00305068.5 Pre-mRNA-processing factor 6 96 107656 4 4 4 4 3389 6111 1 1 1 585.8169 1169.6192 2 1169.6193 -0.0001 0 26.76 0.0087 K NPGLWLESVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7122.7122.2.dta 133 1 IPI00305068.5 Pre-mRNA-processing factor 6 96 107656 4 4 4 4 3439 5194 1 1 1 588.2879 1174.5613 2 1174.5618 -0.0006 0 43.43 0.00055 K SEDVWLEAAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6211.6211.2.dta 133 IPI00739440.1 similar to U5 snRNP-associated 102 kDa protein 75 47302 3 3 3 3 2515 5885 1 0 1 529.7957 1057.5769 2 1057.5767 0.0001 0 44.41 0.00084 R ESLEALLQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6896.6896.2.dta 133 IPI00739440.1 similar to U5 snRNP-associated 102 kDa protein 75 47302 3 3 3 3 2965 6789 1 0 1 559.3068 1116.599 2 1116.6001 -0.0012 0 47.23 0.0001 K AEVLWLMGAK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7793.7793.2.dta 133 IPI00739440.1 similar to U5 snRNP-associated 102 kDa protein 75 47302 3 3 3 3 3389 6111 1 0 1 585.8169 1169.6192 2 1169.6193 -0.0001 0 26.76 0.0087 K NPGLWLESVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7122.7122.2.dta 134 1 IPI00016910.1 Eukaryotic translation initiation factor 3 subunit 8 94 105962 3 3 3 3 2912 6524 1 1 1 556.345 1110.6755 2 1110.6761 -0.0006 0 62.39 1.90E-06 K ELLGQGLLLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7531.7531.2.dta 134 1 IPI00016910.1 Eukaryotic translation initiation factor 3 subunit 8 94 105962 3 3 3 3 3993 6223 1 1 1 619.3099 1236.6053 2 1236.606 -0.0007 0 45.2 0.00062 K CLEEFELLGK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7233.7233.2.dta 134 1 IPI00016910.1 Eukaryotic translation initiation factor 3 subunit 8 94 105962 3 3 3 3 4622 5539 1 1 1 437.6102 1309.8088 3 1309.8081 0.0006 1 28.22 0.0056 R AKELLGQGLLLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6553.6553.3.dta 134 IPI00738727.1 EIF3S8 protein 73 37827 2 2 2 2 2912 6524 1 0 1 556.345 1110.6755 2 1110.6761 -0.0006 0 62.39 1.90E-06 K ELLGQGLLLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7531.7531.2.dta 134 IPI00738727.1 EIF3S8 protein 73 37827 2 2 2 2 4622 5539 1 0 1 437.6102 1309.8088 3 1309.8081 0.0006 1 28.22 0.0056 R AKELLGQGLLLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6553.6553.3.dta 135 1 IPI00005613.3 Splicing factor U2AF 35 kDa subunit 94 28368 1 1 1 1 5124 1719 1 1 1 687.3239 1372.6333 2 1372.6331 0.0002 0 94.41 1.40E-09 R NPQNSSQSADGLR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2443.2443.2.dta 136 1 IPI00414481.5 213 kDa protein 93 214934 4 4 4 4 780 2098 1 1 1 401.7252 801.4359 2 801.4344 0.0015 0 29.56 0.048 R SAIEQVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2854.2854.2.dta 136 1 IPI00414481.5 213 kDa protein 93 214934 4 4 4 4 2315 4529 1 1 1 515.78 1029.5454 2 1029.5454 -0.0001 0 32.99 0.0028 R NLSEEGLLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5512.5512.2.dta 136 1 IPI00414481.5 213 kDa protein 93 214934 4 4 4 4 3556 6449 1 1 1 596.3521 1190.6897 2 1190.6911 -0.0014 0 49.55 4.60E-05 R LIESLFTIQK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7456.7456.2.dta 136 1 IPI00414481.5 213 kDa protein 93 214934 4 4 4 4 3846 4333 1 1 1 612.7993 1223.584 2 1223.5856 -0.0017 0 43.46 8.40E-05 K VCLAEVYQDK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5300.5300.2.dta 137 1 IPI00297211.1 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 91 122513 5 5 5 5 1278 6091 1 1 1 446.2628 890.5111 2 890.5113 -0.0001 0 33.23 0.0048 R LFELLEK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7103.7103.2.dta 137 1 IPI00297211.1 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 91 122513 5 5 5 5 3054 3926 2 0 1 564.8213 1127.628 2 1127.6299 -0.0018 0 35.58 0.002 R LDSIVIQQGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4860.4860.2.dta 137 1 IPI00297211.1 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 91 122513 5 5 5 5 3841 3459 1 1 1 612.2975 1222.5805 2 1222.583 -0.0024 0 56.35 7.60E-06 R FITDNTVEER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4355.4355.2.dta 137 1 IPI00297211.1 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 91 122513 5 5 5 5 3924 6483 1 1 1 616.8364 1231.6583 2 1231.6594 -0.0011 0 16.82 0.026 R CNTLITLIER E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7489.7489.2.dta 137 1 IPI00297211.1 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 91 122513 5 5 5 5 7386 5943 1 1 1 867.4072 1732.7998 2 1732.8003 -0.0005 0 24.38 0.014 K ESEITDEDIDGILER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6954.6954.2.dta 137 IPI00216046.2 Isoform 1 of Probable global transcription activator SNF2L1 47 123211 2 2 2 2 1278 6091 1 0 1 446.2628 890.5111 2 890.5113 -0.0001 0 33.23 0.0048 R LFELLEK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7103.7103.2.dta 137 IPI00216046.2 Isoform 1 of Probable global transcription activator SNF2L1 47 123211 2 2 2 2 3054 3926 2 0 1 564.8213 1127.628 2 1127.6299 -0.0018 0 35.58 0.002 R LDSIVIQQGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4860.4860.2.dta 138 1 IPI00030131.3 "Isoform Beta of Lamina-associated polypeptide 2, isoforms beta/gamma" 91 50696 4 4 4 4 2643 641 1 1 1 538.2778 1074.541 2 1074.5418 -0.0008 1 33.01 0.014 K LREQGTESR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1275.1275.2.dta 138 1 IPI00030131.3 "Isoform Beta of Lamina-associated polypeptide 2, isoforms beta/gamma" 91 50696 4 4 4 4 4782 4097 1 1 1 665.8588 1329.703 2 1329.7041 -0.0011 0 61.04 5.00E-06 K YGVNPGPIVGTTR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5045.5045.2.dta 138 1 IPI00030131.3 "Isoform Beta of Lamina-associated polypeptide 2, isoforms beta/gamma" 91 50696 4 4 4 4 5134 5696 1 1 1 687.8597 1373.7048 2 1373.7078 -0.003 0 40.93 0.0006 M PEFLEDPSVLTK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6709.6709.2.dta 138 1 IPI00030131.3 "Isoform Beta of Lamina-associated polypeptide 2, isoforms beta/gamma" 91 50696 4 4 4 4 8401 4265 1 1 1 857.407 2569.1993 3 2569.2045 -0.0052 1 18.41 0.019 K GPPDFSSDEEREPTPVLGSGAAAAGR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5227.5227.3.dta 139 1 IPI00300053.3 Keratin type II cuticular Hb2 91 58015 3 3 3 3 32 1747 1 0 0 302.1898 602.365 2 602.3639 0.0011 0 24.89 0.047 K LLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2474.2474.2.dta 139 1 IPI00300053.3 Keratin type II cuticular Hb2 91 58015 3 3 3 3 2369 2682 1 1 1 519.746 1037.4774 2 1037.4778 -0.0004 0 58.07 1.50E-05 K AQYDDIASR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3489.3489.2.dta 139 1 IPI00300053.3 Keratin type II cuticular Hb2 91 58015 3 3 3 3 2599 4723 1 1 1 536.3055 1070.5964 2 1070.5971 -0.0007 0 55.22 4.80E-05 K LAGLEEALQK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5723.5723.2.dta 140 1 IPI00384456.4 Isoform GTBP-N of DNA mismatch repair protein MSH6 89 154514 5 5 5 5 1604 2724 1 1 1 470.2427 938.4709 2 938.4709 0 0 33.86 0.0025 R YSDSLVQK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3534.3534.2.dta 140 1 IPI00384456.4 Isoform GTBP-N of DNA mismatch repair protein MSH6 89 154514 5 5 5 5 1635 6749 1 1 1 471.8152 941.6158 2 941.6161 -0.0003 1 51.17 7.60E-06 K LLTLIKEL - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7753.7753.2.dta 140 1 IPI00384456.4 Isoform GTBP-N of DNA mismatch repair protein MSH6 89 154514 5 5 5 5 3790 6430 1 1 1 609.3134 1216.6123 2 1216.6128 -0.0005 0 25.08 0.0044 R QSTLYSFFPK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7437.7437.2.dta 140 1 IPI00384456.4 Isoform GTBP-N of DNA mismatch repair protein MSH6 89 154514 5 5 5 5 5693 4613 1 1 1 483.237 1446.6891 3 1446.6892 -0.0001 0 20.78 0.013 R VHVQFFDDSPTR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5603.5603.3.dta 140 1 IPI00384456.4 Isoform GTBP-N of DNA mismatch repair protein MSH6 89 154514 5 5 5 5 6116 5840 1 1 1 755.8794 1509.7442 2 1509.7463 -0.0021 0 21.76 0.017 R YQLEIPENFTTR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6850.6850.2.dta 140 IPI00106847.3 Isoform GTBP-alt of DNA mismatch repair protein MSH6 52 121627 4 4 4 4 1604 2724 1 0 1 470.2427 938.4709 2 938.4709 0 0 33.86 0.0025 R YSDSLVQK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3534.3534.2.dta 140 IPI00106847.3 Isoform GTBP-alt of DNA mismatch repair protein MSH6 52 121627 4 4 4 4 3790 6430 1 0 1 609.3134 1216.6123 2 1216.6128 -0.0005 0 25.08 0.0044 R QSTLYSFFPK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7437.7437.2.dta 140 IPI00106847.3 Isoform GTBP-alt of DNA mismatch repair protein MSH6 52 121627 4 4 4 4 5693 4613 1 0 1 483.237 1446.6891 3 1446.6892 -0.0001 0 20.78 0.013 R VHVQFFDDSPTR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5603.5603.3.dta 140 IPI00106847.3 Isoform GTBP-alt of DNA mismatch repair protein MSH6 52 121627 4 4 4 4 6116 5840 1 0 1 755.8794 1509.7442 2 1509.7463 -0.0021 0 21.76 0.017 R YQLEIPENFTTR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6850.6850.2.dta 140 IPI00440122.1 Sperm protein 51 37751 1 1 1 1 1635 6749 1 0 1 471.8152 941.6158 2 941.6161 -0.0003 1 51.17 7.60E-06 K LLTLIKEL - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7753.7753.2.dta 141 1 IPI00604620.3 Isoform 1 of Nucleolin 89 76625 5 5 5 5 775 608 1 1 1 401.2453 800.476 2 800.4756 0.0004 1 26.45 0.012 K AVTTPGKK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1240.1240.2.dta 141 1 IPI00604620.3 Isoform 1 of Nucleolin 89 76625 5 5 5 5 1035 4769 1 1 1 422.7606 843.5066 2 843.5065 0 0 23.11 0.03 K ALELTGLK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5771.5771.2.dta 141 1 IPI00604620.3 Isoform 1 of Nucleolin 89 76625 5 5 5 5 1590 4929 1 1 1 469.2529 936.4912 2 936.4917 -0.0004 0 25.37 0.039 K TGISDVFAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5940.5940.2.dta 141 1 IPI00604620.3 Isoform 1 of Nucleolin 89 76625 5 5 5 5 3563 933 1 1 1 596.8117 1191.6089 2 1191.6095 -0.0007 1 59.24 1.30E-05 R IVTDRETGSSK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1592.1592.2.dta 141 1 IPI00604620.3 Isoform 1 of Nucleolin 89 76625 5 5 5 5 6374 6198 1 1 1 781.3425 1560.6705 2 1560.6733 -0.0028 0 37.89 0.00048 K GFGFVDFNSEEDAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7209.7209.2.dta 141 IPI00183526.5 NCL protein 84 51667 3 3 3 3 775 608 1 0 1 401.2453 800.476 2 800.4756 0.0004 1 26.45 0.012 K AVTTPGKK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1240.1240.2.dta 141 IPI00183526.5 NCL protein 84 51667 3 3 3 3 3563 933 1 0 1 596.8117 1191.6089 2 1191.6095 -0.0007 1 59.24 1.30E-05 R IVTDRETGSSK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1592.1592.2.dta 141 IPI00183526.5 NCL protein 84 51667 3 3 3 3 6374 6198 1 0 1 781.3425 1560.6705 2 1560.6733 -0.0028 0 37.89 0.00048 K GFGFVDFNSEEDAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7209.7209.2.dta 141 IPI00444262.3 "CDNA FLJ45706 fis, clone FEBRA2028457, highly similar to Nucleolin" 83 65979 4 4 4 4 1035 4769 1 0 1 422.7606 843.5066 2 843.5065 0 0 23.11 0.03 K ALELTGLK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5771.5771.2.dta 141 IPI00444262.3 "CDNA FLJ45706 fis, clone FEBRA2028457, highly similar to Nucleolin" 83 65979 4 4 4 4 1590 4929 1 0 1 469.2529 936.4912 2 936.4917 -0.0004 0 25.37 0.039 K TGISDVFAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5940.5940.2.dta 141 IPI00444262.3 "CDNA FLJ45706 fis, clone FEBRA2028457, highly similar to Nucleolin" 83 65979 4 4 4 4 3563 933 1 0 1 596.8117 1191.6089 2 1191.6095 -0.0007 1 59.24 1.30E-05 R IVTDRETGSSK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1592.1592.2.dta 141 IPI00444262.3 "CDNA FLJ45706 fis, clone FEBRA2028457, highly similar to Nucleolin" 83 65979 4 4 4 4 6374 6198 1 0 1 781.3425 1560.6705 2 1560.6733 -0.0028 0 37.89 0.00048 K GFGFVDFNSEEDAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7209.7209.2.dta 142 1 IPI00299904.3 Isoform 1 of DNA replication licensing factor MCM7 88 81884 3 3 3 3 759 6274 1 1 1 400.2736 798.5326 2 798.5327 -0.0001 0 33.82 0.0018 R TLLAILR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7284.7284.2.dta 142 1 IPI00299904.3 Isoform 1 of DNA replication licensing factor MCM7 88 81884 3 3 3 3 2309 4937 1 1 1 515.3057 1028.5969 2 1028.5978 -0.0009 0 62.51 6.80E-06 K AGILTTLNAR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5949.5949.2.dta 142 1 IPI00299904.3 Isoform 1 of DNA replication licensing factor MCM7 88 81884 3 3 3 3 5869 5102 1 1 1 491.9441 1472.8104 3 1472.81 0.0005 0 33.5 0.0025 R TQRPADVIFATVR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6118.6118.3.dta 143 1 IPI00300631.3 Scaffold attachment factor B 88 103036 3 3 2 2 1586 634 1 1 1 313.1483 936.4231 3 936.4236 -0.0005 0 19.85 0.049 R MHVEHER R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1268.1268.3.dta 143 1 IPI00300631.3 Scaffold attachment factor B 88 103036 3 3 2 2 1587 636 1 1 1 469.2191 936.4237 2 936.4236 0.0001 0 45.47 0.0004 R MHVEHER R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1270.1270.2.dta 143 1 IPI00300631.3 Scaffold attachment factor B 88 103036 3 3 2 2 4989 5855 1 1 1 677.8405 1353.6664 2 1353.6677 -0.0014 0 63.14 1.40E-06 R NFWVSGLSSTTR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6867.6867.2.dta 144 1 IPI00014424.1 Elongation factor 1-alpha 2 86 50780 3 3 3 3 1173 3615 1 1 1 435.7737 869.5329 2 869.5334 -0.0005 0 29.19 0.0073 K QLIVGVNK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4524.4524.2.dta 144 1 IPI00014424.1 Elongation factor 1-alpha 2 86 50780 3 3 3 3 2991 2502 1 1 1 560.8028 1119.591 2 1119.5924 -0.0014 0 53.42 3.40E-05 K STTTGHLIYK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3294.3294.2.dta 144 1 IPI00014424.1 Elongation factor 1-alpha 2 86 50780 3 3 3 3 4641 5275 1 1 1 657.8741 1313.7337 2 1313.7343 -0.0006 0 44.05 0.00024 R EHALLAYTLGVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6291.6291.2.dta 144 IPI00431441.1 EEF1A1 protein 53 7639 1 1 1 1 2991 2502 1 0 1 560.8028 1119.591 2 1119.5924 -0.0014 0 53.42 3.40E-05 K STTTGHLIYK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3294.3294.2.dta 144 IPI00556204.1 Eukaryotic translation elongation factor 1 alpha 2 variant (Fragment) 53 37116 2 2 2 2 1173 3615 1 0 1 435.7737 869.5329 2 869.5334 -0.0005 0 29.19 0.0073 K QLIVGVNK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4524.4524.2.dta 144 IPI00556204.1 Eukaryotic translation elongation factor 1 alpha 2 variant (Fragment) 53 37116 2 2 2 2 4641 5275 1 0 1 657.8741 1313.7337 2 1313.7343 -0.0006 0 44.05 0.00024 R EHALLAYTLGVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6291.6291.2.dta 145 1 IPI00303063.7 SCC-112 protein 85 152274 2 2 2 2 4780 2210 1 1 1 665.8511 1329.6876 2 1329.6888 -0.0012 0 78.95 1.10E-07 R TVTAAGAENIQQK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2975.2975.2.dta 145 1 IPI00303063.7 SCC-112 protein 85 152274 2 2 2 2 6221 7297 1 1 1 765.4188 1528.8231 2 1528.8249 -0.0018 0 24.29 0.0053 K EVQLAQIFEPLSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8295.8295.2.dta 146 1 IPI00303105.3 Small ubiquitin-related modifier 1 precursor 85 11607 3 3 3 3 1294 681 1 1 1 448.2352 894.4558 2 894.4559 -0.0001 0 36.01 0.00042 R IADNHTPK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1319.1319.2.dta 146 1 IPI00303105.3 Small ubiquitin-related modifier 1 precursor 85 11607 3 3 3 3 1301 4843 1 1 1 448.7348 895.455 2 895.4552 -0.0002 0 37.24 0.0039 R FLFEGQR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5850.5850.2.dta 146 1 IPI00303105.3 Small ubiquitin-related modifier 1 precursor 85 11607 3 3 3 3 5029 3645 1 1 1 680.3483 1358.682 2 1358.683 -0.001 0 49.3 2.40E-05 K VIGQDSSEIHFK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4557.4557.2.dta 146 IPI00418254.3 LOC391257 protein 66 11592 2 2 2 2 1301 4843 1 0 1 448.7348 895.455 2 895.4552 -0.0002 0 37.24 0.0039 R FLFEGQR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5850.5850.2.dta 146 IPI00418254.3 LOC391257 protein 66 11592 2 2 2 2 5029 3645 1 0 1 680.3483 1358.682 2 1358.683 -0.001 0 49.3 2.40E-05 R VIGQDSSEIHFK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4557.4557.2.dta 146 IPI00477045.1 SMT3 suppressor of mif two 3 homolog 1 isoform b precursor 53 8850 2 2 2 2 1294 681 1 0 1 448.2352 894.4558 2 894.4559 -0.0001 0 36.01 0.00042 R IADNHTPK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1319.1319.2.dta 146 IPI00477045.1 SMT3 suppressor of mif two 3 homolog 1 isoform b precursor 53 8850 2 2 2 2 1301 4843 1 0 1 448.7348 895.455 2 895.4552 -0.0002 0 37.24 0.0039 R FLFEGQR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5850.5850.2.dta 147 1 IPI00011200.5 D-3-phosphoglycerate dehydrogenase 83 57356 2 2 2 2 1321 6140 1 1 1 450.287 898.5595 2 898.56 -0.0005 0 42.17 0.00055 K TLGILGLGR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7151.7151.2.dta 147 1 IPI00011200.5 D-3-phosphoglycerate dehydrogenase 83 57356 2 2 2 2 6003 4024 1 1 1 744.8664 1487.7182 2 1487.7216 -0.0034 0 64.31 5.50E-06 R AGTGVDNVDLEAATR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4966.4966.2.dta 148 1 IPI00782992.2 Isoform 1 of Serine/arginine repetitive matrix protein 2 81 300239 2 2 2 2 4534 4152 1 1 1 650.864 1299.7135 2 1299.7146 -0.0012 0 31.37 0.013 R TAAALAPASLTSAR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5105.5105.2.dta 148 1 IPI00782992.2 Isoform 1 of Serine/arginine repetitive matrix protein 2 81 300239 2 2 2 2 5165 3443 1 1 1 689.8738 1377.733 2 1377.7364 -0.0034 0 70.87 2.30E-07 R TPQAPASANLVGPR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4338.4338.2.dta 149 1 IPI00003515.1 Thyroid receptor-interacting protein 11 81 228184 4 4 4 4 2331 6642 1 1 1 516.8082 1031.6019 2 1031.6015 0.0004 0 60.32 5.20E-06 K ALAFEQLLK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7647.7647.2.dta 149 1 IPI00003515.1 Thyroid receptor-interacting protein 11 81 228184 4 4 4 4 2634 1203 1 1 1 537.7744 1073.5342 2 1073.5353 -0.0011 0 30.65 0.022 K IIEDQNQSK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1884.1884.2.dta 149 1 IPI00003515.1 Thyroid receptor-interacting protein 11 81 228184 4 4 4 4 3062 5174 2 0 1 565.3077 1128.6009 2 1128.5928 0.0082 0 35.98 0.0051 R TDVNPFLAPR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6191.6191.2.dta 149 1 IPI00003515.1 Thyroid receptor-interacting protein 11 81 228184 4 4 4 4 3306 1936 1 1 1 580.816 1159.6174 2 1159.6197 -0.0023 1 27.56 0.032 K SLQEKDATIR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2678.2678.2.dta 150 1 IPI00307155.7 Rho-associated protein kinase 2 81 161952 4 4 4 4 1953 1408 1 1 1 493.7729 985.5312 2 985.5305 0.0008 0 36.43 0.002 K IQQNQSIR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2106.2106.2.dta 150 1 IPI00307155.7 Rho-associated protein kinase 2 81 161952 4 4 4 4 3381 6825 1 1 1 585.337 1168.6595 2 1168.6604 -0.0009 0 28.92 0.0037 R LEGWLSLPVR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7829.7829.2.dta 150 1 IPI00307155.7 Rho-associated protein kinase 2 81 161952 4 4 4 4 3837 7078 1 1 1 611.8155 1221.6164 2 1221.6176 -0.0012 0 29.34 0.0018 K NLICAFLTDR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8078.8078.2.dta 150 1 IPI00307155.7 Rho-associated protein kinase 2 81 161952 4 4 4 4 3884 2273 1 1 1 615.3139 1228.6133 2 1228.616 -0.0027 0 44.79 0.00061 K QIQQLESNNR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3043.3043.2.dta 150 IPI00022542.1 Rho-associated protein kinase 1 29 159102 1 1 1 1 3837 7078 1 0 1 611.8155 1221.6164 2 1221.6176 -0.0012 0 29.34 0.0018 K NLICAFLTDR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8078.8078.2.dta 151 1 IPI00169434.3 150 kDa protein 81 150521 3 3 3 3 4647 4553 1 1 1 658.3455 1314.6764 2 1314.6779 -0.0015 0 60.93 2.00E-05 K SLLEIQQEEAR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5538.5538.2.dta 151 1 IPI00169434.3 150 kDa protein 81 150521 3 3 3 3 4872 4660 1 1 1 671.869 1341.7234 2 1341.7252 -0.0019 0 15.05 0.047 R ISDQNIIPSVTR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5654.5654.2.dta 151 1 IPI00169434.3 150 kDa protein 81 150521 3 3 3 3 5976 758 1 1 1 742.384 1482.7535 2 1482.7539 -0.0004 0 42.09 0.00011 K ALQQQQQQQQQK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1402.1402.2.dta 152 1 IPI00409671.2 DEAD box polypeptide 42 protein 80 103197 1 1 1 1 4849 6030 1 1 1 670.3817 1338.7488 2 1338.7507 -0.002 0 80.43 1.10E-07 K DIPVLVATDVAAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7042.7042.2.dta 153 1 IPI00219525.10 "6-phosphogluconate dehydrogenase, decarboxylating" 80 53619 1 1 1 1 6590 5543 1 1 1 796.4063 1590.7981 2 1590.8002 -0.0021 0 80.18 2.00E-07 K GILFVGSGVSGGEEGAR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6558.6558.2.dta 154 1 IPI00000874.1 Peroxiredoxin-1 79 22324 2 2 2 2 3604 5198 1 1 1 598.8192 1195.6239 2 1195.6237 0.0001 0 55.12 2.00E-05 R LVQAFQFTDK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6215.6215.2.dta 154 1 IPI00000874.1 Peroxiredoxin-1 79 22324 2 2 2 2 3749 4630 1 1 1 606.3404 1210.6662 2 1210.667 -0.0008 0 46.61 0.00033 R QITVNDLPVGR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5622.5622.2.dta 154 IPI00027350.3 Peroxiredoxin-2 47 22049 1 1 1 1 3749 4630 1 0 1 606.3404 1210.6662 2 1210.667 -0.0008 0 46.61 0.00033 R QITVNDLPVGR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5622.5622.2.dta 155 1 IPI00297191.1 CRSP complex subunit 2 78 162043 5 5 5 5 336 3177 1 0 0 350.1775 698.3404 2 698.3388 0.0016 0 21.45 0.043 K FFETR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4049.4049.2.dta 155 1 IPI00297191.1 CRSP complex subunit 2 78 162043 5 5 5 5 2158 5286 1 1 1 506.25 1010.4854 2 1010.4855 -0.0001 0 28.36 0.0078 R SLLDCTFR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6302.6302.2.dta 155 1 IPI00297191.1 CRSP complex subunit 2 78 162043 5 5 5 5 3089 6045 1 1 1 567.3007 1132.5869 2 1132.5877 -0.0008 0 34.04 0.0041 K ENIQDLVFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7057.7057.2.dta 155 1 IPI00297191.1 CRSP complex subunit 2 78 162043 5 5 5 5 4448 5511 1 1 1 645.8578 1289.7011 2 1289.702 -0.0008 0 34.72 0.00055 K LVEGFYPAPGLK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6525.6525.2.dta 155 1 IPI00297191.1 CRSP complex subunit 2 78 162043 5 5 5 5 4512 6196 1 1 1 650.324 1298.6335 2 1298.6329 0.0006 0 35.02 0.00076 R LYECVLEFAR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7207.7207.2.dta 156 1 IPI00008982.1 Isoform Long of Delta 1-pyrroline-5-carboxylate synthetase 78 87989 2 2 2 2 3495 6281 1 1 1 592.8472 1183.6799 2 1183.6812 -0.0013 0 50.43 1.90E-05 R GPVGLEGLLTTK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7290.7290.2.dta 156 1 IPI00008982.1 Isoform Long of Delta 1-pyrroline-5-carboxylate synthetase 78 87989 2 2 2 2 3798 1776 1 1 1 609.8072 1217.5998 2 1217.6 -0.0002 0 44.46 0.00014 R QIAASSQDSVGR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2505.2505.2.dta 157 1 IPI00305152.6 SEC31 homolog A isoform 4 76 122544 3 3 3 3 938 745 1 0 1 419.7303 837.4461 2 837.4457 0.0004 0 17.9 0.047 R VLENHAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1388.1388.2.dta 157 1 IPI00305152.6 SEC31 homolog A isoform 4 76 122544 3 3 3 3 3016 5644 1 0 1 561.7934 1121.5722 2 1121.5717 0.0006 0 48.67 0.00021 K TTFEDLIQR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6659.6659.2.dta 157 1 IPI00305152.6 SEC31 homolog A isoform 4 76 122544 3 3 3 3 3718 1732 1 0 1 604.2848 1206.555 2 1206.5551 0 0 51.8 7.80E-05 R CLSSATDPQTK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2457.2457.2.dta 157 IPI00445429.1 "CDNA FLJ43909 fis, clone TESTI4010831" 77 106512 2 2 2 2 3016 5644 1 0 1 561.7934 1121.5722 2 1121.5717 0.0006 0 48.67 0.00021 K TTFEDLIQR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6659.6659.2.dta 157 IPI00445429.1 "CDNA FLJ43909 fis, clone TESTI4010831" 77 106512 2 2 2 2 3718 1732 1 0 1 604.2848 1206.555 2 1206.5551 0 0 51.8 7.80E-05 R CLSSATDPQTK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2457.2457.2.dta 158 1 IPI00006167.1 Protein phosphatase 2C isoform gamma 77 59919 1 1 1 1 4332 6436 1 1 1 638.8423 1275.67 2 1275.671 -0.001 0 76.86 4.60E-07 K ALEDAFLAIDAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7443.7443.2.dta 159 1 IPI00028888.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein D0 77 38581 2 2 2 2 3361 4188 1 1 1 584.2892 1166.5639 2 1166.5642 -0.0002 0 33.07 0.00079 K FGEVVDCTLK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5144.5144.2.dta 159 1 IPI00028888.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein D0 77 38581 2 2 2 2 6005 4818 1 1 1 744.882 1487.7494 2 1487.7508 -0.0014 0 63.6 8.10E-06 K IFVGGLSPDTPEEK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5823.5823.2.dta 159 2 IPI00334587.1 Isoform 2 of Heterogeneous nuclear ribonucleoprotein A/B 67 36059 3 3 3 3 2264 635 1 0 1 512.7801 1023.5456 2 1023.5461 -0.0005 1 26.26 0.022 K VLDQKEHR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1269.1269.2.dta 159 2 IPI00334587.1 Isoform 2 of Heterogeneous nuclear ribonucleoprotein A/B 67 36059 3 3 3 3 3361 4188 1 0 1 584.2892 1166.5639 2 1166.5642 -0.0002 0 33.07 0.00079 K FGEVVDCTIK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5144.5144.2.dta 159 2 IPI00334587.1 Isoform 2 of Heterogeneous nuclear ribonucleoprotein A/B 67 36059 3 3 3 3 6069 4927 1 0 1 752.3868 1502.759 2 1502.7617 -0.0027 0 47.47 0.00019 K IFVGGLNPEATEEK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5938.5938.2.dta 159 IPI00106509.2 Isoform 4 of Heterogeneous nuclear ribonucleoprotein A/B 41 31328 2 2 2 2 2264 635 1 0 1 512.7801 1023.5456 2 1023.5461 -0.0005 1 26.26 0.022 K VLDQKEHR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1269.1269.2.dta 159 IPI00106509.2 Isoform 4 of Heterogeneous nuclear ribonucleoprotein A/B 41 31328 2 2 2 2 3361 4188 1 0 1 584.2892 1166.5639 2 1166.5642 -0.0002 0 33.07 0.00079 K FGEVVDCTIK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5144.5144.2.dta 159 IPI00011274.2 heterogeneous nuclear ribonucleoprotein D-like 33 46580 1 1 1 1 3361 4188 1 0 1 584.2892 1166.5639 2 1166.5642 -0.0002 0 33.07 0.00079 R FGEVVDCTIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5144.5144.2.dta 160 1 IPI00182469.2 Isoform 1AB of Catenin delta-1 76 107853 3 3 3 3 556 2327 1 1 1 379.7116 757.4086 2 757.4082 0.0004 0 25.6 0.028 R NLAVDAR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3102.3102.2.dta 160 1 IPI00182469.2 Isoform 1AB of Catenin delta-1 76 107853 3 3 3 3 5066 4190 1 1 1 682.8303 1363.646 2 1363.648 -0.0021 0 56.32 5.40E-05 K SDFQVNLNNASR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5146.5146.2.dta 160 1 IPI00182469.2 Isoform 1AB of Catenin delta-1 76 107853 3 3 3 3 5719 6640 1 1 1 725.3891 1448.7636 2 1448.7664 -0.0027 0 43.53 0.00084 R GYELLFQPEVVR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7644.7644.2.dta 161 1 IPI00329791.8 Probable ATP-dependent RNA helicase DDX46 75 117803 6 6 6 6 1048 2485 1 1 1 423.7686 845.5227 2 845.5222 0.0004 0 27.02 0.0085 K VVTVVTTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3274.3274.2.dta 161 1 IPI00329791.8 Probable ATP-dependent RNA helicase DDX46 75 117803 6 6 6 6 2937 3863 1 1 1 557.8265 1113.6385 2 1113.6394 -0.0008 0 26.3 0.029 R GGTILAPTVSAK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4792.4792.2.dta 161 1 IPI00329791.8 Probable ATP-dependent RNA helicase DDX46 75 117803 6 6 6 6 3561 1760 1 1 1 596.8008 1191.587 2 1191.5884 -0.0014 0 43.63 0.00078 R LQNSYQPTNK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2488.2488.2.dta 161 1 IPI00329791.8 Probable ATP-dependent RNA helicase DDX46 75 117803 6 6 6 6 4611 6083 1 1 1 654.8453 1307.676 2 1307.6761 -0.0001 0 23.58 0.019 K NFYVEVPELAK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7095.7095.2.dta 161 1 IPI00329791.8 Probable ATP-dependent RNA helicase DDX46 75 117803 6 6 6 6 7582 6572 1 1 1 900.462 1798.9095 2 1798.9135 -0.004 0 16.15 0.031 R SLEEGEGPIAVIMTPTR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7578.7578.2.dta 161 1 IPI00329791.8 Probable ATP-dependent RNA helicase DDX46 75 117803 6 6 6 6 7841 4669 1 1 1 635.6412 1903.9017 3 1903.9064 -0.0047 1 34.77 0.00067 R AGNKGYAYTFITEDQAR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5664.5664.3.dta 162 1 IPI00374065.3 similar to melanoma inhibitory activity 3 isoform 1 74 214256 2 2 2 2 1303 5858 1 1 1 449.2485 896.4825 2 896.4828 -0.0003 1 20.37 0.031 K KHVQETR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.687.687.2.dta 162 1 IPI00374065.3 similar to melanoma inhibitory activity 3 isoform 1 74 214256 2 2 2 2 5583 6046 1 1 1 716.8788 1431.7431 2 1431.7457 -0.0025 0 71.94 2.30E-07 R TQTAISVVEEDLK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7058.7058.2.dta 163 1 IPI00006408.4 Nitric oxide synthase-interacting protein 74 33664 2 2 2 2 1588 2484 1 1 1 469.2404 936.4662 2 936.4665 -0.0004 0 43.77 0.00049 R GGTGFAGSGVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3273.3273.2.dta 163 1 IPI00006408.4 Nitric oxide synthase-interacting protein 74 33664 2 2 2 2 4979 2690 1 1 1 677.3217 1352.6288 2 1352.632 -0.0033 0 49.23 2.40E-05 K DTAASGYGTQNIR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3497.3497.2.dta 164 1 IPI00025512.2 Heat-shock protein beta-1 73 22826 2 2 2 2 2646 3178 1 1 1 538.2903 1074.5661 2 1074.5669 -0.0008 0 46.22 0.00045 R QLSSGVSEIR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4050.4050.2.dta 164 1 IPI00025512.2 Heat-shock protein beta-1 73 22826 2 2 2 2 7843 5872 1 1 1 953.4986 1904.9826 2 1904.9843 -0.0017 0 47.19 3.80E-05 K LATQSNEITIPVTFESR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6883.6883.2.dta 165 1 IPI00333010.7 calcium homeostasis endoplasmic reticulum protein 72 104150 1 1 1 1 4878 4442 1 1 1 672.3701 1342.7257 2 1342.7278 -0.0022 0 72.48 1.80E-07 K LALEQQQLICK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5418.5418.2.dta 166 1 IPI00442073.5 Cysteine and glycine-rich protein 1 72 21409 1 1 1 1 5586 5534 1 1 1 717.3434 1432.6723 2 1432.6736 -0.0012 0 71.71 2.50E-07 K GFGFGQGAGALVHSE - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6548.6548.2.dta 167 1 IPI00217468.3 Histone H1.5 71 22566 2 2 2 2 908 7867 1 1 0 416.2377 830.4608 2 830.461 -0.0002 1 32.52 0.017 K AVAASKER N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.893.893.2.dta 167 1 IPI00217468.3 Histone H1.5 71 22566 2 2 2 2 3759 4668 1 1 1 606.8441 1211.6736 2 1211.6761 -0.0026 0 63.8 5.40E-06 K ATGPPVSELITK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5663.5663.2.dta 167 2 IPI00217465.5 Histone H1.2 29 21352 2 2 2 2 908 7867 1 0 0 416.2377 830.4608 2 830.461 -0.0002 1 32.52 0.017 K AVAASKER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.893.893.2.dta 167 2 IPI00217465.5 Histone H1.2 29 21352 2 2 2 2 1870 3471 1 0 1 325.206 972.5961 3 972.5968 -0.0007 1 16.85 0.026 R SGVSLAALKK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4368.4368.3.dta 168 1 IPI00216587.9 40S ribosomal protein S8 71 24475 1 1 1 1 6090 5155 1 1 1 753.8932 1505.7718 2 1505.7726 -0.0007 0 70.67 1.60E-06 K ISSLLEEQFQQGK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6171.6171.2.dta 169 1 IPI00004450.1 testes-specific heterogenous nuclear ribonucleoprotein G-T 70 42929 1 1 1 1 5989 6518 1 1 1 743.8636 1485.7126 2 1485.714 -0.0014 0 70.38 1.50E-06 R GFAFVTFESPADAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7525.7525.2.dta 170 1 IPI00169383.3 Phosphoglycerate kinase 1 70 44985 3 3 3 3 803 1670 1 1 1 405.2114 808.4083 2 808.4079 0.0004 0 35.95 0.0044 K YAEAVTR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2390.2390.2.dta 170 1 IPI00169383.3 Phosphoglycerate kinase 1 70 44985 3 3 3 3 6793 4694 1 1 1 545.6025 1633.7858 3 1633.7849 0.0009 0 33.3 0.0011 K LGDVYVNDAFGTAHR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5691.5691.3.dta 170 1 IPI00169383.3 Phosphoglycerate kinase 1 70 44985 3 3 3 3 7507 6844 1 1 1 884.9713 1767.9281 2 1767.9301 -0.002 0 38.38 0.00025 K ACANPAAGSVILLENLR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7847.7847.2.dta 170 IPI00219568.4 "Phosphoglycerate kinase, testis specific" 33 45166 1 1 1 1 6793 4694 1 0 1 545.6025 1633.7858 3 1633.7849 0.0009 0 33.3 0.0011 K LGDVYVNDAFGTAHR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5691.5691.3.dta 171 1 IPI00000846.1 Isoform 1 of Chromodomain helicase-DNA-binding protein 4 70 219393 4 4 4 4 444 4940 1 1 0 364.2573 726.5001 2 726.5003 -0.0002 0 16.94 0.038 K LLLLQK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5952.5952.2.dta 171 1 IPI00000846.1 Isoform 1 of Chromodomain helicase-DNA-binding protein 4 70 219393 4 4 4 4 3393 3017 1 1 1 586.2775 1170.5405 2 1170.5418 -0.0013 0 24.61 0.0049 R WQDIQNDPR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3870.3870.2.dta 171 1 IPI00000846.1 Isoform 1 of Chromodomain helicase-DNA-binding protein 4 70 219393 4 4 4 4 5853 5211 1 1 1 735.8251 1469.6356 2 1469.6423 -0.0067 0 28.14 0.0023 R ENEFSFEDNAIR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6228.6228.2.dta 171 1 IPI00000846.1 Isoform 1 of Chromodomain helicase-DNA-binding protein 4 70 219393 4 4 4 4 6332 1436 1 1 1 518.5738 1552.6995 3 1552.7018 -0.0023 0 46.83 0.0001 R HHYEQQQEDLAR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2137.2137.3.dta 171 IPI00646871.2 Chromodomain helicase DNA binding protein 5 58 137235 2 2 2 2 5853 5211 1 0 1 735.8251 1469.6356 2 1469.6423 -0.0067 0 28.14 0.0023 R ENEFSFEDNAIR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6228.6228.2.dta 171 IPI00646871.2 Chromodomain helicase DNA binding protein 5 58 137235 2 2 2 2 6332 1436 1 0 1 518.5738 1552.6995 3 1552.7018 -0.0023 0 46.83 0.0001 R HHYEQQQEDLAR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2137.2137.3.dta 171 IPI00445286.2 Chromodomain helicase DNA binding protein 5 55 92084 2 2 2 2 3393 3017 1 0 1 586.2775 1170.5405 2 1170.5418 -0.0013 0 24.61 0.0049 R WQDIQNDPR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3870.3870.2.dta 171 IPI00445286.2 Chromodomain helicase DNA binding protein 5 55 92084 2 2 2 2 6332 1436 1 0 1 518.5738 1552.6995 3 1552.7018 -0.0023 0 46.83 0.0001 R HHYEQQQEDLAR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2137.2137.3.dta 171 IPI00373870.3 Isoform 1 of Chromodomain helicase-DNA-binding protein 3 47 227989 1 1 1 1 6332 1436 1 0 1 518.5738 1552.6995 3 1552.7018 -0.0023 0 46.83 0.0001 R HHYEQQQEDLAR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2137.2137.3.dta 171 IPI00444866.5 "CDNA FLJ45103 fis, clone BRAWH3032571, moderately similar to Chromodomain helicase-DNA-binding protein 4" 28 143205 1 1 1 1 5853 5211 1 0 1 735.8251 1469.6356 2 1469.6423 -0.0067 0 28.14 0.0023 R ENEFSFEDNAIR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6228.6228.2.dta 172 1 IPI00216654.1 Isoform Beta of Nucleolar phosphoprotein p130 69 74819 5 5 5 5 249 8341 1 1 0 336.7241 671.4336 2 671.433 0.0006 1 29.25 0.021 K KQVVAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.972.972.2.dta 172 1 IPI00216654.1 Isoform Beta of Nucleolar phosphoprotein p130 69 74819 5 5 5 5 443 7723 1 1 1 364.2274 726.4403 2 726.4388 0.0015 0 27.71 0.018 K GVKPQAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.875.875.2.dta 172 1 IPI00216654.1 Isoform Beta of Nucleolar phosphoprotein p130 69 74819 5 5 5 5 2361 1177 1 1 1 346.21 1035.6081 3 1035.6077 0.0005 0 29.17 0.0041 K SPAVKPAAAPK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1856.1856.3.dta 172 1 IPI00216654.1 Isoform Beta of Nucleolar phosphoprotein p130 69 74819 5 5 5 5 3011 1731 1 1 1 561.7791 1121.5437 2 1121.5465 -0.0028 1 20.94 0.026 R VADNSFDAKR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2456.2456.2.dta 172 1 IPI00216654.1 Isoform Beta of Nucleolar phosphoprotein p130 69 74819 5 5 5 5 3192 678 1 1 1 573.809 1145.6035 2 1145.604 -0.0005 0 46.37 0.00017 K NSSNKPAVTTK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1316.1316.2.dta 173 1 IPI00248395.7 similar to PR domain zinc finger protein 6 69 68087 2 2 2 2 1428 1214 1 1 1 457.7564 913.4983 2 913.4981 0.0002 0 29.1 0.018 K LAPTTQQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1896.1896.2.dta 173 1 IPI00248395.7 similar to PR domain zinc finger protein 6 69 68087 2 2 2 2 3131 3276 1 1 1 569.795 1137.5754 2 1137.5778 -0.0024 0 64.98 7.80E-06 R SFTQATQLSR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4157.4157.2.dta 174 1 IPI00005668.4 Aldo-keto reductase family 1 member C2 69 37111 2 2 2 2 384 2111 1 1 0 354.1957 706.3768 2 706.3762 0.0006 0 27.93 0.035 R YQLQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2868.2868.2.dta 174 1 IPI00005668.4 Aldo-keto reductase family 1 member C2 69 37111 2 2 2 2 1094 5040 1 1 1 427.7766 853.5387 2 853.5385 0.0002 0 63.41 2.10E-06 R TPALIALR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6055.6055.2.dta 175 1 IPI00013891.1 Isoform Long of Transformer-2 protein homolog 68 32726 1 1 1 1 6403 5350 1 1 1 783.8977 1565.7809 2 1565.7838 -0.003 0 68.41 4.00E-07 R YGPLSGVNVVYDQR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6366.6366.2.dta 176 1 IPI00554590.1 Isoform 1 of Rab3 GTPase-activating protein non-catalytic subunit 68 157482 1 1 1 1 3606 3757 1 1 1 598.8344 1195.6543 2 1195.6561 -0.0018 0 68.25 1.60E-06 K VSSLQAEPLPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4677.4677.2.dta 177 1 IPI00298058.1 Isoform 1 of Transcription elongation factor SPT5 67 121324 2 2 2 2 474 1536 1 1 1 367.214 732.4134 2 732.413 0.0004 0 28.1 0.007 R LTTVGSR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2245.2245.2.dta 177 1 IPI00298058.1 Isoform 1 of Transcription elongation factor SPT5 67 121324 2 2 2 2 3176 3856 1 1 1 572.8022 1143.5898 2 1143.5884 0.0014 0 61.16 1.80E-05 R DNELIGQTVR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4784.4784.2.dta 178 1 IPI00001735.5 nuclear receptor co-repressor 2 isoform 1 67 275248 3 3 3 3 1519 3347 1 1 1 464.7625 927.5105 2 927.5138 -0.0033 0 45.05 0.00057 R GSITQGIPR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4234.4234.2.dta 178 1 IPI00001735.5 nuclear receptor co-repressor 2 isoform 1 67 275248 3 3 3 3 1808 3951 1 1 1 483.2563 964.498 2 964.4978 0.0002 0 26.21 0.018 R GVSGVDLYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4887.4887.2.dta 178 1 IPI00001735.5 nuclear receptor co-repressor 2 isoform 1 67 275248 3 3 3 3 6337 5398 1 1 1 777.4459 1552.8773 2 1552.8825 -0.0052 0 36.13 0.00041 K GIITAVEPSTPTVLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6414.6414.2.dta 179 1 IPI00746388.1 Ezrin 66 69816 2 2 2 2 2987 5500 1 1 1 560.7849 1119.5552 2 1119.556 -0.0009 1 18.06 0.02 K QRIDEFEAL - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6514.6514.2.dta 179 1 IPI00746388.1 Ezrin 66 69816 2 2 2 2 3479 6002 1 1 1 591.8006 1181.5866 2 1181.5869 -0.0003 0 64.17 1.50E-06 K APDFVFYAPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7014.7014.2.dta 179 IPI00017367.5 Radixin 64 68635 1 1 1 1 3479 6002 1 0 1 591.8006 1181.5866 2 1181.5869 -0.0003 0 64.17 1.50E-06 K APDFVFYAPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7014.7014.2.dta 180 1 IPI00410693.3 Isoform 1 of Plasminogen activator inhibitor 1 RNA-binding protein 65 44995 1 1 1 1 5776 1043 1 1 1 730.858 1459.7014 2 1459.7015 -0.0001 0 65.38 7.40E-07 K SAAQAAAQTNSNAAGK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1711.1711.2.dta 181 1 IPI00166010.6 "CCR4-NOT transcription complex, subunit 1 isoform a" 65 269106 2 2 2 2 2921 6506 1 1 1 556.837 1111.6594 2 1111.6601 -0.0007 0 43.23 0.00025 R DAIAALGLLQK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7512.7512.2.dta 181 1 IPI00166010.6 "CCR4-NOT transcription complex, subunit 1 isoform a" 65 269106 2 2 2 2 3103 6502 1 1 1 567.8109 1133.6072 2 1133.6081 -0.0009 0 44.62 0.00059 R SPVTFLSDLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7509.7509.2.dta 181 IPI00032299.4 Adrenal gland protein AD-005 45 36447 1 1 1 1 3103 6502 1 0 1 567.8109 1133.6072 2 1133.6081 -0.0009 0 44.62 0.00059 R SPVTFLSDLR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7509.7509.2.dta 181 IPI00642900.2 CCR4-NOT transcription complex subunit 1 43 243216 1 1 1 1 2921 6506 1 0 1 556.837 1111.6594 2 1111.6601 -0.0007 0 43.23 0.00025 R DAIAALGLLQK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7512.7512.2.dta 182 1 IPI00374732.4 similar to peptidylprolyl isomerase A isoform 1 65 24316 1 1 1 1 4076 4073 1 1 1 624.3172 1246.6198 2 1246.6227 -0.0029 1 64.85 4.30E-06 K KITIADCGQLE - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5019.5019.2.dta 183 1 IPI00289344.4 Isoform 1 of Nuclear receptor corepressor 1 64 270957 2 2 2 2 5414 6501 1 1 1 703.8733 1405.732 2 1405.7354 -0.0033 0 60.9 3.20E-06 R ALDPAAAAYLFQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7508.7508.2.dta 183 1 IPI00289344.4 Isoform 1 of Nuclear receptor corepressor 1 64 270957 2 2 2 2 6216 6307 1 1 1 764.3953 1526.776 2 1526.7763 -0.0003 0 19.99 0.013 R ESPVSAPLEGLICR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7316.7316.2.dta 183 IPI00791853.1 Nuclear receptor co-repressor 20 259741 1 1 1 1 6216 6307 1 0 1 764.3953 1526.776 2 1526.7763 -0.0003 0 19.99 0.013 R ESPVSAPLEGLICR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7316.7316.2.dta 184 1 IPI00010720.1 T-complex protein 1 subunit epsilon 63 60089 1 1 1 1 5283 5600 1 1 1 696.3738 1390.7331 2 1390.7344 -0.0013 1 62.97 1.20E-06 R DVDFELIKVEGK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6613.6613.2.dta 185 1 IPI00000873.3 Valyl-tRNA synthetase 63 141642 1 1 1 1 5849 5415 1 1 1 735.3893 1468.7641 2 1468.7634 0.0007 0 62.96 2.10E-06 R SSAQDPQAVLGALGR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6430.6430.2.dta 186 1 IPI00300371.5 Isoform 1 of Splicing factor 3B subunit 3 63 136575 1 1 1 1 7123 5624 1 1 1 841.4474 1680.8803 2 1680.8835 -0.0032 0 62.92 7.80E-06 K TPVEEVPAAIAPFQGR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6638.6638.2.dta 187 1 IPI00029778.3 Isoform 1 of Tumor suppressor p53-binding protein 1 62 215495 1 1 1 1 4888 5849 1 1 1 672.853 1343.6915 2 1343.6932 -0.0017 0 61.9 1.30E-05 K AADISLDNLVEGK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6860.6860.2.dta 188 1 IPI00031556.7 Splicing factor U2AF 65 kDa subunit 62 53809 4 4 4 4 314 4132 1 1 1 346.2105 690.4065 2 690.4064 0.0001 0 26.34 0.02 K AFNLVK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5083.5083.2.dta 188 1 IPI00031556.7 Splicing factor U2AF 65 kDa subunit 62 53809 4 4 4 4 2404 7074 1 1 1 522.269 1042.5234 2 1042.5236 -0.0002 0 38.21 0.00038 K NFAFLEFR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8073.8073.2.dta 188 1 IPI00031556.7 Splicing factor U2AF 65 kDa subunit 62 53809 4 4 4 4 2865 6164 1 1 1 552.8186 1103.6227 2 1103.6226 0 0 30.57 0.0083 K ELLTSFGPLK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7175.7175.2.dta 188 1 IPI00031556.7 Splicing factor U2AF 65 kDa subunit 62 53809 4 4 4 4 7849 4813 1 1 1 636.9993 1907.9762 3 1907.9775 -0.0014 0 22.02 0.0094 K SIEIPRPVDGVEVPGCGK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5818.5818.3.dta 189 1 IPI00328798.1 B-cell CLL/lymphoma 9-like 61 157427 1 1 1 1 6622 5197 1 1 1 800.4092 1598.8039 2 1598.8053 -0.0013 0 61.11 1.20E-05 R LGQDSLTPEQVAWR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6214.6214.2.dta 190 1 IPI00247871.1 Transcription elongation regulator 1 61 124110 2 2 2 2 4834 6713 1 1 1 669.3462 1336.6778 2 1336.6775 0.0003 0 44.85 9.80E-05 R EALFNEFVAAAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7717.7717.2.dta 190 1 IPI00247871.1 Transcription elongation regulator 1 61 124110 2 2 2 2 5286 5307 1 1 1 696.8447 1391.6749 2 1391.6755 -0.0006 0 31.97 0.0012 R YLVLDCVPEER R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6323.6323.2.dta 191 1 IPI00018278.3 Histone H2AV 61 13501 1 1 1 1 1647 4901 1 1 1 472.769 943.5234 2 943.524 -0.0005 0 60.64 1.70E-05 R AGLQFPVGR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5911.5911.2.dta 192 1 IPI00066641.4 81 kDa protein 60 81849 1 1 1 1 1130 6325 1 1 1 432.7401 863.4656 2 863.4654 0.0002 0 60.27 1.50E-05 K SGFLVWR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7333.7333.2.dta 193 1 IPI00550689.3 UPF0027 protein C22orf28 60 55688 1 1 1 1 5214 5784 1 1 1 693.3317 1384.6488 2 1384.651 -0.0023 0 59.74 1.10E-05 R SYNDELQFLEK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6796.6796.2.dta 194 1 IPI00015953.3 Isoform 1 of Nucleolar RNA helicase 2 59 87804 3 3 3 3 1347 477 1 1 1 452.2252 902.4359 2 902.4359 0 0 39.76 0.00072 R VYSGHQGR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1099.1099.2.dta 194 1 IPI00015953.3 Isoform 1 of Nucleolar RNA helicase 2 59 87804 3 3 3 3 3341 4931 1 1 1 582.8578 1163.701 2 1163.7026 -0.0016 0 35.46 0.00041 R APQVLVLAPTR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5942.5942.2.dta 194 1 IPI00015953.3 Isoform 1 of Nucleolar RNA helicase 2 59 87804 3 3 3 3 3823 6973 1 1 1 610.855 1219.6955 2 1219.6965 -0.001 0 19.84 0.043 R GVTFLFPIQAK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7974.7974.2.dta 195 1 IPI00024661.4 Protein transport protein Sec24C 59 119779 2 2 2 2 5100 2698 1 1 1 685.3497 1368.6849 2 1368.6885 -0.0036 0 50.5 0.00014 K SPVESTTEPPAVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3506.3506.2.dta 195 1 IPI00024661.4 Protein transport protein Sec24C 59 119779 2 2 2 2 7008 5128 1 1 1 833.9429 1665.8712 2 1665.8726 -0.0014 0 28.05 0.0023 K TLFQPQTGAYQTLAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6144.6144.2.dta 196 1 IPI00013894.1 Stress-induced-phosphoprotein 1 58 63227 2 2 2 2 2842 6605 2 1 1 550.8274 1099.6402 2 1099.6423 -0.0021 0 19.69 0.027 K LMDVGLIAIR - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7610.7610.2.dta 196 1 IPI00013894.1 Stress-induced-phosphoprotein 1 58 63227 2 2 2 2 6006 5739 1 1 1 744.8997 1487.7848 2 1487.7871 -0.0023 0 56.99 1.30E-05 R LAYINPDLALEEK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6751.6751.2.dta 197 1 IPI00291638.2 183 kDa protein 57 185435 2 2 2 2 561 1122 1 1 1 379.7229 757.4312 2 757.4334 -0.0021 0 47.9 0.00045 K QLQELK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1797.1797.2.dta 197 1 IPI00291638.2 183 kDa protein 57 185435 2 2 2 2 4835 5496 1 1 1 669.3497 1336.6848 2 1336.6874 -0.0027 0 35.34 0.0048 R TTNESLLTSFPK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6510.6510.2.dta 198 1 IPI00220219.6 Coatomer subunit beta~ 57 103278 3 3 3 3 3242 1418 1 1 1 577.3027 1152.5909 2 1152.5887 0.0022 0 32.12 0.0016 K HSEVQQANLK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2117.2117.2.dta 198 1 IPI00220219.6 Coatomer subunit beta~ 57 103278 3 3 3 3 3260 4431 1 1 1 578.2922 1154.5699 2 1154.572 -0.0021 0 27.26 0.0036 R VFNYNTLER V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5406.5406.2.dta 198 1 IPI00220219.6 Coatomer subunit beta~ 57 103278 3 3 3 3 3972 5315 1 1 1 618.3079 1234.6012 2 1234.6016 -0.0004 0 35.16 0.0059 K TFEVCDLPVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6330.6330.2.dta 199 1 IPI00383645.2 CGI-151 protein 56 45490 1 1 1 1 4474 4781 1 1 1 647.3373 1292.66 2 1292.6612 -0.0012 0 56.49 5.50E-05 R YAALSDQGLDIK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5784.5784.2.dta 200 1 IPI00296374.3 Isoform 1 of Zinc finger protein-like 1 56 34833 1 1 1 1 1542 4292 1 1 1 465.7613 929.508 2 929.5083 -0.0003 0 56.06 4.10E-05 K LATVNWAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5257.5257.2.dta 201 1 IPI00165434.3 similar to YLP motif-containing protein 1 (Nuclear protein ZAP3) (ZAP113) isoform 2 56 241723 2 2 2 2 2757 701 1 1 1 544.7534 1087.4923 2 1087.4934 -0.0011 0 15.76 0.033 R YEGHPAEGTK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1340.1340.2.dta 201 1 IPI00165434.3 similar to YLP motif-containing protein 1 (Nuclear protein ZAP3) (ZAP113) isoform 2 56 241723 2 2 2 2 5236 2535 1 1 1 694.3557 1386.6969 2 1386.6991 -0.0022 0 57.28 1.40E-05 K TTVQQEPLESGAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3329.3329.2.dta 202 1 IPI00017303.1 DNA mismatch repair protein Msh2 56 105418 2 2 2 2 198 3024 2 0 1 329.2054 656.3963 2 656.3969 -0.0007 0 34.2 0.0083 R QIIQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3878.3878.2.dta 202 1 IPI00017303.1 DNA mismatch repair protein Msh2 56 105418 2 2 2 2 4466 5720 1 1 1 646.836 1291.6574 2 1291.652 0.0054 0 44.58 0.00021 K NNSFVNEIISR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6732.6732.2.dta 203 1 IPI00019380.1 Nuclear cap-binding protein subunit 1 55 92864 1 1 1 1 4101 6647 1 1 1 625.8344 1249.6543 2 1249.6554 -0.0011 0 55.05 2.00E-05 K ATNDEIFSILK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7652.7652.2.dta 204 1 IPI00007927.3 Isoform 1 of Structural maintenance of chromosomes protein 2 55 136266 2 2 2 2 6133 5119 1 1 1 757.9176 1513.8207 2 1513.8239 -0.0033 0 56.66 2.20E-05 K TILEEEITPTIQK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6134.6134.2.dta 204 1 IPI00007927.3 Isoform 1 of Structural maintenance of chromosomes protein 2 55 136266 2 2 2 2 7995 5272 1 1 1 652.9961 1955.9665 3 1955.9702 -0.0037 0 15.88 0.032 R TVTLGGDVFDPHGTLSGGAR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6289.6289.3.dta 205 1 IPI00021187.4 Isoform 1 of RuvB-like 1 55 50538 1 1 1 1 3900 6213 1 1 1 615.8419 1229.6692 2 1229.6689 0.0002 0 54.89 3.90E-05 R EACGVIVELIK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7223.7223.2.dta 206 1 IPI00329745.4 "CDNA FLJ43793 fis, clone TESTI4000014, highly similar to 130 kDa leucine-rich protein" 55 160023 1 1 1 1 4297 2293 1 1 1 636.8301 1271.6456 2 1271.647 -0.0014 0 54.75 1.90E-05 K TVLDQQQTPSR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3065.3065.2.dta 207 1 IPI00003843.1 Isoform A1 of Tight junction protein ZO-2 54 134118 2 2 2 2 4365 2079 1 1 1 642.3168 1282.6191 2 1282.6193 -0.0002 0 25.72 0.0039 R YQEEPPAPQPK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2833.2833.2.dta 207 1 IPI00003843.1 Isoform A1 of Tight junction protein ZO-2 54 134118 2 2 2 2 6574 1960 1 1 1 794.3859 1586.7572 2 1586.7536 0.0036 0 42.83 9.60E-05 K SNPSAVAGNETPGASTK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2704.2704.2.dta 207 IPI00216246.3 Isoform C2 of Tight junction protein ZO-2 26 115227 1 1 1 1 4365 2079 1 0 1 642.3168 1282.6191 2 1282.6193 -0.0002 0 25.72 0.0039 R YQEEPPAPQPK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2833.2833.2.dta 208 1 IPI00163866.4 330 kDa protein 53 332411 1 1 1 1 4413 5397 1 1 1 644.3559 1286.6972 2 1286.6983 -0.001 0 53.37 4.00E-05 R ISNPSAFSIVPR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6413.6413.2.dta 209 1 IPI00550069.3 Ribonuclease inhibitor 53 51766 1 1 1 1 3740 5438 1 1 1 605.3506 1208.6867 2 1208.6877 -0.0009 0 52.7 2.80E-05 R VNPALAELNLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6454.6454.2.dta 210 1 IPI00163187.10 Fascin 53 55123 3 3 3 3 5645 3853 1 1 1 719.3577 1436.7009 2 1436.697 0.0039 0 37.75 0.0029 R LSCFAQTVSPAEK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4781.4781.2.dta 210 1 IPI00163187.10 Fascin 53 55123 3 3 3 3 6261 7238 1 1 1 769.8538 1537.6931 2 1537.6936 -0.0006 0 30.42 0.0014 K ASAETVDPASLWEY - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8237.8237.2.dta 210 1 IPI00163187.10 Fascin 53 55123 3 3 3 3 7630 4880 1 1 1 607.3281 1818.9624 3 1818.9628 -0.0004 0 19.75 0.014 R LVARPEPATGYTLEFR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5889.5889.3.dta 211 1 IPI00400922.4 RRP5 protein homolog 52 209973 1 1 1 1 3384 6096 1 1 1 585.3479 1168.6812 2 1168.6816 -0.0003 0 52.32 4.20E-05 K AINIGQLVDVK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7108.7108.2.dta 212 1 IPI00000875.6 Elongation factor 1-gamma 52 50429 2 2 2 2 586 4119 1 1 1 381.7111 761.4076 2 761.4072 0.0004 0 31.51 0.017 R TPEFLR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5069.5069.2.dta 212 1 IPI00000875.6 Elongation factor 1-gamma 52 50429 2 2 2 2 4938 4055 1 1 1 674.3713 1346.728 2 1346.7306 -0.0026 0 42.14 0.00018 K ALIAAQYSGAQVR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5000.5000.2.dta 213 1 IPI00293655.3 ATP-dependent RNA helicase DDX1 52 83349 1 1 1 1 5216 574 1 1 1 693.3416 1384.6687 2 1384.6695 -0.0008 0 51.7 2.90E-05 K SQHSGNAQVTQTK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1203.1203.2.dta 214 1 IPI00005648.1 Scaffold attachment factor B2 51 107921 1 1 1 1 4696 5542 1 1 1 660.8488 1319.6831 2 1319.6834 -0.0003 0 51.35 6.90E-05 R NLWVSGLSSTTR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6557.6557.2.dta 215 1 IPI00018350.3 DNA replication licensing factor MCM5 51 83031 2 2 2 2 4654 4511 1 1 1 658.8428 1315.6711 2 1315.6732 -0.0021 0 45.49 5.40E-05 R VLGIQVDTDGSGR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5493.5493.2.dta 215 1 IPI00018350.3 DNA replication licensing factor MCM5 51 83031 2 2 2 2 5464 6554 1 1 1 708.9078 1415.801 2 1415.8024 -0.0014 0 19.82 0.014 R LAALPNVYEVISK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7560.7560.2.dta 215 IPI00555581.1 Minichromosome maintenance deficient protein 5 variant (Fragment) 20 46288 1 1 1 1 5464 6554 1 0 1 708.9078 1415.801 2 1415.8024 -0.0014 0 19.82 0.014 R LAALPNVYEVISK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7560.7560.2.dta 216 1 IPI00009841.4 "CDNA FLJ31747 fis, clone NT2RI2007377, highly similar to RNA-BINDING PROTEIN EWS" 51 69208 2 2 2 2 5726 2823 1 1 1 725.8383 1449.662 2 1449.6624 -0.0004 0 48.52 2.80E-05 K GDATVSYEDPPTAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3656.3656.2.dta 216 1 IPI00009841.4 "CDNA FLJ31747 fis, clone NT2RI2007377, highly similar to RNA-BINDING PROTEIN EWS" 51 69208 2 2 2 2 7134 5158 1 1 1 842.9001 1683.7857 2 1683.7893 -0.0035 1 17.1 0.025 K AAVEWFDGKDFQGSK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6174.6174.2.dta 217 1 IPI00304589.4 182 kDa tankyrase 1-binding protein 51 182697 1 1 1 1 4469 6334 1 1 1 646.8583 1291.702 2 1291.7023 -0.0003 0 50.61 1.80E-05 R FAATTVEEILAK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7342.7342.2.dta 218 1 IPI00074330.7 Isoform 3 of Nucleoporin NDC1 50 64158 1 1 1 1 3477 5791 1 1 1 591.3129 1180.6113 2 1180.6128 -0.0015 1 50.45 0.00016 R LQQFLEFKE - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6803.6803.2.dta 219 1 IPI00217030.10 "40S ribosomal protein S4, X isoform" 50 29807 1 1 1 1 1994 5919 1 1 1 495.8025 989.5905 2 989.591 -0.0005 0 49.9 3.90E-05 R LSNIFVIGK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6929.6929.2.dta 220 1 IPI00328306.8 Zinc finger CCCH domain-containing protein 11A 50 90146 2 2 2 2 367 2147 1 0 1 352.6953 703.376 2 703.3752 0.0008 0 32.5 0.017 K IDSEIK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2907.2907.2.dta 220 1 IPI00328306.8 Zinc finger CCCH domain-containing protein 11A 50 90146 2 2 2 2 2948 6344 1 1 1 558.3188 1114.623 2 1114.6234 -0.0003 0 42.87 0.00068 K TLEEILLER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7352.7352.2.dta 221 1 IPI00029170.5 "CDNA FLJ12531 fis, clone NT2RM4000199" 50 37252 1 1 1 1 3331 6374 1 1 1 582.3245 1162.6344 2 1162.6346 -0.0002 0 49.65 0.00018 R AFSLASADLLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7381.7381.2.dta 222 1 IPI00177938.2 Isoform 2 of Transducin-like enhancer protein 3 49 82969 1 1 1 1 5980 2865 1 1 1 742.8699 1483.7252 2 1483.7267 -0.0015 0 48.83 0.00023 R NDAPTPGTSTTPGLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3704.3704.2.dta 223 1 IPI00005634.3 Tetratricopeptide repeat protein KIAA0372 49 177485 1 1 1 1 5606 6869 1 1 1 718.4159 1434.8172 2 1434.8194 -0.0022 0 48.57 2.80E-05 K SNPDQPAVILLLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7871.7871.2.dta 224 1 IPI00396370.5 Isoform 1 of Eukaryotic translation initiation factor 3 subunit 9 48 92833 1 1 1 1 5840 6384 1 1 1 734.3831 1466.7516 2 1466.7518 -0.0002 0 48.46 4.50E-05 K GTQGVVTNFEIFR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7392.7392.2.dta 225 1 IPI00039626.3 Isoform D of UPF0318 protein FAM120A 48 118415 1 1 1 1 5228 4759 1 1 1 693.8582 1385.7018 2 1385.7038 -0.002 1 48.21 7.70E-05 R EAALEAAVLNKEE - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5760.5760.2.dta 226 1 IPI00003964.3 "ubiquitin specific protease 9, X-linked isoform 4" 47 293733 1 1 1 1 3789 2417 1 1 1 609.3085 1216.6025 2 1216.6048 -0.0022 0 47.49 0.00043 R LAQQISDEASR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3199.3199.2.dta 227 1 IPI00029485.2 Isoform p150 of Dynactin-1 47 142348 1 1 1 1 5373 2165 1 1 1 702.3408 1402.6671 2 1402.6688 -0.0017 0 46.97 0.00028 R ELTNQQEASVER Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2926.2926.2.dta 228 1 IPI00005146.2 179 kDa protein 47 181728 3 3 3 3 2672 2148 1 1 1 540.2586 1078.5027 2 1078.5043 -0.0017 0 47.93 0.00025 R FINQDSAER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2908.2908.2.dta 228 1 IPI00005146.2 179 kDa protein 47 181728 3 3 3 3 3994 6850 1 1 1 619.3685 1236.7224 2 1236.723 -0.0007 0 19.61 0.018 K LFPAVPLPDIR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7852.7852.2.dta 228 1 IPI00005146.2 179 kDa protein 47 181728 3 3 3 3 7040 5324 1 1 1 834.4326 1666.8506 2 1666.8414 0.0092 0 14.69 0.048 R LQDYDVSSISALTQK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6340.6340.2.dta 228 IPI00828134.1 Isoform 2 of Limkain-b1 44 136628 2 2 2 2 2672 2148 1 0 1 540.2586 1078.5027 2 1078.5043 -0.0017 0 47.93 0.00025 R FINQDSAER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2908.2908.2.dta 228 IPI00828134.1 Isoform 2 of Limkain-b1 44 136628 2 2 2 2 7040 5324 1 0 1 834.4326 1666.8506 2 1666.8414 0.0092 0 14.69 0.048 R LQDYDVSSISALTQK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6340.6340.2.dta 228 IPI00645477.1 81 kDa protein 20 82401 1 1 1 1 3994 6850 1 0 1 619.3685 1236.7224 2 1236.723 -0.0007 0 19.61 0.018 K LFPAVPLPDIR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7852.7852.2.dta 228 IPI00374095.1 66 kDa protein 15 66850 1 1 1 1 7040 5324 1 0 1 834.4326 1666.8506 2 1666.8414 0.0092 0 14.69 0.048 R LQDYDVSSISALTQK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6340.6340.2.dta 229 1 IPI00157790.7 KIAA0368 protein 47 225491 2 2 2 2 154 1379 1 1 0 322.2293 642.4441 2 642.4428 0.0013 1 22.02 0.017 K AALLKK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2075.2075.2.dta 229 1 IPI00157790.7 KIAA0368 protein 47 225491 2 2 2 2 2219 5536 1 1 1 509.3026 1016.5907 2 1016.5906 0.0001 0 42.71 0.00022 K VYLGDIPLK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6550.6550.2.dta 230 1 IPI00220919.1 Isoform 3 of DNA (cytosine-5)-methyltransferase 1 47 146597 5 5 5 5 1719 4976 1 1 1 478.7385 955.4624 2 955.4624 0 1 19.45 0.042 R YTHHDRK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.599.599.2.dta 230 1 IPI00220919.1 Isoform 3 of DNA (cytosine-5)-methyltransferase 1 47 146597 5 5 5 5 1910 4617 1 1 1 490.7559 979.4972 2 979.4975 -0.0002 0 29.8 0.014 R FTEDSLLR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5608.5608.2.dta 230 1 IPI00220919.1 Isoform 3 of DNA (cytosine-5)-methyltransferase 1 47 146597 5 5 5 5 2198 765 1 1 1 339.186 1014.5361 3 1014.5359 0.0002 0 19.37 0.015 R VLHPEQHR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1410.1410.3.dta 230 1 IPI00220919.1 Isoform 3 of DNA (cytosine-5)-methyltransferase 1 47 146597 5 5 5 5 2365 6724 1 1 1 519.2921 1036.5697 2 1036.5706 -0.0009 0 30.81 0.01 R FFLLENVR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7729.7729.2.dta 230 1 IPI00220919.1 Isoform 3 of DNA (cytosine-5)-methyltransferase 1 47 146597 5 5 5 5 4237 6417 1 1 1 633.3138 1264.613 2 1264.6128 0.0002 0 24.82 0.0091 R FYFLEAYNAK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7424.7424.2.dta 231 1 IPI00022371.1 Histidine-rich glycoprotein precursor 47 60510 1 1 1 1 3033 7573 1 1 1 562.808 1123.6015 2 1123.6026 -0.0011 0 46.62 0.00043 R DGYLFQLLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8578.8578.2.dta 232 1 IPI00072534.2 Isoform 1 of UNC45 homolog A 46 104266 1 1 1 1 6760 6349 1 1 1 813.4576 1624.9007 2 1624.9036 -0.0028 0 46.41 4.40E-05 R ALIPLALEGTDVGQTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7357.7357.2.dta 233 1 IPI00179964.5 Isoform 1 of Polypyrimidine tract-binding protein 1 46 57357 2 2 2 2 137 1979 1 1 0 319.2115 636.4084 2 636.4071 0.0012 0 28.29 0.006 R VIHIR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2725.2725.2.dta 233 1 IPI00179964.5 Isoform 1 of Polypyrimidine tract-binding protein 1 46 57357 2 2 2 2 2000 2255 1 1 1 496.275 990.5354 2 990.5359 -0.0005 0 38.1 0.0011 K HQNVQLPR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3024.3024.2.dta 234 1 IPI00033561.3 Isoform 1 of RNA-binding protein with serine-rich domain 1 46 34188 1 1 1 1 7479 4963 1 1 1 880.8847 1759.7549 2 1759.7577 -0.0028 0 45.71 0.0001 K GYAYVEFENPDEAEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5976.5976.2.dta 235 1 IPI00016932.2 inositol polyphosphate phosphatase-like 1 46 139311 1 1 1 1 3172 6242 1 1 1 572.3527 1142.6908 2 1142.6911 -0.0003 0 45.64 8.90E-05 R LLLDTLQLSK - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7251.7251.2.dta 236 1 IPI00410666.1 Isoform 3 of Protein LAP4 46 178601 1 1 1 1 6009 6204 1 1 1 745.3852 1488.7558 2 1488.7572 -0.0014 0 45.64 5.30E-05 K ALEIADFSGNPLSR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7214.7214.2.dta 237 1 IPI00221384.1 Isoform Short of Collagen alpha-1(XII) chain precursor 45 206439 1 1 1 1 2958 5956 1 1 1 558.8184 1115.6222 2 1115.6227 -0.0005 0 45.05 9.60E-05 R IVEVFDIGPK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6967.6967.2.dta 238 1 IPI00657645.1 Isoform 2 of 5~-3~ exoribonuclease 1 45 194261 1 1 1 1 2964 5159 1 1 1 559.3035 1116.5924 2 1116.5928 -0.0004 0 44.78 0.00069 R ENFSVPVGLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6175.6175.2.dta 239 1 IPI00004068.2 Mediator of RNA polymerase II transcription subunit 12 45 250028 2 2 2 2 2997 6468 1 1 1 561.2902 1120.5658 2 1120.5665 -0.0008 0 30.42 0.02 K DNFWLVTAR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7474.7474.2.dta 239 1 IPI00004068.2 Mediator of RNA polymerase II transcription subunit 12 45 250028 2 2 2 2 3078 6421 1 1 1 566.3417 1130.6688 2 1130.67 -0.0012 0 36.83 0.00084 R IVDGAVFAVLK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7429.7429.2.dta 239 IPI00745010.1 TNRC11 protein 37 228860 1 1 1 1 3078 6421 1 0 1 566.3417 1130.6688 2 1130.67 -0.0012 0 36.83 0.00084 R IVDGAVFAVLK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7429.7429.2.dta 239 IPI00645480.1 Protein 30 14579 1 1 1 1 2997 6468 1 0 1 561.2902 1120.5658 2 1120.5665 -0.0008 0 30.42 0.02 K DNFWLVTAR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7474.7474.2.dta 240 1 IPI00216592.2 Isoform C1 of Heterogeneous nuclear ribonucleoproteins C1/C2 45 32375 2 2 2 2 1641 3016 1 1 1 472.2889 942.5632 2 942.5651 -0.0019 0 16.01 0.031 R VPPPPPIAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3869.3869.2.dta 240 1 IPI00216592.2 Isoform C1 of Heterogeneous nuclear ribonucleoproteins C1/C2 45 32375 2 2 2 2 4767 5976 1 1 1 665.3325 1328.6504 2 1328.6513 -0.001 0 43.08 9.10E-05 K GFAFVQYVNER N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6988.6988.2.dta 240 IPI00736458.1 similar to heterogeneous nuclear ribonucleoprotein C isoform b isoform 2 16 26507 1 1 1 1 1641 3016 1 0 1 472.2889 942.5632 2 942.5651 -0.0019 0 16.01 0.031 R VPPPPPIAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3869.3869.2.dta 241 1 IPI00219065.2 Isoform 5 of Glycogen debranching enzyme 44 174739 1 1 1 1 4906 6081 1 1 1 673.3765 1344.7384 2 1344.7402 -0.0018 0 44.3 7.00E-05 K SGGGYIVVDPILR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7093.7093.2.dta 242 1 IPI00791913.1 GATA zinc finger domain containing 2A 44 52766 2 2 2 2 115 977 7 0 1 315.221 628.4275 2 628.4272 0.0004 1 29.8 0.021 M IKQLK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1639.1639.2.dta 242 1 IPI00791913.1 GATA zinc finger domain containing 2A 44 52766 2 2 2 2 3857 2127 1 1 1 613.3481 1224.6817 2 1224.6826 -0.0009 0 34.29 0.00061 R LLQQGTAPAQAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2885.2885.2.dta 243 1 IPI00005154.1 FACT complex subunit SSRP1 44 81367 1 1 1 1 4883 6815 1 1 1 672.8322 1343.6498 2 1343.651 -0.0012 0 43.74 0.00079 R FDEISFVNFAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7819.7819.2.dta 244 1 IPI00018465.1 T-complex protein 1 subunit eta 44 59842 1 1 1 1 824 4708 1 1 1 406.2555 810.4964 2 810.4963 0.0001 0 43.67 0.00021 K ALEIIPR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5706.5706.2.dta 245 1 IPI00218421.1 Isoform 15 of Fibroblast growth factor receptor 2 precursor 43 79959 2 2 2 2 424 638 1 1 0 361.6956 721.3766 2 721.3759 0.0008 1 27.62 0.038 K NGKEFK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1272.1272.2.dta 245 1 IPI00218421.1 Isoform 15 of Fibroblast growth factor receptor 2 precursor 43 79959 2 2 2 2 1119 4819 1 1 1 431.7427 861.4709 2 861.4708 0.0001 0 42.79 0.0018 K IADFGLAR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5824.5824.2.dta 246 1 IPI00005978.8 "Splicing factor, arginine/serine-rich 2" 43 25461 2 2 2 2 327 4846 1 1 0 348.6951 695.3756 2 695.3755 0.0001 0 23.6 0.05 R GFAFVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5854.5854.2.dta 246 1 IPI00005978.8 "Splicing factor, arginine/serine-rich 2" 43 25461 2 2 2 2 1457 3954 1 1 1 459.7557 917.4969 2 917.4971 -0.0002 0 42.28 0.00049 R VGDVYIPR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4891.4891.2.dta 247 1 IPI00411614.1 WD repeat and HMG-box DNA-binding protein 1 43 127371 1 1 1 1 2385 4841 1 1 1 520.774 1039.5334 2 1039.5338 -0.0004 1 43.23 8.80E-05 K LSAFAFKQE - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5848.5848.2.dta 248 1 IPI00029601.4 Src substrate cortactin 43 61896 1 1 1 1 2750 1103 1 1 1 544.251 1086.4874 2 1086.4877 -0.0003 0 42.81 0.00013 K HCSQVDSVR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1776.1776.2.dta 249 1 IPI00028931.2 desmoglein 2 preproprotein 43 123016 1 1 1 1 8103 4836 1 1 1 682.3542 2044.0409 3 2044.0436 -0.0027 1 42.62 0.00016 K SLQEANAEKVTQEIVTER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5843.5843.3.dta 250 1 IPI00418169.3 annexin A2 isoform 1 43 40671 1 1 1 1 6289 7329 1 1 1 771.9277 1541.8408 2 1541.8413 -0.0005 0 42.62 0.00074 K GVDEVTIVNILTNR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8327.8327.2.dta 251 1 IPI00294627.3 Isoform 2 of Splicing factor 1 42 68817 1 1 1 1 3031 2129 1 1 1 562.7844 1123.5543 2 1123.5543 0 0 42.35 0.00011 R SITNTTVCTK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2887.2887.2.dta 252 1 IPI00299147.8 Small ubiquitin-related modifier 3 precursor 42 11687 3 3 3 3 278 943 1 1 0 341.6992 681.3838 2 681.381 0.0029 0 20.87 0.022 R HTPLSK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1603.1603.2.dta 252 1 IPI00299147.8 Small ubiquitin-related modifier 3 precursor 42 11687 3 3 3 3 311 2504 1 1 0 346.1817 690.3488 2 690.3483 0.0005 0 36.03 0.0028 R QGLSMR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3296.3296.2.dta 252 1 IPI00299147.8 Small ubiquitin-related modifier 3 precursor 42 11687 3 3 3 3 2719 2185 1 1 1 542.2747 1082.5348 2 1082.5356 -0.0008 0 21.28 0.01 K TENDHINLK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2948.2948.2.dta 253 1 IPI00025057.1 Isoform 2 of Double-stranded RNA-specific adenosine deaminase 42 134317 1 1 1 1 4432 6729 1 1 1 644.8308 1287.6471 2 1287.6493 -0.0022 0 42.11 0.001 R DINAVLIDMER Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7733.7733.2.dta 254 1 IPI00017297.1 Matrin-3 41 95078 3 3 3 3 1223 5643 1 1 1 439.2375 876.4605 2 876.4606 -0.0001 0 30.38 0.0056 K ALWFQGR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6657.6657.2.dta 254 1 IPI00017297.1 Matrin-3 41 95078 3 3 3 3 4724 2651 1 1 1 662.8403 1323.666 2 1323.6644 0.0016 0 23.69 0.02 R GNLGAGNGNLQGPR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3455.3455.2.dta 254 1 IPI00017297.1 Matrin-3 41 95078 3 3 3 3 8301 4967 1 1 1 788.0259 2361.0558 3 2361.0622 -0.0064 1 25.84 0.013 R DSFDDRGPSLNPVLDYDHGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5980.5980.3.dta 255 1 IPI00465248.5 Isoform alpha-enolase of Alpha-enolase 41 47481 1 1 1 1 815 850 1 1 1 405.7273 809.44 2 809.4395 0.0004 0 40.89 0.00076 K AVEHINK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1502.1502.2.dta 256 1 IPI00300074.3 Phenylalanyl-tRNA synthetase beta chain 41 66715 1 1 1 1 2329 6841 1 1 1 516.7953 1031.5761 2 1031.5764 -0.0002 0 40.65 0.0015 R DLLFQALGR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7844.7844.2.dta 257 1 IPI00297572.4 Intron-binding protein aquarius 41 172270 1 1 1 1 4743 4530 1 1 1 663.8527 1325.6909 2 1325.694 -0.0031 0 40.56 0.00016 R VGVPTVDLDAQGR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5513.5513.2.dta 258 1 IPI00465294.2 Cell division cycle 5-like protein 40 92422 1 1 1 1 1898 6226 1 1 1 489.821 977.6274 2 977.6273 0.0001 0 40.46 9.00E-05 R LGLLGLPAPK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7236.7236.2.dta 259 1 IPI00005780.3 Isoform 3 of UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit 40 118104 1 1 1 1 2863 5888 1 1 1 552.8002 1103.5859 2 1103.5863 -0.0004 0 39.98 0.0021 K AFLDSLPDVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6899.6899.2.dta 260 1 IPI00304885.1 Centromere protein C 1 40 107488 1 1 1 1 3113 4787 1 1 1 568.7664 1135.5183 2 1135.5219 -0.0036 1 39.69 0.00019 R STKYEMYSK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5790.5790.2.dta 261 1 IPI00219483.1 Isoform 2 of U1 small nuclear ribonucleoprotein 70 kDa 40 50644 1 1 1 1 1727 1678 1 1 1 479.2648 956.5151 2 956.5152 -0.0001 1 39.62 0.00091 R RGGADVNIR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2399.2399.2.dta 262 1 IPI00385001.3 Hypothetical protein DKFZp686L1653 (Fragment) 39 184586 1 1 1 1 2638 3635 1 1 1 537.7894 1073.5642 2 1073.5652 -0.001 0 39.22 0.0018 R TLQCLNAVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4546.4546.2.dta 263 1 IPI00387100.1 Ig kappa chain V-I region Roy 39 11889 1 1 1 1 1476 4450 1 1 1 461.765 921.5154 2 921.5171 -0.0017 0 39.19 0.0014 K LLIYDASK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5428.5428.2.dta 264 1 IPI00296909.3 Poly [ADP-ribose] polymerase 4 39 194633 1 1 1 1 3427 7360 1 1 1 587.3344 1172.6543 2 1172.6554 -0.0011 0 39.17 0.00021 K SPVDVLQIFR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8357.8357.2.dta 265 1 IPI00017375.1 Protein transport protein Sec23A 39 87004 1 1 1 1 5694 5510 1 1 1 724.371 1446.7274 2 1446.7289 -0.0015 0 39.16 0.00026 R AVLNPLCQVDYR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6524.6524.2.dta 266 1 IPI00217442.2 MASK-4E-BP3 protein 39 279056 1 1 1 1 3266 6541 1 1 1 578.3397 1154.6648 2 1154.6659 -0.0011 0 38.83 0.00023 R QEVVDLLLAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7548.7548.2.dta 267 1 IPI00299149.1 Small ubiquitin-related modifier 2 precursor 38 10921 3 3 3 3 278 943 1 0 0 341.6992 681.3838 2 681.381 0.0029 0 20.87 0.022 R HTPLSK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1603.1603.2.dta 267 1 IPI00299149.1 Small ubiquitin-related modifier 2 precursor 38 10921 3 3 3 3 311 2504 1 0 0 346.1817 690.3488 2 690.3483 0.0005 0 36.03 0.0028 R QGLSMR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3296.3296.2.dta 267 1 IPI00299149.1 Small ubiquitin-related modifier 2 precursor 38 10921 3 3 3 3 3611 2106 1 1 1 399.8669 1196.5789 3 1196.5785 0.0004 0 18.05 0.027 K TENNDHINLK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2863.2863.3.dta 268 1 IPI00217121.1 Uncharacterized protein C19orf21 38 75482 1 1 1 1 4853 1573 1 1 1 670.8436 1339.6726 2 1339.6732 -0.0006 0 38.14 0.002 R GTPAGTTPGASQAPK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2285.2285.2.dta 269 1 IPI00017669.5 Isoform 1 of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 38 46678 1 1 1 1 1855 1108 1 1 1 486.7453 971.4761 2 971.4785 -0.0024 0 37.83 0.002 R LGGNPGTNSR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1781.1781.2.dta 270 1 IPI00430472.1 Isoform 1 of Activating signal cointegrator 1 complex subunit 3 38 252985 2 2 2 2 3314 5235 2 0 1 581.316 1160.6174 2 1160.6289 -0.0115 0 29.15 0.026 K VSDSLTDLALK - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6252.6252.2.dta 270 1 IPI00430472.1 Isoform 1 of Activating signal cointegrator 1 complex subunit 3 38 252985 2 2 2 2 4040 5446 1 1 1 622.3565 1242.6985 2 1242.6932 0.0053 0 30.56 0.003 K SVGDVALSQIVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6461.6461.2.dta 271 1 IPI00329672.4 Myosin-Ie 37 127531 1 1 1 1 4493 7021 1 1 1 648.8448 1295.6751 2 1295.6762 -0.001 0 37.48 0.00031 R VFDFLVDSINK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8021.8021.2.dta 272 1 IPI00012136.1 Isoform BI-1-GGCAG of Voltage-dependent P/Q-type calcium channel subunit alpha-1A 37 283782 1 1 1 1 1537 490 1 1 1 465.2801 928.5456 2 928.5454 0.0002 1 37.27 0.0027 R KQNLLASR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1112.1112.2.dta 273 1 IPI00383565.4 Isoform 2 of Bromodomain adjacent to zinc finger domain protein 1A 37 176986 1 1 1 1 2324 6469 1 1 1 516.2919 1030.5693 2 1030.5699 -0.0006 0 37.07 0.0051 K DAIDPLLFK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7475.7475.2.dta 274 1 IPI00373968.5 IMP dehydrogenase/GMP reductase family protein 37 70998 2 2 2 2 20 2839 1 0 1 300.6949 599.3752 2 599.3755 -0.0003 0 34.71 0.0097 R ALQIR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3674.3674.2.dta 274 1 IPI00373968.5 IMP dehydrogenase/GMP reductase family protein 37 70998 2 2 2 2 2955 2478 1 1 1 558.7849 1115.5553 2 1115.5571 -0.0018 0 27.33 0.019 R GSQLEDQALR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3266.3266.2.dta 275 1 IPI00395813.1 Isoform 1 of Zinc finger protein 687 37 131898 1 1 1 1 4087 6073 1 1 1 624.8872 1247.7599 2 1247.7601 -0.0003 0 36.97 0.00047 K NVLGLVPQALPK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7085.7085.2.dta 276 1 IPI00014214.2 R3H domain protein 1 37 108266 1 1 1 1 1090 5988 1 0 1 427.2446 852.4746 2 852.4745 0.0001 0 36.73 0.0031 K LFGELFK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7000.7000.2.dta 277 1 IPI00044779.2 TC4 protein 36 12221 1 1 1 1 2202 3854 1 1 1 508.2932 1014.5719 2 1014.571 0.0009 0 36.33 0.0041 K LVLVGDGGTGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4782.4782.2.dta 278 1 IPI00012011.6 Cofilin-1 36 18719 1 1 1 1 4831 4421 1 1 1 669.3156 1336.6167 2 1336.6187 -0.002 0 36.23 0.00051 R YALYDATYETK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5395.5395.2.dta 279 1 IPI00008868.3 Microtubule-associated protein 1B 36 271651 1 1 1 1 6225 6664 1 1 1 765.9282 1529.8418 2 1529.8454 -0.0036 0 36.21 0.0004 R SVGNTIDPVILFQK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7669.7669.2.dta 280 1 IPI00654623.1 Tumor endothelial marker 6 36 129181 1 1 1 1 3508 2057 1 1 1 593.7925 1185.5705 2 1185.5738 -0.0033 0 35.69 0.00045 R QGSSAEQPLGGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2809.2809.2.dta 281 1 IPI00329208.3 KIAA0251 protein 36 55746 1 1 1 1 6117 6028 1 1 1 755.8828 1509.7511 2 1509.7504 0.0007 0 35.52 0.0024 R FFQELPGSDPVFK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7040.7040.2.dta 282 1 IPI00012007.6 Adenosylhomocysteinase 35 48255 1 1 1 1 1255 4915 1 1 1 442.7817 883.5489 2 883.5491 -0.0002 0 35.13 0.0017 R IILLAEGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5926.5926.2.dta 283 1 IPI00478834.3 Hypothetical protein FLJ10154 35 33197 1 1 1 1 1999 564 1 1 1 496.2675 990.5204 2 990.5206 -0.0002 1 34.86 0.0076 R STNTAVSRR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1192.1192.2.dta 284 1 IPI00012535.1 DnaJ homolog subfamily A member 1 35 45581 1 1 1 1 5736 4829 1 1 1 726.3719 1450.7293 2 1450.7303 -0.001 0 34.76 0.00055 K QISQAYEVLSDAK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5835.5835.2.dta 285 1 IPI00020127.1 Replication protein A 70 kDa DNA-binding subunit 34 68723 1 1 1 1 5370 5167 1 1 1 701.8997 1401.7849 2 1401.7868 -0.0019 0 34.46 0.00059 K VVPIASLTPYQSK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6183.6183.2.dta 286 1 IPI00024975.2 Kinesin-like protein KIF15 34 161030 1 1 1 1 5673 6853 1 1 1 721.8954 1441.7763 2 1441.7776 -0.0013 0 34.28 0.00076 K ANLNLENLLEATK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7856.7856.2.dta 287 1 IPI00453473.6 Histone H4 34 11360 1 1 1 1 4739 3385 1 1 1 663.3784 1324.7423 2 1324.7463 -0.004 0 34.01 0.0033 R DNIQGITKPAIR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4275.4275.2.dta 288 1 IPI00178953.3 Isoform 4 of Zinc finger protein 638 34 129378 1 1 1 1 1531 3304 1 1 1 465.2558 928.497 2 928.4978 -0.0007 0 34 0.0074 K ALEDVVQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4187.4187.2.dta 289 1 IPI00006725.1 Probable ATP-dependent RNA helicase DDX23 34 95930 1 1 1 1 4627 6851 1 1 1 656.3784 1310.7422 2 1310.7445 -0.0024 0 33.81 0.00079 K AQPLSLEELLAK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7853.7853.2.dta 290 1 IPI00030781.1 Isoform Alpha of Signal transducer and activator of transcription 1-alpha/beta 34 87850 1 1 1 1 5037 6741 1 1 1 680.8767 1359.7389 2 1359.7398 -0.0009 0 33.72 0.00069 K ELSAVTFPDIIR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7745.7745.2.dta 291 1 IPI00290791.1 Isoform A of Caspase-10 precursor 34 59597 1 1 1 1 1489 992 1 0 1 462.7673 923.5201 2 923.515 0.0051 1 33.55 0.0049 R MLKFLEK T Oxidation (M) 0.1000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1656.1656.2.dta 292 1 IPI00183294.3 Nuclear pore complex protein Nup214 33 214377 1 1 1 1 4608 1892 1 1 1 654.8311 1307.6476 2 1307.6569 -0.0093 0 33.43 0.0011 K ASSTSLTSTQPTK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2631.2631.2.dta 293 1 IPI00022460.1 Zinc finger protein 592 33 140148 2 2 2 2 174 2940 1 0 0 324.6802 647.3459 2 647.3425 0.0034 0 37.71 0.0058 K CSLLR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3787.3787.2.dta 293 1 IPI00022460.1 Zinc finger protein 592 33 140148 2 2 2 2 4483 2737 1 1 1 648.35 1294.6854 2 1294.6881 -0.0027 0 15.64 0.034 R VPTEPPATSVAAR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3549.3549.2.dta 294 1 IPI00012837.1 Kinesin heavy chain 33 110358 1 1 1 1 3722 5912 1 1 1 604.3317 1206.6488 2 1206.6496 -0.0008 0 32.71 0.0032 K LYLVDLAGSEK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6922.6922.2.dta 295 1 IPI00386718.3 Isoform Short of Probable global transcription activator SNF2L2 33 179349 2 2 2 2 154 1379 1 0 0 322.2293 642.4441 2 642.4428 0.0013 1 22.02 0.017 R AALLKK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2075.2075.2.dta 295 1 IPI00386718.3 Isoform Short of Probable global transcription activator SNF2L2 33 179349 2 2 2 2 3460 2519 1 1 1 589.7884 1177.5622 2 1177.5649 -0.0026 0 30.65 0.0098 R LCTVNSVEEK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3312.3312.2.dta 296 1 IPI00303341.6 Tumor necrosis factor-inducible protein TSG-6 precursor 32 31639 1 1 1 1 839 1170 1 1 1 408.2404 814.4662 2 814.4661 0.0002 1 32.44 0.018 K QLEAARK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1849.1849.2.dta 297 1 IPI00031627.2 217 kDa protein 32 218663 2 2 2 2 3107 2296 1 1 1 568.2778 1134.5411 2 1134.5418 -0.0007 0 25.83 0.0073 R QTFENQVNR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3068.3068.2.dta 297 1 IPI00031627.2 217 kDa protein 32 218663 2 2 2 2 3392 4410 1 1 1 585.8326 1169.6506 2 1169.6517 -0.0011 0 25.54 0.018 R NSINQVVQLR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5383.5383.2.dta 298 1 IPI00220317.3 DNA polymerase alpha catalytic subunit 32 167575 1 1 1 1 5016 5654 1 1 1 679.8177 1357.6209 2 1357.6224 -0.0014 0 32.35 0.0018 R YIFDAECALEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6668.6668.2.dta 299 1 IPI00038356.3 25 kDa protein 32 25641 1 1 1 1 566 1593 1 0 1 379.7426 757.4706 2 757.4698 0.0008 1 32.34 0.013 R KAGLLEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2307.2307.2.dta 300 1 IPI00298520.3 Hypothetical protein DKFZp686M09245 32 62129 1 1 1 1 5463 7317 1 1 1 708.87 1415.7254 2 1415.7256 -0.0002 0 32.3 0.0018 K NSNILEDLETLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8315.8315.2.dta 301 1 IPI00004968.1 Pre-mRNA-processing factor 19 32 55603 1 1 1 1 4694 5013 1 1 1 660.8428 1319.671 2 1319.6721 -0.0011 0 32.14 0.0086 K TLQLDNNFEVK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6027.6027.2.dta 302 1 IPI00010460.1 AH receptor-interacting protein 32 38096 1 1 1 1 5951 6238 1 1 1 739.9319 1477.8493 2 1477.8504 -0.0011 0 32.03 0.003 K VLELDPALAPVVSR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7248.7248.2.dta 303 1 IPI00182289.6 40S ribosomal protein S29 32 6900 1 1 1 1 1465 6599 1 1 1 460.7583 919.502 2 919.5015 0.0005 1 32.01 0.0086 K DIGFIKLD - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7604.7604.2.dta 304 1 IPI00291668.6 Tight junction protein 2 32 111993 1 1 1 1 4272 1961 1 1 1 635.3109 1268.6073 2 1268.6037 0.0036 0 31.78 0.001 R YQEDPPAPQPK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2705.2705.2.dta 305 1 IPI00018755.1 High mobility group protein 1-like 10 32 24374 2 2 2 2 1446 1415 1 1 1 306.1685 915.4835 3 915.4814 0.0021 1 31.63 0.021 K FKDPNAPK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2114.2114.3.dta 305 1 IPI00018755.1 High mobility group protein 1-like 10 32 24374 2 2 2 2 6155 3375 1 1 1 507.6183 1519.8331 3 1519.8358 -0.0027 1 20.65 0.012 K IKGEHPGLSIGDVAK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4264.4264.3.dta 305 IPI00011675.1 Isoform Sp100-HMG of Nuclear autoantigen Sp-100 32 101495 1 1 1 1 1446 1415 1 0 1 306.1685 915.4835 3 915.4814 0.0021 1 31.63 0.021 K FKDPNAPK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2114.2114.3.dta 306 1 IPI00003935.6 Histone H2B type 2-E 32 13912 1 1 1 1 1709 5435 1 0 1 477.3051 952.5957 2 952.5957 0 0 31.6 0.0016 R LLLPGELAK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6451.6451.2.dta 307 1 IPI00171611.7 Histone H3.2 31 15436 2 2 2 2 909 4305 1 0 1 416.251 830.4875 2 830.4861 0.0013 0 31.57 0.013 K STELLIR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5270.5270.2.dta 307 1 IPI00171611.7 Histone H3.2 31 15436 2 2 2 2 2330 2694 1 0 1 344.8702 1031.5887 3 1031.5876 0.0011 0 22.33 0.036 R YRPGTVALR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3502.3502.3.dta 307 IPI00742969.1 14 kDa protein 32 13852 1 1 1 1 909 4305 1 0 1 416.251 830.4875 2 830.4861 0.0013 0 31.57 0.013 K STELLIR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5270.5270.2.dta 307 IPI00413826.2 "similar to H3 histone, family 3B" 22 15273 1 1 1 1 2330 2694 1 0 1 344.8702 1031.5887 3 1031.5876 0.0011 0 22.33 0.036 R YRPGTVALR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3502.3502.3.dta 308 1 IPI00465044.2 Protein RCC2 32 56790 1 1 1 1 982 7493 1 1 1 421.7459 841.4773 2 841.477 0.0003 0 31.5 0.0093 R AARPATAGK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.849.849.2.dta 309 1 IPI00337602.4 A-kinase anchoring protein 95 (AKAP95) family protein 31 55878 1 1 1 1 7251 6639 1 1 1 849.9854 1697.9562 2 1697.9563 -0.0002 0 31.32 0.0012 R ESVLTATSILNNPIVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7643.7643.2.dta 310 1 IPI00008575.3 "Isoform 1 of KH domain-containing, RNA-binding, signal transduction-associated protein 1" 31 48311 2 2 2 2 389 4172 1 1 0 356.1949 710.3753 2 710.3752 0.0002 0 28.61 0.012 K FNFVGK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5127.5127.2.dta 310 1 IPI00008575.3 "Isoform 1 of KH domain-containing, RNA-binding, signal transduction-associated protein 1" 31 48311 2 2 2 2 2388 3131 1 1 1 520.8081 1039.6017 2 1039.6026 -0.0009 0 20.41 0.013 K ILGPQGNTIK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3998.3998.2.dta 311 1 IPI00026119.6 Ubiquitin-activating enzyme E1 31 57443 1 1 1 1 6751 6482 1 1 1 541.9741 1622.9004 3 1622.8992 0.0012 0 30.86 0.0013 R LAGTQPLEVLEAVQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7488.7488.3.dta 312 1 IPI00465261.2 Leukocyte-derived arginine aminopeptidase long form variant 31 111075 1 1 1 1 2117 5648 1 1 1 503.269 1004.5234 2 1004.5212 0.0021 0 30.68 0.0066 K LIELGMEGK V Oxidation (M) 0.000001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6662.6662.2.dta 313 1 IPI00414339.3 Deubiquitinating enzyme DUB2 31 60488 1 1 1 1 2518 1183 1 1 1 530.2787 1058.5429 2 1058.5468 -0.0039 1 30.52 0.023 R ALGAEATDRR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1863.1863.2.dta 314 1 IPI00289851.4 "solute carrier family 25, member 25 isoform c" 30 56372 1 1 1 1 1106 625 1 1 1 429.7558 857.4971 2 857.4971 0 1 30.49 0.025 K KIVQAGDK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1258.1258.2.dta 315 1 IPI00413272.3 Isoform 3 of CRSP complex subunit 3 30 157974 2 2 2 2 3127 6870 1 1 1 569.3127 1136.6109 2 1136.6117 -0.0008 0 27.94 0.0069 K LFDLLYPEK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7872.7872.2.dta 315 1 IPI00413272.3 Isoform 3 of CRSP complex subunit 3 30 157974 2 2 2 2 4268 6835 1 1 1 634.882 1267.7494 2 1267.75 -0.0006 0 22.16 0.039 K EVGNALLNVVLK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7838.7838.2.dta 315 IPI00472333.1 Isoform 2 of CRSP complex subunit 3 28 101910 1 1 1 1 3127 6870 1 0 1 569.3127 1136.6109 2 1136.6117 -0.0008 0 27.94 0.0069 K LFDLLYPEK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7872.7872.2.dta 316 1 IPI00793696.1 19 kDa protein 30 19569 1 1 1 1 353 2990 1 0 1 351.2315 700.4485 2 700.4483 0.0002 0 29.83 0.021 K LLLGASK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3841.3841.2.dta 317 1 IPI00464952.2 Splicing factor arginine/serine-rich 11 29 53624 1 1 1 1 7547 6586 1 1 1 892.4956 1782.9767 2 1782.9767 -0.0001 0 29.41 0.0017 R ALIVVPYAEGVIPDEAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7591.7591.2.dta 318 1 IPI00011276.1 "2-oxoisovalerate dehydrogenase subunit beta, mitochondrial precursor" 29 43779 1 1 1 1 4891 7019 1 1 1 448.916 1343.7261 3 1343.7384 -0.0122 0 29.28 0.0057 - MAVVAAAAGWLLR L Oxidation (M) 0.1000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.802.802.3.dta 319 1 IPI00033025.8 Isoform 1 of Septin-7 29 51062 1 1 1 1 2636 1528 1 1 1 537.7804 1073.5462 2 1073.5465 -0.0003 0 29.12 0.011 R ILEQQNSSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2236.2236.2.dta 320 1 IPI00028275.1 Cytoskeleton-associated protein 5 29 227076 1 1 1 1 5681 6151 1 1 1 722.3687 1442.7229 2 1442.7253 -0.0024 0 29.03 0.0019 K EGLDEVAGIINDAK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7162.7162.2.dta 321 1 IPI00295542.5 Nucleobindin-1 precursor 29 53846 1 1 1 1 3059 4921 1 1 1 565.2975 1128.5804 2 1128.5887 -0.0083 1 28.98 0.027 R EAELNAKAQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5932.5932.2.dta 322 1 IPI00444517.1 "CDNA FLJ45433 fis, clone BRHIP3040878" 29 15508 1 1 1 1 1383 5561 1 1 1 453.7433 905.4721 2 905.4719 0.0003 1 28.96 0.03 R GEFLRER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6575.6575.2.dta 323 1 IPI00219018.7 Glyceraldehyde-3-phosphate dehydrogenase 29 36201 1 1 1 1 5438 4864 1 1 1 706.3974 1410.7802 2 1410.7831 -0.0028 0 28.89 0.002 R GALQNIIPASTGAAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5872.5872.2.dta 324 1 IPI00385074.1 MSTP157 29 8515 1 1 1 1 1487 990 1 1 1 308.8372 923.4898 3 923.482 0.0078 1 28.75 0.024 R MKIIMEK D 2 Oxidation (M) 0.1000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1654.1654.3.dta 325 1 IPI00375358.2 Isoform 1 of Replication factor C subunit 1 29 128688 1 1 1 1 5206 7449 1 1 1 692.3945 1382.7744 2 1382.7769 -0.0025 0 28.61 0.0025 K IIDEDGLLNLIR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8447.8447.2.dta 326 1 IPI00477680.6 Isoform 2 of Myopalladin 29 115877 1 1 1 1 1720 432 1 1 1 478.7488 955.4831 2 955.4835 -0.0005 0 28.61 0.0068 R LTSAGQSHR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1065.1065.2.dta 327 1 IPI00395347.2 c-Mpl binding protein isoform a 28 81258 1 1 1 1 2741 504 1 1 1 543.7605 1085.5064 2 1085.4964 0.01 0 28.49 0.014 K QLEFCFSR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1127.1127.2.dta 328 1 IPI00026338.3 Isoform 3 of Zinc finger FYVE domain-containing protein 9 28 85492 1 1 1 1 2266 2928 1 1 1 513.2267 1024.4389 2 1024.4443 -0.0054 1 28.47 0.0021 R HHCRACGK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3774.3774.2.dta 329 1 IPI00445401.2 "Isoform 2 of HECT, UBA and WWE domain-containing protein 1" 28 483831 1 1 1 1 4334 4608 1 1 1 638.8472 1275.6799 2 1275.6823 -0.0024 0 28.43 0.0042 R IVNQPSSLFGSK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5598.5598.2.dta 330 1 IPI00173589.2 similar to 60S ribosomal protein L29 28 17380 1 1 1 1 1569 2099 1 1 1 467.741 933.4674 2 933.4702 -0.0028 1 28.18 0.05 K GVSCKLDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2855.2855.2.dta 331 1 IPI00827931.1 HRV Fab 025-VH (Fragment) 28 13017 1 1 1 1 729 1699 1 1 1 397.7294 793.4443 2 793.4446 -0.0003 1 28.12 0.015 K GRFTVSK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2422.2422.2.dta 332 1 IPI00293078.1 Probable ATP-dependent RNA helicase DDX27 28 90292 1 1 1 1 3520 6479 1 1 1 594.342 1186.6695 2 1186.671 -0.0015 0 27.95 0.018 K TAAFALPVLER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7485.7485.2.dta 333 1 IPI00152242.4 MGC27348 protein 28 20064 1 1 1 1 1427 7521 1 1 1 457.7562 913.4979 2 913.4981 -0.0002 0 27.77 0.028 R VEVLQGGGR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8518.8518.2.dta 334 1 IPI00218993.1 Isoform Beta of Heat-shock protein 105 kDa 28 92970 1 1 1 1 4704 6818 1 1 1 661.3613 1320.708 2 1320.7078 0.0002 0 27.73 0.0048 K VLGTAFDPFLGGK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7821.7821.2.dta 335 1 IPI00219005.3 FK506-binding protein 4 28 52057 1 1 1 1 2765 4193 1 1 1 544.808 1087.6015 2 1087.6026 -0.001 0 27.66 0.032 K VLQLYPNNK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5149.5149.2.dta 336 1 IPI00419054.1 "CDNA FLJ43586 fis, clone SKNMC2007504" 27 42528 1 1 1 1 440 1963 1 1 1 364.2092 726.4039 2 726.4024 0.0015 0 26.78 0.028 M SSPPALR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2708.2708.2.dta 337 1 IPI00178727.4 "CDNA FLJ36006 fis, clone TESTI2015437" 27 53227 1 1 1 1 1330 576 1 1 1 451.241 900.4675 2 900.4665 0.001 0 26.69 0.044 K VQQEIER V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1205.1205.2.dta 338 1 IPI00169325.1 WD repeat protein 36 27 106282 1 1 1 1 4927 6618 1 1 1 674.338 1346.6614 2 1346.6619 -0.0006 0 26.68 0.013 R IWIFDGPTGEGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7623.7623.2.dta 339 1 IPI00337385.2 similar to Pre-mRNA-processing factor 40 homolog A (Formin-binding protein 3) (Huntingtin yeast partner A) (Huntingtin-interacting protein HYPA/FBP11) (Fas ligand-associated factor 1) (NY-REN-6 antigen) isoform 3 27 110641 1 1 1 1 2346 5875 1 1 1 517.7973 1033.5801 2 1033.5808 -0.0007 0 26.53 0.0084 K LAFNSLLEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6886.6886.2.dta 340 1 IPI00033907.1 Anaphase-promoting complex subunit 1 26 218528 1 1 1 1 3721 6637 1 1 1 604.308 1206.6014 2 1206.6033 -0.0019 0 26.47 0.0097 R DLQEFVPFGR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7641.7641.2.dta 341 1 IPI00173947.1 Synaptic vesicle glycoprotein 2C 26 83315 1 1 1 1 2302 6043 1 1 1 515.2828 1028.551 2 1028.5502 0.0008 0 26.36 0.0067 K DSIVSVGQPK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7055.7055.2.dta 342 1 IPI00032406.1 DnaJ homolog subfamily A member 2 26 46344 1 1 1 1 4828 2367 1 1 1 669.2994 1336.5842 2 1336.5864 -0.0022 0 26.26 0.0092 K NVLCSACSGQGGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3145.3145.2.dta 343 1 IPI00073096.3 Isoform Alpha of Tripartite motif-containing protein 29 26 66478 1 1 1 1 3038 540 1 1 1 563.3035 1124.5925 2 1124.5938 -0.0013 1 26.21 0.0035 K VLHEDKQTR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1166.1166.2.dta 344 1 IPI00010418.4 Myosin-Ic 26 118763 1 1 1 1 7281 6532 1 1 1 853.9459 1705.8773 2 1705.8774 -0.0001 0 26.17 0.0035 R DGTIDFTPGSELLITK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7539.7539.2.dta 345 1 IPI00745911.1 Conserved hypothetical protein 26 12871 1 1 1 1 1007 3019 1 1 1 421.7584 841.5022 2 841.5021 0.0001 0 25.99 0.023 K LSSLGLPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3872.3872.2.dta 346 1 IPI00027461.2 Isoform 1 of cAMP response element-binding protein 5 26 57278 1 1 1 1 1086 6215 1 1 1 426.7686 851.5227 2 851.5229 -0.0001 0 25.98 0.0086 K QLLLTHK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7225.7225.2.dta 347 1 IPI00063523.9 similar to Temporarily Assigned Gene name family member 26 279530 1 1 1 1 1386 3369 1 1 1 302.8431 905.5075 3 905.5004 0.0071 0 25.89 0.032 R SLSISIMR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4258.4258.3.dta 348 1 IPI00749115.1 TRNA (guanine-N1-)-meThylTransferase family proTein 26 13891 1 1 1 1 3196 1270 1 1 1 574.2919 1146.5692 2 1146.5782 -0.009 0 25.89 0.0066 R AEISGPHSPPR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1957.1957.2.dta 349 1 IPI00007334.1 Isoform 1 of Apoptotic chromatin condensation inducer in the nucleus 26 152196 1 1 1 1 2900 839 1 1 1 555.7725 1109.5305 2 1109.5313 -0.0008 0 25.79 0.0055 R TSTSSSSVQAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1490.1490.2.dta 350 1 IPI00386765.2 "Isoform 7 of cAMP-specific 3~,5~-cyclic phosphodiesterase 4D" 26 23995 1 1 1 1 1148 5255 1 1 1 434.7661 867.5177 2 867.5178 -0.0001 0 25.78 0.0038 K LSPVISPR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6272.6272.2.dta 351 1 IPI00643308.1 Chromosome 9 open reading frame 58 26 5247 1 1 1 1 5027 2450 1 1 1 680.3306 1358.6467 2 1358.65 -0.0033 1 25.7 0.006 K KMISEVTGGSHDV - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3235.3235.2.dta 352 1 IPI00220289.7 Isoform 1 of Chromodomain-helicase-DNA-binding protein 6 25 308071 1 1 1 1 3322 5836 1 1 1 582.2911 1162.5677 2 1162.5692 -0.0015 0 25.49 0.0085 R ADPALCFLEK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6847.6847.2.dta 353 1 IPI00016461.4 Hypothetical protein DKFZp686K101 25 88859 1 1 1 1 1832 3670 1 0 1 485.2899 968.5653 2 968.5655 -0.0001 0 25.33 0.013 R VISGQQLPK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4584.4584.2.dta 354 1 IPI00030876.5 diaphanous 1 isoform 1 25 141942 2 2 2 2 849 5395 1 1 1 409.7605 817.5064 2 817.5061 0.0003 0 27.09 0.011 R LNAILFK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6410.6410.2.dta 354 1 IPI00030876.5 diaphanous 1 isoform 1 25 141942 2 2 2 2 5007 7106 1 1 1 679.3367 1356.6589 2 1356.6602 -0.0012 0 13.93 0.049 K ELGEYFLFDPK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8106.8106.2.dta 355 1 IPI00012726.4 Isoform 1 of Polyadenylate-binding protein 4 24 71080 1 1 1 1 4280 5826 1 1 1 635.8185 1269.6225 2 1269.6241 -0.0016 0 24.5 0.005 K EFSPFGSITSAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6837.6837.2.dta 356 1 IPI00030851.1 Protein transport protein Sec24B 24 138900 1 1 1 1 2137 2424 1 1 1 504.752 1007.4895 2 1007.4883 0.0011 0 24.25 0.016 R SVSSSLSDAR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3207.3207.2.dta 357 1 IPI00021338.1 "Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial precursor" 24 66195 1 1 1 1 6336 6950 1 1 1 777.4327 1552.8508 2 1552.8535 -0.0027 0 24.18 0.0054 R DVPLGTPLCIIVEK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7951.7951.2.dta 358 1 IPI00550037.3 "28S ribosomal protein S15, mitochondrial precursor" 24 29937 1 1 1 1 492 4528 1 0 1 372.2549 742.4952 2 742.4953 0 0 24.18 0.03 R IIALSVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5511.5511.2.dta 359 1 IPI00022462.2 Transferrin receptor protein 1 24 85274 1 1 1 1 5592 7080 1 1 1 717.4153 1432.8161 2 1432.8177 -0.0016 0 24.08 0.0055 K VSASPLLYTLIEK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8080.8080.2.dta 360 1 IPI00027486.3 Carcinoembryonic antigen-related cell adhesion molecule 5 precursor 24 77489 1 1 1 1 1752 3150 1 1 1 480.2507 958.4869 2 958.4832 0.0037 0 23.98 0.013 R LQLSNDNR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4020.4020.2.dta 361 1 IPI00414440.2 "CDNA FLJ29008 fis, clone TST06032" 24 38841 1 1 1 1 1342 828 1 1 1 451.7761 901.5377 2 901.5419 -0.0042 1 23.85 0.044 K QKVMVAVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1478.1478.2.dta 362 1 IPI00376439.1 Isoform 1 of Vacuolar protein sorting-associated protein 13B 23 454379 1 1 1 1 1251 2031 1 0 1 442.192 882.3694 2 882.3654 0.004 0 23.47 0.019 R ENGFCTR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2781.2781.2.dta 363 1 IPI00003421.3 T-brain-1 protein 23 74520 1 1 1 1 4380 7561 1 1 1 642.8618 1283.7091 2 1283.7085 0.0006 0 23.01 0.029 K LSPVLDGVSELR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8564.8564.2.dta 364 1 IPI00418262.4 Fructose-bisphosphate aldolase C 23 39830 1 1 1 1 7858 3026 1 1 1 479.2623 1913.0202 4 1913.0292 -0.009 1 22.7 0.013 R IVAPGKGILAADESVGSMAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3880.3880.4.dta 365 1 IPI00302927.6 T-complex protein 1 subunit delta 23 58401 1 1 1 1 1565 5878 1 1 1 467.2917 932.5688 2 932.5695 -0.0007 0 22.6 0.015 R AYILNLVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6889.6889.2.dta 366 1 IPI00554711.2 Junction plakoglobin 23 82376 1 1 1 1 4861 4241 1 1 1 671.3652 1340.7159 2 1340.7188 -0.0028 0 22.55 0.0077 K LLNDEDPVVVTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5201.5201.2.dta 367 1 IPI00001429.1 Protocadherin beta 4 precursor 23 87615 1 1 1 1 1438 1044 1 1 1 305.8473 914.52 3 914.5185 0.0015 0 22.51 0.032 R QTGDLLLR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1712.1712.3.dta 368 1 IPI00550212.3 cytoplasmic FMR1 interacting protein 1 isoform b 22 95660 1 1 1 1 4960 5977 1 1 1 676.3533 1350.692 2 1350.6932 -0.0012 0 22.5 0.042 R TVLPFSQEFQR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6989.6989.2.dta 369 1 IPI00294211.2 Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 22 141270 2 2 2 2 607 878 1 1 1 384.2119 766.4092 2 766.4086 0.0006 0 25.38 0.026 R HLGSTPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1532.1532.2.dta 369 1 IPI00294211.2 Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 22 141270 2 2 2 2 5772 7208 1 1 1 730.3962 1458.7779 2 1458.7792 -0.0013 0 14.44 0.044 R LMVEFPLDPALSK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8207.8207.2.dta 370 1 IPI00031545.2 "Isoform Long of Inositol 1,4,5-trisphosphate receptor type 2" 22 311288 1 1 1 1 5453 6674 1 1 1 707.8705 1413.7264 2 1413.7286 -0.0022 0 22.32 0.022 K CNSLLPLDDIVR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7679.7679.2.dta 371 1 IPI00044584.1 Testis-specific serine/threonine-protein kinase 3 22 30538 1 1 1 1 3320 6905 1 1 1 582.2784 1162.5422 2 1162.5441 -0.0019 0 22.05 0.017 K MGGPEEFIQR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7908.7908.2.dta 372 1 IPI00303226.1 Olfactory receptor 13H1 22 35117 1 1 1 1 1830 7613 1 1 1 484.7977 967.5808 2 967.5815 -0.0007 0 21.91 0.033 R VVAISNPLR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8623.8623.2.dta 373 1 IPI00007765.5 "Stress-70 protein, mitochondrial precursor" 22 73920 1 1 1 1 5046 6966 1 1 1 681.3749 1360.7353 2 1360.7351 0.0003 0 21.83 0.039 R AQFEGIVTDLIR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7967.7967.2.dta 374 1 IPI00427501.1 Isoform 1 of GH3 domain-containing protein precursor 22 58058 1 1 1 1 862 2448 1 1 1 411.7456 821.4767 2 821.4759 0.0008 0 21.79 0.034 R NHLPLTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3233.3233.2.dta 375 1 IPI00066974.4 133 kDa protein 22 135354 1 1 1 1 5343 2088 1 1 1 699.8456 1397.6767 2 1397.6786 -0.0019 0 21.66 0.0093 R LQPQEAPETETR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2843.2843.2.dta 376 1 IPI00292975.4 RNA-binding protein 27 22 119101 1 1 1 1 4923 5982 1 1 1 673.9107 1345.8069 2 1345.8082 -0.0013 0 21.56 0.021 R LQLGTPPPLLAAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6994.6994.2.dta 377 1 IPI00002483.4 Zinc transporter 1 22 56318 1 1 1 1 4338 5736 1 1 1 639.2985 1276.5825 2 1276.5904 -0.0079 0 21.54 0.043 K SSVVPCELACR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6748.6748.2.dta 378 1 IPI00166599.4 Isoform 1 of Uncharacterized protein C3orf23 22 58458 1 1 1 1 2270 6488 1 1 1 513.3027 1024.5908 2 1024.593 -0.0022 1 21.52 0.023 K SRILFHPR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7494.7494.2.dta 379 1 IPI00165619.2 152 kDa protein 22 152923 1 1 1 1 6122 6754 1 1 1 756.9341 1511.8537 2 1511.8559 -0.0021 0 21.51 0.026 R LSTAITLLPLEEGR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7758.7758.2.dta 380 1 IPI00031023.1 Protein flightless-1 homolog 21 146142 2 2 2 2 230 8044 1 1 1 335.6854 669.3562 2 669.3558 0.0004 0 20.01 0.022 R HATVSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.917.917.2.dta 380 1 IPI00031023.1 Protein flightless-1 homolog 21 146142 2 2 2 2 2959 7171 1 1 1 558.8229 1115.6313 2 1115.6339 -0.0026 0 17.18 0.044 K ADLTALFLPR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8170.8170.2.dta 381 1 IPI00292817.6 Novel protein 21 149343 1 1 1 1 935 8124 1 1 1 419.2324 836.4502 2 836.4505 -0.0002 1 21.07 0.033 K KFQTGTR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.931.931.2.dta 382 1 IPI00009071.2 Isoform 3 of FUS-interacting serine-arginine-rich protein 1 21 22457 1 1 1 1 4574 4683 1 1 1 652.8315 1303.6485 2 1303.6521 -0.0035 0 21.02 0.039 R QIEIQFAQGDR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.5679.5679.2.dta 383 1 IPI00016928.2 Homeobox protein CDX-2 21 33603 1 1 1 1 4283 1445 1 1 1 424.2379 1269.6917 3 1269.7041 -0.0124 0 21.01 0.018 R KPAQQSLGSQVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2146.2146.3.dta 384 1 IPI00023048.4 Elongation factor 1-delta 21 31217 1 1 1 1 5126 6559 1 1 1 687.3746 1372.7347 2 1372.7351 -0.0003 0 20.91 0.023 R SIQLDGLVWGASK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7565.7565.2.dta 385 1 IPI00398505.5 Ubiquitin carboxyl-terminal hydrolase 24 21 297200 1 1 1 1 4234 5837 1 1 1 632.8602 1263.7058 2 1263.7074 -0.0016 0 20.84 0.011 R VLYNLEVLSSK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6848.6848.2.dta 386 1 IPI00015806.3 Isoform 1 of General transcription factor 3C polypeptide 3 21 102006 1 1 1 1 4636 5735 1 1 1 657.3557 1312.6969 2 1312.6987 -0.0018 0 20.76 0.011 R ILNLLSPSDGER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6747.6747.2.dta 387 1 IPI00745464.1 Conserved hypothetical protein 21 11695 1 1 1 1 6484 7949 1 1 1 394.2049 1572.7906 4 1572.7896 0.001 0 20.61 0.027 R QSSFLQEAPPGGSIR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.9035.9035.4.dta 388 1 IPI00022305.4 Basic leucine zipper and W2 domain-containing protein 2 21 48360 1 1 1 1 2842 6605 1 0 1 550.8274 1099.6402 2 1099.639 0.0013 0 20.56 0.022 R LLELFPVNR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7610.7610.2.dta 389 1 IPI00044456.2 Isoform 1 of NADPH oxidase 5 20 87511 1 1 1 1 2564 2379 1 1 1 533.7321 1065.4497 2 1065.4397 0.01 0 20.45 0.02 R GTMSAEEDAR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3158.3158.2.dta 390 1 IPI00064496.5 34 kDa protein 20 34177 1 1 1 1 2026 1025 1 0 1 332.2105 993.6096 3 993.6083 0.0013 1 20.34 0.026 R QQLKKPPR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1691.1691.3.dta 391 1 IPI00176193.6 Isoform 1 of Collagen alpha-1(XIV) chain precursor 20 194478 1 1 1 1 2379 7706 1 1 1 347.1811 1038.5214 3 1038.5207 0.0008 0 20.08 0.047 K GNPGVGTQGPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.873.873.3.dta 392 1 IPI00030320.4 Probable ATP-dependent RNA helicase DDX6 20 54781 1 1 1 1 3915 6975 1 1 1 616.3558 1230.697 2 1230.6972 -0.0002 0 19.96 0.013 K SGAYLIPLLER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7976.7976.2.dta 393 1 IPI00410663.1 Isoform 1 of Probable palmitoyltransferase ZDHHC13 20 71983 1 1 1 1 4284 6082 1 1 1 635.8739 1269.7333 2 1269.7333 0 0 19.73 0.031 K VIGPEPTGFLLK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7094.7094.2.dta 394 1 IPI00298447.3 Probable methyltransferase TARBP1 20 183840 1 1 1 1 4537 7053 1 1 1 650.8851 1299.7557 2 1299.7551 0.0007 0 19.71 0.042 R EVAAGYLVPLLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8053.8053.2.dta 395 1 IPI00401213.1 "CDNA FLJ46365 fis, clone TESTI4051054" 19 21848 1 1 1 1 4243 3423 1 1 1 422.8872 1265.6397 3 1265.6472 -0.0075 1 19.13 0.039 K MLDLTMTRAAK I Oxidation (M) 0.00000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4316.4316.3.dta 396 1 IPI00254606.7 Similar to ProcKr2 19 113039 2 2 2 2 103 5328 1 1 0 314.231 626.4475 2 626.4479 -0.0004 0 19.03 0.025 K LLIIR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6344.6344.2.dta 396 1 IPI00254606.7 Similar to ProcKr2 19 113039 2 2 2 2 828 884 1 1 1 406.7432 811.4719 2 811.4664 0.0055 1 14.65 0.047 R QGPRAVGK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1539.1539.2.dta 397 1 IPI00477965.4 Similar to Zik1 18 103407 1 1 1 1 5397 3227 1 1 1 703.3192 1404.6238 2 1404.6238 -0.0001 1 18.46 0.024 R VHTGVRSCDCSK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4103.4103.2.dta 398 1 IPI00021264.1 Calponin-1 18 33321 1 1 1 1 6448 8040 1 1 1 394.1964 1572.7563 4 1572.7467 0.0096 1 17.77 0.024 K FASQQGMTAYGTRR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.9164.9164.4.dta 399 1 IPI00328488.6 Isoform 1 of Epididymis-specific alpha-mannosidase precursor 18 114102 1 1 1 1 6859 3170 1 1 1 819.3845 1636.7544 2 1636.7701 -0.0158 0 17.72 0.022 R DMYATHLASGMLGVR K Oxidation (M) 0.000000000010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4041.4041.2.dta 400 1 IPI00100731.3 SH2 domain-containing protein 4A 18 52922 1 1 1 1 8205 7877 1 1 1 737.7095 2210.1066 3 2210.1178 -0.0112 1 17.69 0.031 K EELEQGSRPAPTLEEEKIR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8940.8940.3.dta 401 1 IPI00167391.3 family with sequence similarity 123B 18 125092 1 1 1 1 5073 558 1 1 1 455.8934 1364.6584 3 1364.6684 -0.01 1 17.65 0.037 R KENANPQDAPGPK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1186.1186.3.dta 402 1 IPI00305559.1 D site-binding protein 18 34442 1 1 1 1 5136 2460 1 1 1 458.9298 1373.7677 3 1373.7666 0.001 1 17.64 0.022 R AAFLEKENALLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.3246.3246.3.dta 403 1 IPI00790484.1 Protein 18 30636 1 1 1 1 4586 3994 1 1 1 653.3607 1304.7069 2 1304.7023 0.0046 1 17.52 0.026 R HLTIKCPPSPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4934.4934.2.dta 404 1 IPI00293832.6 RING finger protein 113B 17 37091 1 1 1 1 7697 5331 1 1 1 614.2845 1839.8316 3 1839.8284 0.0032 0 17.35 0.048 R CYICDQPTGGIFNPAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6348.6348.3.dta 405 1 IPI00023283.3 Isoform 2 of Titin 17 3832803 1 1 1 1 8461 3387 1 1 1 688.348 2749.363 4 2749.3885 -0.0255 0 17.24 0.024 K TADQDLVVDVGKPLTMVVPYDAYPK A Oxidation (M) 0.0000000000000001000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4277.4277.4.dta 406 1 IPI00102936.3 Isoform 2 of Signal recognition particle 68 kDa protein 17 67775 1 1 1 1 8332 7793 1 1 1 598.2697 2389.0498 4 2389.0426 0.0072 1 17.18 0.024 - MAAEKQVPGGGGGGGSGGGGGSGGGGSGGGR G Oxidation (M) 0.1000000000000000000000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8831.8831.4.dta 407 1 IPI00329629.6 DnaJ homolog subfamily C member 7 17 57203 1 1 1 1 5398 5968 1 1 1 703.3632 1404.7119 2 1404.7137 -0.0018 0 16.92 0.027 K EVGEAFTILSDPK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6979.6979.2.dta 408 1 IPI00013983.1 Proto-oncogene tyrosine-protein kinase receptor ret precursor 17 126178 1 1 1 1 4452 3429 1 1 1 646.3168 1290.6191 2 1290.6317 -0.0126 0 16.73 0.027 R GSIVGGHEPGEPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4323.4323.2.dta 409 1 IPI00443629.1 "CDNA FLJ46590 fis, clone THYMU3044441" 16 14373 1 1 1 1 6127 6326 1 1 1 757.4051 1512.7956 2 1512.8082 -0.0126 0 16.45 0.029 R LHVGSTIIMSLGNR M Oxidation (M) 0.00000000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7335.7335.2.dta 410 1 IPI00293464.5 DNA damage-binding protein 1 16 128142 1 1 1 1 1299 7619 1 1 1 448.72 895.4254 2 895.426 -0.0006 0 16.41 0.029 R AHGNVQDR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.863.863.2.dta 411 1 IPI00445119.1 "CDNA FLJ44595 fis, clone BLADE2004849" 16 32715 1 1 1 1 4458 1893 1 1 1 646.7785 1291.5425 2 1291.5502 -0.0077 0 16.4 0.029 R TQNGGGSGGGGGGSSR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.2632.2632.2.dta 412 1 IPI00291783.3 Gem-associated protein 5 16 170793 1 1 1 1 6199 6663 1 1 1 762.8658 1523.717 2 1523.7191 -0.0021 0 16.36 0.029 R CSDAVPGGLFGFAAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.7668.7668.2.dta 413 1 IPI00300073.6 KRAB-zinc finger protein SZF1-1 16 48984 1 1 1 1 1826 1293 1 1 1 484.7252 967.4359 2 967.4294 0.0065 1 15.99 0.032 R ECGRGFSR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1982.1982.2.dta 414 1 IPI00045478.1 Ras-related protein Rab-40C 16 31740 1 1 1 1 1237 5689 1 1 1 440.7971 879.5796 2 879.5793 0.0002 0 15.97 0.025 K LPLPVTIK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.6702.6702.2.dta 415 1 IPI00442829.1 "CDNA FLJ26541 fis, clone KDN09394" 16 16208 1 1 1 1 2545 3655 1 1 1 532.2932 1062.5718 2 1062.5743 -0.0026 1 15.93 0.047 K MALIQKTDK N Oxidation (M) 0.100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.4568.4568.2.dta 416 1 IPI00394829.3 hypothetical protein LOC286077 15 127557 1 1 1 1 7524 7273 1 1 1 887.972 1773.9295 2 1773.9308 -0.0013 0 15.26 0.037 R MPGGALEPHAGLRPLSR R Oxidation (M) 0.10000000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.8271.8271.2.dta 417 1 IPI00418724.2 Zinc finger protein 788 15 76103 1 1 1 1 3568 465 1 1 1 398.5392 1192.5958 3 1192.6061 -0.0103 1 15.26 0.045 R SASHLRTHER T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1086.1086.3.dta 418 1 IPI00145593.7 Nucleolar MIF4G domain-containing protein 1 15 96768 1 1 1 1 3601 720 1 1 1 399.5406 1195.5998 3 1195.5946 0.0053 0 14.92 0.04 R TAGPEQGPGLGGR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1361.1361.3.dta 419 1 IPI00019533.3 Chitinase 3-like protein 2 precursor 15 43701 1 1 1 1 2057 7363 1 1 1 499.718 997.4215 2 997.4209 0.0006 0 14.74 0.041 - MGATTMDQK S Oxidation (M) 0.000001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.836.836.2.dta 420 1 IPI00018306.1 Isoform Long of Granulocyte colony-stimulating factor precursor 15 22564 1 1 1 1 4149 1010 1 1 1 629.3479 1256.6812 2 1256.6724 0.0088 1 14.62 0.042 R KIQGDGAALQEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.1675.1675.2.dta 421 1 IPI00747433.1 "Similar to actin, gamma 1 propeptide" 14 10547 1 1 1 1 6509 401 1 1 1 525.6045 1573.7916 3 1573.7997 -0.008 1 14.43 0.044 K VVLWMPQDSMPKK E Oxidation (M) 0.0000100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-1.10590.10590.3.dta