Header -------------------------------------------------------- Search title orb_160921_AE-MF-2_#5-4.raw Timestamp 2016-09-28T01:37:56Z User lu-31 Email Report URI http://mascot.bioreg.kyushu-u.ac.jp/mascot/cgi/master_results.pl?file=D:/2016/20160928/F073894.dat Peak list data path D:\data\oda\160921_AE-MF-2\orb_160921_AE-MF-2_#5-4.raw Peak list format Mascot generic Search type MIS Mascot version 2.5.1 Database ipi_HUM_NEW Fasta file ipi_HUM_NEW_3.26.fasta Total sequences 67667 Total residues 28462731 Sequences after taxonomy filter 67667 Number of queries 9294 Fixed modifications -------------------------------------------------------- Identifier Name Delta Neutral loss 1 Carbamidomethyl (C) 57.021464 Variable modifications -------------------------------------------------------- Identifier Name Delta Neutral loss(es) 1 Oxidation (M) 15.994915 0 63.998285 Search Parameters -------------------------------------------------------- Taxonomy filter All entries Enzyme Trypsin Maximum Missed Cleavages 1 Fixed modifications Carbamidomethyl (C) Variable modifications Oxidation (M) Peptide Mass Tolerance 10 Peptide Mass Tolerance Units ppm Fragment Mass Tolerance 0.8 Fragment Mass Tolerance Units Da Mass values Monoisotopic Instrument type ESI-TRAP Format parameters -------------------------------------------------------- Significance threshold 0.05 Max. number of hits 0 Min. number of sig. unique sequences 1 Use MudPIT protein scoring 1 Ions score cut-off -1 Include same-set proteins 0 Include sub-set proteins 1 Include unassigned 0 Require bold red 0 Use homology threshold 1 Group protein families 1 Show duplicate peptides 1 Protein hits -------------------------------------------------------- prot_hit_num prot_family_member prot_acc prot_desc prot_score prot_mass prot_matches prot_matches_sig prot_sequences prot_sequences_sig pep_query pep_index pep_rank pep_isbold pep_isunique pep_exp_mz pep_exp_mr pep_exp_z pep_calc_mr pep_delta pep_miss pep_score pep_expect pep_res_before pep_seq pep_res_after pep_var_mod pep_var_mod_pos pep_summed_mod_pos pep_local_mod_pos pep_scan_title 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 56 1917 1 1 0 307.7087 613.4029 2 613.4024 0.0006 1 29.96 0.02 K RLIGR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2149.2149.2.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 269 2335 1 1 0 344.2062 686.3979 2 686.3963 0.0017 0 28.43 0.039 R LIGDAAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2605.2605.2.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 562 2573 1 1 1 383.211 764.4074 2 764.4068 0.0006 0 33.56 0.0082 K VQVEYK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2863.2863.2.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 602 3480 1 1 1 387.2117 772.4089 2 772.4079 0.001 0 37.33 0.0052 K DNNLLGK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3872.3872.2.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 608 2023 1 1 0 387.722 773.4294 2 773.4283 0.001 0 34.13 0.013 R NTTIPTK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2265.2265.2.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 1301 1536 1 1 0 453.2346 904.4547 2 904.4549 -0.0002 1 35.8 0.0045 R LRTACER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1736.1736.2.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 1302 1163 1 1 0 302.4926 904.456 3 904.4549 0.0011 1 32.1 0.0049 R LRTACER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1333.1333.3.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 1557 3548 1 1 1 472.765 943.5155 2 943.5161 -0.0006 0 28.84 0.049 K VCNPIITK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3949.3949.2.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 1829 2279 1 1 1 495.2667 988.5189 2 988.5189 0 1 55.48 7.50E-05 R LSKEDIER M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2544.2544.2.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 2038 2064 1 1 0 509.2874 1016.5602 2 1016.5614 -0.0013 1 57.06 5.60E-05 K ITITNDKGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2309.2309.2.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 2490 6536 1 1 1 541.2876 1080.5606 2 1080.5604 0.0002 0 56.26 3.90E-05 K LLQDFFNGK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7068.7068.2.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 3158 2192 1 1 1 590.8131 1179.6117 2 1179.6135 -0.0019 1 61.23 6.30E-06 K VQVEYKGETK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2450.2450.2.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 3159 2191 1 1 1 394.2116 1179.613 3 1179.6135 -0.0005 1 26.95 0.013 K VQVEYKGETK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2449.2449.3.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 3262 4694 1 1 1 400.2318 1197.6734 3 1197.6717 0.0017 1 26.18 0.04 R GTLDPVEKALR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5196.5196.3.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 3268 6299 1 1 1 600.34 1198.6655 2 1198.667 -0.0015 0 72.17 9.60E-07 K DAGTIAGLNVLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6833.6833.2.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 3269 6646 1 1 1 600.3403 1198.666 2 1198.667 -0.001 0 63.21 7.00E-06 K DAGTIAGLNVLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7181.7181.2.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 3270 7290 1 1 1 600.3409 1198.6672 2 1198.667 0.0002 0 75.38 5.20E-07 K DAGTIAGLNVLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7852.7852.2.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 3271 6335 1 1 1 400.563 1198.6673 3 1198.667 0.0003 0 65.29 5.30E-06 K DAGTIAGLNVLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6868.6868.3.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 3602 5324 1 1 1 618.3154 1234.6163 2 1234.6169 -0.0005 0 49.34 0.00026 R MVNHFIAEFK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5858.5858.2.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 3604 5319 1 1 1 412.5466 1234.618 3 1234.6169 0.0011 0 28.36 0.02 R MVNHFIAEFK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5852.5852.3.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 3709 4418 1 1 1 626.8323 1251.6501 2 1251.6533 -0.0031 1 59.59 2.10E-05 K MKEIAEAYLGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4897.4897.2.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 3710 4416 1 1 1 418.2245 1251.6517 3 1251.6533 -0.0015 1 53.19 9.00E-05 K MKEIAEAYLGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4895.4895.3.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 3712 6711 1 1 1 627.3119 1252.6093 2 1252.6088 0.0006 0 54.3 2.10E-05 R FEELNADLFR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7248.7248.2.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 3719 4341 1 1 1 627.7866 1253.5586 2 1253.5598 -0.0012 0 53.75 4.50E-05 R FDDAVVQSDMK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4813.4813.2.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 3858 3902 1 1 1 634.8308 1267.6471 2 1267.6482 -0.0011 1 56.84 3.60E-05 K MKEIAEAYLGK T Oxidation (M) 0.10000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4338.4338.2.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 3859 3894 1 1 1 423.5564 1267.6475 3 1267.6482 -0.0007 1 33.98 0.0024 K MKEIAEAYLGK T Oxidation (M) 0.10000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4329.4329.3.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 4113 5895 1 1 1 652.3025 1302.5904 2 1302.5914 -0.001 0 80.49 2.80E-08 K NSLESYAFNMK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6430.6430.2.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 4132 7045 1 1 1 652.819 1303.6234 2 1303.623 0.0003 0 44.12 0.00061 K CNEIINWLDK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7586.7586.2.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 4256 4933 1 1 1 660.2988 1318.5831 2 1318.5863 -0.0032 0 52.38 1.20E-05 K NSLESYAFNMK A Oxidation (M) 0.00000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5456.5456.2.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 4888 3942 1 1 1 470.894 1409.66 3 1409.6609 -0.0009 1 21.03 0.011 R RFDDAVVQSDMK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4381.4381.3.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 5131 4088 1 1 1 481.9345 1442.7817 3 1442.7803 0.0014 1 27.42 0.025 K ELEKVCNPIITK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4539.4539.3.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 5132 4090 1 1 1 722.3989 1442.7832 2 1442.7803 0.0029 1 47.44 0.00033 K ELEKVCNPIITK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4541.4541.2.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 5372 6128 1 1 1 494.2568 1479.7486 3 1479.747 0.0016 1 44.21 0.00052 R ARFEELNADLFR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6663.6663.3.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 5377 4657 1 1 1 741.4064 1480.7982 2 1480.7998 -0.0016 0 56.53 5.00E-06 K SQIHDIVLVGGSTR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5156.5156.2.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 5392 4871 1 1 0 744.353 1486.6915 2 1486.694 -0.0025 0 47.3 8.20E-05 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5387.5387.2.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 5393 5073 1 1 0 496.5718 1486.6935 3 1486.694 -0.0005 0 38.4 0.0021 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5603.5603.3.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 5394 5055 1 1 0 744.3543 1486.6941 2 1486.694 0.0001 0 70.5 2.50E-07 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5585.5585.2.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 5791 6185 1 1 1 783.4216 1564.8286 2 1564.8249 0.0037 1 76.98 2.50E-07 K LLQDFFNGKELNK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6720.6720.2.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 5793 6180 1 1 1 522.6179 1564.8319 3 1564.8249 0.007 1 31.48 0.0059 K LLQDFFNGKELNK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6716.6716.3.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 6044 6798 1 1 1 808.8985 1615.7824 2 1615.7804 0.0021 0 89.24 5.10E-09 K SFYPEEVSSMVLTK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7333.7333.2.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 6130 5373 1 1 1 814.4597 1626.9048 2 1626.9053 -0.0006 1 89.72 3.90E-09 R QATKDAGTIAGLNVLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5907.5907.2.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 6131 5547 1 1 1 543.3094 1626.9065 3 1626.9053 0.0012 1 44.38 0.00035 R QATKDAGTIAGLNVLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6082.6082.3.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 6153 5913 1 1 1 816.8929 1631.7712 2 1631.7753 -0.0041 0 75.08 9.10E-08 K SFYPEEVSSMVLTK M Oxidation (M) 0.00000000010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6448.6448.2.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 6320 5113 1 1 1 825.3995 1648.7844 2 1648.7879 -0.0035 0 66.12 8.90E-07 K NQVAMNPTNTVFDAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5643.5643.2.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 6374 6333 1 1 0 553.9657 1658.8753 3 1658.8879 -0.0126 0 18.76 0.023 R IINEPTAAAIAYGLDK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6866.6866.3.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 6379 6341 1 1 0 830.4504 1658.8863 2 1658.8879 -0.0016 0 83.77 5.40E-08 R IINEPTAAAIAYGLDK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6874.6874.2.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 6380 6351 1 1 0 553.9708 1658.8906 3 1658.8879 0.0028 0 58.83 1.60E-05 R IINEPTAAAIAYGLDK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6884.6884.3.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 6412 4371 1 1 1 833.3973 1664.78 2 1664.7828 -0.0028 0 83.74 3.40E-08 K NQVAMNPTNTVFDAK R Oxidation (M) 0.000010000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4846.4846.2.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 6567 3415 1 1 1 846.3651 1690.7156 2 1690.7183 -0.0028 0 63.77 1.40E-06 K STAGDTHLGGEDFDNR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3800.3800.2.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 6568 3402 1 1 1 564.5795 1690.7166 3 1690.7183 -0.0018 0 38.63 0.00052 K STAGDTHLGGEDFDNR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3786.3786.3.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 6996 6875 1 1 1 591.978 1772.9123 3 1772.9131 -0.0008 1 35.15 0.0008 K ILDKCNEIINWLDK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7409.7409.3.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 7027 5729 1 1 1 894.4971 1786.9797 2 1786.9828 -0.0031 1 81.02 4.70E-08 R IINEPTAAAIAYGLDKK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6264.6264.2.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 7028 5725 1 1 1 596.6681 1786.9824 3 1786.9828 -0.0004 1 22.58 0.0078 R IINEPTAAAIAYGLDKK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6260.6260.3.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 7103 4556 1 1 1 903.4504 1804.8862 2 1804.889 -0.0028 1 51.12 0.00013 K NQVAMNPTNTVFDAKR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5046.5046.2.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 7104 4519 1 1 1 602.637 1804.8891 3 1804.889 0.0001 1 18.29 0.019 K NQVAMNPTNTVFDAKR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5006.5006.3.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 7172 3831 1 1 1 607.9684 1820.8833 3 1820.8839 -0.0006 1 21.91 0.013 K NQVAMNPTNTVFDAKR L Oxidation (M) 0.0000100000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4261.4261.3.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 7248 4814 1 1 1 919.5087 1837.0029 2 1837.0058 -0.0029 1 97.37 7.40E-10 K LDKSQIHDIVLVGGSTR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5326.5326.2.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 7249 4800 1 1 1 613.3418 1837.0036 3 1837.0058 -0.0022 1 63.11 3.30E-06 K LDKSQIHDIVLVGGSTR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5311.5311.3.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 7250 4804 1 1 1 460.2589 1837.0065 4 1837.0058 0.0008 1 18.22 0.03 K LDKSQIHDIVLVGGSTR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5315.5315.4.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 7251 4794 1 1 1 613.343 1837.0072 3 1837.0058 0.0015 1 54.34 8.00E-06 K LDKSQIHDIVLVGGSTR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5304.5304.3.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 7753 6102 1 1 1 991.5013 1980.9881 2 1980.9905 -0.0024 0 42.54 0.0001 K TVTNAVVTVPAYFNDSQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6637.6637.2.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 7754 5967 1 1 1 991.5023 1980.9901 2 1980.9905 -0.0004 0 53.27 1.20E-05 K TVTNAVVTVPAYFNDSQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6501.6501.2.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 7755 5969 1 1 1 661.3376 1980.9909 3 1980.9905 0.0004 0 29.86 0.0035 K TVTNAVVTVPAYFNDSQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6503.6503.3.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 7756 6090 1 1 1 661.338 1980.992 3 1980.9905 0.0015 0 58.48 3.30E-06 K TVTNAVVTVPAYFNDSQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6625.6625.3.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 7924 6912 1 1 1 698.355 2092.0431 3 2092.0477 -0.0046 1 17.57 0.022 R FEELNADLFRGTLDPVEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7447.7447.3.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 7925 6933 1 1 1 698.3566 2092.0479 3 2092.0477 0.0002 1 26.69 0.0031 R FEELNADLFRGTLDPVEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7469.7469.3.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 8270 5332 1 1 1 773.3984 2317.1733 3 2317.1736 -0.0003 1 77.94 4.90E-08 R LIGDAAKNQVAMNPTNTVFDAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5866.5866.3.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 8296 4777 1 1 1 778.7302 2333.1687 3 2333.1685 0.0001 1 39.79 0.00051 R LIGDAAKNQVAMNPTNTVFDAK R Oxidation (M) 0.0000000000010000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5286.5286.3.dta 1 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 1980 71082 69 69 38 38 8850 5396 1 1 0 899.7747 2696.3021 3 2696.3042 -0.002 1 40.3 0.0012 K VEIIANDQGNRTTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5930.5930.3.dta 1 2 IPI00304925.4 Heat shock 70 kDa protein 1 984 70280 38 38 28 28 56 1917 1 0 0 307.7087 613.4029 2 613.4024 0.0006 1 29.96 0.02 K RLIGR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2149.2149.2.dta 1 2 IPI00304925.4 Heat shock 70 kDa protein 1 984 70280 38 38 28 28 269 2335 1 0 0 344.2062 686.3979 2 686.3963 0.0017 0 28.43 0.039 R LIGDAAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2605.2605.2.dta 1 2 IPI00304925.4 Heat shock 70 kDa protein 1 984 70280 38 38 28 28 394 2469 1 0 0 362.206 722.3974 2 722.3963 0.0011 0 25.93 0.027 K VQVSYK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2750.2750.2.dta 1 2 IPI00304925.4 Heat shock 70 kDa protein 1 984 70280 38 38 28 28 707 3722 1 0 0 401.2146 800.4146 2 800.414 0.0006 0 28.12 0.021 K DNNLLGR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4142.4142.2.dta 1 2 IPI00304925.4 Heat shock 70 kDa protein 1 984 70280 38 38 28 28 1278 2761 1 0 0 451.7453 901.476 2 901.4756 0.0004 0 34.21 0.0086 R STLEPVEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3067.3067.2.dta 1 2 IPI00304925.4 Heat shock 70 kDa protein 1 984 70280 38 38 28 28 1301 1536 1 0 0 453.2346 904.4547 2 904.4549 -0.0002 1 35.8 0.0045 R LRTACER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1736.1736.2.dta 1 2 IPI00304925.4 Heat shock 70 kDa protein 1 984 70280 38 38 28 28 1302 1163 1 0 0 302.4926 904.456 3 904.4549 0.0011 1 32.1 0.0049 R LRTACER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1333.1333.3.dta 1 2 IPI00304925.4 Heat shock 70 kDa protein 1 984 70280 38 38 28 28 1947 2154 1 0 0 335.1868 1002.5386 3 1002.5345 0.004 1 28.87 0.031 R LSKEEIER M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2408.2408.3.dta 1 2 IPI00304925.4 Heat shock 70 kDa protein 1 984 70280 38 38 28 28 2038 2064 1 0 0 509.2874 1016.5602 2 1016.5614 -0.0013 1 57.06 5.60E-05 K ITITNDKGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2309.2309.2.dta 1 2 IPI00304925.4 Heat shock 70 kDa protein 1 984 70280 38 38 28 28 2667 6612 1 0 0 555.2904 1108.5663 2 1108.5665 -0.0003 0 44.75 0.00068 K LLQDFFNGR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7146.7146.2.dta 1 2 IPI00304925.4 Heat shock 70 kDa protein 1 984 70280 38 38 28 28 2779 2109 1 0 1 562.801 1123.5874 2 1123.5873 0 1 42.32 0.00036 K VQVSYKGDTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2359.2359.2.dta 1 2 IPI00304925.4 Heat shock 70 kDa protein 1 984 70280 38 38 28 28 3347 4123 1 0 0 602.77 1203.5255 2 1203.5255 -0.0001 0 41.94 0.00012 K GGSGSGPTIEEVD - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4577.4577.2.dta 1 2 IPI00304925.4 Heat shock 70 kDa protein 1 984 70280 38 38 28 28 3814 5034 1 0 0 421.2238 1260.6496 3 1260.6503 -0.0007 0 18.43 0.019 R LVNHFVEEFK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5563.5563.3.dta 1 2 IPI00304925.4 Heat shock 70 kDa protein 1 984 70280 38 38 28 28 3968 5999 1 0 0 644.3054 1286.5963 2 1286.5965 -0.0002 0 73.72 1.20E-07 K NALESYAFNMK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6534.6534.2.dta 1 2 IPI00304925.4 Heat shock 70 kDa protein 1 984 70280 38 38 28 28 4219 6674 1 0 0 658.3031 1314.5916 2 1314.5914 0.0002 0 53.87 1.70E-05 R FEELCSDLFR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7210.7210.2.dta 1 2 IPI00304925.4 Heat shock 70 kDa protein 1 984 70280 38 38 28 28 5258 4920 1 0 0 489.2742 1464.8008 3 1464.8049 -0.0041 0 14.58 0.043 K AQIHDLVLVGGSTR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5442.5442.3.dta 1 2 IPI00304925.4 Heat shock 70 kDa protein 1 984 70280 38 38 28 28 5392 4871 1 0 0 744.353 1486.6915 2 1486.694 -0.0025 0 47.3 8.20E-05 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5387.5387.2.dta 1 2 IPI00304925.4 Heat shock 70 kDa protein 1 984 70280 38 38 28 28 5393 5073 1 0 0 496.5718 1486.6935 3 1486.694 -0.0005 0 38.4 0.0021 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5603.5603.3.dta 1 2 IPI00304925.4 Heat shock 70 kDa protein 1 984 70280 38 38 28 28 5394 5055 1 0 0 744.3543 1486.6941 2 1486.694 0.0001 0 70.5 2.50E-07 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5585.5585.2.dta 1 2 IPI00304925.4 Heat shock 70 kDa protein 1 984 70280 38 38 28 28 5685 6273 1 0 0 771.8717 1541.7289 2 1541.7296 -0.0008 1 51.89 1.40E-05 R ARFEELCSDLFR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6808.6808.2.dta 1 2 IPI00304925.4 Heat shock 70 kDa protein 1 984 70280 38 38 28 28 5686 6272 1 0 0 514.9186 1541.7339 3 1541.7296 0.0043 1 40.25 0.00025 R ARFEELCSDLFR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6807.6807.3.dta 1 2 IPI00304925.4 Heat shock 70 kDa protein 1 984 70280 38 38 28 28 5914 6268 1 0 0 790.4129 1578.8113 2 1578.8154 -0.0042 1 67.69 3.60E-06 K LLQDFFNGRDLNK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6802.6802.2.dta 1 2 IPI00304925.4 Heat shock 70 kDa protein 1 984 70280 38 38 28 28 6037 7338 1 0 0 807.9052 1613.7959 2 1613.8011 -0.0052 0 60.94 1.70E-05 K AFYPEEISSMVLTK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7912.7912.2.dta 1 2 IPI00304925.4 Heat shock 70 kDa protein 1 984 70280 38 38 28 28 6038 7350 1 0 0 538.9407 1613.8002 3 1613.8011 -0.0009 0 27.5 0.012 K AFYPEEISSMVLTK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7927.7927.3.dta 1 2 IPI00304925.4 Heat shock 70 kDa protein 1 984 70280 38 38 28 28 6121 5900 1 0 0 813.4681 1624.9217 2 1624.926 -0.0043 1 65.55 2.30E-06 R QATKDAGVIAGLNVLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6435.6435.2.dta 1 2 IPI00304925.4 Heat shock 70 kDa protein 1 984 70280 38 38 28 28 6122 5883 1 0 0 542.6501 1624.9284 3 1624.926 0.0024 1 73.12 3.70E-07 R QATKDAGVIAGLNVLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6419.6419.3.dta 1 2 IPI00304925.4 Heat shock 70 kDa protein 1 984 70280 38 38 28 28 6143 6450 1 0 0 815.9039 1629.7932 2 1629.796 -0.0028 0 46.15 5.10E-05 K AFYPEEISSMVLTK M Oxidation (M) 0.00000000010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6981.6981.2.dta 1 2 IPI00304925.4 Heat shock 70 kDa protein 1 984 70280 38 38 28 28 6369 5241 1 0 0 829.9273 1657.8401 2 1657.8424 -0.0023 0 68.11 4.10E-07 K NQVALNPQNTVFDAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5773.5773.2.dta 1 2 IPI00304925.4 Heat shock 70 kDa protein 1 984 70280 38 38 28 28 6490 3442 1 0 0 838.3682 1674.7219 2 1674.7234 -0.0015 0 64.77 8.40E-07 K ATAGDTHLGGEDFDNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3829.3829.2.dta 1 2 IPI00304925.4 Heat shock 70 kDa protein 1 984 70280 38 38 28 28 6491 3427 1 0 0 559.2487 1674.7241 3 1674.7234 0.0007 0 32.78 0.00084 K ATAGDTHLGGEDFDNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3813.3813.3.dta 1 2 IPI00304925.4 Heat shock 70 kDa protein 1 984 70280 38 38 28 28 6551 6482 1 0 0 844.4538 1686.893 2 1686.894 -0.001 0 81.11 2.50E-08 R IINEPTAAAIAYGLDR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7014.7014.2.dta 1 2 IPI00304925.4 Heat shock 70 kDa protein 1 984 70280 38 38 28 28 6552 6483 1 0 0 563.3055 1686.8946 3 1686.894 0.0006 0 51.49 3.40E-05 R IINEPTAAAIAYGLDR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7015.7015.3.dta 1 2 IPI00304925.4 Heat shock 70 kDa protein 1 984 70280 38 38 28 28 7138 4696 1 0 0 907.9774 1813.9403 2 1813.9435 -0.0032 1 63.94 1.00E-06 K NQVALNPQNTVFDAKR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5198.5198.2.dta 1 2 IPI00304925.4 Heat shock 70 kDa protein 1 984 70280 38 38 28 28 7139 4668 1 0 0 605.6545 1813.9418 3 1813.9435 -0.0017 1 23.42 0.018 K NQVALNPQNTVFDAKR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5168.5168.3.dta 1 2 IPI00304925.4 Heat shock 70 kDa protein 1 984 70280 38 38 28 28 7173 5036 1 0 0 456.26 1821.0107 4 1821.0108 -0.0002 1 31.17 0.0047 K LDKAQIHDLVLVGGSTR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5565.5565.4.dta 1 2 IPI00304925.4 Heat shock 70 kDa protein 1 984 70280 38 38 28 28 8290 5429 1 0 0 776.4142 2326.2207 3 2326.2281 -0.0074 1 63.92 1.40E-06 R LIGDAAKNQVALNPQNTVFDAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5964.5964.3.dta 1 2 IPI00304925.4 Heat shock 70 kDa protein 1 984 70280 38 38 28 28 8850 5396 1 0 0 899.7747 2696.3021 3 2696.3042 -0.002 1 40.3 0.0012 K VEIIANDQGNRTTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5930.5930.3.dta 1 2 IPI00304925.4 Heat shock 70 kDa protein 1 984 70280 38 38 28 28 9074 7236 1 0 0 1019.1674 3054.4802 3 3054.4869 -0.0067 0 33.07 0.00079 K ELEQVCNPIISGLYQGAGGPGPGGFGAQGPK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7790.7790.3.dta 1 3 IPI00807640.1 heat shock 70kDa protein 1B 984 70294 38 38 28 28 56 1917 1 0 0 307.7087 613.4029 2 613.4024 0.0006 1 29.96 0.02 K RLIGR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2149.2149.2.dta 1 3 IPI00807640.1 heat shock 70kDa protein 1B 984 70294 38 38 28 28 269 2335 1 0 0 344.2062 686.3979 2 686.3963 0.0017 0 28.43 0.039 R LIGDAAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2605.2605.2.dta 1 3 IPI00807640.1 heat shock 70kDa protein 1B 984 70294 38 38 28 28 394 2469 1 0 0 362.206 722.3974 2 722.3963 0.0011 0 25.93 0.027 K VQVSYK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2750.2750.2.dta 1 3 IPI00807640.1 heat shock 70kDa protein 1B 984 70294 38 38 28 28 707 3722 1 0 0 401.2146 800.4146 2 800.414 0.0006 0 28.12 0.021 K DNNLLGR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4142.4142.2.dta 1 3 IPI00807640.1 heat shock 70kDa protein 1B 984 70294 38 38 28 28 1278 2761 1 0 0 451.7453 901.476 2 901.4756 0.0004 0 34.21 0.0086 R STLEPVEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3067.3067.2.dta 1 3 IPI00807640.1 heat shock 70kDa protein 1B 984 70294 38 38 28 28 1301 1536 1 0 0 453.2346 904.4547 2 904.4549 -0.0002 1 35.8 0.0045 R LRTACER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1736.1736.2.dta 1 3 IPI00807640.1 heat shock 70kDa protein 1B 984 70294 38 38 28 28 1302 1163 1 0 0 302.4926 904.456 3 904.4549 0.0011 1 32.1 0.0049 R LRTACER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1333.1333.3.dta 1 3 IPI00807640.1 heat shock 70kDa protein 1B 984 70294 38 38 28 28 1947 2154 1 0 0 335.1868 1002.5386 3 1002.5345 0.004 1 28.87 0.031 R LSKEEIER M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2408.2408.3.dta 1 3 IPI00807640.1 heat shock 70kDa protein 1B 984 70294 38 38 28 28 2038 2064 1 0 0 509.2874 1016.5602 2 1016.5614 -0.0013 1 57.06 5.60E-05 K ITITNDKGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2309.2309.2.dta 1 3 IPI00807640.1 heat shock 70kDa protein 1B 984 70294 38 38 28 28 2667 6612 1 0 0 555.2904 1108.5663 2 1108.5665 -0.0003 0 44.75 0.00068 K LLQDFFNGR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7146.7146.2.dta 1 3 IPI00807640.1 heat shock 70kDa protein 1B 984 70294 38 38 28 28 2874 2179 1 0 1 569.8093 1137.6041 2 1137.603 0.0011 1 39.36 0.00032 K VQVSYKGETK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2436.2436.2.dta 1 3 IPI00807640.1 heat shock 70kDa protein 1B 984 70294 38 38 28 28 3347 4123 1 0 0 602.77 1203.5255 2 1203.5255 -0.0001 0 41.94 0.00012 K GGSGSGPTIEEVD - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4577.4577.2.dta 1 3 IPI00807640.1 heat shock 70kDa protein 1B 984 70294 38 38 28 28 3814 5034 1 0 0 421.2238 1260.6496 3 1260.6503 -0.0007 0 18.43 0.019 R LVNHFVEEFK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5563.5563.3.dta 1 3 IPI00807640.1 heat shock 70kDa protein 1B 984 70294 38 38 28 28 3968 5999 1 0 0 644.3054 1286.5963 2 1286.5965 -0.0002 0 73.72 1.20E-07 K NALESYAFNMK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6534.6534.2.dta 1 3 IPI00807640.1 heat shock 70kDa protein 1B 984 70294 38 38 28 28 4219 6674 1 0 0 658.3031 1314.5916 2 1314.5914 0.0002 0 53.87 1.70E-05 R FEELCSDLFR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7210.7210.2.dta 1 3 IPI00807640.1 heat shock 70kDa protein 1B 984 70294 38 38 28 28 5258 4920 1 0 0 489.2742 1464.8008 3 1464.8049 -0.0041 0 14.58 0.043 K AQIHDLVLVGGSTR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5442.5442.3.dta 1 3 IPI00807640.1 heat shock 70kDa protein 1B 984 70294 38 38 28 28 5392 4871 1 0 0 744.353 1486.6915 2 1486.694 -0.0025 0 47.3 8.20E-05 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5387.5387.2.dta 1 3 IPI00807640.1 heat shock 70kDa protein 1B 984 70294 38 38 28 28 5393 5073 1 0 0 496.5718 1486.6935 3 1486.694 -0.0005 0 38.4 0.0021 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5603.5603.3.dta 1 3 IPI00807640.1 heat shock 70kDa protein 1B 984 70294 38 38 28 28 5394 5055 1 0 0 744.3543 1486.6941 2 1486.694 0.0001 0 70.5 2.50E-07 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5585.5585.2.dta 1 3 IPI00807640.1 heat shock 70kDa protein 1B 984 70294 38 38 28 28 5685 6273 1 0 0 771.8717 1541.7289 2 1541.7296 -0.0008 1 51.89 1.40E-05 R ARFEELCSDLFR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6808.6808.2.dta 1 3 IPI00807640.1 heat shock 70kDa protein 1B 984 70294 38 38 28 28 5686 6272 1 0 0 514.9186 1541.7339 3 1541.7296 0.0043 1 40.25 0.00025 R ARFEELCSDLFR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6807.6807.3.dta 1 3 IPI00807640.1 heat shock 70kDa protein 1B 984 70294 38 38 28 28 5914 6268 1 0 0 790.4129 1578.8113 2 1578.8154 -0.0042 1 67.69 3.60E-06 K LLQDFFNGRDLNK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6802.6802.2.dta 1 3 IPI00807640.1 heat shock 70kDa protein 1B 984 70294 38 38 28 28 6037 7338 1 0 0 807.9052 1613.7959 2 1613.8011 -0.0052 0 60.94 1.70E-05 K AFYPEEISSMVLTK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7912.7912.2.dta 1 3 IPI00807640.1 heat shock 70kDa protein 1B 984 70294 38 38 28 28 6038 7350 1 0 0 538.9407 1613.8002 3 1613.8011 -0.0009 0 27.5 0.012 K AFYPEEISSMVLTK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7927.7927.3.dta 1 3 IPI00807640.1 heat shock 70kDa protein 1B 984 70294 38 38 28 28 6121 5900 1 0 0 813.4681 1624.9217 2 1624.926 -0.0043 1 65.55 2.30E-06 R QATKDAGVIAGLNVLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6435.6435.2.dta 1 3 IPI00807640.1 heat shock 70kDa protein 1B 984 70294 38 38 28 28 6122 5883 1 0 0 542.6501 1624.9284 3 1624.926 0.0024 1 73.12 3.70E-07 R QATKDAGVIAGLNVLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6419.6419.3.dta 1 3 IPI00807640.1 heat shock 70kDa protein 1B 984 70294 38 38 28 28 6143 6450 1 0 0 815.9039 1629.7932 2 1629.796 -0.0028 0 46.15 5.10E-05 K AFYPEEISSMVLTK M Oxidation (M) 0.00000000010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6981.6981.2.dta 1 3 IPI00807640.1 heat shock 70kDa protein 1B 984 70294 38 38 28 28 6369 5241 1 0 0 829.9273 1657.8401 2 1657.8424 -0.0023 0 68.11 4.10E-07 K NQVALNPQNTVFDAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5773.5773.2.dta 1 3 IPI00807640.1 heat shock 70kDa protein 1B 984 70294 38 38 28 28 6490 3442 1 0 0 838.3682 1674.7219 2 1674.7234 -0.0015 0 64.77 8.40E-07 K ATAGDTHLGGEDFDNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3829.3829.2.dta 1 3 IPI00807640.1 heat shock 70kDa protein 1B 984 70294 38 38 28 28 6491 3427 1 0 0 559.2487 1674.7241 3 1674.7234 0.0007 0 32.78 0.00084 K ATAGDTHLGGEDFDNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3813.3813.3.dta 1 3 IPI00807640.1 heat shock 70kDa protein 1B 984 70294 38 38 28 28 6551 6482 1 0 0 844.4538 1686.893 2 1686.894 -0.001 0 81.11 2.50E-08 R IINEPTAAAIAYGLDR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7014.7014.2.dta 1 3 IPI00807640.1 heat shock 70kDa protein 1B 984 70294 38 38 28 28 6552 6483 1 0 0 563.3055 1686.8946 3 1686.894 0.0006 0 51.49 3.40E-05 R IINEPTAAAIAYGLDR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7015.7015.3.dta 1 3 IPI00807640.1 heat shock 70kDa protein 1B 984 70294 38 38 28 28 7138 4696 1 0 0 907.9774 1813.9403 2 1813.9435 -0.0032 1 63.94 1.00E-06 K NQVALNPQNTVFDAKR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5198.5198.2.dta 1 3 IPI00807640.1 heat shock 70kDa protein 1B 984 70294 38 38 28 28 7139 4668 1 0 0 605.6545 1813.9418 3 1813.9435 -0.0017 1 23.42 0.018 K NQVALNPQNTVFDAKR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5168.5168.3.dta 1 3 IPI00807640.1 heat shock 70kDa protein 1B 984 70294 38 38 28 28 7173 5036 1 0 0 456.26 1821.0107 4 1821.0108 -0.0002 1 31.17 0.0047 K LDKAQIHDLVLVGGSTR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5565.5565.4.dta 1 3 IPI00807640.1 heat shock 70kDa protein 1B 984 70294 38 38 28 28 8290 5429 1 0 0 776.4142 2326.2207 3 2326.2281 -0.0074 1 63.92 1.40E-06 R LIGDAAKNQVALNPQNTVFDAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5964.5964.3.dta 1 3 IPI00807640.1 heat shock 70kDa protein 1B 984 70294 38 38 28 28 8850 5396 1 0 0 899.7747 2696.3021 3 2696.3042 -0.002 1 40.3 0.0012 K VEIIANDQGNRTTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5930.5930.3.dta 1 3 IPI00807640.1 heat shock 70kDa protein 1B 984 70294 38 38 28 28 9074 7236 1 0 0 1019.1674 3054.4802 3 3054.4869 -0.0067 0 33.07 0.00079 K ELEQVCNPIISGLYQGAGGPGPGGFGAQGPK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7790.7790.3.dta 1 4 IPI00007765.5 "Stress-70 protein, mitochondrial precursor" 301 73920 8 8 8 8 56 1917 1 0 0 307.7087 613.4029 2 613.4024 0.0006 1 29.96 0.02 K RLIGR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2149.2149.2.dta 1 4 IPI00007765.5 "Stress-70 protein, mitochondrial precursor" 301 73920 8 8 8 8 608 2023 1 0 0 387.722 773.4294 2 773.4283 0.001 0 34.13 0.013 R NTTIPTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2265.2265.2.dta 1 4 IPI00007765.5 "Stress-70 protein, mitochondrial precursor" 301 73920 8 8 8 8 3514 3238 1 0 1 616.3352 1230.6559 2 1230.6568 -0.0009 0 66.47 9.00E-07 R QAASSLQQASLK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3602.3602.2.dta 1 4 IPI00007765.5 "Stress-70 protein, mitochondrial precursor" 301 73920 8 8 8 8 3639 5868 1 0 1 621.8434 1241.6722 2 1241.6728 -0.0006 0 66.37 5.60E-06 K DAGQISGLNVLR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6404.6404.2.dta 1 4 IPI00007765.5 "Stress-70 protein, mitochondrial precursor" 301 73920 8 8 8 8 4524 7464 1 0 1 681.375 1360.7354 2 1360.7351 0.0004 0 60.88 1.10E-05 R AQFEGIVTDLIR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8054.8054.2.dta 1 4 IPI00007765.5 "Stress-70 protein, mitochondrial precursor" 301 73920 8 8 8 8 5177 5143 1 0 1 725.8611 1449.7077 2 1449.71 -0.0023 0 87.61 6.10E-09 R TTPSVVAFTADGER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5673.5673.2.dta 1 4 IPI00007765.5 "Stress-70 protein, mitochondrial precursor" 301 73920 8 8 8 8 5813 3863 1 0 1 784.8874 1567.7602 2 1567.7631 -0.0028 0 65.45 7.30E-07 R QAVTNPNNTFYATK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4295.4295.2.dta 1 4 IPI00007765.5 "Stress-70 protein, mitochondrial precursor" 301 73920 8 8 8 8 6635 6158 1 0 1 847.9285 1693.8425 2 1693.8424 0.0001 0 43.82 0.00017 K NAVITVPAYFNDSQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6693.6693.2.dta 1 5 IPI00003362.2 HSPA5 protein 262 72492 10 10 7 7 56 1917 1 0 0 307.7087 613.4029 2 613.4024 0.0006 1 29.96 0.02 K RLIGR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2149.2149.2.dta 1 5 IPI00003362.2 HSPA5 protein 262 72492 10 10 7 7 269 2335 1 0 0 344.2062 686.3979 2 686.3963 0.0017 0 28.43 0.039 R LIGDAAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2605.2605.2.dta 1 5 IPI00003362.2 HSPA5 protein 262 72492 10 10 7 7 3432 5839 1 0 1 609.3182 1216.6218 2 1216.6234 -0.0016 0 72.28 1.30E-06 K DAGTIAGLNVMR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6375.6375.2.dta 1 5 IPI00003362.2 HSPA5 protein 262 72492 10 10 7 7 5491 6782 1 0 1 504.9223 1511.7451 3 1511.7442 0.0009 1 45.8 0.00034 R AKFEELNMDLFR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7318.7318.3.dta 1 5 IPI00003362.2 HSPA5 protein 262 72492 10 10 7 7 5635 7369 1 0 1 768.9028 1535.7911 2 1535.7905 0.0006 0 57.06 3.70E-05 K TFAPEEISAMVLTK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7947.7947.2.dta 1 5 IPI00003362.2 HSPA5 protein 262 72492 10 10 7 7 6374 6333 1 0 0 553.9657 1658.8753 3 1658.8879 -0.0126 0 18.76 0.023 R IINEPTAAAIAYGLDK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6866.6866.3.dta 1 5 IPI00003362.2 HSPA5 protein 262 72492 10 10 7 7 6379 6341 1 0 0 830.4504 1658.8863 2 1658.8879 -0.0016 0 83.77 5.40E-08 R IINEPTAAAIAYGLDK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6874.6874.2.dta 1 5 IPI00003362.2 HSPA5 protein 262 72492 10 10 7 7 6380 6351 1 0 0 553.9708 1658.8906 3 1658.8879 0.0028 0 58.83 1.60E-05 R IINEPTAAAIAYGLDK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6884.6884.3.dta 1 5 IPI00003362.2 HSPA5 protein 262 72492 10 10 7 7 7147 6480 1 0 1 605.9999 1814.9778 3 1814.989 -0.0112 1 38.19 0.00026 R IINEPTAAAIAYGLDKR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7011.7011.3.dta 1 5 IPI00003362.2 HSPA5 protein 262 72492 10 10 7 7 7148 5858 1 0 1 606.0027 1814.9864 3 1814.989 -0.0026 1 24.84 0.005 R IINEPTAAAIAYGLDKR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6394.6394.3.dta 1 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 1758 53598 60 60 31 31 56 1917 1 0 0 307.7087 613.4029 2 613.4024 0.0006 1 29.96 0.02 K RLIGR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2149.2149.2.dta 1 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 1758 53598 60 60 31 31 269 2335 1 0 0 344.2062 686.3979 2 686.3963 0.0017 0 28.43 0.039 R LIGDAAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2605.2605.2.dta 1 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 1758 53598 60 60 31 31 562 2573 1 0 1 383.211 764.4074 2 764.4068 0.0006 0 33.56 0.0082 K VQVEYK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2863.2863.2.dta 1 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 1758 53598 60 60 31 31 602 3480 1 0 1 387.2117 772.4089 2 772.4079 0.001 0 37.33 0.0052 K DNNLLGK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3872.3872.2.dta 1 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 1758 53598 60 60 31 31 608 2023 1 0 0 387.722 773.4294 2 773.4283 0.001 0 34.13 0.013 R NTTIPTK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2265.2265.2.dta 1 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 1758 53598 60 60 31 31 1301 1536 1 0 0 453.2346 904.4547 2 904.4549 -0.0002 1 35.8 0.0045 R LRTACER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1736.1736.2.dta 1 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 1758 53598 60 60 31 31 1302 1163 1 0 0 302.4926 904.456 3 904.4549 0.0011 1 32.1 0.0049 R LRTACER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1333.1333.3.dta 1 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 1758 53598 60 60 31 31 2490 6536 1 0 1 541.2876 1080.5606 2 1080.5604 0.0002 0 56.26 3.90E-05 K LLQDFFNGK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7068.7068.2.dta 1 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 1758 53598 60 60 31 31 3158 2192 1 0 1 590.8131 1179.6117 2 1179.6135 -0.0019 1 61.23 6.30E-06 K VQVEYKGETK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2450.2450.2.dta 1 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 1758 53598 60 60 31 31 3159 2191 1 0 1 394.2116 1179.613 3 1179.6135 -0.0005 1 26.95 0.013 K VQVEYKGETK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2449.2449.3.dta 1 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 1758 53598 60 60 31 31 3262 4694 1 0 1 400.2318 1197.6734 3 1197.6717 0.0017 1 26.18 0.04 R GTLDPVEKALR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5196.5196.3.dta 1 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 1758 53598 60 60 31 31 3268 6299 1 0 1 600.34 1198.6655 2 1198.667 -0.0015 0 72.17 9.60E-07 K DAGTIAGLNVLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6833.6833.2.dta 1 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 1758 53598 60 60 31 31 3269 6646 1 0 1 600.3403 1198.666 2 1198.667 -0.001 0 63.21 7.00E-06 K DAGTIAGLNVLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7181.7181.2.dta 1 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 1758 53598 60 60 31 31 3270 7290 1 0 1 600.3409 1198.6672 2 1198.667 0.0002 0 75.38 5.20E-07 K DAGTIAGLNVLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7852.7852.2.dta 1 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 1758 53598 60 60 31 31 3271 6335 1 0 1 400.563 1198.6673 3 1198.667 0.0003 0 65.29 5.30E-06 K DAGTIAGLNVLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6868.6868.3.dta 1 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 1758 53598 60 60 31 31 3602 5324 1 0 1 618.3154 1234.6163 2 1234.6169 -0.0005 0 49.34 0.00026 R MVNHFIAEFK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5858.5858.2.dta 1 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 1758 53598 60 60 31 31 3604 5319 1 0 1 412.5466 1234.618 3 1234.6169 0.0011 0 28.36 0.02 R MVNHFIAEFK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5852.5852.3.dta 1 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 1758 53598 60 60 31 31 3709 4418 1 0 1 626.8323 1251.6501 2 1251.6533 -0.0031 1 59.59 2.10E-05 K MKEIAEAYLGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4897.4897.2.dta 1 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 1758 53598 60 60 31 31 3710 4416 1 0 1 418.2245 1251.6517 3 1251.6533 -0.0015 1 53.19 9.00E-05 K MKEIAEAYLGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4895.4895.3.dta 1 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 1758 53598 60 60 31 31 3712 6711 1 0 1 627.3119 1252.6093 2 1252.6088 0.0006 0 54.3 2.10E-05 R FEELNADLFR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7248.7248.2.dta 1 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 1758 53598 60 60 31 31 3719 4341 1 0 1 627.7866 1253.5586 2 1253.5598 -0.0012 0 53.75 4.50E-05 R FDDAVVQSDMK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4813.4813.2.dta 1 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 1758 53598 60 60 31 31 3858 3902 1 0 1 634.8308 1267.6471 2 1267.6482 -0.0011 1 56.84 3.60E-05 K MKEIAEAYLGK T Oxidation (M) 0.10000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4338.4338.2.dta 1 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 1758 53598 60 60 31 31 3859 3894 1 0 1 423.5564 1267.6475 3 1267.6482 -0.0007 1 33.98 0.0024 K MKEIAEAYLGK T Oxidation (M) 0.10000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4329.4329.3.dta 1 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 1758 53598 60 60 31 31 4888 3942 1 0 1 470.894 1409.66 3 1409.6609 -0.0009 1 21.03 0.011 R RFDDAVVQSDMK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4381.4381.3.dta 1 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 1758 53598 60 60 31 31 5372 6128 1 0 1 494.2568 1479.7486 3 1479.747 0.0016 1 44.21 0.00052 R ARFEELNADLFR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6663.6663.3.dta 1 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 1758 53598 60 60 31 31 5377 4657 1 0 1 741.4064 1480.7982 2 1480.7998 -0.0016 0 56.53 5.00E-06 K SQIHDIVLVGGSTR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5156.5156.2.dta 1 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 1758 53598 60 60 31 31 5392 4871 1 0 0 744.353 1486.6915 2 1486.694 -0.0025 0 47.3 8.20E-05 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5387.5387.2.dta 1 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 1758 53598 60 60 31 31 5393 5073 1 0 0 496.5718 1486.6935 3 1486.694 -0.0005 0 38.4 0.0021 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5603.5603.3.dta 1 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 1758 53598 60 60 31 31 5394 5055 1 0 0 744.3543 1486.6941 2 1486.694 0.0001 0 70.5 2.50E-07 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5585.5585.2.dta 1 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 1758 53598 60 60 31 31 5791 6185 1 0 1 783.4216 1564.8286 2 1564.8249 0.0037 1 76.98 2.50E-07 K LLQDFFNGKELNK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6720.6720.2.dta 1 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 1758 53598 60 60 31 31 5793 6180 1 0 1 522.6179 1564.8319 3 1564.8249 0.007 1 31.48 0.0059 K LLQDFFNGKELNK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6716.6716.3.dta 1 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 1758 53598 60 60 31 31 6044 6798 1 0 1 808.8985 1615.7824 2 1615.7804 0.0021 0 89.24 5.10E-09 K SFYPEEVSSMVLTK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7333.7333.2.dta 1 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 1758 53598 60 60 31 31 6130 5373 1 0 1 814.4597 1626.9048 2 1626.9053 -0.0006 1 89.72 3.90E-09 R QATKDAGTIAGLNVLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5907.5907.2.dta 1 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 1758 53598 60 60 31 31 6131 5547 1 0 1 543.3094 1626.9065 3 1626.9053 0.0012 1 44.38 0.00035 R QATKDAGTIAGLNVLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6082.6082.3.dta 1 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 1758 53598 60 60 31 31 6153 5913 1 0 1 816.8929 1631.7712 2 1631.7753 -0.0041 0 75.08 9.10E-08 K SFYPEEVSSMVLTK M Oxidation (M) 0.00000000010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6448.6448.2.dta 1 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 1758 53598 60 60 31 31 6320 5113 1 0 1 825.3995 1648.7844 2 1648.7879 -0.0035 0 66.12 8.90E-07 K NQVAMNPTNTVFDAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5643.5643.2.dta 1 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 1758 53598 60 60 31 31 6374 6333 1 0 0 553.9657 1658.8753 3 1658.8879 -0.0126 0 18.76 0.023 R IINEPTAAAIAYGLDK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6866.6866.3.dta 1 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 1758 53598 60 60 31 31 6379 6341 1 0 0 830.4504 1658.8863 2 1658.8879 -0.0016 0 83.77 5.40E-08 R IINEPTAAAIAYGLDK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6874.6874.2.dta 1 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 1758 53598 60 60 31 31 6380 6351 1 0 0 553.9708 1658.8906 3 1658.8879 0.0028 0 58.83 1.60E-05 R IINEPTAAAIAYGLDK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6884.6884.3.dta 1 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 1758 53598 60 60 31 31 6412 4371 1 0 1 833.3973 1664.78 2 1664.7828 -0.0028 0 83.74 3.40E-08 K NQVAMNPTNTVFDAK R Oxidation (M) 0.000010000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4846.4846.2.dta 1 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 1758 53598 60 60 31 31 6567 3415 1 0 1 846.3651 1690.7156 2 1690.7183 -0.0028 0 63.77 1.40E-06 K STAGDTHLGGEDFDNR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3800.3800.2.dta 1 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 1758 53598 60 60 31 31 6568 3402 1 0 1 564.5795 1690.7166 3 1690.7183 -0.0018 0 38.63 0.00052 K STAGDTHLGGEDFDNR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3786.3786.3.dta 1 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 1758 53598 60 60 31 31 7027 5729 1 0 1 894.4971 1786.9797 2 1786.9828 -0.0031 1 81.02 4.70E-08 R IINEPTAAAIAYGLDKK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6264.6264.2.dta 1 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 1758 53598 60 60 31 31 7028 5725 1 0 1 596.6681 1786.9824 3 1786.9828 -0.0004 1 22.58 0.0078 R IINEPTAAAIAYGLDKK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6260.6260.3.dta 1 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 1758 53598 60 60 31 31 7103 4556 1 0 1 903.4504 1804.8862 2 1804.889 -0.0028 1 51.12 0.00013 K NQVAMNPTNTVFDAKR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5046.5046.2.dta 1 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 1758 53598 60 60 31 31 7104 4519 1 0 1 602.637 1804.8891 3 1804.889 0.0001 1 18.29 0.019 K NQVAMNPTNTVFDAKR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5006.5006.3.dta 1 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 1758 53598 60 60 31 31 7172 3831 1 0 1 607.9684 1820.8833 3 1820.8839 -0.0006 1 21.91 0.013 K NQVAMNPTNTVFDAKR L Oxidation (M) 0.0000100000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4261.4261.3.dta 1 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 1758 53598 60 60 31 31 7248 4814 1 0 1 919.5087 1837.0029 2 1837.0058 -0.0029 1 97.37 7.40E-10 K LDKSQIHDIVLVGGSTR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5326.5326.2.dta 1 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 1758 53598 60 60 31 31 7249 4800 1 0 1 613.3418 1837.0036 3 1837.0058 -0.0022 1 63.11 3.30E-06 K LDKSQIHDIVLVGGSTR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5311.5311.3.dta 1 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 1758 53598 60 60 31 31 7250 4804 1 0 1 460.2589 1837.0065 4 1837.0058 0.0008 1 18.22 0.03 K LDKSQIHDIVLVGGSTR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5315.5315.4.dta 1 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 1758 53598 60 60 31 31 7251 4794 1 0 1 613.343 1837.0072 3 1837.0058 0.0015 1 54.34 8.00E-06 K LDKSQIHDIVLVGGSTR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5304.5304.3.dta 1 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 1758 53598 60 60 31 31 7753 6102 1 0 1 991.5013 1980.9881 2 1980.9905 -0.0024 0 42.54 0.0001 K TVTNAVVTVPAYFNDSQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6637.6637.2.dta 1 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 1758 53598 60 60 31 31 7754 5967 1 0 1 991.5023 1980.9901 2 1980.9905 -0.0004 0 53.27 1.20E-05 K TVTNAVVTVPAYFNDSQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6501.6501.2.dta 1 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 1758 53598 60 60 31 31 7755 5969 1 0 1 661.3376 1980.9909 3 1980.9905 0.0004 0 29.86 0.0035 K TVTNAVVTVPAYFNDSQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6503.6503.3.dta 1 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 1758 53598 60 60 31 31 7756 6090 1 0 1 661.338 1980.992 3 1980.9905 0.0015 0 58.48 3.30E-06 K TVTNAVVTVPAYFNDSQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6625.6625.3.dta 1 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 1758 53598 60 60 31 31 7924 6912 1 0 1 698.355 2092.0431 3 2092.0477 -0.0046 1 17.57 0.022 R FEELNADLFRGTLDPVEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7447.7447.3.dta 1 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 1758 53598 60 60 31 31 7925 6933 1 0 1 698.3566 2092.0479 3 2092.0477 0.0002 1 26.69 0.0031 R FEELNADLFRGTLDPVEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7469.7469.3.dta 1 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 1758 53598 60 60 31 31 8270 5332 1 0 1 773.3984 2317.1733 3 2317.1736 -0.0003 1 77.94 4.90E-08 R LIGDAAKNQVAMNPTNTVFDAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5866.5866.3.dta 1 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 1758 53598 60 60 31 31 8296 4777 1 0 1 778.7302 2333.1687 3 2333.1685 0.0001 1 39.79 0.00051 R LIGDAAKNQVAMNPTNTVFDAK R Oxidation (M) 0.0000000000010000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5286.5286.3.dta 1 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 1758 53598 60 60 31 31 8850 5396 1 0 0 899.7747 2696.3021 3 2696.3042 -0.002 1 40.3 0.0012 K VEIIANDQGNRTTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5930.5930.3.dta 1 IPI00795040.1 Heat shock 70kDa protein 8 isoform 2 variant (Fragment) 1752 53580 59 59 30 30 56 1917 1 0 0 307.7087 613.4029 2 613.4024 0.0006 1 29.96 0.02 K RLIGR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2149.2149.2.dta 1 IPI00795040.1 Heat shock 70kDa protein 8 isoform 2 variant (Fragment) 1752 53580 59 59 30 30 269 2335 1 0 0 344.2062 686.3979 2 686.3963 0.0017 0 28.43 0.039 R LIGDAAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2605.2605.2.dta 1 IPI00795040.1 Heat shock 70kDa protein 8 isoform 2 variant (Fragment) 1752 53580 59 59 30 30 562 2573 1 0 1 383.211 764.4074 2 764.4068 0.0006 0 33.56 0.0082 K VQVEYK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2863.2863.2.dta 1 IPI00795040.1 Heat shock 70kDa protein 8 isoform 2 variant (Fragment) 1752 53580 59 59 30 30 602 3480 1 0 1 387.2117 772.4089 2 772.4079 0.001 0 37.33 0.0052 K DNNLLGK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3872.3872.2.dta 1 IPI00795040.1 Heat shock 70kDa protein 8 isoform 2 variant (Fragment) 1752 53580 59 59 30 30 1301 1536 1 0 0 453.2346 904.4547 2 904.4549 -0.0002 1 35.8 0.0045 R LRTACER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1736.1736.2.dta 1 IPI00795040.1 Heat shock 70kDa protein 8 isoform 2 variant (Fragment) 1752 53580 59 59 30 30 1302 1163 1 0 0 302.4926 904.456 3 904.4549 0.0011 1 32.1 0.0049 R LRTACER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1333.1333.3.dta 1 IPI00795040.1 Heat shock 70kDa protein 8 isoform 2 variant (Fragment) 1752 53580 59 59 30 30 2490 6536 1 0 1 541.2876 1080.5606 2 1080.5604 0.0002 0 56.26 3.90E-05 K LLQDFFNGK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7068.7068.2.dta 1 IPI00795040.1 Heat shock 70kDa protein 8 isoform 2 variant (Fragment) 1752 53580 59 59 30 30 3158 2192 1 0 1 590.8131 1179.6117 2 1179.6135 -0.0019 1 61.23 6.30E-06 K VQVEYKGETK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2450.2450.2.dta 1 IPI00795040.1 Heat shock 70kDa protein 8 isoform 2 variant (Fragment) 1752 53580 59 59 30 30 3159 2191 1 0 1 394.2116 1179.613 3 1179.6135 -0.0005 1 26.95 0.013 K VQVEYKGETK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2449.2449.3.dta 1 IPI00795040.1 Heat shock 70kDa protein 8 isoform 2 variant (Fragment) 1752 53580 59 59 30 30 3262 4694 1 0 1 400.2318 1197.6734 3 1197.6717 0.0017 1 26.18 0.04 R GTLDPVEKALR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5196.5196.3.dta 1 IPI00795040.1 Heat shock 70kDa protein 8 isoform 2 variant (Fragment) 1752 53580 59 59 30 30 3268 6299 1 0 1 600.34 1198.6655 2 1198.667 -0.0015 0 72.17 9.60E-07 K DAGTIAGLNVLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6833.6833.2.dta 1 IPI00795040.1 Heat shock 70kDa protein 8 isoform 2 variant (Fragment) 1752 53580 59 59 30 30 3269 6646 1 0 1 600.3403 1198.666 2 1198.667 -0.001 0 63.21 7.00E-06 K DAGTIAGLNVLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7181.7181.2.dta 1 IPI00795040.1 Heat shock 70kDa protein 8 isoform 2 variant (Fragment) 1752 53580 59 59 30 30 3270 7290 1 0 1 600.3409 1198.6672 2 1198.667 0.0002 0 75.38 5.20E-07 K DAGTIAGLNVLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7852.7852.2.dta 1 IPI00795040.1 Heat shock 70kDa protein 8 isoform 2 variant (Fragment) 1752 53580 59 59 30 30 3271 6335 1 0 1 400.563 1198.6673 3 1198.667 0.0003 0 65.29 5.30E-06 K DAGTIAGLNVLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6868.6868.3.dta 1 IPI00795040.1 Heat shock 70kDa protein 8 isoform 2 variant (Fragment) 1752 53580 59 59 30 30 3602 5324 1 0 1 618.3154 1234.6163 2 1234.6169 -0.0005 0 49.34 0.00026 R MVNHFIAEFK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5858.5858.2.dta 1 IPI00795040.1 Heat shock 70kDa protein 8 isoform 2 variant (Fragment) 1752 53580 59 59 30 30 3604 5319 1 0 1 412.5466 1234.618 3 1234.6169 0.0011 0 28.36 0.02 R MVNHFIAEFK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5852.5852.3.dta 1 IPI00795040.1 Heat shock 70kDa protein 8 isoform 2 variant (Fragment) 1752 53580 59 59 30 30 3709 4418 1 0 1 626.8323 1251.6501 2 1251.6533 -0.0031 1 59.59 2.10E-05 K MKEIAEAYLGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4897.4897.2.dta 1 IPI00795040.1 Heat shock 70kDa protein 8 isoform 2 variant (Fragment) 1752 53580 59 59 30 30 3710 4416 1 0 1 418.2245 1251.6517 3 1251.6533 -0.0015 1 53.19 9.00E-05 K MKEIAEAYLGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4895.4895.3.dta 1 IPI00795040.1 Heat shock 70kDa protein 8 isoform 2 variant (Fragment) 1752 53580 59 59 30 30 3712 6711 1 0 1 627.3119 1252.6093 2 1252.6088 0.0006 0 54.3 2.10E-05 R FEELNADLFR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7248.7248.2.dta 1 IPI00795040.1 Heat shock 70kDa protein 8 isoform 2 variant (Fragment) 1752 53580 59 59 30 30 3719 4341 1 0 1 627.7866 1253.5586 2 1253.5598 -0.0012 0 53.75 4.50E-05 R FDDAVVQSDMK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4813.4813.2.dta 1 IPI00795040.1 Heat shock 70kDa protein 8 isoform 2 variant (Fragment) 1752 53580 59 59 30 30 3858 3902 1 0 1 634.8308 1267.6471 2 1267.6482 -0.0011 1 56.84 3.60E-05 K MKEIAEAYLGK T Oxidation (M) 0.10000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4338.4338.2.dta 1 IPI00795040.1 Heat shock 70kDa protein 8 isoform 2 variant (Fragment) 1752 53580 59 59 30 30 3859 3894 1 0 1 423.5564 1267.6475 3 1267.6482 -0.0007 1 33.98 0.0024 K MKEIAEAYLGK T Oxidation (M) 0.10000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4329.4329.3.dta 1 IPI00795040.1 Heat shock 70kDa protein 8 isoform 2 variant (Fragment) 1752 53580 59 59 30 30 4888 3942 1 0 1 470.894 1409.66 3 1409.6609 -0.0009 1 21.03 0.011 R RFDDAVVQSDMK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4381.4381.3.dta 1 IPI00795040.1 Heat shock 70kDa protein 8 isoform 2 variant (Fragment) 1752 53580 59 59 30 30 5372 6128 1 0 1 494.2568 1479.7486 3 1479.747 0.0016 1 44.21 0.00052 R ARFEELNADLFR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6663.6663.3.dta 1 IPI00795040.1 Heat shock 70kDa protein 8 isoform 2 variant (Fragment) 1752 53580 59 59 30 30 5377 4657 1 0 1 741.4064 1480.7982 2 1480.7998 -0.0016 0 56.53 5.00E-06 K SQIHDIVLVGGSTR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5156.5156.2.dta 1 IPI00795040.1 Heat shock 70kDa protein 8 isoform 2 variant (Fragment) 1752 53580 59 59 30 30 5392 4871 1 0 0 744.353 1486.6915 2 1486.694 -0.0025 0 47.3 8.20E-05 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5387.5387.2.dta 1 IPI00795040.1 Heat shock 70kDa protein 8 isoform 2 variant (Fragment) 1752 53580 59 59 30 30 5393 5073 1 0 0 496.5718 1486.6935 3 1486.694 -0.0005 0 38.4 0.0021 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5603.5603.3.dta 1 IPI00795040.1 Heat shock 70kDa protein 8 isoform 2 variant (Fragment) 1752 53580 59 59 30 30 5394 5055 1 0 0 744.3543 1486.6941 2 1486.694 0.0001 0 70.5 2.50E-07 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5585.5585.2.dta 1 IPI00795040.1 Heat shock 70kDa protein 8 isoform 2 variant (Fragment) 1752 53580 59 59 30 30 5791 6185 1 0 1 783.4216 1564.8286 2 1564.8249 0.0037 1 76.98 2.50E-07 K LLQDFFNGKELNK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6720.6720.2.dta 1 IPI00795040.1 Heat shock 70kDa protein 8 isoform 2 variant (Fragment) 1752 53580 59 59 30 30 5793 6180 1 0 1 522.6179 1564.8319 3 1564.8249 0.007 1 31.48 0.0059 K LLQDFFNGKELNK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6716.6716.3.dta 1 IPI00795040.1 Heat shock 70kDa protein 8 isoform 2 variant (Fragment) 1752 53580 59 59 30 30 6044 6798 1 0 1 808.8985 1615.7824 2 1615.7804 0.0021 0 89.24 5.10E-09 K SFYPEEVSSMVLTK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7333.7333.2.dta 1 IPI00795040.1 Heat shock 70kDa protein 8 isoform 2 variant (Fragment) 1752 53580 59 59 30 30 6130 5373 1 0 1 814.4597 1626.9048 2 1626.9053 -0.0006 1 89.72 3.90E-09 R QATKDAGTIAGLNVLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5907.5907.2.dta 1 IPI00795040.1 Heat shock 70kDa protein 8 isoform 2 variant (Fragment) 1752 53580 59 59 30 30 6131 5547 1 0 1 543.3094 1626.9065 3 1626.9053 0.0012 1 44.38 0.00035 R QATKDAGTIAGLNVLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6082.6082.3.dta 1 IPI00795040.1 Heat shock 70kDa protein 8 isoform 2 variant (Fragment) 1752 53580 59 59 30 30 6153 5913 1 0 1 816.8929 1631.7712 2 1631.7753 -0.0041 0 75.08 9.10E-08 K SFYPEEVSSMVLTK M Oxidation (M) 0.00000000010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6448.6448.2.dta 1 IPI00795040.1 Heat shock 70kDa protein 8 isoform 2 variant (Fragment) 1752 53580 59 59 30 30 6320 5113 1 0 1 825.3995 1648.7844 2 1648.7879 -0.0035 0 66.12 8.90E-07 K NQVAMNPTNTVFDAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5643.5643.2.dta 1 IPI00795040.1 Heat shock 70kDa protein 8 isoform 2 variant (Fragment) 1752 53580 59 59 30 30 6374 6333 1 0 0 553.9657 1658.8753 3 1658.8879 -0.0126 0 18.76 0.023 R IINEPTAAAIAYGLDK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6866.6866.3.dta 1 IPI00795040.1 Heat shock 70kDa protein 8 isoform 2 variant (Fragment) 1752 53580 59 59 30 30 6379 6341 1 0 0 830.4504 1658.8863 2 1658.8879 -0.0016 0 83.77 5.40E-08 R IINEPTAAAIAYGLDK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6874.6874.2.dta 1 IPI00795040.1 Heat shock 70kDa protein 8 isoform 2 variant (Fragment) 1752 53580 59 59 30 30 6380 6351 1 0 0 553.9708 1658.8906 3 1658.8879 0.0028 0 58.83 1.60E-05 R IINEPTAAAIAYGLDK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6884.6884.3.dta 1 IPI00795040.1 Heat shock 70kDa protein 8 isoform 2 variant (Fragment) 1752 53580 59 59 30 30 6412 4371 1 0 1 833.3973 1664.78 2 1664.7828 -0.0028 0 83.74 3.40E-08 K NQVAMNPTNTVFDAK R Oxidation (M) 0.000010000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4846.4846.2.dta 1 IPI00795040.1 Heat shock 70kDa protein 8 isoform 2 variant (Fragment) 1752 53580 59 59 30 30 6567 3415 1 0 1 846.3651 1690.7156 2 1690.7183 -0.0028 0 63.77 1.40E-06 K STAGDTHLGGEDFDNR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3800.3800.2.dta 1 IPI00795040.1 Heat shock 70kDa protein 8 isoform 2 variant (Fragment) 1752 53580 59 59 30 30 6568 3402 1 0 1 564.5795 1690.7166 3 1690.7183 -0.0018 0 38.63 0.00052 K STAGDTHLGGEDFDNR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3786.3786.3.dta 1 IPI00795040.1 Heat shock 70kDa protein 8 isoform 2 variant (Fragment) 1752 53580 59 59 30 30 7027 5729 1 0 1 894.4971 1786.9797 2 1786.9828 -0.0031 1 81.02 4.70E-08 R IINEPTAAAIAYGLDKK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6264.6264.2.dta 1 IPI00795040.1 Heat shock 70kDa protein 8 isoform 2 variant (Fragment) 1752 53580 59 59 30 30 7028 5725 1 0 1 596.6681 1786.9824 3 1786.9828 -0.0004 1 22.58 0.0078 R IINEPTAAAIAYGLDKK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6260.6260.3.dta 1 IPI00795040.1 Heat shock 70kDa protein 8 isoform 2 variant (Fragment) 1752 53580 59 59 30 30 7103 4556 1 0 1 903.4504 1804.8862 2 1804.889 -0.0028 1 51.12 0.00013 K NQVAMNPTNTVFDAKR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5046.5046.2.dta 1 IPI00795040.1 Heat shock 70kDa protein 8 isoform 2 variant (Fragment) 1752 53580 59 59 30 30 7104 4519 1 0 1 602.637 1804.8891 3 1804.889 0.0001 1 18.29 0.019 K NQVAMNPTNTVFDAKR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5006.5006.3.dta 1 IPI00795040.1 Heat shock 70kDa protein 8 isoform 2 variant (Fragment) 1752 53580 59 59 30 30 7172 3831 1 0 1 607.9684 1820.8833 3 1820.8839 -0.0006 1 21.91 0.013 K NQVAMNPTNTVFDAKR L Oxidation (M) 0.0000100000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4261.4261.3.dta 1 IPI00795040.1 Heat shock 70kDa protein 8 isoform 2 variant (Fragment) 1752 53580 59 59 30 30 7248 4814 1 0 1 919.5087 1837.0029 2 1837.0058 -0.0029 1 97.37 7.40E-10 K LDKSQIHDIVLVGGSTR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5326.5326.2.dta 1 IPI00795040.1 Heat shock 70kDa protein 8 isoform 2 variant (Fragment) 1752 53580 59 59 30 30 7249 4800 1 0 1 613.3418 1837.0036 3 1837.0058 -0.0022 1 63.11 3.30E-06 K LDKSQIHDIVLVGGSTR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5311.5311.3.dta 1 IPI00795040.1 Heat shock 70kDa protein 8 isoform 2 variant (Fragment) 1752 53580 59 59 30 30 7250 4804 1 0 1 460.2589 1837.0065 4 1837.0058 0.0008 1 18.22 0.03 K LDKSQIHDIVLVGGSTR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5315.5315.4.dta 1 IPI00795040.1 Heat shock 70kDa protein 8 isoform 2 variant (Fragment) 1752 53580 59 59 30 30 7251 4794 1 0 1 613.343 1837.0072 3 1837.0058 0.0015 1 54.34 8.00E-06 K LDKSQIHDIVLVGGSTR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5304.5304.3.dta 1 IPI00795040.1 Heat shock 70kDa protein 8 isoform 2 variant (Fragment) 1752 53580 59 59 30 30 7753 6102 1 0 1 991.5013 1980.9881 2 1980.9905 -0.0024 0 42.54 0.0001 K TVTNAVVTVPAYFNDSQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6637.6637.2.dta 1 IPI00795040.1 Heat shock 70kDa protein 8 isoform 2 variant (Fragment) 1752 53580 59 59 30 30 7754 5967 1 0 1 991.5023 1980.9901 2 1980.9905 -0.0004 0 53.27 1.20E-05 K TVTNAVVTVPAYFNDSQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6501.6501.2.dta 1 IPI00795040.1 Heat shock 70kDa protein 8 isoform 2 variant (Fragment) 1752 53580 59 59 30 30 7755 5969 1 0 1 661.3376 1980.9909 3 1980.9905 0.0004 0 29.86 0.0035 K TVTNAVVTVPAYFNDSQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6503.6503.3.dta 1 IPI00795040.1 Heat shock 70kDa protein 8 isoform 2 variant (Fragment) 1752 53580 59 59 30 30 7756 6090 1 0 1 661.338 1980.992 3 1980.9905 0.0015 0 58.48 3.30E-06 K TVTNAVVTVPAYFNDSQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6625.6625.3.dta 1 IPI00795040.1 Heat shock 70kDa protein 8 isoform 2 variant (Fragment) 1752 53580 59 59 30 30 7924 6912 1 0 1 698.355 2092.0431 3 2092.0477 -0.0046 1 17.57 0.022 R FEELNADLFRGTLDPVEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7447.7447.3.dta 1 IPI00795040.1 Heat shock 70kDa protein 8 isoform 2 variant (Fragment) 1752 53580 59 59 30 30 7925 6933 1 0 1 698.3566 2092.0479 3 2092.0477 0.0002 1 26.69 0.0031 R FEELNADLFRGTLDPVEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7469.7469.3.dta 1 IPI00795040.1 Heat shock 70kDa protein 8 isoform 2 variant (Fragment) 1752 53580 59 59 30 30 8270 5332 1 0 1 773.3984 2317.1733 3 2317.1736 -0.0003 1 77.94 4.90E-08 R LIGDAAKNQVAMNPTNTVFDAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5866.5866.3.dta 1 IPI00795040.1 Heat shock 70kDa protein 8 isoform 2 variant (Fragment) 1752 53580 59 59 30 30 8296 4777 1 0 1 778.7302 2333.1687 3 2333.1685 0.0001 1 39.79 0.00051 R LIGDAAKNQVAMNPTNTVFDAK R Oxidation (M) 0.0000000000010000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5286.5286.3.dta 1 IPI00795040.1 Heat shock 70kDa protein 8 isoform 2 variant (Fragment) 1752 53580 59 59 30 30 8850 5396 1 0 0 899.7747 2696.3021 3 2696.3042 -0.002 1 40.3 0.0012 K VEIIANDQGNRTTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5930.5930.3.dta 1 IPI00792459.1 23 kDa protein 1257 23238 39 39 18 18 56 1917 1 0 0 307.7087 613.4029 2 613.4024 0.0006 1 29.96 0.02 K RLIGR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2149.2149.2.dta 1 IPI00792459.1 23 kDa protein 1257 23238 39 39 18 18 269 2335 1 0 0 344.2062 686.3979 2 686.3963 0.0017 0 28.43 0.039 R LIGDAAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2605.2605.2.dta 1 IPI00792459.1 23 kDa protein 1257 23238 39 39 18 18 562 2573 1 0 1 383.211 764.4074 2 764.4068 0.0006 0 33.56 0.0082 K VQVEYK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2863.2863.2.dta 1 IPI00792459.1 23 kDa protein 1257 23238 39 39 18 18 3158 2192 1 0 1 590.8131 1179.6117 2 1179.6135 -0.0019 1 61.23 6.30E-06 K VQVEYKGETK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2450.2450.2.dta 1 IPI00792459.1 23 kDa protein 1257 23238 39 39 18 18 3159 2191 1 0 1 394.2116 1179.613 3 1179.6135 -0.0005 1 26.95 0.013 K VQVEYKGETK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2449.2449.3.dta 1 IPI00792459.1 23 kDa protein 1257 23238 39 39 18 18 3268 6299 1 0 1 600.34 1198.6655 2 1198.667 -0.0015 0 72.17 9.60E-07 K DAGTIAGLNVLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6833.6833.2.dta 1 IPI00792459.1 23 kDa protein 1257 23238 39 39 18 18 3269 6646 1 0 1 600.3403 1198.666 2 1198.667 -0.001 0 63.21 7.00E-06 K DAGTIAGLNVLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7181.7181.2.dta 1 IPI00792459.1 23 kDa protein 1257 23238 39 39 18 18 3270 7290 1 0 1 600.3409 1198.6672 2 1198.667 0.0002 0 75.38 5.20E-07 K DAGTIAGLNVLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7852.7852.2.dta 1 IPI00792459.1 23 kDa protein 1257 23238 39 39 18 18 3271 6335 1 0 1 400.563 1198.6673 3 1198.667 0.0003 0 65.29 5.30E-06 K DAGTIAGLNVLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6868.6868.3.dta 1 IPI00792459.1 23 kDa protein 1257 23238 39 39 18 18 3709 4418 1 0 1 626.8323 1251.6501 2 1251.6533 -0.0031 1 59.59 2.10E-05 K MKEIAEAYLGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4897.4897.2.dta 1 IPI00792459.1 23 kDa protein 1257 23238 39 39 18 18 3710 4416 1 0 1 418.2245 1251.6517 3 1251.6533 -0.0015 1 53.19 9.00E-05 K MKEIAEAYLGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4895.4895.3.dta 1 IPI00792459.1 23 kDa protein 1257 23238 39 39 18 18 3719 4341 1 0 1 627.7866 1253.5586 2 1253.5598 -0.0012 0 53.75 4.50E-05 R FDDAVVQSDMK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4813.4813.2.dta 1 IPI00792459.1 23 kDa protein 1257 23238 39 39 18 18 3858 3902 1 0 1 634.8308 1267.6471 2 1267.6482 -0.0011 1 56.84 3.60E-05 K MKEIAEAYLGK T Oxidation (M) 0.10000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4338.4338.2.dta 1 IPI00792459.1 23 kDa protein 1257 23238 39 39 18 18 3859 3894 1 0 1 423.5564 1267.6475 3 1267.6482 -0.0007 1 33.98 0.0024 K MKEIAEAYLGK T Oxidation (M) 0.10000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4329.4329.3.dta 1 IPI00792459.1 23 kDa protein 1257 23238 39 39 18 18 4888 3942 1 0 1 470.894 1409.66 3 1409.6609 -0.0009 1 21.03 0.011 R RFDDAVVQSDMK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4381.4381.3.dta 1 IPI00792459.1 23 kDa protein 1257 23238 39 39 18 18 5392 4871 1 0 0 744.353 1486.6915 2 1486.694 -0.0025 0 47.3 8.20E-05 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5387.5387.2.dta 1 IPI00792459.1 23 kDa protein 1257 23238 39 39 18 18 5393 5073 1 0 0 496.5718 1486.6935 3 1486.694 -0.0005 0 38.4 0.0021 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5603.5603.3.dta 1 IPI00792459.1 23 kDa protein 1257 23238 39 39 18 18 5394 5055 1 0 0 744.3543 1486.6941 2 1486.694 0.0001 0 70.5 2.50E-07 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5585.5585.2.dta 1 IPI00792459.1 23 kDa protein 1257 23238 39 39 18 18 6044 6798 1 0 1 808.8985 1615.7824 2 1615.7804 0.0021 0 89.24 5.10E-09 K SFYPEEVSSMVLTK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7333.7333.2.dta 1 IPI00792459.1 23 kDa protein 1257 23238 39 39 18 18 6130 5373 1 0 1 814.4597 1626.9048 2 1626.9053 -0.0006 1 89.72 3.90E-09 R QATKDAGTIAGLNVLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5907.5907.2.dta 1 IPI00792459.1 23 kDa protein 1257 23238 39 39 18 18 6131 5547 1 0 1 543.3094 1626.9065 3 1626.9053 0.0012 1 44.38 0.00035 R QATKDAGTIAGLNVLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6082.6082.3.dta 1 IPI00792459.1 23 kDa protein 1257 23238 39 39 18 18 6153 5913 1 0 1 816.8929 1631.7712 2 1631.7753 -0.0041 0 75.08 9.10E-08 K SFYPEEVSSMVLTK M Oxidation (M) 0.00000000010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6448.6448.2.dta 1 IPI00792459.1 23 kDa protein 1257 23238 39 39 18 18 6320 5113 1 0 1 825.3995 1648.7844 2 1648.7879 -0.0035 0 66.12 8.90E-07 K NQVAMNPTNTVFDAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5643.5643.2.dta 1 IPI00792459.1 23 kDa protein 1257 23238 39 39 18 18 6374 6333 1 0 0 553.9657 1658.8753 3 1658.8879 -0.0126 0 18.76 0.023 R IINEPTAAAIAYGLDK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6866.6866.3.dta 1 IPI00792459.1 23 kDa protein 1257 23238 39 39 18 18 6379 6341 1 0 0 830.4504 1658.8863 2 1658.8879 -0.0016 0 83.77 5.40E-08 R IINEPTAAAIAYGLDK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6874.6874.2.dta 1 IPI00792459.1 23 kDa protein 1257 23238 39 39 18 18 6380 6351 1 0 0 553.9708 1658.8906 3 1658.8879 0.0028 0 58.83 1.60E-05 R IINEPTAAAIAYGLDK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6884.6884.3.dta 1 IPI00792459.1 23 kDa protein 1257 23238 39 39 18 18 6412 4371 1 0 1 833.3973 1664.78 2 1664.7828 -0.0028 0 83.74 3.40E-08 K NQVAMNPTNTVFDAK R Oxidation (M) 0.000010000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4846.4846.2.dta 1 IPI00792459.1 23 kDa protein 1257 23238 39 39 18 18 7027 5729 1 0 1 894.4971 1786.9797 2 1786.9828 -0.0031 1 81.02 4.70E-08 R IINEPTAAAIAYGLDKK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6264.6264.2.dta 1 IPI00792459.1 23 kDa protein 1257 23238 39 39 18 18 7028 5725 1 0 1 596.6681 1786.9824 3 1786.9828 -0.0004 1 22.58 0.0078 R IINEPTAAAIAYGLDKK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6260.6260.3.dta 1 IPI00792459.1 23 kDa protein 1257 23238 39 39 18 18 7103 4556 1 0 1 903.4504 1804.8862 2 1804.889 -0.0028 1 51.12 0.00013 K NQVAMNPTNTVFDAKR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5046.5046.2.dta 1 IPI00792459.1 23 kDa protein 1257 23238 39 39 18 18 7104 4519 1 0 1 602.637 1804.8891 3 1804.889 0.0001 1 18.29 0.019 K NQVAMNPTNTVFDAKR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5006.5006.3.dta 1 IPI00792459.1 23 kDa protein 1257 23238 39 39 18 18 7172 3831 1 0 1 607.9684 1820.8833 3 1820.8839 -0.0006 1 21.91 0.013 K NQVAMNPTNTVFDAKR L Oxidation (M) 0.0000100000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4261.4261.3.dta 1 IPI00792459.1 23 kDa protein 1257 23238 39 39 18 18 7753 6102 1 0 1 991.5013 1980.9881 2 1980.9905 -0.0024 0 42.54 0.0001 K TVTNAVVTVPAYFNDSQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6637.6637.2.dta 1 IPI00792459.1 23 kDa protein 1257 23238 39 39 18 18 7754 5967 1 0 1 991.5023 1980.9901 2 1980.9905 -0.0004 0 53.27 1.20E-05 K TVTNAVVTVPAYFNDSQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6501.6501.2.dta 1 IPI00792459.1 23 kDa protein 1257 23238 39 39 18 18 7755 5969 1 0 1 661.3376 1980.9909 3 1980.9905 0.0004 0 29.86 0.0035 K TVTNAVVTVPAYFNDSQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6503.6503.3.dta 1 IPI00792459.1 23 kDa protein 1257 23238 39 39 18 18 7756 6090 1 0 1 661.338 1980.992 3 1980.9905 0.0015 0 58.48 3.30E-06 K TVTNAVVTVPAYFNDSQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6625.6625.3.dta 1 IPI00792459.1 23 kDa protein 1257 23238 39 39 18 18 8270 5332 1 0 1 773.3984 2317.1733 3 2317.1736 -0.0003 1 77.94 4.90E-08 R LIGDAAKNQVAMNPTNTVFDAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5866.5866.3.dta 1 IPI00792459.1 23 kDa protein 1257 23238 39 39 18 18 8296 4777 1 0 1 778.7302 2333.1687 3 2333.1685 0.0001 1 39.79 0.00051 R LIGDAAKNQVAMNPTNTVFDAK R Oxidation (M) 0.0000000000010000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5286.5286.3.dta 1 IPI00792459.1 23 kDa protein 1257 23238 39 39 18 18 8850 5396 1 0 0 899.7747 2696.3021 3 2696.3042 -0.002 1 40.3 0.0012 K VEIIANDQGNRTTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5930.5930.3.dta 1 IPI00797523.1 20 kDa protein 1188 20413 37 37 17 17 56 1917 1 0 0 307.7087 613.4029 2 613.4024 0.0006 1 29.96 0.02 K RLIGR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2149.2149.2.dta 1 IPI00797523.1 20 kDa protein 1188 20413 37 37 17 17 269 2335 1 0 0 344.2062 686.3979 2 686.3963 0.0017 0 28.43 0.039 R LIGDAAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2605.2605.2.dta 1 IPI00797523.1 20 kDa protein 1188 20413 37 37 17 17 562 2573 1 0 1 383.211 764.4074 2 764.4068 0.0006 0 33.56 0.0082 K VQVEYK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2863.2863.2.dta 1 IPI00797523.1 20 kDa protein 1188 20413 37 37 17 17 3158 2192 1 0 1 590.8131 1179.6117 2 1179.6135 -0.0019 1 61.23 6.30E-06 K VQVEYKGETK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2450.2450.2.dta 1 IPI00797523.1 20 kDa protein 1188 20413 37 37 17 17 3159 2191 1 0 1 394.2116 1179.613 3 1179.6135 -0.0005 1 26.95 0.013 K VQVEYKGETK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2449.2449.3.dta 1 IPI00797523.1 20 kDa protein 1188 20413 37 37 17 17 3268 6299 1 0 1 600.34 1198.6655 2 1198.667 -0.0015 0 72.17 9.60E-07 K DAGTIAGLNVLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6833.6833.2.dta 1 IPI00797523.1 20 kDa protein 1188 20413 37 37 17 17 3269 6646 1 0 1 600.3403 1198.666 2 1198.667 -0.001 0 63.21 7.00E-06 K DAGTIAGLNVLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7181.7181.2.dta 1 IPI00797523.1 20 kDa protein 1188 20413 37 37 17 17 3270 7290 1 0 1 600.3409 1198.6672 2 1198.667 0.0002 0 75.38 5.20E-07 K DAGTIAGLNVLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7852.7852.2.dta 1 IPI00797523.1 20 kDa protein 1188 20413 37 37 17 17 3271 6335 1 0 1 400.563 1198.6673 3 1198.667 0.0003 0 65.29 5.30E-06 K DAGTIAGLNVLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6868.6868.3.dta 1 IPI00797523.1 20 kDa protein 1188 20413 37 37 17 17 3709 4418 1 0 1 626.8323 1251.6501 2 1251.6533 -0.0031 1 59.59 2.10E-05 K MKEIAEAYLGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4897.4897.2.dta 1 IPI00797523.1 20 kDa protein 1188 20413 37 37 17 17 3710 4416 1 0 1 418.2245 1251.6517 3 1251.6533 -0.0015 1 53.19 9.00E-05 K MKEIAEAYLGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4895.4895.3.dta 1 IPI00797523.1 20 kDa protein 1188 20413 37 37 17 17 3719 4341 1 0 1 627.7866 1253.5586 2 1253.5598 -0.0012 0 53.75 4.50E-05 R FDDAVVQSDMK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4813.4813.2.dta 1 IPI00797523.1 20 kDa protein 1188 20413 37 37 17 17 3858 3902 1 0 1 634.8308 1267.6471 2 1267.6482 -0.0011 1 56.84 3.60E-05 K MKEIAEAYLGK T Oxidation (M) 0.10000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4338.4338.2.dta 1 IPI00797523.1 20 kDa protein 1188 20413 37 37 17 17 3859 3894 1 0 1 423.5564 1267.6475 3 1267.6482 -0.0007 1 33.98 0.0024 K MKEIAEAYLGK T Oxidation (M) 0.10000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4329.4329.3.dta 1 IPI00797523.1 20 kDa protein 1188 20413 37 37 17 17 4888 3942 1 0 1 470.894 1409.66 3 1409.6609 -0.0009 1 21.03 0.011 R RFDDAVVQSDMK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4381.4381.3.dta 1 IPI00797523.1 20 kDa protein 1188 20413 37 37 17 17 5392 4871 1 0 0 744.353 1486.6915 2 1486.694 -0.0025 0 47.3 8.20E-05 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5387.5387.2.dta 1 IPI00797523.1 20 kDa protein 1188 20413 37 37 17 17 5393 5073 1 0 0 496.5718 1486.6935 3 1486.694 -0.0005 0 38.4 0.0021 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5603.5603.3.dta 1 IPI00797523.1 20 kDa protein 1188 20413 37 37 17 17 5394 5055 1 0 0 744.3543 1486.6941 2 1486.694 0.0001 0 70.5 2.50E-07 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5585.5585.2.dta 1 IPI00797523.1 20 kDa protein 1188 20413 37 37 17 17 6044 6798 1 0 1 808.8985 1615.7824 2 1615.7804 0.0021 0 89.24 5.10E-09 K SFYPEEVSSMVLTK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7333.7333.2.dta 1 IPI00797523.1 20 kDa protein 1188 20413 37 37 17 17 6130 5373 1 0 1 814.4597 1626.9048 2 1626.9053 -0.0006 1 89.72 3.90E-09 R QATKDAGTIAGLNVLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5907.5907.2.dta 1 IPI00797523.1 20 kDa protein 1188 20413 37 37 17 17 6131 5547 1 0 1 543.3094 1626.9065 3 1626.9053 0.0012 1 44.38 0.00035 R QATKDAGTIAGLNVLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6082.6082.3.dta 1 IPI00797523.1 20 kDa protein 1188 20413 37 37 17 17 6153 5913 1 0 1 816.8929 1631.7712 2 1631.7753 -0.0041 0 75.08 9.10E-08 K SFYPEEVSSMVLTK M Oxidation (M) 0.00000000010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6448.6448.2.dta 1 IPI00797523.1 20 kDa protein 1188 20413 37 37 17 17 6320 5113 1 0 1 825.3995 1648.7844 2 1648.7879 -0.0035 0 66.12 8.90E-07 K NQVAMNPTNTVFDAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5643.5643.2.dta 1 IPI00797523.1 20 kDa protein 1188 20413 37 37 17 17 6374 6333 1 0 0 553.9657 1658.8753 3 1658.8879 -0.0126 0 18.76 0.023 R IINEPTAAAIAYGLDK - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6866.6866.3.dta 1 IPI00797523.1 20 kDa protein 1188 20413 37 37 17 17 6379 6341 1 0 0 830.4504 1658.8863 2 1658.8879 -0.0016 0 83.77 5.40E-08 R IINEPTAAAIAYGLDK - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6874.6874.2.dta 1 IPI00797523.1 20 kDa protein 1188 20413 37 37 17 17 6380 6351 1 0 0 553.9708 1658.8906 3 1658.8879 0.0028 0 58.83 1.60E-05 R IINEPTAAAIAYGLDK - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6884.6884.3.dta 1 IPI00797523.1 20 kDa protein 1188 20413 37 37 17 17 6412 4371 1 0 1 833.3973 1664.78 2 1664.7828 -0.0028 0 83.74 3.40E-08 K NQVAMNPTNTVFDAK R Oxidation (M) 0.000010000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4846.4846.2.dta 1 IPI00797523.1 20 kDa protein 1188 20413 37 37 17 17 7103 4556 1 0 1 903.4504 1804.8862 2 1804.889 -0.0028 1 51.12 0.00013 K NQVAMNPTNTVFDAKR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5046.5046.2.dta 1 IPI00797523.1 20 kDa protein 1188 20413 37 37 17 17 7104 4519 1 0 1 602.637 1804.8891 3 1804.889 0.0001 1 18.29 0.019 K NQVAMNPTNTVFDAKR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5006.5006.3.dta 1 IPI00797523.1 20 kDa protein 1188 20413 37 37 17 17 7172 3831 1 0 1 607.9684 1820.8833 3 1820.8839 -0.0006 1 21.91 0.013 K NQVAMNPTNTVFDAKR L Oxidation (M) 0.0000100000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4261.4261.3.dta 1 IPI00797523.1 20 kDa protein 1188 20413 37 37 17 17 7753 6102 1 0 1 991.5013 1980.9881 2 1980.9905 -0.0024 0 42.54 0.0001 K TVTNAVVTVPAYFNDSQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6637.6637.2.dta 1 IPI00797523.1 20 kDa protein 1188 20413 37 37 17 17 7754 5967 1 0 1 991.5023 1980.9901 2 1980.9905 -0.0004 0 53.27 1.20E-05 K TVTNAVVTVPAYFNDSQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6501.6501.2.dta 1 IPI00797523.1 20 kDa protein 1188 20413 37 37 17 17 7755 5969 1 0 1 661.3376 1980.9909 3 1980.9905 0.0004 0 29.86 0.0035 K TVTNAVVTVPAYFNDSQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6503.6503.3.dta 1 IPI00797523.1 20 kDa protein 1188 20413 37 37 17 17 7756 6090 1 0 1 661.338 1980.992 3 1980.9905 0.0015 0 58.48 3.30E-06 K TVTNAVVTVPAYFNDSQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6625.6625.3.dta 1 IPI00797523.1 20 kDa protein 1188 20413 37 37 17 17 8270 5332 1 0 1 773.3984 2317.1733 3 2317.1736 -0.0003 1 77.94 4.90E-08 R LIGDAAKNQVAMNPTNTVFDAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5866.5866.3.dta 1 IPI00797523.1 20 kDa protein 1188 20413 37 37 17 17 8296 4777 1 0 1 778.7302 2333.1687 3 2333.1685 0.0001 1 39.79 0.00051 R LIGDAAKNQVAMNPTNTVFDAK R Oxidation (M) 0.0000000000010000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5286.5286.3.dta 1 IPI00797523.1 20 kDa protein 1188 20413 37 37 17 17 8850 5396 1 0 0 899.7747 2696.3021 3 2696.3042 -0.002 1 40.3 0.0012 K VEIIANDQGNRTTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5930.5930.3.dta 1 IPI00793644.1 17 kDa protein 915 16567 27 27 12 12 56 1917 1 0 0 307.7087 613.4029 2 613.4024 0.0006 1 29.96 0.02 K RLIGR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2149.2149.2.dta 1 IPI00793644.1 17 kDa protein 915 16567 27 27 12 12 562 2573 1 0 1 383.211 764.4074 2 764.4068 0.0006 0 33.56 0.0082 K VQVEYK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2863.2863.2.dta 1 IPI00793644.1 17 kDa protein 915 16567 27 27 12 12 3158 2192 1 0 1 590.8131 1179.6117 2 1179.6135 -0.0019 1 61.23 6.30E-06 K VQVEYKGETK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2450.2450.2.dta 1 IPI00793644.1 17 kDa protein 915 16567 27 27 12 12 3159 2191 1 0 1 394.2116 1179.613 3 1179.6135 -0.0005 1 26.95 0.013 K VQVEYKGETK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2449.2449.3.dta 1 IPI00793644.1 17 kDa protein 915 16567 27 27 12 12 3268 6299 1 0 1 600.34 1198.6655 2 1198.667 -0.0015 0 72.17 9.60E-07 K DAGTIAGLNVLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6833.6833.2.dta 1 IPI00793644.1 17 kDa protein 915 16567 27 27 12 12 3269 6646 1 0 1 600.3403 1198.666 2 1198.667 -0.001 0 63.21 7.00E-06 K DAGTIAGLNVLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7181.7181.2.dta 1 IPI00793644.1 17 kDa protein 915 16567 27 27 12 12 3270 7290 1 0 1 600.3409 1198.6672 2 1198.667 0.0002 0 75.38 5.20E-07 K DAGTIAGLNVLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7852.7852.2.dta 1 IPI00793644.1 17 kDa protein 915 16567 27 27 12 12 3271 6335 1 0 1 400.563 1198.6673 3 1198.667 0.0003 0 65.29 5.30E-06 K DAGTIAGLNVLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6868.6868.3.dta 1 IPI00793644.1 17 kDa protein 915 16567 27 27 12 12 3709 4418 1 0 1 626.8323 1251.6501 2 1251.6533 -0.0031 1 59.59 2.10E-05 K MKEIAEAYLGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4897.4897.2.dta 1 IPI00793644.1 17 kDa protein 915 16567 27 27 12 12 3710 4416 1 0 1 418.2245 1251.6517 3 1251.6533 -0.0015 1 53.19 9.00E-05 K MKEIAEAYLGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4895.4895.3.dta 1 IPI00793644.1 17 kDa protein 915 16567 27 27 12 12 3719 4341 1 0 1 627.7866 1253.5586 2 1253.5598 -0.0012 0 53.75 4.50E-05 R FDDAVVQSDMK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4813.4813.2.dta 1 IPI00793644.1 17 kDa protein 915 16567 27 27 12 12 3858 3902 1 0 1 634.8308 1267.6471 2 1267.6482 -0.0011 1 56.84 3.60E-05 K MKEIAEAYLGK T Oxidation (M) 0.10000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4338.4338.2.dta 1 IPI00793644.1 17 kDa protein 915 16567 27 27 12 12 3859 3894 1 0 1 423.5564 1267.6475 3 1267.6482 -0.0007 1 33.98 0.0024 K MKEIAEAYLGK T Oxidation (M) 0.10000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4329.4329.3.dta 1 IPI00793644.1 17 kDa protein 915 16567 27 27 12 12 4888 3942 1 0 1 470.894 1409.66 3 1409.6609 -0.0009 1 21.03 0.011 R RFDDAVVQSDMK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4381.4381.3.dta 1 IPI00793644.1 17 kDa protein 915 16567 27 27 12 12 6044 6798 1 0 1 808.8985 1615.7824 2 1615.7804 0.0021 0 89.24 5.10E-09 K SFYPEEVSSMVLTK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7333.7333.2.dta 1 IPI00793644.1 17 kDa protein 915 16567 27 27 12 12 6130 5373 1 0 1 814.4597 1626.9048 2 1626.9053 -0.0006 1 89.72 3.90E-09 R QATKDAGTIAGLNVLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5907.5907.2.dta 1 IPI00793644.1 17 kDa protein 915 16567 27 27 12 12 6131 5547 1 0 1 543.3094 1626.9065 3 1626.9053 0.0012 1 44.38 0.00035 R QATKDAGTIAGLNVLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6082.6082.3.dta 1 IPI00793644.1 17 kDa protein 915 16567 27 27 12 12 6153 5913 1 0 1 816.8929 1631.7712 2 1631.7753 -0.0041 0 75.08 9.10E-08 K SFYPEEVSSMVLTK M Oxidation (M) 0.00000000010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6448.6448.2.dta 1 IPI00793644.1 17 kDa protein 915 16567 27 27 12 12 6374 6333 1 0 0 553.9657 1658.8753 3 1658.8879 -0.0126 0 18.76 0.023 R IINEPTAAAIAYGLDK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6866.6866.3.dta 1 IPI00793644.1 17 kDa protein 915 16567 27 27 12 12 6379 6341 1 0 0 830.4504 1658.8863 2 1658.8879 -0.0016 0 83.77 5.40E-08 R IINEPTAAAIAYGLDK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6874.6874.2.dta 1 IPI00793644.1 17 kDa protein 915 16567 27 27 12 12 6380 6351 1 0 0 553.9708 1658.8906 3 1658.8879 0.0028 0 58.83 1.60E-05 R IINEPTAAAIAYGLDK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6884.6884.3.dta 1 IPI00793644.1 17 kDa protein 915 16567 27 27 12 12 7027 5729 1 0 1 894.4971 1786.9797 2 1786.9828 -0.0031 1 81.02 4.70E-08 R IINEPTAAAIAYGLDKK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6264.6264.2.dta 1 IPI00793644.1 17 kDa protein 915 16567 27 27 12 12 7028 5725 1 0 1 596.6681 1786.9824 3 1786.9828 -0.0004 1 22.58 0.0078 R IINEPTAAAIAYGLDKK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6260.6260.3.dta 1 IPI00793644.1 17 kDa protein 915 16567 27 27 12 12 7753 6102 1 0 1 991.5013 1980.9881 2 1980.9905 -0.0024 0 42.54 0.0001 K TVTNAVVTVPAYFNDSQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6637.6637.2.dta 1 IPI00793644.1 17 kDa protein 915 16567 27 27 12 12 7754 5967 1 0 1 991.5023 1980.9901 2 1980.9905 -0.0004 0 53.27 1.20E-05 K TVTNAVVTVPAYFNDSQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6501.6501.2.dta 1 IPI00793644.1 17 kDa protein 915 16567 27 27 12 12 7755 5969 1 0 1 661.3376 1980.9909 3 1980.9905 0.0004 0 29.86 0.0035 K TVTNAVVTVPAYFNDSQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6503.6503.3.dta 1 IPI00793644.1 17 kDa protein 915 16567 27 27 12 12 7756 6090 1 0 1 661.338 1980.992 3 1980.9905 0.0015 0 58.48 3.30E-06 K TVTNAVVTVPAYFNDSQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6625.6625.3.dta 1 IPI00797951.1 16 kDa protein 697 15671 24 24 13 13 56 1917 1 0 0 307.7087 613.4029 2 613.4024 0.0006 1 29.96 0.02 K RLIGR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2149.2149.2.dta 1 IPI00797951.1 16 kDa protein 697 15671 24 24 13 13 269 2335 1 0 0 344.2062 686.3979 2 686.3963 0.0017 0 28.43 0.039 R LIGDAAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2605.2605.2.dta 1 IPI00797951.1 16 kDa protein 697 15671 24 24 13 13 562 2573 1 0 1 383.211 764.4074 2 764.4068 0.0006 0 33.56 0.0082 K VQVEYK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2863.2863.2.dta 1 IPI00797951.1 16 kDa protein 697 15671 24 24 13 13 3158 2192 1 0 1 590.8131 1179.6117 2 1179.6135 -0.0019 1 61.23 6.30E-06 K VQVEYKGETK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2450.2450.2.dta 1 IPI00797951.1 16 kDa protein 697 15671 24 24 13 13 3159 2191 1 0 1 394.2116 1179.613 3 1179.6135 -0.0005 1 26.95 0.013 K VQVEYKGETK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2449.2449.3.dta 1 IPI00797951.1 16 kDa protein 697 15671 24 24 13 13 3709 4418 1 0 1 626.8323 1251.6501 2 1251.6533 -0.0031 1 59.59 2.10E-05 K MKEIAEAYLGK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4897.4897.2.dta 1 IPI00797951.1 16 kDa protein 697 15671 24 24 13 13 3710 4416 1 0 1 418.2245 1251.6517 3 1251.6533 -0.0015 1 53.19 9.00E-05 K MKEIAEAYLGK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4895.4895.3.dta 1 IPI00797951.1 16 kDa protein 697 15671 24 24 13 13 3719 4341 1 0 1 627.7866 1253.5586 2 1253.5598 -0.0012 0 53.75 4.50E-05 R FDDAVVQSDMK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4813.4813.2.dta 1 IPI00797951.1 16 kDa protein 697 15671 24 24 13 13 3858 3902 1 0 1 634.8308 1267.6471 2 1267.6482 -0.0011 1 56.84 3.60E-05 K MKEIAEAYLGK W Oxidation (M) 0.10000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4338.4338.2.dta 1 IPI00797951.1 16 kDa protein 697 15671 24 24 13 13 3859 3894 1 0 1 423.5564 1267.6475 3 1267.6482 -0.0007 1 33.98 0.0024 K MKEIAEAYLGK W Oxidation (M) 0.10000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4329.4329.3.dta 1 IPI00797951.1 16 kDa protein 697 15671 24 24 13 13 4888 3942 1 0 1 470.894 1409.66 3 1409.6609 -0.0009 1 21.03 0.011 R RFDDAVVQSDMK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4381.4381.3.dta 1 IPI00797951.1 16 kDa protein 697 15671 24 24 13 13 5392 4871 1 0 0 744.353 1486.6915 2 1486.694 -0.0025 0 47.3 8.20E-05 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5387.5387.2.dta 1 IPI00797951.1 16 kDa protein 697 15671 24 24 13 13 5393 5073 1 0 0 496.5718 1486.6935 3 1486.694 -0.0005 0 38.4 0.0021 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5603.5603.3.dta 1 IPI00797951.1 16 kDa protein 697 15671 24 24 13 13 5394 5055 1 0 0 744.3543 1486.6941 2 1486.694 0.0001 0 70.5 2.50E-07 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5585.5585.2.dta 1 IPI00797951.1 16 kDa protein 697 15671 24 24 13 13 6044 6798 1 0 1 808.8985 1615.7824 2 1615.7804 0.0021 0 89.24 5.10E-09 K SFYPEEVSSMVLTK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7333.7333.2.dta 1 IPI00797951.1 16 kDa protein 697 15671 24 24 13 13 6153 5913 1 0 1 816.8929 1631.7712 2 1631.7753 -0.0041 0 75.08 9.10E-08 K SFYPEEVSSMVLTK M Oxidation (M) 0.00000000010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6448.6448.2.dta 1 IPI00797951.1 16 kDa protein 697 15671 24 24 13 13 6320 5113 1 0 1 825.3995 1648.7844 2 1648.7879 -0.0035 0 66.12 8.90E-07 K NQVAMNPTNTVFDAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5643.5643.2.dta 1 IPI00797951.1 16 kDa protein 697 15671 24 24 13 13 6412 4371 1 0 1 833.3973 1664.78 2 1664.7828 -0.0028 0 83.74 3.40E-08 K NQVAMNPTNTVFDAK R Oxidation (M) 0.000010000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4846.4846.2.dta 1 IPI00797951.1 16 kDa protein 697 15671 24 24 13 13 7103 4556 1 0 1 903.4504 1804.8862 2 1804.889 -0.0028 1 51.12 0.00013 K NQVAMNPTNTVFDAKR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5046.5046.2.dta 1 IPI00797951.1 16 kDa protein 697 15671 24 24 13 13 7104 4519 1 0 1 602.637 1804.8891 3 1804.889 0.0001 1 18.29 0.019 K NQVAMNPTNTVFDAKR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5006.5006.3.dta 1 IPI00797951.1 16 kDa protein 697 15671 24 24 13 13 7172 3831 1 0 1 607.9684 1820.8833 3 1820.8839 -0.0006 1 21.91 0.013 K NQVAMNPTNTVFDAKR L Oxidation (M) 0.0000100000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4261.4261.3.dta 1 IPI00797951.1 16 kDa protein 697 15671 24 24 13 13 8270 5332 1 0 1 773.3984 2317.1733 3 2317.1736 -0.0003 1 77.94 4.90E-08 R LIGDAAKNQVAMNPTNTVFDAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5866.5866.3.dta 1 IPI00797951.1 16 kDa protein 697 15671 24 24 13 13 8296 4777 1 0 1 778.7302 2333.1687 3 2333.1685 0.0001 1 39.79 0.00051 R LIGDAAKNQVAMNPTNTVFDAK R Oxidation (M) 0.0000000000010000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5286.5286.3.dta 1 IPI00797951.1 16 kDa protein 697 15671 24 24 13 13 8850 5396 1 0 0 899.7747 2696.3021 3 2696.3042 -0.002 1 40.3 0.0012 K VEIIANDQGNRTTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5930.5930.3.dta 1 IPI00007702.1 Heat shock-related 70 kDa protein 2 649 70263 26 26 17 17 56 1917 1 0 0 307.7087 613.4029 2 613.4024 0.0006 1 29.96 0.02 K RLIGR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2149.2149.2.dta 1 IPI00007702.1 Heat shock-related 70 kDa protein 2 649 70263 26 26 17 17 269 2335 1 0 0 344.2062 686.3979 2 686.3963 0.0017 0 28.43 0.039 R LIGDAAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2605.2605.2.dta 1 IPI00007702.1 Heat shock-related 70 kDa protein 2 649 70263 26 26 17 17 562 2573 1 0 1 383.211 764.4074 2 764.4068 0.0006 0 33.56 0.0082 K VQVEYK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2863.2863.2.dta 1 IPI00007702.1 Heat shock-related 70 kDa protein 2 649 70263 26 26 17 17 602 3480 1 0 1 387.2117 772.4089 2 772.4079 0.001 0 37.33 0.0052 K DNNLLGK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3872.3872.2.dta 1 IPI00007702.1 Heat shock-related 70 kDa protein 2 649 70263 26 26 17 17 608 2023 1 0 0 387.722 773.4294 2 773.4283 0.001 0 34.13 0.013 R NTTIPTK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2265.2265.2.dta 1 IPI00007702.1 Heat shock-related 70 kDa protein 2 649 70263 26 26 17 17 1301 1536 1 0 0 453.2346 904.4547 2 904.4549 -0.0002 1 35.8 0.0045 R LRTACER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1736.1736.2.dta 1 IPI00007702.1 Heat shock-related 70 kDa protein 2 649 70263 26 26 17 17 1302 1163 1 0 0 302.4926 904.456 3 904.4549 0.0011 1 32.1 0.0049 R LRTACER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1333.1333.3.dta 1 IPI00007702.1 Heat shock-related 70 kDa protein 2 649 70263 26 26 17 17 2038 2064 1 0 0 509.2874 1016.5602 2 1016.5614 -0.0013 1 57.06 5.60E-05 K ITITNDKGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2309.2309.2.dta 1 IPI00007702.1 Heat shock-related 70 kDa protein 2 649 70263 26 26 17 17 2490 6536 1 0 1 541.2876 1080.5606 2 1080.5604 0.0002 0 56.26 3.90E-05 K LLQDFFNGK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7068.7068.2.dta 1 IPI00007702.1 Heat shock-related 70 kDa protein 2 649 70263 26 26 17 17 3158 2192 1 0 1 590.8131 1179.6117 2 1179.6135 -0.0019 1 61.23 6.30E-06 K VQVEYKGETK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2450.2450.2.dta 1 IPI00007702.1 Heat shock-related 70 kDa protein 2 649 70263 26 26 17 17 3159 2191 1 0 1 394.2116 1179.613 3 1179.6135 -0.0005 1 26.95 0.013 K VQVEYKGETK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2449.2449.3.dta 1 IPI00007702.1 Heat shock-related 70 kDa protein 2 649 70263 26 26 17 17 3712 6711 1 0 1 627.3119 1252.6093 2 1252.6088 0.0006 0 54.3 2.10E-05 R FEELNADLFR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7248.7248.2.dta 1 IPI00007702.1 Heat shock-related 70 kDa protein 2 649 70263 26 26 17 17 5372 6128 1 0 1 494.2568 1479.7486 3 1479.747 0.0016 1 44.21 0.00052 R ARFEELNADLFR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6663.6663.3.dta 1 IPI00007702.1 Heat shock-related 70 kDa protein 2 649 70263 26 26 17 17 5392 4871 1 0 0 744.353 1486.6915 2 1486.694 -0.0025 0 47.3 8.20E-05 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5387.5387.2.dta 1 IPI00007702.1 Heat shock-related 70 kDa protein 2 649 70263 26 26 17 17 5393 5073 1 0 0 496.5718 1486.6935 3 1486.694 -0.0005 0 38.4 0.0021 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5603.5603.3.dta 1 IPI00007702.1 Heat shock-related 70 kDa protein 2 649 70263 26 26 17 17 5394 5055 1 0 0 744.3543 1486.6941 2 1486.694 0.0001 0 70.5 2.50E-07 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5585.5585.2.dta 1 IPI00007702.1 Heat shock-related 70 kDa protein 2 649 70263 26 26 17 17 5791 6185 1 0 1 783.4216 1564.8286 2 1564.8249 0.0037 1 76.98 2.50E-07 K LLQDFFNGKELNK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6720.6720.2.dta 1 IPI00007702.1 Heat shock-related 70 kDa protein 2 649 70263 26 26 17 17 5793 6180 1 0 1 522.6179 1564.8319 3 1564.8249 0.007 1 31.48 0.0059 K LLQDFFNGKELNK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6716.6716.3.dta 1 IPI00007702.1 Heat shock-related 70 kDa protein 2 649 70263 26 26 17 17 6374 6333 1 0 0 553.9657 1658.8753 3 1658.8879 -0.0126 0 18.76 0.023 R IINEPTAAAIAYGLDK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6866.6866.3.dta 1 IPI00007702.1 Heat shock-related 70 kDa protein 2 649 70263 26 26 17 17 6379 6341 1 0 0 830.4504 1658.8863 2 1658.8879 -0.0016 0 83.77 5.40E-08 R IINEPTAAAIAYGLDK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6874.6874.2.dta 1 IPI00007702.1 Heat shock-related 70 kDa protein 2 649 70263 26 26 17 17 6380 6351 1 0 0 553.9708 1658.8906 3 1658.8879 0.0028 0 58.83 1.60E-05 R IINEPTAAAIAYGLDK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6884.6884.3.dta 1 IPI00007702.1 Heat shock-related 70 kDa protein 2 649 70263 26 26 17 17 6567 3415 1 0 1 846.3651 1690.7156 2 1690.7183 -0.0028 0 63.77 1.40E-06 K STAGDTHLGGEDFDNR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3800.3800.2.dta 1 IPI00007702.1 Heat shock-related 70 kDa protein 2 649 70263 26 26 17 17 6568 3402 1 0 1 564.5795 1690.7166 3 1690.7183 -0.0018 0 38.63 0.00052 K STAGDTHLGGEDFDNR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3786.3786.3.dta 1 IPI00007702.1 Heat shock-related 70 kDa protein 2 649 70263 26 26 17 17 7027 5729 1 0 1 894.4971 1786.9797 2 1786.9828 -0.0031 1 81.02 4.70E-08 R IINEPTAAAIAYGLDKK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6264.6264.2.dta 1 IPI00007702.1 Heat shock-related 70 kDa protein 2 649 70263 26 26 17 17 7028 5725 1 0 1 596.6681 1786.9824 3 1786.9828 -0.0004 1 22.58 0.0078 R IINEPTAAAIAYGLDKK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6260.6260.3.dta 1 IPI00007702.1 Heat shock-related 70 kDa protein 2 649 70263 26 26 17 17 8850 5396 1 0 0 899.7747 2696.3021 3 2696.3042 -0.002 1 40.3 0.0012 K VEIIANDQGNRTTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5930.5930.3.dta 1 IPI00301277.1 Heat shock 70 kDa protein 1L 588 70730 22 22 13 13 56 1917 1 0 0 307.7087 613.4029 2 613.4024 0.0006 1 29.96 0.02 K RLIGR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2149.2149.2.dta 1 IPI00301277.1 Heat shock 70 kDa protein 1L 588 70730 22 22 13 13 269 2335 1 0 0 344.2062 686.3979 2 686.3963 0.0017 0 28.43 0.039 R LIGDAAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2605.2605.2.dta 1 IPI00301277.1 Heat shock 70 kDa protein 1L 588 70730 22 22 13 13 707 3722 1 0 0 401.2146 800.4146 2 800.414 0.0006 0 28.12 0.021 K DNNLLGR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4142.4142.2.dta 1 IPI00301277.1 Heat shock 70 kDa protein 1L 588 70730 22 22 13 13 1301 1536 1 0 0 453.2346 904.4547 2 904.4549 -0.0002 1 35.8 0.0045 R LRTACER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1736.1736.2.dta 1 IPI00301277.1 Heat shock 70 kDa protein 1L 588 70730 22 22 13 13 1302 1163 1 0 0 302.4926 904.456 3 904.4549 0.0011 1 32.1 0.0049 R LRTACER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1333.1333.3.dta 1 IPI00301277.1 Heat shock 70 kDa protein 1L 588 70730 22 22 13 13 1947 2154 1 0 0 335.1868 1002.5386 3 1002.5345 0.004 1 28.87 0.031 R LSKEEIER M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2408.2408.3.dta 1 IPI00301277.1 Heat shock 70 kDa protein 1L 588 70730 22 22 13 13 2038 2064 1 0 0 509.2874 1016.5602 2 1016.5614 -0.0013 1 57.06 5.60E-05 K ITITNDKGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2309.2309.2.dta 1 IPI00301277.1 Heat shock 70 kDa protein 1L 588 70730 22 22 13 13 3968 5999 1 0 0 644.3054 1286.5963 2 1286.5965 -0.0002 0 73.72 1.20E-07 K NALESYAFNMK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6534.6534.2.dta 1 IPI00301277.1 Heat shock 70 kDa protein 1L 588 70730 22 22 13 13 5392 4871 1 0 0 744.353 1486.6915 2 1486.694 -0.0025 0 47.3 8.20E-05 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5387.5387.2.dta 1 IPI00301277.1 Heat shock 70 kDa protein 1L 588 70730 22 22 13 13 5393 5073 1 0 0 496.5718 1486.6935 3 1486.694 -0.0005 0 38.4 0.0021 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5603.5603.3.dta 1 IPI00301277.1 Heat shock 70 kDa protein 1L 588 70730 22 22 13 13 5394 5055 1 0 0 744.3543 1486.6941 2 1486.694 0.0001 0 70.5 2.50E-07 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5585.5585.2.dta 1 IPI00301277.1 Heat shock 70 kDa protein 1L 588 70730 22 22 13 13 6037 7338 1 0 0 807.9052 1613.7959 2 1613.8011 -0.0052 0 60.94 1.70E-05 K AFYPEEISSMVLTK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7912.7912.2.dta 1 IPI00301277.1 Heat shock 70 kDa protein 1L 588 70730 22 22 13 13 6038 7350 1 0 0 538.9407 1613.8002 3 1613.8011 -0.0009 0 27.5 0.012 K AFYPEEISSMVLTK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7927.7927.3.dta 1 IPI00301277.1 Heat shock 70 kDa protein 1L 588 70730 22 22 13 13 6121 5900 1 0 0 813.4681 1624.9217 2 1624.926 -0.0043 1 65.55 2.30E-06 R QATKDAGVIAGLNVLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6435.6435.2.dta 1 IPI00301277.1 Heat shock 70 kDa protein 1L 588 70730 22 22 13 13 6122 5883 1 0 0 542.6501 1624.9284 3 1624.926 0.0024 1 73.12 3.70E-07 R QATKDAGVIAGLNVLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6419.6419.3.dta 1 IPI00301277.1 Heat shock 70 kDa protein 1L 588 70730 22 22 13 13 6143 6450 1 0 0 815.9039 1629.7932 2 1629.796 -0.0028 0 46.15 5.10E-05 K AFYPEEISSMVLTK L Oxidation (M) 0.00000000010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6981.6981.2.dta 1 IPI00301277.1 Heat shock 70 kDa protein 1L 588 70730 22 22 13 13 6374 6333 1 0 0 553.9657 1658.8753 3 1658.8879 -0.0126 0 18.76 0.023 R IINEPTAAAIAYGLDK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6866.6866.3.dta 1 IPI00301277.1 Heat shock 70 kDa protein 1L 588 70730 22 22 13 13 6379 6341 1 0 0 830.4504 1658.8863 2 1658.8879 -0.0016 0 83.77 5.40E-08 R IINEPTAAAIAYGLDK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6874.6874.2.dta 1 IPI00301277.1 Heat shock 70 kDa protein 1L 588 70730 22 22 13 13 6380 6351 1 0 0 553.9708 1658.8906 3 1658.8879 0.0028 0 58.83 1.60E-05 R IINEPTAAAIAYGLDK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6884.6884.3.dta 1 IPI00301277.1 Heat shock 70 kDa protein 1L 588 70730 22 22 13 13 6490 3442 1 0 0 838.3682 1674.7219 2 1674.7234 -0.0015 0 64.77 8.40E-07 K ATAGDTHLGGEDFDNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3829.3829.2.dta 1 IPI00301277.1 Heat shock 70 kDa protein 1L 588 70730 22 22 13 13 6491 3427 1 0 0 559.2487 1674.7241 3 1674.7234 0.0007 0 32.78 0.00084 K ATAGDTHLGGEDFDNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3813.3813.3.dta 1 IPI00301277.1 Heat shock 70 kDa protein 1L 588 70730 22 22 13 13 8850 5396 1 0 0 899.7747 2696.3021 3 2696.3042 -0.002 1 40.3 0.0012 K VEIIANDQGNRTTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5930.5930.3.dta 1 IPI00339269.1 Heat shock 70 kDa protein 6 564 71440 21 21 14 14 56 1917 1 0 0 307.7087 613.4029 2 613.4024 0.0006 1 29.96 0.02 K RLIGR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2149.2149.2.dta 1 IPI00339269.1 Heat shock 70 kDa protein 6 564 71440 21 21 14 14 707 3722 1 0 0 401.2146 800.4146 2 800.414 0.0006 0 28.12 0.021 K DNNLLGR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4142.4142.2.dta 1 IPI00339269.1 Heat shock 70 kDa protein 6 564 71440 21 21 14 14 1278 2761 1 0 0 451.7453 901.476 2 901.4756 0.0004 0 34.21 0.0086 R STLEPVEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3067.3067.2.dta 1 IPI00339269.1 Heat shock 70 kDa protein 6 564 71440 21 21 14 14 1301 1536 1 0 0 453.2346 904.4547 2 904.4549 -0.0002 1 35.8 0.0045 R LRTACER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1736.1736.2.dta 1 IPI00339269.1 Heat shock 70 kDa protein 6 564 71440 21 21 14 14 1302 1163 1 0 0 302.4926 904.456 3 904.4549 0.0011 1 32.1 0.0049 R LRTACER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1333.1333.3.dta 1 IPI00339269.1 Heat shock 70 kDa protein 6 564 71440 21 21 14 14 1829 2279 2 0 1 495.2667 988.5189 2 988.5189 0 1 38.17 0.004 R LSKEEVER M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2544.2544.2.dta 1 IPI00339269.1 Heat shock 70 kDa protein 6 564 71440 21 21 14 14 2038 2064 1 0 0 509.2874 1016.5602 2 1016.5614 -0.0013 1 57.06 5.60E-05 K ITITNDKGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2309.2309.2.dta 1 IPI00339269.1 Heat shock 70 kDa protein 6 564 71440 21 21 14 14 2490 6536 1 0 1 541.2876 1080.5606 2 1080.5604 0.0002 0 56.26 3.90E-05 K LLQDFFNGK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7068.7068.2.dta 1 IPI00339269.1 Heat shock 70 kDa protein 6 564 71440 21 21 14 14 4219 6674 1 0 0 658.3031 1314.5916 2 1314.5914 0.0002 0 53.87 1.70E-05 R FEELCSDLFR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7210.7210.2.dta 1 IPI00339269.1 Heat shock 70 kDa protein 6 564 71440 21 21 14 14 5392 4871 1 0 0 744.353 1486.6915 2 1486.694 -0.0025 0 47.3 8.20E-05 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5387.5387.2.dta 1 IPI00339269.1 Heat shock 70 kDa protein 6 564 71440 21 21 14 14 5393 5073 1 0 0 496.5718 1486.6935 3 1486.694 -0.0005 0 38.4 0.0021 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5603.5603.3.dta 1 IPI00339269.1 Heat shock 70 kDa protein 6 564 71440 21 21 14 14 5394 5055 1 0 0 744.3543 1486.6941 2 1486.694 0.0001 0 70.5 2.50E-07 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5585.5585.2.dta 1 IPI00339269.1 Heat shock 70 kDa protein 6 564 71440 21 21 14 14 5685 6273 1 0 0 771.8717 1541.7289 2 1541.7296 -0.0008 1 51.89 1.40E-05 R ARFEELCSDLFR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6808.6808.2.dta 1 IPI00339269.1 Heat shock 70 kDa protein 6 564 71440 21 21 14 14 5686 6272 1 0 0 514.9186 1541.7339 3 1541.7296 0.0043 1 40.25 0.00025 R ARFEELCSDLFR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6807.6807.3.dta 1 IPI00339269.1 Heat shock 70 kDa protein 6 564 71440 21 21 14 14 5791 6185 1 0 1 783.4216 1564.8286 2 1564.8249 0.0037 1 76.98 2.50E-07 K LLQDFFNGKELNK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6720.6720.2.dta 1 IPI00339269.1 Heat shock 70 kDa protein 6 564 71440 21 21 14 14 5793 6180 1 0 1 522.6179 1564.8319 3 1564.8249 0.007 1 31.48 0.0059 K LLQDFFNGKELNK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6716.6716.3.dta 1 IPI00339269.1 Heat shock 70 kDa protein 6 564 71440 21 21 14 14 6490 3442 1 0 0 838.3682 1674.7219 2 1674.7234 -0.0015 0 64.77 8.40E-07 K ATAGDTHLGGEDFDNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3829.3829.2.dta 1 IPI00339269.1 Heat shock 70 kDa protein 6 564 71440 21 21 14 14 6491 3427 1 0 0 559.2487 1674.7241 3 1674.7234 0.0007 0 32.78 0.00084 K ATAGDTHLGGEDFDNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3813.3813.3.dta 1 IPI00339269.1 Heat shock 70 kDa protein 6 564 71440 21 21 14 14 6551 6482 1 0 0 844.4538 1686.893 2 1686.894 -0.001 0 81.11 2.50E-08 R IINEPTAAAIAYGLDR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7014.7014.2.dta 1 IPI00339269.1 Heat shock 70 kDa protein 6 564 71440 21 21 14 14 6552 6483 1 0 0 563.3055 1686.8946 3 1686.894 0.0006 0 51.49 3.40E-05 R IINEPTAAAIAYGLDR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7015.7015.3.dta 1 IPI00339269.1 Heat shock 70 kDa protein 6 564 71440 21 21 14 14 8850 5396 1 0 1 899.7747 2696.3021 3 2696.3042 -0.002 1 40.3 0.0012 R VEILANDQGNRTTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5930.5930.3.dta 1 IPI00647012.1 Heat shock 70kDa protein 1A 426 52200 19 19 16 16 707 3722 1 0 0 401.2146 800.4146 2 800.414 0.0006 0 28.12 0.021 K DNNLLGR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4142.4142.2.dta 1 IPI00647012.1 Heat shock 70kDa protein 1A 426 52200 19 19 16 16 1278 2761 1 0 0 451.7453 901.476 2 901.4756 0.0004 0 34.21 0.0086 R STLEPVEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3067.3067.2.dta 1 IPI00647012.1 Heat shock 70kDa protein 1A 426 52200 19 19 16 16 1301 1536 1 0 0 453.2346 904.4547 2 904.4549 -0.0002 1 35.8 0.0045 R LRTACER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1736.1736.2.dta 1 IPI00647012.1 Heat shock 70kDa protein 1A 426 52200 19 19 16 16 1302 1163 1 0 0 302.4926 904.456 3 904.4549 0.0011 1 32.1 0.0049 R LRTACER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1333.1333.3.dta 1 IPI00647012.1 Heat shock 70kDa protein 1A 426 52200 19 19 16 16 1947 2154 1 0 0 335.1868 1002.5386 3 1002.5345 0.004 1 28.87 0.031 R LSKEEIER M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2408.2408.3.dta 1 IPI00647012.1 Heat shock 70kDa protein 1A 426 52200 19 19 16 16 2038 2064 1 0 0 509.2874 1016.5602 2 1016.5614 -0.0013 1 57.06 5.60E-05 K ITITNDKGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2309.2309.2.dta 1 IPI00647012.1 Heat shock 70kDa protein 1A 426 52200 19 19 16 16 2667 6612 1 0 0 555.2904 1108.5663 2 1108.5665 -0.0003 0 44.75 0.00068 K LLQDFFNGR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7146.7146.2.dta 1 IPI00647012.1 Heat shock 70kDa protein 1A 426 52200 19 19 16 16 3347 4123 1 0 0 602.77 1203.5255 2 1203.5255 -0.0001 0 41.94 0.00012 K GGSGSGPTIEEVD - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4577.4577.2.dta 1 IPI00647012.1 Heat shock 70kDa protein 1A 426 52200 19 19 16 16 3814 5034 1 0 0 421.2238 1260.6496 3 1260.6503 -0.0007 0 18.43 0.019 R LVNHFVEEFK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5563.5563.3.dta 1 IPI00647012.1 Heat shock 70kDa protein 1A 426 52200 19 19 16 16 3968 5999 1 0 0 644.3054 1286.5963 2 1286.5965 -0.0002 0 73.72 1.20E-07 K NALESYAFNMK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6534.6534.2.dta 1 IPI00647012.1 Heat shock 70kDa protein 1A 426 52200 19 19 16 16 4219 6674 1 0 0 658.3031 1314.5916 2 1314.5914 0.0002 0 53.87 1.70E-05 R FEELCSDLFR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7210.7210.2.dta 1 IPI00647012.1 Heat shock 70kDa protein 1A 426 52200 19 19 16 16 5258 4920 1 0 0 489.2742 1464.8008 3 1464.8049 -0.0041 0 14.58 0.043 K AQIHDLVLVGGSTR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5442.5442.3.dta 1 IPI00647012.1 Heat shock 70kDa protein 1A 426 52200 19 19 16 16 5685 6273 1 0 0 771.8717 1541.7289 2 1541.7296 -0.0008 1 51.89 1.40E-05 R ARFEELCSDLFR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6808.6808.2.dta 1 IPI00647012.1 Heat shock 70kDa protein 1A 426 52200 19 19 16 16 5686 6272 1 0 0 514.9186 1541.7339 3 1541.7296 0.0043 1 40.25 0.00025 R ARFEELCSDLFR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6807.6807.3.dta 1 IPI00647012.1 Heat shock 70kDa protein 1A 426 52200 19 19 16 16 5914 6268 1 0 0 790.4129 1578.8113 2 1578.8154 -0.0042 1 67.69 3.60E-06 K LLQDFFNGRDLNK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6802.6802.2.dta 1 IPI00647012.1 Heat shock 70kDa protein 1A 426 52200 19 19 16 16 6490 3442 1 0 0 838.3682 1674.7219 2 1674.7234 -0.0015 0 64.77 8.40E-07 K ATAGDTHLGGEDFDNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3829.3829.2.dta 1 IPI00647012.1 Heat shock 70kDa protein 1A 426 52200 19 19 16 16 6491 3427 1 0 0 559.2487 1674.7241 3 1674.7234 0.0007 0 32.78 0.00084 K ATAGDTHLGGEDFDNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3813.3813.3.dta 1 IPI00647012.1 Heat shock 70kDa protein 1A 426 52200 19 19 16 16 7173 5036 1 0 0 456.26 1821.0107 4 1821.0108 -0.0002 1 31.17 0.0047 K LDKAQIHDLVLVGGSTR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5565.5565.4.dta 1 IPI00647012.1 Heat shock 70kDa protein 1A 426 52200 19 19 16 16 9074 7236 1 0 0 1019.1674 3054.4802 3 3054.4869 -0.0067 0 33.07 0.00079 K ELEQVCNPIISGLYQGAGGPGPGGFGAQGPK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7790.7790.3.dta 1 IPI00791608.1 20 kDa protein 395 19783 14 14 9 9 608 2023 1 0 0 387.722 773.4294 2 773.4283 0.001 0 34.13 0.013 R NTTIPTK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2265.2265.2.dta 1 IPI00791608.1 20 kDa protein 395 19783 14 14 9 9 2490 6536 1 0 1 541.2876 1080.5606 2 1080.5604 0.0002 0 56.26 3.90E-05 K LLQDFFNGK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7068.7068.2.dta 1 IPI00791608.1 20 kDa protein 395 19783 14 14 9 9 3262 4694 1 0 1 400.2318 1197.6734 3 1197.6717 0.0017 1 26.18 0.04 R GTLDPVEKALR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5196.5196.3.dta 1 IPI00791608.1 20 kDa protein 395 19783 14 14 9 9 3712 6711 1 0 1 627.3119 1252.6093 2 1252.6088 0.0006 0 54.3 2.10E-05 R FEELNADLFR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7248.7248.2.dta 1 IPI00791608.1 20 kDa protein 395 19783 14 14 9 9 5372 6128 1 0 1 494.2568 1479.7486 3 1479.747 0.0016 1 44.21 0.00052 R ARFEELNADLFR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6663.6663.3.dta 1 IPI00791608.1 20 kDa protein 395 19783 14 14 9 9 5377 4657 1 0 1 741.4064 1480.7982 2 1480.7998 -0.0016 0 56.53 5.00E-06 K SQIHDIVLVGGSTR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5156.5156.2.dta 1 IPI00791608.1 20 kDa protein 395 19783 14 14 9 9 5791 6185 1 0 1 783.4216 1564.8286 2 1564.8249 0.0037 1 76.98 2.50E-07 K LLQDFFNGKELNK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6720.6720.2.dta 1 IPI00791608.1 20 kDa protein 395 19783 14 14 9 9 5793 6180 1 0 1 522.6179 1564.8319 3 1564.8249 0.007 1 31.48 0.0059 K LLQDFFNGKELNK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6716.6716.3.dta 1 IPI00791608.1 20 kDa protein 395 19783 14 14 9 9 7248 4814 1 0 1 919.5087 1837.0029 2 1837.0058 -0.0029 1 97.37 7.40E-10 K LDKSQIHDIVLVGGSTR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5326.5326.2.dta 1 IPI00791608.1 20 kDa protein 395 19783 14 14 9 9 7249 4800 1 0 1 613.3418 1837.0036 3 1837.0058 -0.0022 1 63.11 3.30E-06 K LDKSQIHDIVLVGGSTR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5311.5311.3.dta 1 IPI00791608.1 20 kDa protein 395 19783 14 14 9 9 7250 4804 1 0 1 460.2589 1837.0065 4 1837.0058 0.0008 1 18.22 0.03 K LDKSQIHDIVLVGGSTR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5315.5315.4.dta 1 IPI00791608.1 20 kDa protein 395 19783 14 14 9 9 7251 4794 1 0 1 613.343 1837.0072 3 1837.0058 0.0015 1 54.34 8.00E-06 K LDKSQIHDIVLVGGSTR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5304.5304.3.dta 1 IPI00791608.1 20 kDa protein 395 19783 14 14 9 9 7924 6912 1 0 1 698.355 2092.0431 3 2092.0477 -0.0046 1 17.57 0.022 R FEELNADLFRGTLDPVEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7447.7447.3.dta 1 IPI00791608.1 20 kDa protein 395 19783 14 14 9 9 7925 6933 1 0 1 698.3566 2092.0479 3 2092.0477 0.0002 1 26.69 0.0031 R FEELNADLFRGTLDPVEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7469.7469.3.dta 1 IPI00011134.1 Heat shock 70 kDa protein 7 (Fragment) 203 27004 7 7 4 4 56 1917 1 0 0 307.7087 613.4029 2 613.4024 0.0006 1 29.96 0.02 K RLIGR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2149.2149.2.dta 1 IPI00011134.1 Heat shock 70 kDa protein 7 (Fragment) 203 27004 7 7 4 4 5392 4871 1 0 0 744.353 1486.6915 2 1486.694 -0.0025 0 47.3 8.20E-05 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5387.5387.2.dta 1 IPI00011134.1 Heat shock 70 kDa protein 7 (Fragment) 203 27004 7 7 4 4 5393 5073 1 0 0 496.5718 1486.6935 3 1486.694 -0.0005 0 38.4 0.0021 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5603.5603.3.dta 1 IPI00011134.1 Heat shock 70 kDa protein 7 (Fragment) 203 27004 7 7 4 4 5394 5055 1 0 0 744.3543 1486.6941 2 1486.694 0.0001 0 70.5 2.50E-07 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5585.5585.2.dta 1 IPI00011134.1 Heat shock 70 kDa protein 7 (Fragment) 203 27004 7 7 4 4 6490 3442 1 0 0 838.3682 1674.7219 2 1674.7234 -0.0015 0 64.77 8.40E-07 K ATAGDTHLGGEDFDNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3829.3829.2.dta 1 IPI00011134.1 Heat shock 70 kDa protein 7 (Fragment) 203 27004 7 7 4 4 6491 3427 1 0 0 559.2487 1674.7241 3 1674.7234 0.0007 0 32.78 0.00084 K ATAGDTHLGGEDFDNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3813.3813.3.dta 1 IPI00011134.1 Heat shock 70 kDa protein 7 (Fragment) 203 27004 7 7 4 4 8850 5396 1 0 1 899.7747 2696.3021 3 2696.3042 -0.002 1 40.3 0.0012 R VEILANDQGNRTTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5930.5930.3.dta 1 IPI00827673.1 15 kDa protein 143 14667 3 3 3 3 56 1917 1 0 0 307.7087 613.4029 2 613.4024 0.0006 1 29.96 0.02 K RLIGR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2149.2149.2.dta 1 IPI00827673.1 15 kDa protein 143 14667 3 3 3 3 5177 5143 1 0 1 725.8611 1449.7077 2 1449.71 -0.0023 0 87.61 6.10E-09 R TTPSVVAFTADGER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5673.5673.2.dta 1 IPI00827673.1 15 kDa protein 143 14667 3 3 3 3 5813 3863 1 0 1 784.8874 1567.7602 2 1567.7631 -0.0028 0 65.45 7.30E-07 R QAVTNPNNTFYATK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4295.4295.2.dta 1 IPI00796149.1 10 kDa protein 136 9794 5 5 3 3 269 2335 1 0 0 344.2062 686.3979 2 686.3963 0.0017 0 28.43 0.039 R LIGDAAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2605.2605.2.dta 1 IPI00796149.1 10 kDa protein 136 9794 5 5 3 3 5392 4871 1 0 0 744.353 1486.6915 2 1486.694 -0.0025 0 47.3 8.20E-05 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5387.5387.2.dta 1 IPI00796149.1 10 kDa protein 136 9794 5 5 3 3 5393 5073 1 0 0 496.5718 1486.6935 3 1486.694 -0.0005 0 38.4 0.0021 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5603.5603.3.dta 1 IPI00796149.1 10 kDa protein 136 9794 5 5 3 3 5394 5055 1 0 0 744.3543 1486.6941 2 1486.694 0.0001 0 70.5 2.50E-07 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5585.5585.2.dta 1 IPI00796149.1 10 kDa protein 136 9794 5 5 3 3 8850 5396 1 0 0 899.7747 2696.3021 3 2696.3042 -0.002 1 40.3 0.0012 K VEIIANDQGNRTTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5930.5930.3.dta 1 IPI00796414.1 18 kDa protein 69 17682 2 2 2 2 608 2023 1 0 0 387.722 773.4294 2 773.4283 0.001 0 34.13 0.013 R NTTIPTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2265.2265.2.dta 1 IPI00796414.1 18 kDa protein 69 17682 2 2 2 2 4524 7464 1 0 1 681.375 1360.7354 2 1360.7351 0.0004 0 60.88 1.10E-05 R AQFEGIVTDLIR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8054.8054.2.dta 1 IPI00795269.1 11 kDa protein 66 10921 1 1 1 1 3514 3238 1 0 1 616.3352 1230.6559 2 1230.6568 -0.0009 0 66.47 9.00E-07 R QAASSLQQASLK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3602.3602.2.dta 1 IPI00796789.1 13 kDa protein 44 13308 2 2 2 2 602 3480 1 0 1 387.2117 772.4089 2 772.4079 0.001 0 37.33 0.0052 K DNNLLGK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3872.3872.2.dta 1 IPI00796789.1 13 kDa protein 44 13308 2 2 2 2 608 2023 1 0 0 387.722 773.4294 2 773.4283 0.001 0 34.13 0.013 R NTTIPTK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2265.2265.2.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 76 1418 1 1 1 312.6584 623.3022 2 623.3027 -0.0006 0 26.23 0.026 R QFSSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1609.1609.2.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 227 2239 1 1 1 337.1982 672.3819 2 672.3806 0.0012 0 35.44 0.006 K VDLQAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2501.2501.2.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 878 4107 1 1 1 416.75 831.4855 2 831.4814 0.0041 0 46.72 0.0001 K SISISVAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4560.4560.2.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 1145 5125 1 1 1 437.7531 873.4917 2 873.492 -0.0003 0 31.07 0.0056 R SLVNLGGSK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5655.5655.2.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 1146 4272 1 1 1 437.7542 873.4939 2 873.492 0.002 0 49.53 0.00029 R SLVNLGGSK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4739.4739.2.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 1483 1724 1 1 1 466.7556 931.4966 2 931.4974 -0.0008 1 31.02 0.01 R SEIDNVKK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1940.1940.2.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 1562 1533 1 1 1 473.2537 944.4928 2 944.4927 0.0001 1 37.76 0.0039 R GENALKDAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1733.1733.2.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 2129 3496 1 1 1 517.262 1032.5094 2 1032.5087 0.0006 0 40.18 0.00052 R TLLEGEESR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3892.3892.2.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 2414 2566 1 1 1 358.5369 1072.5889 3 1072.5876 0.0012 1 29.11 0.0047 R LRSEIDNVK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2855.2855.3.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 2559 1674 1 1 1 546.7546 1091.4947 2 1091.4956 -0.0009 0 61.44 8.80E-06 R GSGGGSSGGSIGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1885.1885.2.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 2560 1814 1 1 1 546.7546 1091.4947 2 1091.4956 -0.0009 0 83.45 5.50E-08 R GSGGGSSGGSIGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2037.2037.2.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 2561 1534 1 1 1 546.7547 1091.4948 2 1091.4956 -0.0007 0 84.49 4.30E-08 R GSGGGSSGGSIGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1734.1734.2.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 2786 3074 1 1 1 563.2725 1124.5305 2 1124.5349 -0.0044 0 19.68 0.046 K AEAESLYQSK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3409.3409.2.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 2891 4491 1 1 1 571.2626 1140.5107 2 1140.5121 -0.0014 0 57.17 1.20E-05 R DYQELMNTK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4976.4976.2.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 2907 1635 1 1 1 572.2707 1142.5268 2 1142.5278 -0.0009 1 50.39 0.0001 K KDVDGAYMTK V Oxidation (M) 0.0000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1843.1843.2.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 3118 1425 1 1 1 588.3029 1174.5913 2 1174.5942 -0.0029 1 51.31 7.20E-05 R VDQLKSDQSR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1617.1617.2.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 3119 1423 1 1 1 392.5387 1174.5943 3 1174.5942 0.0001 1 24.34 0.013 R VDQLKSDQSR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1615.1615.3.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 3840 4849 1 1 1 633.3212 1264.6279 2 1264.6299 -0.002 0 53.89 2.80E-05 R TNAENEFVTIK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5364.5364.2.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 3920 3113 1 1 1 426.5496 1276.6269 3 1276.6259 0.0011 1 37.68 0.0045 K SDQSRLDSELK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3451.3451.3.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 4067 5068 1 1 1 650.7672 1299.5199 2 1299.5224 -0.0025 0 66.78 4.70E-07 K NMQDMVEDYR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5599.5599.2.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 4090 3889 1 1 1 651.8523 1301.69 2 1301.6939 -0.0038 1 49.95 0.00023 R NSKIEISELNR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4324.4324.2.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 4091 3888 1 1 1 434.9049 1301.6928 3 1301.6939 -0.0011 1 46.15 0.00058 R NSKIEISELNR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4323.4323.3.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 4093 8866 1 1 1 651.8601 1301.7057 2 1301.7078 -0.0022 0 19.07 0.022 R SLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.9502.9502.2.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 4096 8173 1 1 1 651.8607 1301.7068 2 1301.7078 -0.0011 0 40.84 0.0015 R SLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8801.8801.2.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 4097 8431 1 1 1 651.8607 1301.7068 2 1301.7078 -0.0011 0 26.18 0.0041 R SLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.9056.9056.2.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 4098 9085 1 1 1 651.8609 1301.7073 2 1301.7078 -0.0006 0 27.85 0.015 R SLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.9753.9753.2.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 4099 8297 1 1 1 651.861 1301.7074 2 1301.7078 -0.0005 0 81.11 1.30E-07 R SLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8924.8924.2.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 4100 7786 1 1 1 434.9098 1301.7075 3 1301.7078 -0.0004 0 33.06 0.0087 R SLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8410.8410.3.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 4102 8035 1 1 1 651.861 1301.7075 2 1301.7078 -0.0003 0 73.37 8.10E-07 R SLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8665.8665.2.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 4104 7905 1 1 1 651.8611 1301.7076 2 1301.7078 -0.0002 0 100.3 1.60E-09 R SLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8536.8536.2.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 4109 441 1 1 1 651.8622 1301.7099 2 1301.7078 0.0021 0 21.8 0.018 R SLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.10567.10567.2.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 4370 2622 1 1 1 670.8371 1339.6596 2 1339.6619 -0.0023 1 61.45 1.00E-05 K SKAEAESLYQSK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2916.2916.2.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 4371 2633 1 1 1 447.561 1339.6611 3 1339.6619 -0.0008 1 46.38 0.00014 K SKAEAESLYQSK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2928.2928.3.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 4490 5650 1 1 1 679.3506 1356.6866 2 1356.6885 -0.0019 0 64.7 4.10E-06 K LNDLEDALQQAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6185.6185.2.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 4686 6497 1 1 1 692.3485 1382.6825 2 1382.683 -0.0006 0 72.8 1.10E-06 K SLNNQFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7029.7029.2.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 4779 3854 1 1 1 465.2481 1392.7226 3 1392.7249 -0.0023 1 28.48 0.0053 R TNAENEFVTIKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4286.4286.3.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 4780 3862 1 1 1 697.3687 1392.7229 2 1392.7249 -0.002 1 73.51 1.30E-07 R TNAENEFVTIKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4294.4294.2.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 5283 5583 1 1 0 735.4233 1468.8321 2 1468.8361 -0.004 1 22.78 0.041 K IEISELNRVIQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6119.6119.2.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 5341 6303 1 1 1 738.3773 1474.7401 2 1474.7416 -0.0015 0 51.78 1.40E-05 K WELLQQVDTSTR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6837.6837.2.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 5343 4328 1 1 0 492.6004 1474.7795 3 1474.778 0.0015 0 37.36 0.003 R FLEQQNQVLQTK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4799.4799.3.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 5344 4308 1 1 0 738.3978 1474.781 2 1474.778 0.003 0 76.09 4.70E-07 R FLEQQNQVLQTK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4778.4778.2.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 5564 5061 1 1 1 762.3976 1522.7806 2 1522.7813 -0.0007 1 51.07 8.90E-05 R LLRDYQELMNTK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5591.5591.2.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 5565 5057 1 1 1 508.601 1522.7813 3 1522.7813 0 1 31.69 0.0011 R LLRDYQELMNTK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5587.5587.3.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 5661 3928 1 1 1 770.3943 1538.7741 2 1538.7762 -0.0021 1 58.1 3.60E-06 R LLRDYQELMNTK L Oxidation (M) 0.000000001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4366.4366.2.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 5663 3916 1 1 1 513.9325 1538.7757 3 1538.7762 -0.0006 1 36.36 0.00084 R LLRDYQELMNTK L Oxidation (M) 0.000000001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4353.4353.3.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 5964 5813 1 1 1 800.4189 1598.8232 2 1598.8264 -0.0031 1 84.53 6.70E-08 K NKLNDLEDALQQAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6347.6347.2.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 5965 5808 1 1 1 533.949 1598.8251 3 1598.8264 -0.0013 1 47.03 0.00012 K NKLNDLEDALQQAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6342.6342.3.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 6354 4741 1 1 1 551.943 1652.8072 3 1652.808 -0.0008 1 20.11 0.014 K DVDGAYMTKVDLQAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5247.5247.3.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 6355 4732 1 1 1 827.411 1652.8075 2 1652.808 -0.0005 1 60.22 2.30E-06 K DVDGAYMTKVDLQAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5237.5237.2.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 6366 4872 1 1 1 829.3984 1656.7822 2 1656.7856 -0.0034 0 78.54 4.30E-08 R SGGGFSSGSAGIINYQR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5389.5389.2.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 6465 3893 1 1 1 557.273 1668.7972 3 1668.8029 -0.0057 1 27.58 0.0038 K DVDGAYMTKVDLQAK L Oxidation (M) 0.000000100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4328.4328.3.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 6749 4991 1 1 1 858.928 1715.8415 2 1715.8438 -0.0023 0 90.98 6.60E-09 K QISNLQQSISDAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5519.5519.2.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 6750 4996 1 1 1 572.9555 1715.8447 3 1715.8438 0.0009 0 81.16 1.40E-07 K QISNLQQSISDAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5523.5523.3.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 6796 4508 1 1 0 577.6563 1729.9469 3 1729.9475 -0.0006 1 18.76 0.045 K VRFLEQQNQVLQTK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4994.4994.3.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 6964 4548 1 1 1 589.2502 1764.7287 3 1764.7275 0.0012 0 73.42 1.10E-07 R FSSCGGGGGSFGAGGGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5038.5038.3.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 7447 6223 1 1 1 627.9942 1880.9608 3 1880.9632 -0.0024 1 23.25 0.0097 R EQIKSLNNQFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6758.6758.3.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 7665 7330 1 1 1 648.0009 1940.9807 3 1940.9803 0.0004 1 48.22 9.20E-05 K LNDLEDALQQAKEDLAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7902.7902.3.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 7765 6446 1 1 1 662.6359 1984.8858 3 1984.887 -0.0012 1 22.66 0.0075 R LDSELKNMQDMVEDYR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6978.6978.3.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 7826 3794 1 1 1 673.298 2016.8721 3 2016.8768 -0.0047 1 33.95 0.0017 R LDSELKNMQDMVEDYR N 2 Oxidation (M) 0.0000000100100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4221.4221.3.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 7910 1546 1 1 1 693.9762 2078.9068 3 2078.9075 -0.0007 1 43.79 0.00018 R GGSGGGGGGSSGGRGSGGGSSGGSIGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1747.1747.3.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 7911 1261 1 1 1 693.9767 2078.9084 3 2078.9075 0.0009 1 66.76 9.70E-07 R GGSGGGGGGSSGGRGSGGGSSGGSIGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1439.1439.3.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 8223 5349 1 1 1 762.7131 2285.1176 3 2285.1175 0.0001 1 60.03 2.90E-06 K AEAESLYQSKYEELQITAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5883.5883.3.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 8458 8340 1 1 1 795.3205 2382.9397 3 2382.9447 -0.005 0 17.59 0.017 R GGGGGGYGSGGSSYGSGGGSYGSGGGGGGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8966.8966.3.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 8464 2594 1 1 1 795.3216 2382.943 3 2382.9447 -0.0017 0 100.38 9.20E-11 R GGGGGGYGSGGSSYGSGGGSYGSGGGGGGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2885.2885.3.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 8703 4007 1 1 1 855.7264 2564.1573 3 2564.1595 -0.0022 0 38.74 0.00023 R MSGECAPNVSVSVSTSHTTISGGGSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4451.4451.3.dta 2 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1928 66149 66 66 39 39 8713 3824 1 1 1 861.058 2580.1521 3 2580.1545 -0.0023 0 65.32 1.20E-06 R MSGECAPNVSVSVSTSHTTISGGGSR G Oxidation (M) 0.10000000000000000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4253.4253.3.dta 2 2 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1273 66110 34 34 28 28 623 2036 1 0 1 390.1935 778.3724 2 778.3722 0.0002 0 50.49 2.10E-05 K AAFGGSGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2279.2279.2.dta 2 2 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1273 66110 34 34 28 28 852 5033 1 0 0 414.2184 826.4222 2 826.4225 -0.0003 0 43.07 0.00095 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5562.5562.2.dta 2 2 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1273 66110 34 34 28 28 1869 2502 1 0 1 497.7875 993.5604 2 993.5607 -0.0003 0 67.06 1.90E-06 R LQGEIAHVK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2786.2786.2.dta 2 2 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1273 66110 34 34 28 28 1929 1211 1 0 0 501.2715 1000.5285 2 1000.5301 -0.0016 1 31.32 0.024 K AQEREQIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1385.1385.2.dta 2 2 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1273 66110 34 34 28 28 1957 2780 1 0 0 503.2367 1004.4588 2 1004.4597 -0.0009 0 47.92 6.00E-05 K LLEGEECR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3088.3088.2.dta 2 2 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1273 66110 34 34 28 28 2084 1893 1 0 1 342.858 1025.5522 3 1025.5505 0.0016 1 33.25 0.0053 R HGDSLKEIK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2123.2123.3.dta 2 2 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1273 66110 34 34 28 28 2176 3227 1 0 1 521.2827 1040.5509 2 1040.5502 0.0007 0 44.13 0.00041 K VDPEIQNVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3591.3591.2.dta 2 2 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1273 66110 34 34 28 28 2497 4962 1 0 0 541.8034 1081.5923 2 1081.592 0.0002 1 43.79 0.00057 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5487.5487.2.dta 2 2 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1273 66110 34 34 28 28 2498 4957 1 0 0 361.5381 1081.5923 3 1081.592 0.0003 1 26.79 0.0059 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5482.5482.3.dta 2 2 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1273 66110 34 34 28 28 2644 3086 1 0 0 554.2732 1106.5318 2 1106.5356 -0.0038 0 62.92 1.10E-05 K AQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3422.3422.2.dta 2 2 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1273 66110 34 34 28 28 2764 1885 1 0 1 561.8347 1121.6548 2 1121.6557 -0.0009 1 52.12 3.00E-05 R LQGEIAHVKK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2114.2114.2.dta 2 2 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1273 66110 34 34 28 28 2820 3880 1 0 1 566.2569 1130.4992 2 1130.5026 -0.0034 0 51.36 1.50E-05 R STSSFSCLSR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4314.4314.2.dta 2 2 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1273 66110 34 34 28 28 2829 2446 1 0 0 567.2835 1132.5525 2 1132.5546 -0.0022 1 43.44 0.00048 R KLLEGEECR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2725.2725.2.dta 2 2 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1273 66110 34 34 28 28 2830 2447 1 0 0 378.5255 1132.5546 3 1132.5546 0 1 44.5 0.00029 R KLLEGEECR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2726.2726.3.dta 2 2 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1273 66110 34 34 28 28 3250 2093 1 0 1 599.2778 1196.5411 2 1196.5422 -0.0011 0 68 4.20E-07 K GGSISGGGYGSGGGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2340.2340.2.dta 2 2 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1273 66110 34 34 28 28 3378 4974 1 0 1 604.811 1207.6075 2 1207.6085 -0.0009 0 50.12 6.70E-05 R TAAENDFVTLK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5500.5500.2.dta 2 2 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1273 66110 34 34 28 28 3724 3229 1 0 1 627.8073 1253.6001 2 1253.6001 0 0 87.53 3.20E-08 R GFSSGSAVVSGGSR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3593.3593.2.dta 2 2 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1273 66110 34 34 28 28 3969 3208 1 0 1 644.3075 1286.6004 2 1286.6037 -0.0033 1 43.38 0.00046 R RSTSSFSCLSR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3566.3566.2.dta 2 2 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1273 66110 34 34 28 28 3970 3211 1 0 1 429.8749 1286.6028 3 1286.6037 -0.0009 1 35.85 0.00092 R RSTSSFSCLSR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3569.3569.3.dta 2 2 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1273 66110 34 34 28 28 4260 3349 1 0 1 660.7937 1319.5729 2 1319.5756 -0.0028 0 88.28 5.30E-09 R HGGGGGGFGGGGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3728.3728.2.dta 2 2 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1273 66110 34 34 28 28 4261 3345 1 0 1 440.8661 1319.5765 3 1319.5756 0.0009 0 41.69 0.00031 R HGGGGGGFGGGGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3724.3724.3.dta 2 2 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1273 66110 34 34 28 28 4312 4465 1 0 1 665.3217 1328.6288 2 1328.632 -0.0033 0 79.85 1.30E-07 K NVQDAIADAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4948.4948.2.dta 2 2 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1273 66110 34 34 28 28 4318 7767 1 0 0 665.3672 1328.7198 2 1328.7187 0.0011 0 72.49 8.10E-07 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8392.8392.2.dta 2 2 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1273 66110 34 34 28 28 4354 3969 1 0 1 668.8568 1335.6991 2 1335.7034 -0.0043 1 62.16 8.80E-06 R TAAENDFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4410.4410.2.dta 2 2 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1273 66110 34 34 28 28 4355 3964 1 0 1 446.2418 1335.7035 3 1335.7034 0 1 41.34 0.00027 R TAAENDFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4405.4405.3.dta 2 2 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1273 66110 34 34 28 28 4812 5428 1 0 0 699.373 1396.7315 2 1396.735 -0.0035 1 79.35 2.00E-07 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5963.5963.2.dta 2 2 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1273 66110 34 34 28 28 5283 5583 1 0 0 735.4233 1468.8321 2 1468.8361 -0.004 1 22.78 0.041 K IEISELNRVIQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6119.6119.2.dta 2 2 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1273 66110 34 34 28 28 5343 4328 1 0 0 492.6004 1474.7795 3 1474.778 0.0015 0 37.36 0.003 R FLEQQNQVLQTK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4799.4799.3.dta 2 2 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1273 66110 34 34 28 28 5344 4308 1 0 0 738.3978 1474.781 2 1474.778 0.003 0 76.09 4.70E-07 R FLEQQNQVLQTK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4778.4778.2.dta 2 2 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1273 66110 34 34 28 28 5540 5562 1 0 1 507.9409 1520.8007 3 1520.8021 -0.0013 1 41.28 0.00023 R LLRDYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6097.6097.3.dta 2 2 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1273 66110 34 34 28 28 5936 1628 1 0 1 794.8453 1587.676 2 1587.6761 -0.0001 0 128.42 6.50E-13 R GGSSSGGGYGSGGGGSSSVK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1836.1836.2.dta 2 2 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1273 66110 34 34 28 28 6796 4508 1 0 0 577.6563 1729.9469 3 1729.9475 -0.0006 1 18.76 0.045 K VRFLEQQNQVLQTK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4994.4994.3.dta 2 2 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1273 66110 34 34 28 28 6834 2039 1 0 1 870.8564 1739.6983 2 1739.6983 0 0 134.75 3.30E-14 R GSSSGGGYSSGSSSYGSGGR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2282.2282.2.dta 2 2 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 1273 66110 34 34 28 28 6839 2234 1 0 1 871.3784 1740.7423 2 1740.7412 0.0011 0 113.84 1.40E-11 R GGSGGGGSISGGGYGSGGGSGGR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2495.2495.2.dta 2 3 IPI00418471.6 Vimentin 897 53676 33 33 28 28 313 2405 1 0 1 351.2006 700.3867 2 700.3868 -0.0001 0 55.92 6.50E-05 R SSVPGVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2681.2681.2.dta 2 3 IPI00418471.6 Vimentin 897 53676 33 33 28 28 1125 1712 1 0 1 436.7107 871.4068 2 871.4035 0.0033 0 19.35 0.019 R SVSSSSYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1927.1927.2.dta 2 3 IPI00418471.6 Vimentin 897 53676 33 33 28 28 1362 2228 1 0 1 457.7328 913.4511 2 913.4505 0.0006 0 29.98 0.0015 R SYVTTSTR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2489.2489.2.dta 2 3 IPI00418471.6 Vimentin 897 53676 33 33 28 28 1481 2599 1 0 0 466.7373 931.4601 2 931.461 -0.0009 0 46.71 9.60E-05 K LLEGEESR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2891.2891.2.dta 2 3 IPI00418471.6 Vimentin 897 53676 33 33 28 28 1724 2585 1 0 1 485.7926 969.5707 2 969.572 -0.0013 1 24.31 0.034 R LRSSVPGVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2876.2876.2.dta 2 3 IPI00418471.6 Vimentin 897 53676 33 33 28 28 2076 2142 1 0 1 512.2591 1022.5036 2 1022.5032 0.0004 0 41.52 0.00029 R QQYESVAAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2395.2395.2.dta 2 3 IPI00418471.6 Vimentin 897 53676 33 33 28 28 2092 1355 1 0 1 514.7587 1027.5029 2 1027.5047 -0.0018 1 33.78 0.0032 R SVSSSSYRR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1541.1541.2.dta 2 3 IPI00418471.6 Vimentin 897 53676 33 33 28 28 2325 2424 1 0 1 530.7656 1059.5167 2 1059.5197 -0.003 0 38.98 0.00065 R QVDQLTNDK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2701.2701.2.dta 2 3 IPI00418471.6 Vimentin 897 53676 33 33 28 28 2331 2297 1 0 0 530.7852 1059.5559 2 1059.556 -0.0001 1 59.23 3.30E-05 R KLLEGEESR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2564.2564.2.dta 2 3 IPI00418471.6 Vimentin 897 53676 33 33 28 28 2530 2623 1 0 1 544.77 1087.5254 2 1087.5258 -0.0004 0 78.05 2.40E-07 R QDVDNASLAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2917.2917.2.dta 2 3 IPI00418471.6 Vimentin 897 53676 33 33 28 28 2789 4101 1 0 1 563.3062 1124.5979 2 1124.5978 0 1 30.99 0.005 R FANYIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4553.4553.2.dta 2 3 IPI00418471.6 Vimentin 897 53676 33 33 28 28 2790 4081 1 0 1 375.8748 1124.6025 3 1124.5978 0.0047 1 26.69 0.014 R FANYIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4532.4532.3.dta 2 3 IPI00418471.6 Vimentin 897 53676 33 33 28 28 3075 7169 1 0 1 585.3606 1168.7066 2 1168.7067 0 0 53.77 1.90E-05 K ILLAELEQLK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7718.7718.2.dta 2 3 IPI00418471.6 Vimentin 897 53676 33 33 28 28 3421 2125 1 0 1 608.8172 1215.6198 2 1215.6208 -0.0009 1 42 0.00043 R RQVDQLTNDK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2376.2376.2.dta 2 3 IPI00418471.6 Vimentin 897 53676 33 33 28 28 3972 2088 1 0 1 644.3361 1286.6576 2 1286.6579 -0.0003 1 57.23 3.50E-05 R QVDQLTNDKAR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2335.2335.2.dta 2 3 IPI00418471.6 Vimentin 897 53676 33 33 28 28 4172 5304 1 0 1 655.306 1308.5974 2 1308.5986 -0.0012 0 55.42 6.40E-06 K NLQEAEEWYK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5837.5837.2.dta 2 3 IPI00418471.6 Vimentin 897 53676 33 33 28 28 4774 3245 1 0 1 697.3567 1392.6989 2 1392.6997 -0.0008 1 59.01 5.20E-06 R DVRQQYESVAAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3610.3610.2.dta 2 3 IPI00418471.6 Vimentin 897 53676 33 33 28 28 4775 3242 1 0 1 465.2404 1392.6992 3 1392.6997 -0.0005 1 28.52 0.0023 R DVRQQYESVAAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3607.3607.3.dta 2 3 IPI00418471.6 Vimentin 897 53676 33 33 28 28 5002 4238 1 0 1 714.8599 1427.7053 2 1427.7045 0.0008 0 73.61 1.30E-07 R SLYASSPGGVYATR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4702.4702.2.dta 2 3 IPI00418471.6 Vimentin 897 53676 33 33 28 28 5485 2211 1 0 1 504.2401 1509.6984 3 1509.6994 -0.001 0 27.75 0.0042 R MFGGPGTASRPSSSR S Oxidation (M) 0.100000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2470.2470.3.dta 2 3 IPI00418471.6 Vimentin 897 53676 33 33 28 28 5570 4764 1 0 1 508.916 1523.7262 3 1523.7256 0.0006 1 27.97 0.014 K NLQEAEEWYKSK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5272.5272.3.dta 2 3 IPI00418471.6 Vimentin 897 53676 33 33 28 28 5588 4735 1 0 0 764.4166 1526.8186 2 1526.8205 -0.0019 1 64.26 5.80E-06 R HLREYQDLLNVK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5240.5240.2.dta 2 3 IPI00418471.6 Vimentin 897 53676 33 33 28 28 5618 6496 1 0 1 767.4293 1532.844 2 1532.845 -0.001 1 101.72 4.10E-10 R KVESLQEEIAFLK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7028.7028.2.dta 2 3 IPI00418471.6 Vimentin 897 53676 33 33 28 28 5670 6062 1 0 1 770.4573 1538.9001 2 1538.9032 -0.003 1 78.8 4.50E-08 K ILLAELEQLKGQGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6598.6598.2.dta 2 3 IPI00418471.6 Vimentin 897 53676 33 33 28 28 5935 3896 1 0 1 794.3985 1586.7824 2 1586.79 -0.0075 1 55.14 1.70E-05 R TNEKVELQELNDR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4331.4331.2.dta 2 3 IPI00418471.6 Vimentin 897 53676 33 33 28 28 6344 5867 1 0 1 551.6041 1651.7904 3 1651.7875 0.0028 1 17.75 0.029 R LGDLYEEEMRELR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6403.6403.3.dta 2 3 IPI00418471.6 Vimentin 897 53676 33 33 28 28 6555 5491 1 0 1 844.9149 1687.8153 2 1687.8199 -0.0046 1 36.12 0.00041 R VEVERDNLAEDIMR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6027.6027.2.dta 2 3 IPI00418471.6 Vimentin 897 53676 33 33 28 28 6683 4264 1 0 1 568.946 1703.8163 3 1703.8148 0.0015 1 23.91 0.0069 R VEVERDNLAEDIMR L Oxidation (M) 0.00000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4730.4730.3.dta 2 3 IPI00418471.6 Vimentin 897 53676 33 33 28 28 6999 4232 1 0 1 888.9341 1775.8537 2 1775.855 -0.0013 1 25.34 0.0085 K FADLSEAANRNNDALR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4695.4695.2.dta 2 3 IPI00418471.6 Vimentin 897 53676 33 33 28 28 7000 4214 1 0 1 592.9588 1775.8546 3 1775.855 -0.0005 1 40.19 0.00029 K FADLSEAANRNNDALR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4676.4676.3.dta 2 3 IPI00418471.6 Vimentin 897 53676 33 33 28 28 7240 3241 1 0 1 918.9022 1835.7899 2 1835.7922 -0.0023 0 55.78 5.90E-06 R DGQVINETSQHHDDLE - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3606.3606.2.dta 2 3 IPI00418471.6 Vimentin 897 53676 33 33 28 28 7241 3234 1 0 1 612.9377 1835.7914 3 1835.7922 -0.0008 0 37.74 0.00034 R DGQVINETSQHHDDLE - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3598.3598.3.dta 2 3 IPI00418471.6 Vimentin 897 53676 33 33 28 28 8445 5635 1 0 1 793.0592 2376.1558 3 2376.1591 -0.0033 1 59.49 2.60E-06 R QVQSLTCEVDALKGTNESLER Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6170.6170.3.dta 2 4 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 724 60448 20 20 18 18 852 5033 1 0 0 414.2184 826.4222 2 826.4225 -0.0003 0 43.07 0.00095 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5562.5562.2.dta 2 4 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 724 60448 20 20 18 18 1826 1107 1 0 0 495.2303 988.446 2 988.4462 -0.0002 0 41.83 0.00012 K YTTTSSSSR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1272.1272.2.dta 2 4 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 724 60448 20 20 18 18 1957 2780 1 0 0 503.2367 1004.4588 2 1004.4597 -0.0009 0 47.92 6.00E-05 K LLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3088.3088.2.dta 2 4 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 724 60448 20 20 18 18 2030 4202 1 0 0 508.7719 1015.5292 2 1015.5298 -0.0006 0 45.63 0.00066 R QLDSIVGER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4663.4663.2.dta 2 4 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 724 60448 20 20 18 18 2083 4332 1 0 0 513.7647 1025.5149 2 1025.5142 0.0007 0 61.49 1.70E-06 R SGFSSISVSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4804.4804.2.dta 2 4 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 724 60448 20 20 18 18 2153 3533 1 0 0 346.5296 1036.5671 3 1036.5665 0.0005 1 26.4 0.0067 R SLYGLGGSKR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3932.3932.3.dta 2 4 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 724 60448 20 20 18 18 2497 4962 1 0 0 541.8034 1081.5923 2 1081.592 0.0002 1 43.79 0.00057 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5487.5487.2.dta 2 4 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 724 60448 20 20 18 18 2498 4957 1 0 0 361.5381 1081.5923 3 1081.592 0.0003 1 26.79 0.0059 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5482.5482.3.dta 2 4 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 724 60448 20 20 18 18 2644 3086 1 0 0 554.2732 1106.5318 2 1106.5356 -0.0038 0 62.92 1.10E-05 K AQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3422.3422.2.dta 2 4 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 724 60448 20 20 18 18 2829 2446 1 0 0 567.2835 1132.5525 2 1132.5546 -0.0022 1 43.44 0.00048 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2725.2725.2.dta 2 4 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 724 60448 20 20 18 18 2830 2447 1 0 0 378.5255 1132.5546 3 1132.5546 0 1 44.5 0.00029 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2726.2726.3.dta 2 4 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 724 60448 20 20 18 18 3041 3993 1 0 0 583.2954 1164.5763 2 1164.5775 -0.0012 0 79.04 1.40E-07 K YEELQVTAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4436.4436.2.dta 2 4 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 724 60448 20 20 18 18 4318 7767 1 0 0 665.3672 1328.7198 2 1328.7187 0.0011 0 72.49 8.10E-07 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8392.8392.2.dta 2 4 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 724 60448 20 20 18 18 4456 4049 1 0 0 675.8659 1349.7173 2 1349.7191 -0.0018 1 29.25 0.0032 R TAAENEFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4497.4497.2.dta 2 4 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 724 60448 20 20 18 18 4812 5428 1 0 0 699.373 1396.7315 2 1396.735 -0.0035 1 79.35 2.00E-07 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5963.5963.2.dta 2 4 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 724 60448 20 20 18 18 4872 7190 1 0 0 704.3596 1406.7046 2 1406.7041 0.0004 0 78.42 2.30E-07 K ADTLTDEINFLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7743.7743.2.dta 2 4 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 724 60448 20 20 18 18 4978 3759 1 0 0 712.8179 1423.6212 2 1423.6263 -0.0051 0 94.5 2.20E-09 R GSGGLGGACGGAGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4183.4183.2.dta 2 4 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 724 60448 20 20 18 18 5155 4316 1 0 1 724.3919 1446.7693 2 1446.7678 0.0014 0 82.95 5.10E-08 R AIGGGLSSVGGGSSTIK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4786.4786.2.dta 2 4 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 724 60448 20 20 18 18 5348 3807 1 0 0 492.9392 1475.7958 3 1475.7984 -0.0026 1 18.54 0.018 R FLEQQNKVLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4235.4235.3.dta 2 4 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 724 60448 20 20 18 18 5959 4549 1 0 0 799.8824 1597.7503 2 1597.7519 -0.0015 0 104.53 5.40E-10 R ISIGGGSCAISGGYGSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5039.5039.2.dta 2 5 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 720 60247 20 20 18 18 852 5033 1 0 0 414.2184 826.4222 2 826.4225 -0.0003 0 43.07 0.00095 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5562.5562.2.dta 2 5 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 720 60247 20 20 18 18 1826 1107 1 0 0 495.2303 988.446 2 988.4462 -0.0002 0 41.83 0.00012 K YTTTSSSSR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1272.1272.2.dta 2 5 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 720 60247 20 20 18 18 1957 2780 1 0 0 503.2367 1004.4588 2 1004.4597 -0.0009 0 47.92 6.00E-05 K LLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3088.3088.2.dta 2 5 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 720 60247 20 20 18 18 2030 4202 1 0 0 508.7719 1015.5292 2 1015.5298 -0.0006 0 45.63 0.00066 R QLDSIVGER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4663.4663.2.dta 2 5 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 720 60247 20 20 18 18 2083 4332 1 0 0 513.7647 1025.5149 2 1025.5142 0.0007 0 61.49 1.70E-06 R SGFSSISVSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4804.4804.2.dta 2 5 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 720 60247 20 20 18 18 2153 3533 1 0 0 346.5296 1036.5671 3 1036.5665 0.0005 1 26.4 0.0067 R SLYGLGGSKR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3932.3932.3.dta 2 5 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 720 60247 20 20 18 18 2497 4962 1 0 0 541.8034 1081.5923 2 1081.592 0.0002 1 43.79 0.00057 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5487.5487.2.dta 2 5 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 720 60247 20 20 18 18 2498 4957 1 0 0 361.5381 1081.5923 3 1081.592 0.0003 1 26.79 0.0059 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5482.5482.3.dta 2 5 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 720 60247 20 20 18 18 2644 3086 1 0 0 554.2732 1106.5318 2 1106.5356 -0.0038 0 62.92 1.10E-05 K AQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3422.3422.2.dta 2 5 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 720 60247 20 20 18 18 2829 2446 1 0 0 567.2835 1132.5525 2 1132.5546 -0.0022 1 43.44 0.00048 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2725.2725.2.dta 2 5 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 720 60247 20 20 18 18 2830 2447 1 0 0 378.5255 1132.5546 3 1132.5546 0 1 44.5 0.00029 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2726.2726.3.dta 2 5 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 720 60247 20 20 18 18 3041 3993 1 0 0 583.2954 1164.5763 2 1164.5775 -0.0012 0 79.04 1.40E-07 K YEELQVTAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4436.4436.2.dta 2 5 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 720 60247 20 20 18 18 4318 7767 1 0 0 665.3672 1328.7198 2 1328.7187 0.0011 0 72.49 8.10E-07 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8392.8392.2.dta 2 5 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 720 60247 20 20 18 18 4456 4049 1 0 0 675.8659 1349.7173 2 1349.7191 -0.0018 1 29.25 0.0032 R TAAENEFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4497.4497.2.dta 2 5 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 720 60247 20 20 18 18 4812 5428 1 0 0 699.373 1396.7315 2 1396.735 -0.0035 1 79.35 2.00E-07 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5963.5963.2.dta 2 5 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 720 60247 20 20 18 18 4872 7190 1 0 0 704.3596 1406.7046 2 1406.7041 0.0004 0 78.42 2.30E-07 K ADTLTDEINFLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7743.7743.2.dta 2 5 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 720 60247 20 20 18 18 4978 3759 1 0 0 712.8179 1423.6212 2 1423.6263 -0.0051 0 94.5 2.20E-09 R GSGGLGGACGGAGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4183.4183.2.dta 2 5 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 720 60247 20 20 18 18 5044 3549 1 0 1 718.371 1434.7274 2 1434.7315 -0.0041 0 74.02 6.60E-07 R ATGGGLSSVGGGSSTIK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3950.3950.2.dta 2 5 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 720 60247 20 20 18 18 5959 4549 1 0 0 799.8824 1597.7503 2 1597.7519 -0.0015 0 104.53 5.40E-10 R ISIGGGSCAISGGYGSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5039.5039.2.dta 2 5 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 720 60247 20 20 18 18 6936 5687 1 0 0 587.3246 1758.9519 3 1758.9516 0.0003 1 25.31 0.0042 K VLDTKWTLLQEQGTK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6222.6222.3.dta 2 6 IPI00554648.3 "Keratin, type II cytoskeletal 8" 520 53671 17 17 14 14 143 1142 1 0 1 322.2292 642.4438 2 642.4428 0.001 1 33.44 0.0012 R AVVVKK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1310.1310.2.dta 2 6 IPI00554648.3 "Keratin, type II cytoskeletal 8" 520 53671 17 17 14 14 852 5033 1 0 0 414.2184 826.4222 2 826.4225 -0.0003 0 43.07 0.00095 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5562.5562.2.dta 2 6 IPI00554648.3 "Keratin, type II cytoskeletal 8" 520 53671 17 17 14 14 1094 2895 1 0 1 435.7197 869.4248 2 869.4243 0.0005 0 51.58 0.0001 R ISSSSFSR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3214.3214.2.dta 2 6 IPI00554648.3 "Keratin, type II cytoskeletal 8" 520 53671 17 17 14 14 1095 2875 1 0 1 435.7198 869.4251 2 869.4243 0.0009 0 45 0.00046 R ISSSSFSR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3191.3191.2.dta 2 6 IPI00554648.3 "Keratin, type II cytoskeletal 8" 520 53671 17 17 14 14 1481 2599 1 0 0 466.7373 931.4601 2 931.461 -0.0009 0 46.71 9.60E-05 K LLEGEESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2891.2891.2.dta 2 6 IPI00554648.3 "Keratin, type II cytoskeletal 8" 520 53671 17 17 14 14 2111 5571 1 0 1 515.7875 1029.5605 2 1029.5607 -0.0002 0 28.08 0.033 K WSLLQQQK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6106.6106.2.dta 2 6 IPI00554648.3 "Keratin, type II cytoskeletal 8" 520 53671 17 17 14 14 2331 2297 1 0 0 530.7852 1059.5559 2 1059.556 -0.0001 1 59.23 3.30E-05 R KLLEGEESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2564.2564.2.dta 2 6 IPI00554648.3 "Keratin, type II cytoskeletal 8" 520 53671 17 17 14 14 2497 4962 1 0 0 541.8034 1081.5923 2 1081.592 0.0002 1 43.79 0.00057 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5487.5487.2.dta 2 6 IPI00554648.3 "Keratin, type II cytoskeletal 8" 520 53671 17 17 14 14 2498 4957 1 0 0 361.5381 1081.5923 3 1081.592 0.0003 1 26.79 0.0059 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5482.5482.3.dta 2 6 IPI00554648.3 "Keratin, type II cytoskeletal 8" 520 53671 17 17 14 14 2806 5451 1 0 1 565.3131 1128.6117 2 1128.6138 -0.0022 0 83.09 1.20E-07 K LSELEAALQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5988.5988.2.dta 2 6 IPI00554648.3 "Keratin, type II cytoskeletal 8" 520 53671 17 17 14 14 3114 4108 1 0 1 587.322 1172.6295 2 1172.6289 0.0006 0 54.79 5.40E-05 K LVSESSDVLPK - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4561.4561.2.dta 2 6 IPI00554648.3 "Keratin, type II cytoskeletal 8" 520 53671 17 17 14 14 3375 2409 1 0 1 604.7979 1207.5813 2 1207.5867 -0.0054 1 45.44 0.0002 R TKTEISEMNR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2685.2685.2.dta 2 6 IPI00554648.3 "Keratin, type II cytoskeletal 8" 520 53671 17 17 14 14 3376 2410 1 0 1 403.5355 1207.5846 3 1207.5867 -0.002 1 37.49 0.0014 R TKTEISEMNR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2686.2686.3.dta 2 6 IPI00554648.3 "Keratin, type II cytoskeletal 8" 520 53671 17 17 14 14 4263 7226 1 0 1 660.8396 1319.6646 2 1319.6642 0.0004 0 78.62 1.50E-07 R SLDMDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7781.7781.2.dta 2 6 IPI00554648.3 "Keratin, type II cytoskeletal 8" 520 53671 17 17 14 14 4401 5860 1 0 1 672.8409 1343.6672 2 1343.6681 -0.0008 0 67.72 2.30E-06 R ASLEAAIADAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6396.6396.2.dta 2 6 IPI00554648.3 "Keratin, type II cytoskeletal 8" 520 53671 17 17 14 14 4812 5428 1 0 0 699.373 1396.7315 2 1396.735 -0.0035 1 79.35 2.00E-07 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5963.5963.2.dta 2 6 IPI00554648.3 "Keratin, type II cytoskeletal 8" 520 53671 17 17 14 14 4947 7372 1 0 1 710.3767 1418.7389 2 1418.7405 -0.0017 0 56.81 5.20E-06 R LEGLTDEINFLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7951.7951.2.dta 2 7 IPI00306959.10 "Keratin, type II cytoskeletal 7" 506 51443 15 15 14 14 852 5033 1 0 0 414.2184 826.4222 2 826.4225 -0.0003 0 43.07 0.00095 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5562.5562.2.dta 2 7 IPI00306959.10 "Keratin, type II cytoskeletal 7" 506 51443 15 15 14 14 1481 2599 1 0 0 466.7373 931.4601 2 931.461 -0.0009 0 46.71 9.60E-05 K LLEGEESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2891.2891.2.dta 2 7 IPI00306959.10 "Keratin, type II cytoskeletal 7" 506 51443 15 15 14 14 2331 2297 1 0 0 530.7852 1059.5559 2 1059.556 -0.0001 1 59.23 3.30E-05 R KLLEGEESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2564.2564.2.dta 2 7 IPI00306959.10 "Keratin, type II cytoskeletal 7" 506 51443 15 15 14 14 2497 4962 1 0 0 541.8034 1081.5923 2 1081.592 0.0002 1 43.79 0.00057 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5487.5487.2.dta 2 7 IPI00306959.10 "Keratin, type II cytoskeletal 7" 506 51443 15 15 14 14 2498 4957 1 0 0 361.5381 1081.5923 3 1081.592 0.0003 1 26.79 0.0059 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5482.5482.3.dta 2 7 IPI00306959.10 "Keratin, type II cytoskeletal 7" 506 51443 15 15 14 14 2630 3890 1 0 1 552.7922 1103.5698 2 1103.5724 -0.0026 0 64.73 8.90E-06 R SAYGGPVGAGIR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4325.4325.2.dta 2 7 IPI00306959.10 "Keratin, type II cytoskeletal 7" 506 51443 15 15 14 14 2907 1635 2 0 1 572.2707 1142.5268 2 1142.5278 -0.0009 1 31.68 0.0077 K KDVDAAYMSK V Oxidation (M) 0.0000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1843.1843.2.dta 2 7 IPI00306959.10 "Keratin, type II cytoskeletal 7" 506 51443 15 15 14 14 3892 7498 1 0 1 636.8559 1271.6972 2 1271.6973 0 0 94.21 6.70E-09 R SLDLDGIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8094.8094.2.dta 2 7 IPI00306959.10 "Keratin, type II cytoskeletal 7" 506 51443 15 15 14 14 4442 4501 1 0 0 450.2537 1347.7392 3 1347.7398 -0.0005 1 49.45 9.50E-05 R TAAENEFVVLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4987.4987.3.dta 2 7 IPI00306959.10 "Keratin, type II cytoskeletal 7" 506 51443 15 15 14 14 4705 3975 1 0 1 693.3706 1384.7267 2 1384.731 -0.0043 1 67.55 9.20E-07 R AKQEELEAALQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4417.4417.2.dta 2 7 IPI00306959.10 "Keratin, type II cytoskeletal 7" 506 51443 15 15 14 14 4812 5428 1 0 0 699.373 1396.7315 2 1396.735 -0.0035 1 79.35 2.00E-07 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5963.5963.2.dta 2 7 IPI00306959.10 "Keratin, type II cytoskeletal 7" 506 51443 15 15 14 14 4939 6981 1 0 1 709.8663 1417.7181 2 1417.7201 -0.002 0 75.48 1.90E-07 K VDALNDEINFLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7516.7516.2.dta 2 7 IPI00306959.10 "Keratin, type II cytoskeletal 7" 506 51443 15 15 14 14 5113 3396 1 0 1 721.3904 1440.7662 2 1440.7684 -0.0022 1 59.06 6.10E-06 R LQAEIDNIKNQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3779.3779.2.dta 2 7 IPI00306959.10 "Keratin, type II cytoskeletal 7" 506 51443 15 15 14 14 5121 7615 1 0 1 721.9031 1441.7917 2 1441.7929 -0.0012 0 33.24 0.0013 R LPDIFEAQIAGLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8224.8224.2.dta 2 7 IPI00306959.10 "Keratin, type II cytoskeletal 7" 506 51443 15 15 14 14 5412 4419 1 0 0 497.6116 1489.8129 3 1489.814 -0.0011 1 35.96 0.00044 R FLEQQNKLLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4898.4898.3.dta 2 8 IPI00009867.2 "Keratin, type II cytoskeletal 5" 443 62637 14 14 12 12 852 5033 1 0 0 414.2184 826.4222 2 826.4225 -0.0003 0 43.07 0.00095 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5562.5562.2.dta 2 8 IPI00009867.2 "Keratin, type II cytoskeletal 5" 443 62637 14 14 12 12 1196 3072 1 0 1 442.7273 883.44 2 883.44 0.0001 0 32.62 0.002 R TSFTSVSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3406.3406.2.dta 2 8 IPI00009867.2 "Keratin, type II cytoskeletal 5" 443 62637 14 14 12 12 1957 2780 1 0 0 503.2367 1004.4588 2 1004.4597 -0.0009 0 47.92 6.00E-05 K LLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3088.3088.2.dta 2 8 IPI00009867.2 "Keratin, type II cytoskeletal 5" 443 62637 14 14 12 12 2030 4202 1 0 0 508.7719 1015.5292 2 1015.5298 -0.0006 0 45.63 0.00066 R QLDSIVGER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4663.4663.2.dta 2 8 IPI00009867.2 "Keratin, type II cytoskeletal 5" 443 62637 14 14 12 12 2497 4962 1 0 0 541.8034 1081.5923 2 1081.592 0.0002 1 43.79 0.00057 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5487.5487.2.dta 2 8 IPI00009867.2 "Keratin, type II cytoskeletal 5" 443 62637 14 14 12 12 2498 4957 1 0 0 361.5381 1081.5923 3 1081.592 0.0003 1 26.79 0.0059 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5482.5482.3.dta 2 8 IPI00009867.2 "Keratin, type II cytoskeletal 5" 443 62637 14 14 12 12 2829 2446 1 0 0 567.2835 1132.5525 2 1132.5546 -0.0022 1 43.44 0.00048 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2725.2725.2.dta 2 8 IPI00009867.2 "Keratin, type II cytoskeletal 5" 443 62637 14 14 12 12 2830 2447 1 0 0 378.5255 1132.5546 3 1132.5546 0 1 44.5 0.00029 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2726.2726.3.dta 2 8 IPI00009867.2 "Keratin, type II cytoskeletal 5" 443 62637 14 14 12 12 4318 7767 1 0 0 665.3672 1328.7198 2 1328.7187 0.0011 0 72.49 8.10E-07 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8392.8392.2.dta 2 8 IPI00009867.2 "Keratin, type II cytoskeletal 5" 443 62637 14 14 12 12 4812 5428 1 0 0 699.373 1396.7315 2 1396.735 -0.0035 1 79.35 2.00E-07 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5963.5963.2.dta 2 8 IPI00009867.2 "Keratin, type II cytoskeletal 5" 443 62637 14 14 12 12 4889 4297 1 0 1 705.8433 1409.6721 2 1409.6722 -0.0001 0 105.9 1.20E-10 R VSLAGACGVGGYGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4766.4766.2.dta 2 8 IPI00009867.2 "Keratin, type II cytoskeletal 5" 443 62637 14 14 12 12 4891 4479 1 0 1 705.8641 1409.7136 2 1409.7151 -0.0015 0 66.98 1.20E-06 R SFSTASAITPSVSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4963.4963.2.dta 2 8 IPI00009867.2 "Keratin, type II cytoskeletal 5" 443 62637 14 14 12 12 5099 4552 1 0 1 720.3594 1438.7042 2 1438.7053 -0.0011 0 34.89 0.00053 R GLGVGFGSGGGSSSSVK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5042.5042.2.dta 2 8 IPI00009867.2 "Keratin, type II cytoskeletal 5" 443 62637 14 14 12 12 6936 5687 1 0 0 587.3246 1758.9519 3 1758.9516 0.0003 1 25.31 0.0042 K VLDTKWTLLQEQGTK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6222.6222.3.dta 2 9 IPI00182654.5 "Keratin, hair, basic, 1" 269 57059 12 12 12 12 512 2491 1 0 1 378.1794 754.3443 2 754.3432 0.0011 0 25.15 0.025 R GISCYR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2774.2774.2.dta 2 9 IPI00182654.5 "Keratin, hair, basic, 1" 269 57059 12 12 12 12 776 5074 1 0 1 406.2207 810.4269 2 810.4276 -0.0007 0 23.91 0.028 R FAAFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5604.5604.2.dta 2 9 IPI00182654.5 "Keratin, hair, basic, 1" 269 57059 12 12 12 12 1085 1027 1 0 1 434.7407 867.4668 2 867.4675 -0.0007 1 30.79 0.011 R HGETLRR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1186.1186.2.dta 2 9 IPI00182654.5 "Keratin, hair, basic, 1" 269 57059 12 12 12 12 1709 4147 1 0 1 484.7508 967.4871 2 967.4875 -0.0005 0 32.84 0.002 K LQFYQNR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4603.4603.2.dta 2 9 IPI00182654.5 "Keratin, hair, basic, 1" 269 57059 12 12 12 12 1750 2456 1 0 1 487.7605 973.5065 2 973.508 -0.0015 0 51.7 2.50E-05 R LTAEVENAK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2736.2736.2.dta 2 9 IPI00182654.5 "Keratin, hair, basic, 1" 269 57059 12 12 12 12 1992 4106 1 0 1 506.2316 1010.4486 2 1010.4491 -0.0005 0 33.25 0.00076 R DVDCAYLR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4559.4559.2.dta 2 9 IPI00182654.5 "Keratin, hair, basic, 1" 269 57059 12 12 12 12 2373 4897 1 0 1 533.8062 1065.5978 2 1065.5971 0.0006 1 60 6.20E-06 R FAAFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5416.5416.2.dta 2 9 IPI00182654.5 "Keratin, hair, basic, 1" 269 57059 12 12 12 12 2678 3509 1 0 1 556.2548 1110.495 2 1110.495 -0.0001 0 36.5 0.0019 R CCITAAPYR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3905.3905.2.dta 2 9 IPI00182654.5 "Keratin, hair, basic, 1" 269 57059 12 12 12 12 3657 2714 1 0 1 623.3237 1244.6329 2 1244.636 -0.0031 1 50.59 0.00011 R TKEEINELNR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3016.3016.2.dta 2 9 IPI00182654.5 "Keratin, hair, basic, 1" 269 57059 12 12 12 12 3722 3555 1 0 1 627.7958 1253.577 2 1253.5789 -0.0019 1 36.36 0.00039 R SRAEAESWYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3957.3957.2.dta 2 9 IPI00182654.5 "Keratin, hair, basic, 1" 269 57059 12 12 12 12 4268 4111 1 0 1 660.8641 1319.7137 2 1319.7085 0.0052 1 68.74 1.40E-06 R ATAENEFVALKK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4564.4564.2.dta 2 9 IPI00182654.5 "Keratin, hair, basic, 1" 269 57059 12 12 12 12 5412 4419 1 0 0 497.6116 1489.8129 3 1489.814 -0.0011 1 35.96 0.00044 R FLEQQNKLLETK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4898.4898.3.dta 2 10 IPI00300052.1 Keratin type II cuticular Hb4 210 65938 8 8 7 7 852 5033 1 0 0 414.2184 826.4222 2 826.4225 -0.0003 0 43.07 0.00095 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5562.5562.2.dta 2 10 IPI00300052.1 Keratin type II cuticular Hb4 210 65938 8 8 7 7 1481 2599 1 0 0 466.7373 931.4601 2 931.461 -0.0009 0 46.71 9.60E-05 R LLEGEESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2891.2891.2.dta 2 10 IPI00300052.1 Keratin type II cuticular Hb4 210 65938 8 8 7 7 2497 4962 1 0 0 541.8034 1081.5923 2 1081.592 0.0002 1 43.79 0.00057 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5487.5487.2.dta 2 10 IPI00300052.1 Keratin type II cuticular Hb4 210 65938 8 8 7 7 2498 4957 1 0 0 361.5381 1081.5923 3 1081.592 0.0003 1 26.79 0.0059 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5482.5482.3.dta 2 10 IPI00300052.1 Keratin type II cuticular Hb4 210 65938 8 8 7 7 4499 4690 1 0 1 679.8657 1357.7169 2 1357.7202 -0.0033 0 38.65 0.00075 R VAPATGDLLSTGTR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5191.5191.2.dta 2 10 IPI00300052.1 Keratin type II cuticular Hb4 210 65938 8 8 7 7 4812 5428 1 0 0 699.373 1396.7315 2 1396.735 -0.0035 1 79.35 2.00E-07 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5963.5963.2.dta 2 10 IPI00300052.1 Keratin type II cuticular Hb4 210 65938 8 8 7 7 5412 4419 1 0 0 497.6116 1489.8129 3 1489.814 -0.0011 1 35.96 0.00044 R FLEQQNKLLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4898.4898.3.dta 2 10 IPI00300052.1 Keratin type II cuticular Hb4 210 65938 8 8 7 7 7072 7402 1 0 1 897.4902 1792.9659 2 1792.9683 -0.0024 0 35.27 0.00049 K SLLTPLNLEIDPNAQR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7983.7983.2.dta 2 11 IPI00001453.2 Alpha-internexin 172 55528 5 5 5 5 1587 3094 1 0 1 475.2459 948.4773 2 948.4777 -0.0004 0 54.9 7.00E-05 R LSGAGGAGGFR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3430.3430.2.dta 2 11 IPI00001453.2 Alpha-internexin 172 55528 5 5 5 5 2337 2147 1 0 1 531.2648 1060.5151 2 1060.5149 0.0003 0 49.49 6.20E-05 R AQLEEASSAR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2400.2400.2.dta 2 11 IPI00001453.2 Alpha-internexin 172 55528 5 5 5 5 2831 3471 1 0 1 567.2875 1132.5605 2 1132.5625 -0.002 0 61.69 1.60E-05 K FANLNEQAAR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3860.3860.2.dta 2 11 IPI00001453.2 Alpha-internexin 172 55528 5 5 5 5 5588 4735 1 0 0 764.4166 1526.8186 2 1526.8205 -0.0019 1 64.26 5.80E-06 R HLREYQDLLNVK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5240.5240.2.dta 2 11 IPI00001453.2 Alpha-internexin 172 55528 5 5 5 5 7135 4645 1 0 1 605.3173 1812.9301 3 1812.933 -0.0028 1 36.18 0.0023 R SQALLERDGLAEEVQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5143.5143.3.dta 2 12 IPI00103481.3 Keratin-72 119 56470 6 6 5 5 852 5033 1 0 0 414.2184 826.4222 2 826.4225 -0.0003 0 43.07 0.00095 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5562.5562.2.dta 2 12 IPI00103481.3 Keratin-72 119 56470 6 6 5 5 1929 1211 1 0 0 501.2715 1000.5285 2 1000.5301 -0.0016 1 31.32 0.024 R AQEREQIK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1385.1385.2.dta 2 12 IPI00103481.3 Keratin-72 119 56470 6 6 5 5 2497 4962 1 0 0 541.8034 1081.5923 2 1081.592 0.0002 1 43.79 0.00057 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5487.5487.2.dta 2 12 IPI00103481.3 Keratin-72 119 56470 6 6 5 5 2498 4957 1 0 0 361.5381 1081.5923 3 1081.592 0.0003 1 26.79 0.0059 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5482.5482.3.dta 2 12 IPI00103481.3 Keratin-72 119 56470 6 6 5 5 4442 4501 1 0 0 450.2537 1347.7392 3 1347.7398 -0.0005 1 49.45 9.50E-05 R TAAENEFVVLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4987.4987.3.dta 2 12 IPI00103481.3 Keratin-72 119 56470 6 6 5 5 5347 4550 1 0 1 738.8869 1475.7593 2 1475.762 -0.0027 0 43.04 0.001 R FLEQQNQVLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5040.5040.2.dta 2 13 IPI00166205.2 Keratin-78 69 57728 3 3 3 3 1957 2780 1 0 0 503.2367 1004.4588 2 1004.4597 -0.0009 0 47.92 6.00E-05 R LLEGEECR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3088.3088.2.dta 2 13 IPI00166205.2 Keratin-78 69 57728 3 3 3 3 4810 5420 1 0 1 466.5721 1396.6944 3 1396.6987 -0.0043 0 33.55 0.00071 R TLNNQFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5955.5955.3.dta 2 13 IPI00166205.2 Keratin-78 69 57728 3 3 3 3 5348 3807 1 0 0 492.9392 1475.7958 3 1475.7984 -0.0026 1 18.54 0.018 R FLEQQNKVLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4235.4235.3.dta 2 IPI00827679.1 50 kDa protein 836 49680 31 31 27 27 313 2405 1 0 1 351.2006 700.3867 2 700.3868 -0.0001 0 55.92 6.50E-05 R SSVPGVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2681.2681.2.dta 2 IPI00827679.1 50 kDa protein 836 49680 31 31 27 27 1125 1712 1 0 1 436.7107 871.4068 2 871.4035 0.0033 0 19.35 0.019 R SVSSSSYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1927.1927.2.dta 2 IPI00827679.1 50 kDa protein 836 49680 31 31 27 27 1362 2228 1 0 1 457.7328 913.4511 2 913.4505 0.0006 0 29.98 0.0015 R SYVTTSTR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2489.2489.2.dta 2 IPI00827679.1 50 kDa protein 836 49680 31 31 27 27 1481 2599 1 0 0 466.7373 931.4601 2 931.461 -0.0009 0 46.71 9.60E-05 K LLEGEESR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2891.2891.2.dta 2 IPI00827679.1 50 kDa protein 836 49680 31 31 27 27 1724 2585 1 0 1 485.7926 969.5707 2 969.572 -0.0013 1 24.31 0.034 R LRSSVPGVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2876.2876.2.dta 2 IPI00827679.1 50 kDa protein 836 49680 31 31 27 27 2076 2142 1 0 1 512.2591 1022.5036 2 1022.5032 0.0004 0 41.52 0.00029 R QQYESVAAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2395.2395.2.dta 2 IPI00827679.1 50 kDa protein 836 49680 31 31 27 27 2092 1355 1 0 1 514.7587 1027.5029 2 1027.5047 -0.0018 1 33.78 0.0032 R SVSSSSYRR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1541.1541.2.dta 2 IPI00827679.1 50 kDa protein 836 49680 31 31 27 27 2325 2424 1 0 1 530.7656 1059.5167 2 1059.5197 -0.003 0 38.98 0.00065 R QVDQLTNDK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2701.2701.2.dta 2 IPI00827679.1 50 kDa protein 836 49680 31 31 27 27 2331 2297 1 0 0 530.7852 1059.5559 2 1059.556 -0.0001 1 59.23 3.30E-05 R KLLEGEESR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2564.2564.2.dta 2 IPI00827679.1 50 kDa protein 836 49680 31 31 27 27 2530 2623 1 0 1 544.77 1087.5254 2 1087.5258 -0.0004 0 78.05 2.40E-07 R QDVDNASLAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2917.2917.2.dta 2 IPI00827679.1 50 kDa protein 836 49680 31 31 27 27 2789 4101 1 0 1 563.3062 1124.5979 2 1124.5978 0 1 30.99 0.005 R FANYIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4553.4553.2.dta 2 IPI00827679.1 50 kDa protein 836 49680 31 31 27 27 2790 4081 1 0 1 375.8748 1124.6025 3 1124.5978 0.0047 1 26.69 0.014 R FANYIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4532.4532.3.dta 2 IPI00827679.1 50 kDa protein 836 49680 31 31 27 27 3075 7169 1 0 1 585.3606 1168.7066 2 1168.7067 0 0 53.77 1.90E-05 K ILLAELEQLK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7718.7718.2.dta 2 IPI00827679.1 50 kDa protein 836 49680 31 31 27 27 3421 2125 1 0 1 608.8172 1215.6198 2 1215.6208 -0.0009 1 42 0.00043 R RQVDQLTNDK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2376.2376.2.dta 2 IPI00827679.1 50 kDa protein 836 49680 31 31 27 27 3972 2088 1 0 1 644.3361 1286.6576 2 1286.6579 -0.0003 1 57.23 3.50E-05 R QVDQLTNDKAR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2335.2335.2.dta 2 IPI00827679.1 50 kDa protein 836 49680 31 31 27 27 4172 5304 1 0 1 655.306 1308.5974 2 1308.5986 -0.0012 0 55.42 6.40E-06 K NLQEAEEWYK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5837.5837.2.dta 2 IPI00827679.1 50 kDa protein 836 49680 31 31 27 27 4774 3245 1 0 1 697.3567 1392.6989 2 1392.6997 -0.0008 1 59.01 5.20E-06 R DVRQQYESVAAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3610.3610.2.dta 2 IPI00827679.1 50 kDa protein 836 49680 31 31 27 27 4775 3242 1 0 1 465.2404 1392.6992 3 1392.6997 -0.0005 1 28.52 0.0023 R DVRQQYESVAAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3607.3607.3.dta 2 IPI00827679.1 50 kDa protein 836 49680 31 31 27 27 5002 4238 1 0 1 714.8599 1427.7053 2 1427.7045 0.0008 0 73.61 1.30E-07 R SLYASSPGGVYATR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4702.4702.2.dta 2 IPI00827679.1 50 kDa protein 836 49680 31 31 27 27 5485 2211 1 0 1 504.2401 1509.6984 3 1509.6994 -0.001 0 27.75 0.0042 R MFGGPGTASRPSSSR S Oxidation (M) 0.100000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2470.2470.3.dta 2 IPI00827679.1 50 kDa protein 836 49680 31 31 27 27 5570 4764 1 0 1 508.916 1523.7262 3 1523.7256 0.0006 1 27.97 0.014 K NLQEAEEWYKSK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5272.5272.3.dta 2 IPI00827679.1 50 kDa protein 836 49680 31 31 27 27 5588 4735 1 0 0 764.4166 1526.8186 2 1526.8205 -0.0019 1 64.26 5.80E-06 R HLREYQDLLNVK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5240.5240.2.dta 2 IPI00827679.1 50 kDa protein 836 49680 31 31 27 27 5618 6496 1 0 1 767.4293 1532.844 2 1532.845 -0.001 1 101.72 4.10E-10 R KVESLQEEIAFLK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7028.7028.2.dta 2 IPI00827679.1 50 kDa protein 836 49680 31 31 27 27 5670 6062 1 0 1 770.4573 1538.9001 2 1538.9032 -0.003 1 78.8 4.50E-08 K ILLAELEQLKGQGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6598.6598.2.dta 2 IPI00827679.1 50 kDa protein 836 49680 31 31 27 27 5935 3896 1 0 1 794.3985 1586.7824 2 1586.79 -0.0075 1 55.14 1.70E-05 R TNEKVELQELNDR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4331.4331.2.dta 2 IPI00827679.1 50 kDa protein 836 49680 31 31 27 27 6344 5867 1 0 1 551.6041 1651.7904 3 1651.7875 0.0028 1 17.75 0.029 R LGDLYEEEMRELR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6403.6403.3.dta 2 IPI00827679.1 50 kDa protein 836 49680 31 31 27 27 6555 5491 1 0 1 844.9149 1687.8153 2 1687.8199 -0.0046 1 36.12 0.00041 R VEVERDNLAEDIMR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6027.6027.2.dta 2 IPI00827679.1 50 kDa protein 836 49680 31 31 27 27 6683 4264 1 0 1 568.946 1703.8163 3 1703.8148 0.0015 1 23.91 0.0069 R VEVERDNLAEDIMR L Oxidation (M) 0.00000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4730.4730.3.dta 2 IPI00827679.1 50 kDa protein 836 49680 31 31 27 27 6999 4232 1 0 1 888.9341 1775.8537 2 1775.855 -0.0013 1 25.34 0.0085 K FADLSEAANRNNDALR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4695.4695.2.dta 2 IPI00827679.1 50 kDa protein 836 49680 31 31 27 27 7000 4214 1 0 1 592.9588 1775.8546 3 1775.855 -0.0005 1 40.19 0.00029 K FADLSEAANRNNDALR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4676.4676.3.dta 2 IPI00827679.1 50 kDa protein 836 49680 31 31 27 27 8445 5635 1 0 1 793.0592 2376.1558 3 2376.1591 -0.0033 1 59.49 2.60E-06 R QVQSLTCEVDALKGTNESLER Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6170.6170.3.dta 2 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 731 60273 20 20 18 18 852 5033 1 0 0 414.2184 826.4222 2 826.4225 -0.0003 0 43.07 0.00095 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5562.5562.2.dta 2 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 731 60273 20 20 18 18 1826 1107 1 0 0 495.2303 988.446 2 988.4462 -0.0002 0 41.83 0.00012 K YTTTSSSSR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1272.1272.2.dta 2 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 731 60273 20 20 18 18 1957 2780 1 0 0 503.2367 1004.4588 2 1004.4597 -0.0009 0 47.92 6.00E-05 K LLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3088.3088.2.dta 2 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 731 60273 20 20 18 18 2030 4202 1 0 0 508.7719 1015.5292 2 1015.5298 -0.0006 0 45.63 0.00066 R QLDSIVGER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4663.4663.2.dta 2 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 731 60273 20 20 18 18 2083 4332 1 0 0 513.7647 1025.5149 2 1025.5142 0.0007 0 61.49 1.70E-06 R SGFSSISVSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4804.4804.2.dta 2 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 731 60273 20 20 18 18 2153 3533 1 0 0 346.5296 1036.5671 3 1036.5665 0.0005 1 26.4 0.0067 R SLYGLGGSKR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3932.3932.3.dta 2 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 731 60273 20 20 18 18 2497 4962 1 0 0 541.8034 1081.5923 2 1081.592 0.0002 1 43.79 0.00057 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5487.5487.2.dta 2 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 731 60273 20 20 18 18 2498 4957 1 0 0 361.5381 1081.5923 3 1081.592 0.0003 1 26.79 0.0059 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5482.5482.3.dta 2 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 731 60273 20 20 18 18 2644 3086 1 0 0 554.2732 1106.5318 2 1106.5356 -0.0038 0 62.92 1.10E-05 K AQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3422.3422.2.dta 2 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 731 60273 20 20 18 18 2829 2446 1 0 0 567.2835 1132.5525 2 1132.5546 -0.0022 1 43.44 0.00048 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2725.2725.2.dta 2 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 731 60273 20 20 18 18 2830 2447 1 0 0 378.5255 1132.5546 3 1132.5546 0 1 44.5 0.00029 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2726.2726.3.dta 2 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 731 60273 20 20 18 18 3041 3993 1 0 0 583.2954 1164.5763 2 1164.5775 -0.0012 0 79.04 1.40E-07 K YEELQVTAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4436.4436.2.dta 2 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 731 60273 20 20 18 18 4318 7767 1 0 0 665.3672 1328.7198 2 1328.7187 0.0011 0 72.49 8.10E-07 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8392.8392.2.dta 2 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 731 60273 20 20 18 18 4456 4049 1 0 0 675.8659 1349.7173 2 1349.7191 -0.0018 1 29.25 0.0032 R TAAENEFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4497.4497.2.dta 2 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 731 60273 20 20 18 18 4812 5428 1 0 0 699.373 1396.7315 2 1396.735 -0.0035 1 79.35 2.00E-07 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5963.5963.2.dta 2 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 731 60273 20 20 18 18 4872 7190 1 0 0 704.3596 1406.7046 2 1406.7041 0.0004 0 78.42 2.30E-07 K ADTLTDEINFLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7743.7743.2.dta 2 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 731 60273 20 20 18 18 4978 3759 1 0 0 712.8179 1423.6212 2 1423.6263 -0.0051 0 94.5 2.20E-09 R GSGGLGGACGGAGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4183.4183.2.dta 2 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 731 60273 20 20 18 18 5155 4316 1 0 1 724.3919 1446.7693 2 1446.7678 0.0014 0 82.95 5.10E-08 R AIGGGLSSVGGGSSTIK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4786.4786.2.dta 2 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 731 60273 20 20 18 18 5959 4549 1 0 0 799.8824 1597.7503 2 1597.7519 -0.0015 0 104.53 5.40E-10 R ISIGGGSCAISGGYGSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5039.5039.2.dta 2 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 731 60273 20 20 18 18 6936 5687 1 0 0 587.3246 1758.9519 3 1758.9516 0.0003 1 25.31 0.0042 K VLDTKWTLLQEQGTK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6222.6222.3.dta 2 IPI00816709.1 Keratin 6C 701 60245 18 18 17 17 852 5033 1 0 0 414.2184 826.4222 2 826.4225 -0.0003 0 43.07 0.00095 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5562.5562.2.dta 2 IPI00816709.1 Keratin 6C 701 60245 18 18 17 17 1826 1107 1 0 0 495.2303 988.446 2 988.4462 -0.0002 0 41.83 0.00012 K YTTTSSSSR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1272.1272.2.dta 2 IPI00816709.1 Keratin 6C 701 60245 18 18 17 17 1957 2780 1 0 0 503.2367 1004.4588 2 1004.4597 -0.0009 0 47.92 6.00E-05 K LLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3088.3088.2.dta 2 IPI00816709.1 Keratin 6C 701 60245 18 18 17 17 2030 4202 1 0 0 508.7719 1015.5292 2 1015.5298 -0.0006 0 45.63 0.00066 R QLDSIVGER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4663.4663.2.dta 2 IPI00816709.1 Keratin 6C 701 60245 18 18 17 17 2083 4332 1 0 0 513.7647 1025.5149 2 1025.5142 0.0007 0 61.49 1.70E-06 R SGFSSISVSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4804.4804.2.dta 2 IPI00816709.1 Keratin 6C 701 60245 18 18 17 17 2153 3533 1 0 0 346.5296 1036.5671 3 1036.5665 0.0005 1 26.4 0.0067 R SLYGLGGSKR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3932.3932.3.dta 2 IPI00816709.1 Keratin 6C 701 60245 18 18 17 17 2644 3086 1 0 0 554.2732 1106.5318 2 1106.5356 -0.0038 0 62.92 1.10E-05 K AQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3422.3422.2.dta 2 IPI00816709.1 Keratin 6C 701 60245 18 18 17 17 2829 2446 1 0 0 567.2835 1132.5525 2 1132.5546 -0.0022 1 43.44 0.00048 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2725.2725.2.dta 2 IPI00816709.1 Keratin 6C 701 60245 18 18 17 17 2830 2447 1 0 0 378.5255 1132.5546 3 1132.5546 0 1 44.5 0.00029 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2726.2726.3.dta 2 IPI00816709.1 Keratin 6C 701 60245 18 18 17 17 3041 3993 1 0 0 583.2954 1164.5763 2 1164.5775 -0.0012 0 79.04 1.40E-07 K YEELQVTAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4436.4436.2.dta 2 IPI00816709.1 Keratin 6C 701 60245 18 18 17 17 4318 7767 1 0 0 665.3672 1328.7198 2 1328.7187 0.0011 0 72.49 8.10E-07 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8392.8392.2.dta 2 IPI00816709.1 Keratin 6C 701 60245 18 18 17 17 4456 4049 1 0 0 675.8659 1349.7173 2 1349.7191 -0.0018 1 29.25 0.0032 R TAAENEFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4497.4497.2.dta 2 IPI00816709.1 Keratin 6C 701 60245 18 18 17 17 4812 5428 1 0 0 699.373 1396.7315 2 1396.735 -0.0035 1 79.35 2.00E-07 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5963.5963.2.dta 2 IPI00816709.1 Keratin 6C 701 60245 18 18 17 17 4872 7190 1 0 0 704.3596 1406.7046 2 1406.7041 0.0004 0 78.42 2.30E-07 K ADTLTDEINFLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7743.7743.2.dta 2 IPI00816709.1 Keratin 6C 701 60245 18 18 17 17 4978 3759 1 0 0 712.8179 1423.6212 2 1423.6263 -0.0051 0 94.5 2.20E-09 R GSGGLGGACGGAGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4183.4183.2.dta 2 IPI00816709.1 Keratin 6C 701 60245 18 18 17 17 5155 4316 1 0 1 724.3919 1446.7693 2 1446.7678 0.0014 0 82.95 5.10E-08 R AIGGGLSSVGGGSSTIK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4786.4786.2.dta 2 IPI00816709.1 Keratin 6C 701 60245 18 18 17 17 5959 4549 1 0 0 799.8824 1597.7503 2 1597.7519 -0.0015 0 104.53 5.40E-10 R ISIGGGSCAISGGYGSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5039.5039.2.dta 2 IPI00816709.1 Keratin 6C 701 60245 18 18 17 17 6936 5687 1 0 0 587.3246 1758.9519 3 1758.9516 0.0003 1 25.31 0.0042 K VLDTKWTLLQEQGTK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6222.6222.3.dta 2 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 679 60293 19 19 17 17 852 5033 1 0 0 414.2184 826.4222 2 826.4225 -0.0003 0 43.07 0.00095 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5562.5562.2.dta 2 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 679 60293 19 19 17 17 1826 1107 1 0 0 495.2303 988.446 2 988.4462 -0.0002 0 41.83 0.00012 K YTTTSSSSR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1272.1272.2.dta 2 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 679 60293 19 19 17 17 1957 2780 1 0 0 503.2367 1004.4588 2 1004.4597 -0.0009 0 47.92 6.00E-05 K LLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3088.3088.2.dta 2 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 679 60293 19 19 17 17 2030 4202 1 0 0 508.7719 1015.5292 2 1015.5298 -0.0006 0 45.63 0.00066 R QLDSIVGER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4663.4663.2.dta 2 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 679 60293 19 19 17 17 2153 3533 1 0 0 346.5296 1036.5671 3 1036.5665 0.0005 1 26.4 0.0067 R SLYGLGGSKR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3932.3932.3.dta 2 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 679 60293 19 19 17 17 2497 4962 1 0 0 541.8034 1081.5923 2 1081.592 0.0002 1 43.79 0.00057 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5487.5487.2.dta 2 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 679 60293 19 19 17 17 2498 4957 1 0 0 361.5381 1081.5923 3 1081.592 0.0003 1 26.79 0.0059 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5482.5482.3.dta 2 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 679 60293 19 19 17 17 2644 3086 1 0 0 554.2732 1106.5318 2 1106.5356 -0.0038 0 62.92 1.10E-05 K AQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3422.3422.2.dta 2 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 679 60293 19 19 17 17 2829 2446 1 0 0 567.2835 1132.5525 2 1132.5546 -0.0022 1 43.44 0.00048 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2725.2725.2.dta 2 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 679 60293 19 19 17 17 2830 2447 1 0 0 378.5255 1132.5546 3 1132.5546 0 1 44.5 0.00029 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2726.2726.3.dta 2 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 679 60293 19 19 17 17 3041 3993 1 0 0 583.2954 1164.5763 2 1164.5775 -0.0012 0 79.04 1.40E-07 K YEELQVTAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4436.4436.2.dta 2 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 679 60293 19 19 17 17 4318 7767 1 0 0 665.3672 1328.7198 2 1328.7187 0.0011 0 72.49 8.10E-07 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8392.8392.2.dta 2 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 679 60293 19 19 17 17 4456 4049 1 0 0 675.8659 1349.7173 2 1349.7191 -0.0018 1 29.25 0.0032 R TAAENEFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4497.4497.2.dta 2 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 679 60293 19 19 17 17 4812 5428 1 0 0 699.373 1396.7315 2 1396.735 -0.0035 1 79.35 2.00E-07 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5963.5963.2.dta 2 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 679 60293 19 19 17 17 4872 7190 1 0 0 704.3596 1406.7046 2 1406.7041 0.0004 0 78.42 2.30E-07 K ADTLTDEINFLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7743.7743.2.dta 2 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 679 60293 19 19 17 17 4978 3759 1 0 0 712.8179 1423.6212 2 1423.6263 -0.0051 0 94.5 2.20E-09 R GSGGLGGACGGAGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4183.4183.2.dta 2 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 679 60293 19 19 17 17 5155 4316 1 0 1 724.3919 1446.7693 2 1446.7678 0.0014 0 82.95 5.10E-08 R AIGGGLSSVGGGSSTIK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4786.4786.2.dta 2 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 679 60293 19 19 17 17 5348 3807 1 0 0 492.9392 1475.7958 3 1475.7984 -0.0026 1 18.54 0.018 R FLEQQNKVLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4235.4235.3.dta 2 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 679 60293 19 19 17 17 5959 4549 1 0 0 799.8824 1597.7503 2 1597.7519 -0.0015 0 104.53 5.40E-10 R ISIGGGSCAISGGYGSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5039.5039.2.dta 2 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 419 42557 12 12 11 11 1826 1107 1 0 0 495.2303 988.446 2 988.4462 -0.0002 0 41.83 0.00012 K YTTTSSSSR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1272.1272.2.dta 2 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 419 42557 12 12 11 11 1957 2780 1 0 0 503.2367 1004.4588 2 1004.4597 -0.0009 0 47.92 6.00E-05 K LLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3088.3088.2.dta 2 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 419 42557 12 12 11 11 2030 4202 1 0 0 508.7719 1015.5292 2 1015.5298 -0.0006 0 45.63 0.00066 R QLDSIVGER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4663.4663.2.dta 2 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 419 42557 12 12 11 11 2644 3086 1 0 0 554.2732 1106.5318 2 1106.5356 -0.0038 0 62.92 1.10E-05 K AQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3422.3422.2.dta 2 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 419 42557 12 12 11 11 2829 2446 1 0 0 567.2835 1132.5525 2 1132.5546 -0.0022 1 43.44 0.00048 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2725.2725.2.dta 2 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 419 42557 12 12 11 11 2830 2447 1 0 0 378.5255 1132.5546 3 1132.5546 0 1 44.5 0.00029 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2726.2726.3.dta 2 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 419 42557 12 12 11 11 3041 3993 1 0 0 583.2954 1164.5763 2 1164.5775 -0.0012 0 79.04 1.40E-07 K YEELQVTAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4436.4436.2.dta 2 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 419 42557 12 12 11 11 4318 7767 1 0 0 665.3672 1328.7198 2 1328.7187 0.0011 0 72.49 8.10E-07 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8392.8392.2.dta 2 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 419 42557 12 12 11 11 4456 4049 1 0 0 675.8659 1349.7173 2 1349.7191 -0.0018 1 29.25 0.0032 R TAAENEFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4497.4497.2.dta 2 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 419 42557 12 12 11 11 4872 7190 1 0 0 704.3596 1406.7046 2 1406.7041 0.0004 0 78.42 2.30E-07 K ADTLTDEINFLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7743.7743.2.dta 2 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 419 42557 12 12 11 11 5155 4316 1 0 1 724.3919 1446.7693 2 1446.7678 0.0014 0 82.95 5.10E-08 R AIGGGLSSVGGGSSTIK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4786.4786.2.dta 2 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 419 42557 12 12 11 11 6936 5687 1 0 0 587.3246 1758.9519 3 1758.9516 0.0003 1 25.31 0.0042 K VLDTKWTLLQEQGTK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6222.6222.3.dta 2 IPI00005859.2 Keratin-75 351 59809 11 11 9 9 852 5033 1 0 0 414.2184 826.4222 2 826.4225 -0.0003 0 43.07 0.00095 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5562.5562.2.dta 2 IPI00005859.2 Keratin-75 351 59809 11 11 9 9 1957 2780 1 0 0 503.2367 1004.4588 2 1004.4597 -0.0009 0 47.92 6.00E-05 K LLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3088.3088.2.dta 2 IPI00005859.2 Keratin-75 351 59809 11 11 9 9 2497 4962 1 0 0 541.8034 1081.5923 2 1081.592 0.0002 1 43.79 0.00057 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5487.5487.2.dta 2 IPI00005859.2 Keratin-75 351 59809 11 11 9 9 2498 4957 1 0 0 361.5381 1081.5923 3 1081.592 0.0003 1 26.79 0.0059 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5482.5482.3.dta 2 IPI00005859.2 Keratin-75 351 59809 11 11 9 9 2829 2446 1 0 0 567.2835 1132.5525 2 1132.5546 -0.0022 1 43.44 0.00048 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2725.2725.2.dta 2 IPI00005859.2 Keratin-75 351 59809 11 11 9 9 2830 2447 1 0 0 378.5255 1132.5546 3 1132.5546 0 1 44.5 0.00029 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2726.2726.3.dta 2 IPI00005859.2 Keratin-75 351 59809 11 11 9 9 3041 3993 1 0 0 583.2954 1164.5763 2 1164.5775 -0.0012 0 79.04 1.40E-07 K YEELQVTAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4436.4436.2.dta 2 IPI00005859.2 Keratin-75 351 59809 11 11 9 9 4268 4111 1 0 1 660.8641 1319.7137 2 1319.7085 0.0052 1 68.74 1.40E-06 R TAAENEFVALKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4564.4564.2.dta 2 IPI00005859.2 Keratin-75 351 59809 11 11 9 9 4318 7767 1 0 0 665.3672 1328.7198 2 1328.7187 0.0011 0 72.49 8.10E-07 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8392.8392.2.dta 2 IPI00005859.2 Keratin-75 351 59809 11 11 9 9 4812 5428 1 0 0 699.373 1396.7315 2 1396.735 -0.0035 1 79.35 2.00E-07 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5963.5963.2.dta 2 IPI00005859.2 Keratin-75 351 59809 11 11 9 9 5348 3807 1 0 0 492.9392 1475.7958 3 1475.7984 -0.0026 1 18.54 0.018 R FLEQQNKVLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4235.4235.3.dta 2 IPI00793917.1 27 kDa protein 320 26765 8 8 7 7 1481 2599 1 0 0 466.7373 931.4601 2 931.461 -0.0009 0 46.71 9.60E-05 K LLEGEESR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2891.2891.2.dta 2 IPI00793917.1 27 kDa protein 320 26765 8 8 7 7 2331 2297 1 0 0 530.7852 1059.5559 2 1059.556 -0.0001 1 59.23 3.30E-05 R KLLEGEESR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2564.2564.2.dta 2 IPI00793917.1 27 kDa protein 320 26765 8 8 7 7 2806 5451 1 0 1 565.3131 1128.6117 2 1128.6138 -0.0022 0 83.09 1.20E-07 K LSELEAALQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5988.5988.2.dta 2 IPI00793917.1 27 kDa protein 320 26765 8 8 7 7 3375 2409 1 0 1 604.7979 1207.5813 2 1207.5867 -0.0054 1 45.44 0.0002 R TKTEISEMNR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2685.2685.2.dta 2 IPI00793917.1 27 kDa protein 320 26765 8 8 7 7 3376 2410 1 0 1 403.5355 1207.5846 3 1207.5867 -0.002 1 37.49 0.0014 R TKTEISEMNR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2686.2686.3.dta 2 IPI00793917.1 27 kDa protein 320 26765 8 8 7 7 4263 7226 1 0 1 660.8396 1319.6646 2 1319.6642 0.0004 0 78.62 1.50E-07 R SLDMDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7781.7781.2.dta 2 IPI00793917.1 27 kDa protein 320 26765 8 8 7 7 4401 5860 1 0 1 672.8409 1343.6672 2 1343.6681 -0.0008 0 67.72 2.30E-06 R ASLEAAIADAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6396.6396.2.dta 2 IPI00793917.1 27 kDa protein 320 26765 8 8 7 7 4947 7372 1 0 1 710.3767 1418.7389 2 1418.7405 -0.0017 0 56.81 5.20E-06 R LEGLTDEINFLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7951.7951.2.dta 2 IPI00552689.1 Vimentin 308 20138 9 9 7 7 2076 2142 1 0 1 512.2591 1022.5036 2 1022.5032 0.0004 0 41.52 0.00029 R QQYESVAAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2395.2395.2.dta 2 IPI00552689.1 Vimentin 308 20138 9 9 7 7 2530 2623 1 0 1 544.77 1087.5254 2 1087.5258 -0.0004 0 78.05 2.40E-07 R QDVDNASLAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2917.2917.2.dta 2 IPI00552689.1 Vimentin 308 20138 9 9 7 7 4172 5304 1 0 1 655.306 1308.5974 2 1308.5986 -0.0012 0 55.42 6.40E-06 K NLQEAEEWYK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5837.5837.2.dta 2 IPI00552689.1 Vimentin 308 20138 9 9 7 7 4774 3245 1 0 1 697.3567 1392.6989 2 1392.6997 -0.0008 1 59.01 5.20E-06 R DVRQQYESVAAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3610.3610.2.dta 2 IPI00552689.1 Vimentin 308 20138 9 9 7 7 4775 3242 1 0 1 465.2404 1392.6992 3 1392.6997 -0.0005 1 28.52 0.0023 R DVRQQYESVAAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3607.3607.3.dta 2 IPI00552689.1 Vimentin 308 20138 9 9 7 7 5570 4764 1 0 1 508.916 1523.7262 3 1523.7256 0.0006 1 27.97 0.014 K NLQEAEEWYKSK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5272.5272.3.dta 2 IPI00552689.1 Vimentin 308 20138 9 9 7 7 5618 6496 1 0 1 767.4293 1532.844 2 1532.845 -0.001 1 101.72 4.10E-10 R KVESLQEEIAFLK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7028.7028.2.dta 2 IPI00552689.1 Vimentin 308 20138 9 9 7 7 6999 4232 1 0 1 888.9341 1775.8537 2 1775.855 -0.0013 1 25.34 0.0085 K FADLSEAANRNNDALR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4695.4695.2.dta 2 IPI00552689.1 Vimentin 308 20138 9 9 7 7 7000 4214 1 0 1 592.9588 1775.8546 3 1775.855 -0.0005 1 40.19 0.00029 K FADLSEAANRNNDALR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4676.4676.3.dta 2 IPI00017870.1 Keratin-8-like protein 1 256 55459 8 8 7 7 852 5033 1 0 0 414.2184 826.4222 2 826.4225 -0.0003 0 43.07 0.00095 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5562.5562.2.dta 2 IPI00017870.1 Keratin-8-like protein 1 256 55459 8 8 7 7 1481 2599 1 0 0 466.7373 931.4601 2 931.461 -0.0009 0 46.71 9.60E-05 K LLEGEESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2891.2891.2.dta 2 IPI00017870.1 Keratin-8-like protein 1 256 55459 8 8 7 7 2111 5571 1 0 1 515.7875 1029.5605 2 1029.5607 -0.0002 0 28.08 0.033 K WSLLQQQK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6106.6106.2.dta 2 IPI00017870.1 Keratin-8-like protein 1 256 55459 8 8 7 7 2331 2297 1 0 0 530.7852 1059.5559 2 1059.556 -0.0001 1 59.23 3.30E-05 R KLLEGEESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2564.2564.2.dta 2 IPI00017870.1 Keratin-8-like protein 1 256 55459 8 8 7 7 2806 5451 1 0 1 565.3131 1128.6117 2 1128.6138 -0.0022 0 83.09 1.20E-07 K LSELEAALQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5988.5988.2.dta 2 IPI00017870.1 Keratin-8-like protein 1 256 55459 8 8 7 7 3375 2409 1 0 1 604.7979 1207.5813 2 1207.5867 -0.0054 1 45.44 0.0002 R TKTEISEMNR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2685.2685.2.dta 2 IPI00017870.1 Keratin-8-like protein 1 256 55459 8 8 7 7 3376 2410 1 0 1 403.5355 1207.5846 3 1207.5867 -0.002 1 37.49 0.0014 R TKTEISEMNR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2686.2686.3.dta 2 IPI00017870.1 Keratin-8-like protein 1 256 55459 8 8 7 7 4812 5428 1 0 0 699.373 1396.7315 2 1396.735 -0.0035 1 79.35 2.00E-07 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5963.5963.2.dta 2 IPI00297795.3 Keratin type II cuticular Hb3 255 56004 11 11 11 11 512 2491 1 0 1 378.1794 754.3443 2 754.3432 0.0011 0 25.15 0.025 R GISCYR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2774.2774.2.dta 2 IPI00297795.3 Keratin type II cuticular Hb3 255 56004 11 11 11 11 776 5074 1 0 1 406.2207 810.4269 2 810.4276 -0.0007 0 23.91 0.028 R FAAFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5604.5604.2.dta 2 IPI00297795.3 Keratin type II cuticular Hb3 255 56004 11 11 11 11 1085 1027 1 0 1 434.7407 867.4668 2 867.4675 -0.0007 1 30.79 0.011 R HGETLRR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1186.1186.2.dta 2 IPI00297795.3 Keratin type II cuticular Hb3 255 56004 11 11 11 11 1750 2456 1 0 1 487.7605 973.5065 2 973.508 -0.0015 0 51.7 2.50E-05 R LTAEVENAK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2736.2736.2.dta 2 IPI00297795.3 Keratin type II cuticular Hb3 255 56004 11 11 11 11 1992 4106 1 0 1 506.2316 1010.4486 2 1010.4491 -0.0005 0 33.25 0.00076 K DVDCAYLR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4559.4559.2.dta 2 IPI00297795.3 Keratin type II cuticular Hb3 255 56004 11 11 11 11 2373 4897 1 0 1 533.8062 1065.5978 2 1065.5971 0.0006 1 60 6.20E-06 R FAAFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5416.5416.2.dta 2 IPI00297795.3 Keratin type II cuticular Hb3 255 56004 11 11 11 11 2678 3509 1 0 1 556.2548 1110.495 2 1110.495 -0.0001 0 36.5 0.0019 R CCITAAPYR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3905.3905.2.dta 2 IPI00297795.3 Keratin type II cuticular Hb3 255 56004 11 11 11 11 3657 2714 1 0 1 623.3237 1244.6329 2 1244.636 -0.0031 1 50.59 0.00011 R TKEEINELNR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3016.3016.2.dta 2 IPI00297795.3 Keratin type II cuticular Hb3 255 56004 11 11 11 11 3722 3555 1 0 1 627.7958 1253.577 2 1253.5789 -0.0019 1 36.36 0.00039 R SRAEAESWYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3957.3957.2.dta 2 IPI00297795.3 Keratin type II cuticular Hb3 255 56004 11 11 11 11 4268 4111 1 0 1 660.8641 1319.7137 2 1319.7085 0.0052 1 68.74 1.40E-06 R ATAENEFVALKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4564.4564.2.dta 2 IPI00297795.3 Keratin type II cuticular Hb3 255 56004 11 11 11 11 5412 4419 1 0 0 497.6116 1489.8129 3 1489.814 -0.0011 1 35.96 0.00044 R FLEQQNKLLETK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4898.4898.3.dta 2 IPI00182655.7 Keratin type II cuticular Hb6 252 55292 11 11 11 11 512 2491 1 0 1 378.1794 754.3443 2 754.3432 0.0011 0 25.15 0.025 R GISCYR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2774.2774.2.dta 2 IPI00182655.7 Keratin type II cuticular Hb6 252 55292 11 11 11 11 776 5074 1 0 1 406.2207 810.4269 2 810.4276 -0.0007 0 23.91 0.028 R FAAFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5604.5604.2.dta 2 IPI00182655.7 Keratin type II cuticular Hb6 252 55292 11 11 11 11 1085 1027 1 0 1 434.7407 867.4668 2 867.4675 -0.0007 1 30.79 0.011 R HGETLRR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1186.1186.2.dta 2 IPI00182655.7 Keratin type II cuticular Hb6 252 55292 11 11 11 11 1709 4147 1 0 1 484.7508 967.4871 2 967.4875 -0.0005 0 32.84 0.002 K LQFYQNR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4603.4603.2.dta 2 IPI00182655.7 Keratin type II cuticular Hb6 252 55292 11 11 11 11 1750 2456 1 0 1 487.7605 973.5065 2 973.508 -0.0015 0 51.7 2.50E-05 R LTAEVENAK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2736.2736.2.dta 2 IPI00182655.7 Keratin type II cuticular Hb6 252 55292 11 11 11 11 2373 4897 1 0 1 533.8062 1065.5978 2 1065.5971 0.0006 1 60 6.20E-06 R FAAFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5416.5416.2.dta 2 IPI00182655.7 Keratin type II cuticular Hb6 252 55292 11 11 11 11 2678 3509 1 0 1 556.2548 1110.495 2 1110.495 -0.0001 0 36.5 0.0019 R CCITAAPYR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3905.3905.2.dta 2 IPI00182655.7 Keratin type II cuticular Hb6 252 55292 11 11 11 11 3657 2714 1 0 1 623.3237 1244.6329 2 1244.636 -0.0031 1 50.59 0.00011 R TKEEINELNR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3016.3016.2.dta 2 IPI00182655.7 Keratin type II cuticular Hb6 252 55292 11 11 11 11 3722 3555 1 0 1 627.7958 1253.577 2 1253.5789 -0.0019 1 36.36 0.00039 R SRAEAESWYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3957.3957.2.dta 2 IPI00182655.7 Keratin type II cuticular Hb6 252 55292 11 11 11 11 4268 4111 1 0 1 660.8641 1319.7137 2 1319.7085 0.0052 1 68.74 1.40E-06 R ATAENEFVALKK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4564.4564.2.dta 2 IPI00182655.7 Keratin type II cuticular Hb6 252 55292 11 11 11 11 5412 4419 1 0 0 497.6116 1489.8129 3 1489.814 -0.0011 1 35.96 0.00044 R FLEQQNKLLETK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4898.4898.3.dta 2 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 238 47891 6 6 6 6 143 1142 1 0 1 322.2292 642.4438 2 642.4428 0.001 1 33.44 0.0012 R AVVVKK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1310.1310.2.dta 2 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 238 47891 6 6 6 6 2111 5571 1 0 1 515.7875 1029.5605 2 1029.5607 -0.0002 0 28.08 0.033 K WSLLQQQK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6106.6106.2.dta 2 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 238 47891 6 6 6 6 2806 5451 1 0 1 565.3131 1128.6117 2 1128.6138 -0.0022 0 83.09 1.20E-07 K LSELEAALQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5988.5988.2.dta 2 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 238 47891 6 6 6 6 4263 7226 1 0 1 660.8396 1319.6646 2 1319.6642 0.0004 0 78.62 1.50E-07 R SLDMDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7781.7781.2.dta 2 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 238 47891 6 6 6 6 4401 5860 1 0 1 672.8409 1343.6672 2 1343.6681 -0.0008 0 67.72 2.30E-06 R ASLEAAIADAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6396.6396.2.dta 2 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 238 47891 6 6 6 6 4947 7372 1 0 1 710.3767 1418.7389 2 1418.7405 -0.0017 0 56.81 5.20E-06 R LEGLTDEINFLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7951.7951.2.dta 2 IPI00787392.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 1" 235 30826 5 5 5 5 143 1142 1 0 1 322.2292 642.4438 2 642.4428 0.001 1 33.44 0.0012 R AVVVKK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1310.1310.2.dta 2 IPI00787392.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 1" 235 30826 5 5 5 5 2806 5451 1 0 1 565.3131 1128.6117 2 1128.6138 -0.0022 0 83.09 1.20E-07 K LSELEAALQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5988.5988.2.dta 2 IPI00787392.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 1" 235 30826 5 5 5 5 4263 7226 1 0 1 660.8396 1319.6646 2 1319.6642 0.0004 0 78.62 1.50E-07 R SLDMDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7781.7781.2.dta 2 IPI00787392.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 1" 235 30826 5 5 5 5 4401 5860 1 0 1 672.8409 1343.6672 2 1343.6681 -0.0008 0 67.72 2.30E-06 R ASLEAAIADAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6396.6396.2.dta 2 IPI00787392.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 1" 235 30826 5 5 5 5 4947 7372 1 0 1 710.3767 1418.7389 2 1418.7405 -0.0017 0 56.81 5.20E-06 R LEGLTDEINFLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7951.7951.2.dta 2 IPI00008359.1 "Keratin, type II cytoskeletal 2 oral" 228 66400 10 10 8 8 852 5033 1 0 0 414.2184 826.4222 2 826.4225 -0.0003 0 43.07 0.00095 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5562.5562.2.dta 2 IPI00008359.1 "Keratin, type II cytoskeletal 2 oral" 228 66400 10 10 8 8 1929 1211 1 0 0 501.2715 1000.5285 2 1000.5301 -0.0016 1 31.32 0.024 K AQEREQIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1385.1385.2.dta 2 IPI00008359.1 "Keratin, type II cytoskeletal 2 oral" 228 66400 10 10 8 8 1957 2780 1 0 0 503.2367 1004.4588 2 1004.4597 -0.0009 0 47.92 6.00E-05 K LLEGEECR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3088.3088.2.dta 2 IPI00008359.1 "Keratin, type II cytoskeletal 2 oral" 228 66400 10 10 8 8 2497 4962 1 0 0 541.8034 1081.5923 2 1081.592 0.0002 1 43.79 0.00057 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5487.5487.2.dta 2 IPI00008359.1 "Keratin, type II cytoskeletal 2 oral" 228 66400 10 10 8 8 2498 4957 1 0 0 361.5381 1081.5923 3 1081.592 0.0003 1 26.79 0.0059 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5482.5482.3.dta 2 IPI00008359.1 "Keratin, type II cytoskeletal 2 oral" 228 66400 10 10 8 8 2829 2446 1 0 0 567.2835 1132.5525 2 1132.5546 -0.0022 1 43.44 0.00048 R KLLEGEECR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2725.2725.2.dta 2 IPI00008359.1 "Keratin, type II cytoskeletal 2 oral" 228 66400 10 10 8 8 2830 2447 1 0 0 378.5255 1132.5546 3 1132.5546 0 1 44.5 0.00029 R KLLEGEECR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2726.2726.3.dta 2 IPI00008359.1 "Keratin, type II cytoskeletal 2 oral" 228 66400 10 10 8 8 4812 5428 1 0 0 699.373 1396.7315 2 1396.735 -0.0035 1 79.35 2.00E-07 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5963.5963.2.dta 2 IPI00008359.1 "Keratin, type II cytoskeletal 2 oral" 228 66400 10 10 8 8 5348 3807 1 0 0 492.9392 1475.7958 3 1475.7984 -0.0026 1 18.54 0.018 R FLEQQNKVLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4235.4235.3.dta 2 IPI00008359.1 "Keratin, type II cytoskeletal 2 oral" 228 66400 10 10 8 8 5540 5562 1 0 1 507.9409 1520.8007 3 1520.8021 -0.0013 1 41.28 0.00023 R LLRDYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6097.6097.3.dta 2 IPI00792642.1 25 kDa protein 223 24809 7 7 6 6 852 5033 1 0 0 414.2184 826.4222 2 826.4225 -0.0003 0 43.07 0.00095 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5562.5562.2.dta 2 IPI00792642.1 25 kDa protein 223 24809 7 7 6 6 2111 5571 1 0 1 515.7875 1029.5605 2 1029.5607 -0.0002 0 28.08 0.033 K WSLLQQQK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6106.6106.2.dta 2 IPI00792642.1 25 kDa protein 223 24809 7 7 6 6 2497 4962 1 0 0 541.8034 1081.5923 2 1081.592 0.0002 1 43.79 0.00057 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5487.5487.2.dta 2 IPI00792642.1 25 kDa protein 223 24809 7 7 6 6 2498 4957 1 0 0 361.5381 1081.5923 3 1081.592 0.0003 1 26.79 0.0059 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5482.5482.3.dta 2 IPI00792642.1 25 kDa protein 223 24809 7 7 6 6 4263 7226 1 0 1 660.8396 1319.6646 2 1319.6642 0.0004 0 78.62 1.50E-07 R SLDMDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7781.7781.2.dta 2 IPI00792642.1 25 kDa protein 223 24809 7 7 6 6 4812 5428 1 0 0 699.373 1396.7315 2 1396.735 -0.0035 1 79.35 2.00E-07 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5963.5963.2.dta 2 IPI00792642.1 25 kDa protein 223 24809 7 7 6 6 4947 7372 1 0 1 710.3767 1418.7389 2 1418.7405 -0.0017 0 56.81 5.20E-06 R LEGLTDEINFLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7951.7951.2.dta 2 IPI00795725.1 17 kDa protein 202 16798 5 5 4 4 3375 2409 1 0 1 604.7979 1207.5813 2 1207.5867 -0.0054 1 45.44 0.0002 R TKTEISEMNR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2685.2685.2.dta 2 IPI00795725.1 17 kDa protein 202 16798 5 5 4 4 3376 2410 1 0 1 403.5355 1207.5846 3 1207.5867 -0.002 1 37.49 0.0014 R TKTEISEMNR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2686.2686.3.dta 2 IPI00795725.1 17 kDa protein 202 16798 5 5 4 4 4263 7226 1 0 1 660.8396 1319.6646 2 1319.6642 0.0004 0 78.62 1.50E-07 R SLDMDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7781.7781.2.dta 2 IPI00795725.1 17 kDa protein 202 16798 5 5 4 4 4401 5860 1 0 1 672.8409 1343.6672 2 1343.6681 -0.0008 0 67.72 2.30E-06 R ASLEAAIADAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6396.6396.2.dta 2 IPI00795725.1 17 kDa protein 202 16798 5 5 4 4 4947 7372 1 0 1 710.3767 1418.7389 2 1418.7405 -0.0017 0 56.81 5.20E-06 R LEGLTDEINFLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7951.7951.2.dta 2 IPI00241841.8 keratin 6L 200 58085 7 7 6 6 852 5033 1 0 0 414.2184 826.4222 2 826.4225 -0.0003 0 43.07 0.00095 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5562.5562.2.dta 2 IPI00241841.8 keratin 6L 200 58085 7 7 6 6 2497 4962 1 0 0 541.8034 1081.5923 2 1081.592 0.0002 1 43.79 0.00057 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5487.5487.2.dta 2 IPI00241841.8 keratin 6L 200 58085 7 7 6 6 2498 4957 1 0 0 361.5381 1081.5923 3 1081.592 0.0003 1 26.79 0.0059 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5482.5482.3.dta 2 IPI00241841.8 keratin 6L 200 58085 7 7 6 6 4318 7767 1 0 0 665.3672 1328.7198 2 1328.7187 0.0011 0 72.49 8.10E-07 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8392.8392.2.dta 2 IPI00241841.8 keratin 6L 200 58085 7 7 6 6 4812 5428 1 0 0 699.373 1396.7315 2 1396.735 -0.0035 1 79.35 2.00E-07 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5963.5963.2.dta 2 IPI00241841.8 keratin 6L 200 58085 7 7 6 6 5348 3807 1 0 0 492.9392 1475.7958 3 1475.7984 -0.0026 1 18.54 0.018 R FLEQQNKVLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4235.4235.3.dta 2 IPI00241841.8 keratin 6L 200 58085 7 7 6 6 5540 5562 1 0 1 507.9409 1520.8007 3 1520.8021 -0.0013 1 41.28 0.00023 R LLRDYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6097.6097.3.dta 2 IPI00796330.1 18 kDa protein 194 18135 5 5 5 5 2030 4202 1 0 0 508.7719 1015.5292 2 1015.5298 -0.0006 0 45.63 0.00066 R QLDSIVGER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4663.4663.2.dta 2 IPI00796330.1 18 kDa protein 194 18135 5 5 5 5 2644 3086 1 0 0 554.2732 1106.5318 2 1106.5356 -0.0038 0 62.92 1.10E-05 K AQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3422.3422.2.dta 2 IPI00796330.1 18 kDa protein 194 18135 5 5 5 5 4318 7767 1 0 0 665.3672 1328.7198 2 1328.7187 0.0011 0 72.49 8.10E-07 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8392.8392.2.dta 2 IPI00796330.1 18 kDa protein 194 18135 5 5 5 5 4456 4049 1 0 0 675.8659 1349.7173 2 1349.7191 -0.0018 1 29.25 0.0032 R TAAENEFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4497.4497.2.dta 2 IPI00796330.1 18 kDa protein 194 18135 5 5 5 5 4872 7190 1 0 0 704.3596 1406.7046 2 1406.7041 0.0004 0 78.42 2.30E-07 K ADTLTDEINFLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7743.7743.2.dta 2 IPI00032541.1 Keratin type II cuticular Hb5 185 57306 8 8 8 8 776 5074 1 0 1 406.2207 810.4269 2 810.4276 -0.0007 0 23.91 0.028 R FAAFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5604.5604.2.dta 2 IPI00032541.1 Keratin type II cuticular Hb5 185 57306 8 8 8 8 1085 1027 1 0 1 434.7407 867.4668 2 867.4675 -0.0007 1 30.79 0.011 R HGETLRR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1186.1186.2.dta 2 IPI00032541.1 Keratin type II cuticular Hb5 185 57306 8 8 8 8 1992 4106 1 0 1 506.2316 1010.4486 2 1010.4491 -0.0005 0 33.25 0.00076 K DVDCAYLR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4559.4559.2.dta 2 IPI00032541.1 Keratin type II cuticular Hb5 185 57306 8 8 8 8 2373 4897 1 0 1 533.8062 1065.5978 2 1065.5971 0.0006 1 60 6.20E-06 R FAAFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5416.5416.2.dta 2 IPI00032541.1 Keratin type II cuticular Hb5 185 57306 8 8 8 8 3657 2714 1 0 1 623.3237 1244.6329 2 1244.636 -0.0031 1 50.59 0.00011 R TKEEINELNR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3016.3016.2.dta 2 IPI00032541.1 Keratin type II cuticular Hb5 185 57306 8 8 8 8 3722 3555 1 0 1 627.7958 1253.577 2 1253.5789 -0.0019 1 36.36 0.00039 R SRAEAESWYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3957.3957.2.dta 2 IPI00032541.1 Keratin type II cuticular Hb5 185 57306 8 8 8 8 4442 4501 1 0 1 450.2537 1347.7392 3 1347.7398 -0.0005 1 49.45 9.50E-05 R ATAENEFVVLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4987.4987.3.dta 2 IPI00032541.1 Keratin type II cuticular Hb5 185 57306 8 8 8 8 5412 4419 1 0 0 497.6116 1489.8129 3 1489.814 -0.0011 1 35.96 0.00044 R FLEQQNKLLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4898.4898.3.dta 2 IPI00791341.1 20 kDa protein 176 19686 7 7 5 5 852 5033 1 0 0 414.2184 826.4222 2 826.4225 -0.0003 0 43.07 0.00095 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5562.5562.2.dta 2 IPI00791341.1 20 kDa protein 176 19686 7 7 5 5 1094 2895 1 0 1 435.7197 869.4248 2 869.4243 0.0005 0 51.58 0.0001 R ISSSSFSR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3214.3214.2.dta 2 IPI00791341.1 20 kDa protein 176 19686 7 7 5 5 1095 2875 1 0 1 435.7198 869.4251 2 869.4243 0.0009 0 45 0.00046 R ISSSSFSR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3191.3191.2.dta 2 IPI00791341.1 20 kDa protein 176 19686 7 7 5 5 2111 5571 1 0 1 515.7875 1029.5605 2 1029.5607 -0.0002 0 28.08 0.033 K WSLLQQQK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6106.6106.2.dta 2 IPI00791341.1 20 kDa protein 176 19686 7 7 5 5 2497 4962 1 0 0 541.8034 1081.5923 2 1081.592 0.0002 1 43.79 0.00057 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5487.5487.2.dta 2 IPI00791341.1 20 kDa protein 176 19686 7 7 5 5 2498 4957 1 0 0 361.5381 1081.5923 3 1081.592 0.0003 1 26.79 0.0059 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5482.5482.3.dta 2 IPI00791341.1 20 kDa protein 176 19686 7 7 5 5 4812 5428 1 0 0 699.373 1396.7315 2 1396.735 -0.0035 1 79.35 2.00E-07 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5963.5963.2.dta 2 IPI00008669.2 38 kDa protein 173 39031 6 6 6 6 1085 1027 1 0 1 434.7407 867.4668 2 867.4675 -0.0007 1 30.79 0.011 R HGETLRR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1186.1186.2.dta 2 IPI00008669.2 38 kDa protein 173 39031 6 6 6 6 1750 2456 1 0 1 487.7605 973.5065 2 973.508 -0.0015 0 51.7 2.50E-05 R LTAEVENAK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2736.2736.2.dta 2 IPI00008669.2 38 kDa protein 173 39031 6 6 6 6 1992 4106 1 0 1 506.2316 1010.4486 2 1010.4491 -0.0005 0 33.25 0.00076 K DVDCAYLR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4559.4559.2.dta 2 IPI00008669.2 38 kDa protein 173 39031 6 6 6 6 3657 2714 1 0 1 623.3237 1244.6329 2 1244.636 -0.0031 1 50.59 0.00011 R TKEEINELNR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3016.3016.2.dta 2 IPI00008669.2 38 kDa protein 173 39031 6 6 6 6 3722 3555 1 0 1 627.7958 1253.577 2 1253.5789 -0.0019 1 36.36 0.00039 R SRAEAESWYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3957.3957.2.dta 2 IPI00008669.2 38 kDa protein 173 39031 6 6 6 6 4268 4111 1 0 1 660.8641 1319.7137 2 1319.7085 0.0052 1 68.74 1.40E-06 R ATAENEFVALKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4564.4564.2.dta 2 IPI00791653.1 8 kDa protein 171 7516 2 2 2 2 623 2036 1 0 1 390.1935 778.3724 2 778.3722 0.0002 0 50.49 2.10E-05 K AAFGGSGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2279.2279.2.dta 2 IPI00791653.1 8 kDa protein 171 7516 2 2 2 2 6834 2039 1 0 1 870.8564 1739.6983 2 1739.6983 0 0 134.75 3.30E-14 R GSSSGGGYSSGSSSYGSGGR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2282.2282.2.dta 2 IPI00290857.2 "Keratin, type II cytoskeletal 3" 167 64636 8 8 7 7 852 5033 1 0 0 414.2184 826.4222 2 826.4225 -0.0003 0 43.07 0.00095 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5562.5562.2.dta 2 IPI00290857.2 "Keratin, type II cytoskeletal 3" 167 64636 8 8 7 7 1929 1211 1 0 0 501.2715 1000.5285 2 1000.5301 -0.0016 1 31.32 0.024 K AQEREQIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1385.1385.2.dta 2 IPI00290857.2 "Keratin, type II cytoskeletal 3" 167 64636 8 8 7 7 2497 4962 1 0 0 541.8034 1081.5923 2 1081.592 0.0002 1 43.79 0.00057 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5487.5487.2.dta 2 IPI00290857.2 "Keratin, type II cytoskeletal 3" 167 64636 8 8 7 7 2498 4957 1 0 0 361.5381 1081.5923 3 1081.592 0.0003 1 26.79 0.0059 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5482.5482.3.dta 2 IPI00290857.2 "Keratin, type II cytoskeletal 3" 167 64636 8 8 7 7 4456 4049 1 0 0 675.8659 1349.7173 2 1349.7191 -0.0018 1 29.25 0.0032 R TAAENEFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4497.4497.2.dta 2 IPI00290857.2 "Keratin, type II cytoskeletal 3" 167 64636 8 8 7 7 4812 5428 1 0 0 699.373 1396.7315 2 1396.735 -0.0035 1 79.35 2.00E-07 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5963.5963.2.dta 2 IPI00290857.2 "Keratin, type II cytoskeletal 3" 167 64636 8 8 7 7 5348 3807 1 0 0 492.9392 1475.7958 3 1475.7984 -0.0026 1 18.54 0.018 R FLEQQNKVLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4235.4235.3.dta 2 IPI00290857.2 "Keratin, type II cytoskeletal 3" 167 64636 8 8 7 7 5540 5562 1 0 1 507.9409 1520.8007 3 1520.8021 -0.0013 1 41.28 0.00023 R LLRDYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6097.6097.3.dta 2 IPI00174775.2 Keratin 6 irs3 164 59457 8 8 6 6 852 5033 1 0 0 414.2184 826.4222 2 826.4225 -0.0003 0 43.07 0.00095 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5562.5562.2.dta 2 IPI00174775.2 Keratin 6 irs3 164 59457 8 8 6 6 1929 1211 1 0 0 501.2715 1000.5285 2 1000.5301 -0.0016 1 31.32 0.024 R AQEREQIK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1385.1385.2.dta 2 IPI00174775.2 Keratin 6 irs3 164 59457 8 8 6 6 1957 2780 1 0 0 503.2367 1004.4588 2 1004.4597 -0.0009 0 47.92 6.00E-05 K LLEGEECR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3088.3088.2.dta 2 IPI00174775.2 Keratin 6 irs3 164 59457 8 8 6 6 2497 4962 1 0 0 541.8034 1081.5923 2 1081.592 0.0002 1 43.79 0.00057 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5487.5487.2.dta 2 IPI00174775.2 Keratin 6 irs3 164 59457 8 8 6 6 2498 4957 1 0 0 361.5381 1081.5923 3 1081.592 0.0003 1 26.79 0.0059 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5482.5482.3.dta 2 IPI00174775.2 Keratin 6 irs3 164 59457 8 8 6 6 2829 2446 1 0 0 567.2835 1132.5525 2 1132.5546 -0.0022 1 43.44 0.00048 R KLLEGEECR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2725.2725.2.dta 2 IPI00174775.2 Keratin 6 irs3 164 59457 8 8 6 6 2830 2447 1 0 0 378.5255 1132.5546 3 1132.5546 0 1 44.5 0.00029 R KLLEGEECR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2726.2726.3.dta 2 IPI00174775.2 Keratin 6 irs3 164 59457 8 8 6 6 5347 4550 1 0 1 738.8869 1475.7593 2 1475.762 -0.0027 0 43.04 0.001 R FLEQQNQVLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5040.5040.2.dta 2 IPI00465084.6 Desmin 158 53560 4 4 4 4 1481 2599 1 0 0 466.7373 931.4601 2 931.461 -0.0009 0 46.71 9.60E-05 K LLEGEESR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2891.2891.2.dta 2 IPI00465084.6 Desmin 158 53560 4 4 4 4 2331 2297 1 0 0 530.7852 1059.5559 2 1059.556 -0.0001 1 59.23 3.30E-05 R KLLEGEESR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2564.2564.2.dta 2 IPI00465084.6 Desmin 158 53560 4 4 4 4 5588 4735 1 0 0 764.4166 1526.8186 2 1526.8205 -0.0019 1 64.26 5.80E-06 R HLREYQDLLNVK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5240.5240.2.dta 2 IPI00465084.6 Desmin 158 53560 4 4 4 4 5935 3896 1 0 1 794.3985 1586.7824 2 1586.79 -0.0075 1 55.14 1.70E-05 R TNEKVELQELNDR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4331.4331.2.dta 2 IPI00792167.1 9 kDa protein 147 8852 2 2 2 2 3892 7498 1 0 1 636.8559 1271.6972 2 1271.6973 0 0 94.21 6.70E-09 R SLDLDGIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8094.8094.2.dta 2 IPI00792167.1 9 kDa protein 147 8852 2 2 2 2 4939 6981 1 0 1 709.8663 1417.7181 2 1417.7201 -0.002 0 75.48 1.90E-07 K VDALNDEINFLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7516.7516.2.dta 2 IPI00795197.1 24 kDa protein 143 24107 4 4 3 3 1957 2780 1 0 0 503.2367 1004.4588 2 1004.4597 -0.0009 0 47.92 6.00E-05 K LLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3088.3088.2.dta 2 IPI00795197.1 24 kDa protein 143 24107 4 4 3 3 2829 2446 1 0 0 567.2835 1132.5525 2 1132.5546 -0.0022 1 43.44 0.00048 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2725.2725.2.dta 2 IPI00795197.1 24 kDa protein 143 24107 4 4 3 3 2830 2447 1 0 0 378.5255 1132.5546 3 1132.5546 0 1 44.5 0.00029 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2726.2726.3.dta 2 IPI00795197.1 24 kDa protein 143 24107 4 4 3 3 4318 7767 1 0 0 665.3672 1328.7198 2 1328.7187 0.0011 0 72.49 8.10E-07 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8392.8392.2.dta 2 IPI00376379.3 Keratin 77 134 62050 6 6 4 4 852 5033 1 0 0 414.2184 826.4222 2 826.4225 -0.0003 0 43.07 0.00095 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5562.5562.2.dta 2 IPI00376379.3 Keratin 77 134 62050 6 6 4 4 2497 4962 1 0 0 541.8034 1081.5923 2 1081.592 0.0002 1 43.79 0.00057 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5487.5487.2.dta 2 IPI00376379.3 Keratin 77 134 62050 6 6 4 4 2498 4957 1 0 0 361.5381 1081.5923 3 1081.592 0.0003 1 26.79 0.0059 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5482.5482.3.dta 2 IPI00376379.3 Keratin 77 134 62050 6 6 4 4 5343 4328 1 0 0 492.6004 1474.7795 3 1474.778 0.0015 0 37.36 0.003 R FLEQQNQVLQTK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4799.4799.3.dta 2 IPI00376379.3 Keratin 77 134 62050 6 6 4 4 5344 4308 1 0 0 738.3978 1474.781 2 1474.778 0.003 0 76.09 4.70E-07 R FLEQQNQVLQTK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4778.4778.2.dta 2 IPI00376379.3 Keratin 77 134 62050 6 6 4 4 6796 4508 1 0 0 577.6563 1729.9469 3 1729.9475 -0.0006 1 18.76 0.045 K VRFLEQQNQVLQTK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4994.4994.3.dta 2 IPI00655639.1 Hypothetical protein (Fragment) 131 12922 2 2 2 2 3892 7498 1 0 1 636.8559 1271.6972 2 1271.6973 0 0 94.21 6.70E-09 R SLDLDGIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8094.8094.2.dta 2 IPI00655639.1 Hypothetical protein (Fragment) 131 12922 2 2 2 2 5113 3396 1 0 1 721.3904 1440.7662 2 1440.7684 -0.0022 1 59.06 6.10E-06 R LQAEIDNIKNQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3779.3779.2.dta 2 IPI00791554.1 17 kDa protein 129 17100 3 3 3 3 1481 2599 1 0 0 466.7373 931.4601 2 931.461 -0.0009 0 46.71 9.60E-05 K LLEGEESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2891.2891.2.dta 2 IPI00791554.1 17 kDa protein 129 17100 3 3 3 3 2331 2297 1 0 0 530.7852 1059.5559 2 1059.556 -0.0001 1 59.23 3.30E-05 R KLLEGEESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2564.2564.2.dta 2 IPI00791554.1 17 kDa protein 129 17100 3 3 3 3 4705 3975 1 0 1 693.3706 1384.7267 2 1384.731 -0.0043 1 67.55 9.20E-07 R AKQEELEAALQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4417.4417.2.dta 2 IPI00013164.4 Isoform 1 of Peripherin 126 53732 4 4 4 4 1481 2599 1 0 0 466.7373 931.4601 2 931.461 -0.0009 0 46.71 9.60E-05 K LLEGEESR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2891.2891.2.dta 2 IPI00013164.4 Isoform 1 of Peripherin 126 53732 4 4 4 4 2331 2297 1 0 0 530.7852 1059.5559 2 1059.556 -0.0001 1 59.23 3.30E-05 R KLLEGEESR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2564.2564.2.dta 2 IPI00013164.4 Isoform 1 of Peripherin 126 53732 4 4 4 4 4172 5304 1 0 1 655.306 1308.5974 2 1308.5986 -0.0012 0 55.42 6.40E-06 K NLQEAEEWYK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5837.5837.2.dta 2 IPI00013164.4 Isoform 1 of Peripherin 126 53732 4 4 4 4 5570 4764 1 0 1 508.916 1523.7262 3 1523.7256 0.0006 1 27.97 0.014 K NLQEAEEWYKSK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5272.5272.3.dta 2 IPI00794179.1 Desmin 124 32382 3 3 3 3 1481 2599 1 0 0 466.7373 931.4601 2 931.461 -0.0009 0 46.71 9.60E-05 K LLEGEESR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2891.2891.2.dta 2 IPI00794179.1 Desmin 124 32382 3 3 3 3 2331 2297 1 0 0 530.7852 1059.5559 2 1059.556 -0.0001 1 59.23 3.30E-05 R KLLEGEESR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2564.2564.2.dta 2 IPI00794179.1 Desmin 124 32382 3 3 3 3 5588 4735 1 0 0 764.4166 1526.8186 2 1526.8205 -0.0019 1 64.26 5.80E-06 R HLREYQDLLNVK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5240.5240.2.dta 2 IPI00215804.4 "similar to Keratin, type II cytoskeletal 8" 95 23165 2 2 2 2 143 1142 1 0 1 322.2292 642.4438 2 642.4428 0.001 1 33.44 0.0012 R AVVVKK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1310.1310.2.dta 2 IPI00215804.4 "similar to Keratin, type II cytoskeletal 8" 95 23165 2 2 2 2 2806 5451 1 0 1 565.3131 1128.6117 2 1128.6138 -0.0022 0 83.09 1.20E-07 K LSELEAALQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5988.5988.2.dta 2 IPI00021751.5 Neurofilament triplet H protein 94 112640 3 3 2 2 1957 2780 1 0 0 503.2367 1004.4588 2 1004.4597 -0.0009 0 47.92 6.00E-05 K LLEGEECR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3088.3088.2.dta 2 IPI00021751.5 Neurofilament triplet H protein 94 112640 3 3 2 2 2829 2446 1 0 0 567.2835 1132.5525 2 1132.5546 -0.0022 1 43.44 0.00048 R KLLEGEECR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2725.2725.2.dta 2 IPI00021751.5 Neurofilament triplet H protein 94 112640 3 3 2 2 2830 2447 1 0 0 378.5255 1132.5546 3 1132.5546 0 1 44.5 0.00029 R KLLEGEECR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2726.2726.3.dta 2 IPI00061200.3 Keratin-71 92 57769 5 5 4 4 852 5033 1 0 0 414.2184 826.4222 2 826.4225 -0.0003 0 43.07 0.00095 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5562.5562.2.dta 2 IPI00061200.3 Keratin-71 92 57769 5 5 4 4 1929 1211 1 0 0 501.2715 1000.5285 2 1000.5301 -0.0016 1 31.32 0.024 R AQEREQIK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1385.1385.2.dta 2 IPI00061200.3 Keratin-71 92 57769 5 5 4 4 2497 4962 1 0 0 541.8034 1081.5923 2 1081.592 0.0002 1 43.79 0.00057 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5487.5487.2.dta 2 IPI00061200.3 Keratin-71 92 57769 5 5 4 4 2498 4957 1 0 0 361.5381 1081.5923 3 1081.592 0.0003 1 26.79 0.0059 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5482.5482.3.dta 2 IPI00061200.3 Keratin-71 92 57769 5 5 4 4 5347 4550 1 0 1 738.8869 1475.7593 2 1475.762 -0.0027 0 43.04 0.001 R FLEQQNQVLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5040.5040.2.dta 2 IPI00738902.1 "similar to keratin, hair, basic, 6" 90 22583 3 3 3 3 1085 1027 1 0 1 434.7407 867.4668 2 867.4675 -0.0007 1 30.79 0.011 R HGETLRR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1186.1186.2.dta 2 IPI00738902.1 "similar to keratin, hair, basic, 6" 90 22583 3 3 3 3 1750 2456 1 0 1 487.7605 973.5065 2 973.508 -0.0015 0 51.7 2.50E-05 R LTAEVENAK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2736.2736.2.dta 2 IPI00738902.1 "similar to keratin, hair, basic, 6" 90 22583 3 3 3 3 3657 2714 1 0 1 623.3237 1244.6329 2 1244.636 -0.0031 1 50.59 0.00011 R TKEEINELNR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3016.3016.2.dta 2 IPI00290078.5 keratin 4 80 64442 2 2 2 2 852 5033 1 0 0 414.2184 826.4222 2 826.4225 -0.0003 0 43.07 0.00095 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5562.5562.2.dta 2 IPI00290078.5 keratin 4 80 64442 2 2 2 2 2644 3086 1 0 0 554.2732 1106.5318 2 1106.5356 -0.0038 0 62.92 1.10E-05 R AQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3422.3422.2.dta 2 IPI00793572.1 6 kDa protein 75 6322 1 1 1 1 4939 6981 1 0 1 709.8663 1417.7181 2 1417.7201 -0.002 0 75.48 1.90E-07 K VDALNDEINFLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7516.7516.2.dta 2 IPI00793778.1 Keratin 72 10027 1 1 1 1 4318 7767 1 0 0 665.3672 1328.7198 2 1328.7187 0.0011 0 72.49 8.10E-07 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8392.8392.2.dta 2 IPI00217507.5 Neurofilament triplet M protein 64 102444 1 1 1 1 5588 4735 1 0 0 764.4166 1526.8186 2 1526.8205 -0.0019 1 64.26 5.80E-06 R HLREYQDLLNVK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5240.5240.2.dta 2 IPI00793202.1 14 kDa protein 64 14435 2 2 2 2 2111 5571 1 0 1 515.7875 1029.5605 2 1029.5607 -0.0002 0 28.08 0.033 K WSLLQQQK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6106.6106.2.dta 2 IPI00793202.1 14 kDa protein 64 14435 2 2 2 2 4947 7372 1 0 1 710.3767 1418.7389 2 1418.7405 -0.0017 0 56.81 5.20E-06 R LEGLTDEINFLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7951.7951.2.dta 2 IPI00797452.1 33 kDa protein 63 33577 1 1 1 1 2644 3086 1 0 0 554.2732 1106.5318 2 1106.5356 -0.0038 0 62.92 1.10E-05 R AQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3422.3422.2.dta 2 IPI00465166.2 "ATPase, aminophospholipid transporter-like, Class I, type 8A, member 2" 49 134996 2 2 2 2 313 2405 2 0 1 351.2006 700.3867 2 700.3868 -0.0001 0 49.49 0.00029 R SSVGPVR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2681.2681.2.dta 2 IPI00465166.2 "ATPase, aminophospholipid transporter-like, Class I, type 8A, member 2" 49 134996 2 2 2 2 1724 2585 1 0 1 485.7926 969.5707 2 969.572 -0.0013 1 24.31 0.034 R IRSSVGPVR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2876.2876.2.dta 3 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 1884 62320 59 59 27 27 186 1015 1 1 0 330.2079 658.4013 2 658.4013 0 1 37.95 0.0037 K KAALEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1173.1173.2.dta 3 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 1884 62320 59 59 27 27 761 3600 1 1 0 405.2239 808.4332 2 808.433 0.0002 0 36.78 0.0022 R LASYLDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4007.4007.2.dta 3 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 1884 62320 59 59 27 27 781 1290 1 1 1 406.7531 811.4917 2 811.4916 0.0001 1 56.78 1.80E-05 K KGPAAIQK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1470.1470.2.dta 3 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 1884 62320 59 59 27 27 1243 5479 1 1 1 449.2104 896.4062 2 896.4062 0 0 37.61 0.0003 R MTLDDFR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6015.6015.2.dta 3 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 1884 62320 59 59 27 27 1357 4200 1 1 1 457.2076 912.4007 2 912.4011 -0.0004 0 29.34 0.007 R MTLDDFR I Oxidation (M) 0.1000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4661.4661.2.dta 3 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 1884 62320 59 59 27 27 1701 4325 1 1 1 484.2302 966.4458 2 966.4447 0.0011 0 28.27 0.016 K IQDWYDK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4796.4796.2.dta 3 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 1884 62320 59 59 27 27 2333 5195 1 1 1 530.7858 1059.5571 2 1059.556 0.0011 0 52.12 0.00016 K TLLDIDNTR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5727.5727.2.dta 3 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 1884 62320 59 59 27 27 2359 3463 1 1 1 533.2526 1064.4907 2 1064.492 -0.0013 0 40.63 0.00057 K STMQELNSR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3852.3852.2.dta 3 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 1884 62320 59 59 27 27 2362 2872 1 1 1 533.2582 1064.5018 2 1064.492 0.0098 0 46.31 0.00027 K STMQELNSR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3188.3188.2.dta 3 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 1884 62320 59 59 27 27 2368 4381 1 1 1 533.7526 1065.4906 2 1065.4913 -0.0007 0 31.56 0.0017 K FEMEQNLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4857.4857.2.dta 3 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 1884 62320 59 59 27 27 2420 4201 1 1 1 537.764 1073.5135 2 1073.5142 -0.0006 0 52.78 8.40E-05 R QFSSSYLSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4662.4662.2.dta 3 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 1884 62320 59 59 27 27 2483 1762 1 1 1 541.2496 1080.4846 2 1080.487 -0.0024 0 56.95 2.10E-05 K STMQELNSR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1981.1981.2.dta 3 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 1884 62320 59 59 27 27 2492 2900 1 1 1 541.7482 1081.4818 2 1081.4862 -0.0044 0 44.63 0.00013 K FEMEQNLR Q Oxidation (M) 0.00100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3219.3219.2.dta 3 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 1884 62320 59 59 27 27 2575 3527 1 1 1 548.2764 1094.5382 2 1094.5396 -0.0015 1 25.95 0.039 K IQDWYDKK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3925.3925.2.dta 3 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 1884 62320 59 59 27 27 2576 3508 1 1 1 365.8547 1094.5424 3 1094.5396 0.0027 1 23.06 0.016 K IQDWYDKK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3904.3904.3.dta 3 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 1884 62320 59 59 27 27 2746 4309 1 1 1 561.2961 1120.5777 2 1120.5764 0.0013 0 59.23 2.60E-05 R QEYEQLIAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4779.4779.2.dta 3 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 1884 62320 59 59 27 27 2998 4380 1 1 1 579.2988 1156.5831 2 1156.5836 -0.0005 0 83.21 1.60E-08 R QGVDADINGLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4856.4856.2.dta 3 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 1884 62320 59 59 27 27 3200 4934 1 1 1 595.8104 1189.6062 2 1189.6013 0.0049 0 45.71 0.00023 R QVLDNLTMEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5457.5457.2.dta 3 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 1884 62320 59 59 27 27 3366 4294 1 1 1 603.8052 1205.5958 2 1205.5962 -0.0004 0 47.35 8.90E-05 R QVLDNLTMEK S Oxidation (M) 0.0000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4762.4762.2.dta 3 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 1884 62320 59 59 27 27 3524 3022 1 1 1 616.801 1231.5874 2 1231.5906 -0.0032 0 56.28 8.10E-06 R SGGGGGGGLGSGGSIR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3353.3353.2.dta 3 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 1884 62320 59 59 27 27 3525 8769 1 1 1 616.801 1231.5875 2 1231.5906 -0.0031 0 18.61 0.018 R SGGGGGGGLGSGGSIR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.9398.9398.2.dta 3 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 1884 62320 59 59 27 27 3528 3468 1 1 1 616.8014 1231.5882 2 1231.5906 -0.0023 0 49.8 2.10E-05 R SGGGGGGGLGSGGSIR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3857.3857.2.dta 3 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 1884 62320 59 59 27 27 3532 2862 1 1 1 616.8019 1231.5893 2 1231.5906 -0.0012 0 83.5 1.50E-08 R SGGGGGGGLGSGGSIR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3177.3177.2.dta 3 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 1884 62320 59 59 27 27 3533 3367 1 1 1 616.8019 1231.5893 2 1231.5906 -0.0012 0 92.44 3.40E-09 R SGGGGGGGLGSGGSIR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3748.3748.2.dta 3 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 1884 62320 59 59 27 27 3586 2685 1 1 1 618.2665 1234.5185 2 1234.5215 -0.0029 0 80.61 3.70E-08 R FSSSSGYGGGSSR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2985.2985.2.dta 3 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 1884 62320 59 59 27 27 3588 2457 1 1 1 618.2672 1234.5199 2 1234.5215 -0.0016 0 61.61 3.20E-06 R FSSSSGYGGGSSR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2737.2737.2.dta 3 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 1884 62320 59 59 27 27 3589 2166 1 1 1 618.2678 1234.5211 2 1234.5215 -0.0004 0 74.09 1.90E-07 R FSSSSGYGGGSSR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2422.2422.2.dta 3 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 1884 62320 59 59 27 27 3590 2310 1 1 1 618.2679 1234.5212 2 1234.5215 -0.0002 0 55.95 5.70E-06 R FSSSSGYGGGSSR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2578.2578.2.dta 3 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 1884 62320 59 59 27 27 4160 4765 1 1 1 654.3417 1306.6688 2 1306.6703 -0.0015 1 39.56 0.00052 R IKFEMEQNLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5273.5273.2.dta 3 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 1884 62320 59 59 27 27 4277 3588 1 1 1 662.34 1322.6654 2 1322.6652 0.0001 1 42.17 0.0011 R IKFEMEQNLR Q Oxidation (M) 0.0000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3994.3994.2.dta 3 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 1884 62320 59 59 27 27 4278 3576 1 1 1 441.8962 1322.6667 3 1322.6652 0.0015 1 35.77 0.0049 R IKFEMEQNLR Q Oxidation (M) 0.0000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3981.3981.3.dta 3 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 1884 62320 59 59 27 27 4454 2819 1 1 1 450.9006 1349.6801 3 1349.68 0.0001 1 24.57 0.012 K IGLGGRGGSGGSYGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3130.3130.3.dta 3 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 1884 62320 59 59 27 27 5931 4121 1 1 1 793.8867 1585.7589 2 1585.7583 0.0006 0 85.34 1.50E-08 K VQALEEANNDLENK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4575.4575.2.dta 3 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 1884 62320 59 59 27 27 7041 394 1 1 1 896.3661 1790.7176 2 1790.7205 -0.0029 0 19.57 0.018 R GGSGGSYGGGGSGGGYGGGSGSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.10500.10500.2.dta 3 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 1884 62320 59 59 27 27 7042 1976 1 1 1 896.3664 1790.7182 2 1790.7205 -0.0023 0 110.89 1.30E-11 R GGSGGSYGGGGSGGGYGGGSGSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2213.2213.2.dta 3 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 1884 62320 59 59 27 27 7044 2258 1 1 1 896.3671 1790.7196 2 1790.7205 -0.0009 0 106.34 3.80E-11 R GGSGGSYGGGGSGGGYGGGSGSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2521.2521.2.dta 3 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 1884 62320 59 59 27 27 7045 2412 1 1 1 896.3671 1790.7197 2 1790.7205 -0.0008 0 72.8 8.70E-08 R GGSGGSYGGGGSGGGYGGGSGSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2688.2688.2.dta 3 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 1884 62320 59 59 27 27 7046 9055 1 1 1 896.3672 1790.7198 2 1790.7205 -0.0007 0 41.72 0.00011 R GGSGGSYGGGGSGGGYGGGSGSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.9718.9718.2.dta 3 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 1884 62320 59 59 27 27 7049 8501 1 1 1 896.3674 1790.7203 2 1790.7205 -0.0002 0 22.63 0.0071 R GGSGGSYGGGGSGGGYGGGSGSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.9125.9125.2.dta 3 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 1884 62320 59 59 27 27 7051 8630 1 1 1 896.3676 1790.7207 2 1790.7205 0.0002 0 15.93 0.033 R GGSGGSYGGGGSGGGYGGGSGSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.9254.9254.2.dta 3 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 1884 62320 59 59 27 27 7052 260 1 1 1 896.3677 1790.7208 2 1790.7205 0.0003 0 26.16 0.0034 R GGSGGSYGGGGSGGGYGGGSGSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.10325.10325.2.dta 3 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 1884 62320 59 59 27 27 7053 7942 1 1 1 896.3678 1790.721 2 1790.7205 0.0006 0 35.89 0.00036 R GGSGGSYGGGGSGGGYGGGSGSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8572.8572.2.dta 3 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 1884 62320 59 59 27 27 7054 328 1 1 1 896.3679 1790.7212 2 1790.7205 0.0007 0 17.21 0.027 R GGSGGSYGGGGSGGGYGGGSGSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.10414.10414.2.dta 3 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 1884 62320 59 59 27 27 7056 2119 1 1 1 896.3682 1790.7219 2 1790.7205 0.0014 0 106.18 3.60E-11 R GGSGGSYGGGGSGGGYGGGSGSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2370.2370.2.dta 3 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 1884 62320 59 59 27 27 7058 8754 1 1 1 896.3687 1790.7229 2 1790.7205 0.0024 0 21.19 0.011 R GGSGGSYGGGGSGGGYGGGSGSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.9382.9382.2.dta 3 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 1884 62320 59 59 27 27 7059 8241 1 1 1 896.3688 1790.7231 2 1790.7205 0.0026 0 32.21 0.0009 R GGSGGSYGGGGSGGGYGGGSGSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8868.8868.2.dta 3 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 1884 62320 59 59 27 27 7060 443 1 1 1 896.3694 1790.7243 2 1790.7205 0.0038 0 29.35 0.0017 R GGSGGSYGGGGSGGGYGGGSGSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.10570.10570.2.dta 3 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 1884 62320 59 59 27 27 7129 2985 1 1 1 604.9603 1811.859 3 1811.8511 0.0079 1 17 0.025 R SGGGGGGGLGSGGSIRSSYSR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3313.3313.3.dta 3 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 1884 62320 59 59 27 27 7247 6588 1 1 1 919.4874 1836.9602 2 1836.9581 0.0021 0 86.17 8.30E-09 R HGVQELEIELQSQLSK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7122.7122.2.dta 3 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 1884 62320 59 59 27 27 7299 6324 1 1 1 926.4651 1850.9157 2 1850.9196 -0.0039 1 57.95 5.30E-06 K TLNDMRQEYEQLIAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6858.6858.2.dta 3 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 1884 62320 59 59 27 27 7302 6312 1 1 1 926.4659 1850.9173 2 1850.9196 -0.0023 1 23.37 0.03 K TLNDMRQEYEQLIAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6846.6846.2.dta 3 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 1884 62320 59 59 27 27 7303 6311 1 1 1 617.9799 1850.9177 3 1850.9196 -0.0019 1 23.59 0.0077 K TLNDMRQEYEQLIAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6845.6845.3.dta 3 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 1884 62320 59 59 27 27 7410 4922 1 1 1 934.4633 1866.9121 2 1866.9145 -0.0024 1 65.17 7.70E-07 K TLNDMRQEYEQLIAK N Oxidation (M) 0.000010000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5444.5444.2.dta 3 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 1884 62320 59 59 27 27 7718 6116 1 1 1 656.0242 1965.0507 3 1965.0531 -0.0024 1 88.97 4.60E-09 R HGVQELEIELQSQLSKK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6650.6650.3.dta 3 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 1884 62320 59 59 27 27 7923 1709 1 1 1 697.9649 2090.8729 3 2090.8751 -0.0022 1 45.89 6.70E-05 R GSRGGSGGSYGGGGSGGGYGGGSGSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1923.1923.3.dta 3 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 1884 62320 59 59 27 27 8446 6168 1 1 1 793.0677 2376.1814 3 2376.1808 0.0006 1 42.3 0.00016 R LASYLDKVQALEEANNDLENK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6703.6703.3.dta 3 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 1884 62320 59 59 27 27 9021 5717 1 1 1 960.7874 2879.3404 3 2879.3461 -0.0057 1 63.8 1.00E-06 R LEKEIETYHNLLEGGQEDFESSGAGK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6252.6252.3.dta 3 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 1884 62320 59 59 27 27 9022 5712 1 1 1 720.8433 2879.3442 4 2879.3461 -0.0019 1 44 7.50E-05 R LEKEIETYHNLLEGGQEDFESSGAGK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6248.6248.4.dta 3 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 1884 62320 59 59 27 27 9091 2945 1 1 1 1075.1006 3222.2799 3 3222.2744 0.0055 0 88.65 1.40E-09 R GGSGGSHGGGSGFGGESGGSYGGGEEASGSGGGYGGGSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3270.3270.3.dta 3 2 IPI00009865.1 "Keratin, type I cytoskeletal 10" 525 59711 19 19 16 16 732 3828 1 0 0 404.2035 806.3924 2 806.3923 0.0001 0 30.02 0.0038 R LAADDFR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4258.4258.2.dta 3 2 IPI00009865.1 "Keratin, type I cytoskeletal 10" 525 59711 19 19 16 16 761 3600 1 0 0 405.2239 808.4332 2 808.433 0.0002 0 36.78 0.0022 R LASYLDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4007.4007.2.dta 3 2 IPI00009865.1 "Keratin, type I cytoskeletal 10" 525 59711 19 19 16 16 1860 3550 1 0 1 497.2534 992.4922 2 992.4927 -0.0005 0 43.35 0.00017 K YENEVALR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3951.3951.2.dta 3 2 IPI00009865.1 "Keratin, type I cytoskeletal 10" 525 59711 19 19 16 16 1873 3640 1 0 1 498.263 994.5115 2 994.5123 -0.0008 1 28.42 0.027 K IKEWYEK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4050.4050.2.dta 3 2 IPI00009865.1 "Keratin, type I cytoskeletal 10" 525 59711 19 19 16 16 1874 3639 1 0 1 332.512 994.5142 3 994.5123 0.0019 1 30.56 0.016 K IKEWYEK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4049.4049.3.dta 3 2 IPI00009865.1 "Keratin, type I cytoskeletal 10" 525 59711 19 19 16 16 2119 5380 1 0 1 516.303 1030.5915 2 1030.591 0.0005 0 39.22 0.00021 R VLDELTLTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5915.5915.2.dta 3 2 IPI00009865.1 "Keratin, type I cytoskeletal 10" 525 59711 19 19 16 16 2355 3960 1 0 0 355.5416 1063.603 3 1063.6026 0.0004 1 26.37 0.0041 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4401.4401.3.dta 3 2 IPI00009865.1 "Keratin, type I cytoskeletal 10" 525 59711 19 19 16 16 2356 3952 1 0 0 532.8097 1063.6048 2 1063.6026 0.0023 1 49.01 8.90E-05 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4392.4392.2.dta 3 2 IPI00009865.1 "Keratin, type I cytoskeletal 10" 525 59711 19 19 16 16 2640 1905 1 0 0 553.7666 1105.5187 2 1105.5186 0.0001 0 60.85 1.50E-05 K VTMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2136.2136.2.dta 3 2 IPI00009865.1 "Keratin, type I cytoskeletal 10" 525 59711 19 19 16 16 2659 5647 1 0 1 555.2476 1108.4807 2 1108.4825 -0.0018 0 50.5 9.30E-05 K DAEAWFNEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6182.6182.2.dta 3 2 IPI00009865.1 "Keratin, type I cytoskeletal 10" 525 59711 19 19 16 16 2733 6306 1 0 1 559.7571 1117.4997 2 1117.5013 -0.0016 0 40.7 0.00015 K HGNSHQGEPR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.684.684.2.dta 3 2 IPI00009865.1 "Keratin, type I cytoskeletal 10" 525 59711 19 19 16 16 3584 3817 1 0 1 412.2311 1233.6716 3 1233.6717 -0.0001 1 46.68 0.00011 R LKYENEVALR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4246.4246.3.dta 3 2 IPI00009865.1 "Keratin, type I cytoskeletal 10" 525 59711 19 19 16 16 3819 3398 1 0 1 631.8029 1261.5913 2 1261.5899 0.0014 0 15.05 0.039 R SLLEGEGSSGGGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3781.3781.2.dta 3 2 IPI00009865.1 "Keratin, type I cytoskeletal 10" 525 59711 19 19 16 16 4068 2242 1 0 1 434.2032 1299.5877 3 1299.5877 0 1 21.3 0.011 K NHEEEMKDLR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2504.2504.3.dta 3 2 IPI00009865.1 "Keratin, type I cytoskeletal 10" 525 59711 19 19 16 16 5039 4424 1 0 1 717.8865 1433.7584 2 1433.7626 -0.0042 1 47.66 0.00012 K IRLENEIQTYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4903.4903.2.dta 3 2 IPI00009865.1 "Keratin, type I cytoskeletal 10" 525 59711 19 19 16 16 5040 4422 1 0 1 478.9276 1433.761 3 1433.7626 -0.0016 1 28 0.027 K IRLENEIQTYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4901.4901.3.dta 3 2 IPI00009865.1 "Keratin, type I cytoskeletal 10" 525 59711 19 19 16 16 5424 2689 1 0 1 747.3696 1492.7247 2 1492.727 -0.0023 1 56.05 1.00E-05 R SQYEQLAEQNRK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2989.2989.2.dta 3 2 IPI00009865.1 "Keratin, type I cytoskeletal 10" 525 59711 19 19 16 16 5720 2681 1 0 1 775.3408 1548.667 2 1548.67 -0.003 0 121.8 3.40E-12 R SGGGGGGGGCGGGGGVSSLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2981.2981.2.dta 3 2 IPI00009865.1 "Keratin, type I cytoskeletal 10" 525 59711 19 19 16 16 6694 5659 1 0 1 854.387 1706.7595 2 1706.7649 -0.0054 0 105.58 1.30E-10 K GSLGGGFSSGGFSGGSFSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6195.6195.2.dta 3 3 IPI00384444.5 "Keratin, type I cytoskeletal 14" 238 51875 8 8 7 7 732 3828 1 0 0 404.2035 806.3924 2 806.3923 0.0001 0 30.02 0.0038 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4258.4258.2.dta 3 3 IPI00384444.5 "Keratin, type I cytoskeletal 14" 238 51875 8 8 7 7 761 3600 1 0 0 405.2239 808.4332 2 808.433 0.0002 0 36.78 0.0022 R LASYLDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4007.4007.2.dta 3 3 IPI00384444.5 "Keratin, type I cytoskeletal 14" 238 51875 8 8 7 7 2355 3960 1 0 0 355.5416 1063.603 3 1063.6026 0.0004 1 26.37 0.0041 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4401.4401.3.dta 3 3 IPI00384444.5 "Keratin, type I cytoskeletal 14" 238 51875 8 8 7 7 2356 3952 1 0 0 532.8097 1063.6048 2 1063.6026 0.0023 1 49.01 8.90E-05 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4392.4392.2.dta 3 3 IPI00384444.5 "Keratin, type I cytoskeletal 14" 238 51875 8 8 7 7 2640 1905 1 0 0 553.7666 1105.5187 2 1105.5186 0.0001 0 60.85 1.50E-05 K VTMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2136.2136.2.dta 3 3 IPI00384444.5 "Keratin, type I cytoskeletal 14" 238 51875 8 8 7 7 2642 3558 1 0 1 553.7838 1105.553 2 1105.555 -0.002 0 58.31 1.80E-05 R ISSVLAGGSCR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3960.3960.2.dta 3 3 IPI00384444.5 "Keratin, type I cytoskeletal 14" 238 51875 8 8 7 7 4079 4206 1 0 1 651.332 1300.6494 2 1300.651 -0.0016 0 73.81 8.40E-07 R ALEEANADLEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4667.4667.2.dta 3 3 IPI00384444.5 "Keratin, type I cytoskeletal 14" 238 51875 8 8 7 7 4523 3048 1 0 0 681.3478 1360.681 2 1360.6834 -0.0024 0 51.42 3.50E-05 R EVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3381.3381.2.dta 3 4 IPI00554788.4 49 kDa protein 211 48793 6 6 6 6 732 3828 1 0 0 404.2035 806.3924 2 806.3923 0.0001 0 30.02 0.0038 R LAADDFR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4258.4258.2.dta 3 4 IPI00554788.4 49 kDa protein 211 48793 6 6 6 6 1691 3420 1 0 1 483.2379 964.4612 2 964.4614 -0.0002 0 34.81 0.0067 R AQYDELAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3805.3805.2.dta 3 4 IPI00554788.4 49 kDa protein 211 48793 6 6 6 6 2177 4805 1 0 1 521.3058 1040.5971 2 1040.5978 -0.0007 0 45.74 0.00015 R IVLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5316.5316.2.dta 3 4 IPI00554788.4 49 kDa protein 211 48793 6 6 6 6 4258 4425 1 0 1 660.3373 1318.6601 2 1318.6629 -0.0028 0 78.08 2.30E-07 R AQIFANTVDNAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4904.4904.2.dta 3 4 IPI00554788.4 49 kDa protein 211 48793 6 6 6 6 4948 6304 1 0 1 710.3767 1418.7389 2 1418.7405 -0.0016 0 54.8 7.80E-05 R QAQEYEALLNIK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6838.6838.2.dta 3 4 IPI00554788.4 49 kDa protein 211 48793 6 6 6 6 5470 6757 1 0 1 753.8763 1505.7381 2 1505.7395 -0.0014 0 84.02 7.90E-08 R TVQSLEIDLDSMR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7292.7292.2.dta 3 5 IPI00450768.7 "Keratin, type I cytoskeletal 17" 147 48361 8 8 7 7 732 3828 1 0 0 404.2035 806.3924 2 806.3923 0.0001 0 30.02 0.0038 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4258.4258.2.dta 3 5 IPI00450768.7 "Keratin, type I cytoskeletal 17" 147 48361 8 8 7 7 761 3600 1 0 0 405.2239 808.4332 2 808.433 0.0002 0 36.78 0.0022 R LASYLDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4007.4007.2.dta 3 5 IPI00450768.7 "Keratin, type I cytoskeletal 17" 147 48361 8 8 7 7 1799 2730 1 0 1 492.7537 983.4928 2 983.4924 0.0004 0 15.96 0.032 R QFTSSSSIK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3034.3034.2.dta 3 5 IPI00450768.7 "Keratin, type I cytoskeletal 17" 147 48361 8 8 7 7 2136 2715 1 0 1 517.7555 1033.4964 2 1033.4975 -0.001 0 43.79 0.001 R LSGGLGAGSCR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3017.3017.2.dta 3 5 IPI00450768.7 "Keratin, type I cytoskeletal 17" 147 48361 8 8 7 7 2355 3960 1 0 0 355.5416 1063.603 3 1063.6026 0.0004 1 26.37 0.0041 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4401.4401.3.dta 3 5 IPI00450768.7 "Keratin, type I cytoskeletal 17" 147 48361 8 8 7 7 2356 3952 1 0 0 532.8097 1063.6048 2 1063.6026 0.0023 1 49.01 8.90E-05 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4392.4392.2.dta 3 5 IPI00450768.7 "Keratin, type I cytoskeletal 17" 147 48361 8 8 7 7 4523 3048 1 0 0 681.3478 1360.681 2 1360.6834 -0.0024 0 51.42 3.50E-05 R EVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3381.3381.2.dta 3 5 IPI00450768.7 "Keratin, type I cytoskeletal 17" 147 48361 8 8 7 7 6376 4514 1 0 1 553.9684 1658.8835 3 1658.8839 -0.0004 1 23.61 0.0061 R TIVEEVQDGKVISSR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5001.5001.3.dta 3 6 IPI00031423.1 "Keratin, type I cuticular Ha3-II" 128 47325 5 5 5 5 732 3828 1 0 0 404.2035 806.3924 2 806.3923 0.0001 0 30.02 0.0038 K LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4258.4258.2.dta 3 6 IPI00031423.1 "Keratin, type I cuticular Ha3-II" 128 47325 5 5 5 5 1917 4116 1 0 1 500.2954 998.5763 2 998.576 0.0003 0 51.77 6.90E-05 R LVVQIDNAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4570.4570.2.dta 3 6 IPI00031423.1 "Keratin, type I cuticular Ha3-II" 128 47325 5 5 5 5 3251 3742 1 0 1 599.28 1196.5454 2 1196.5495 -0.0042 0 21.5 0.016 R LECEINTYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4164.4164.2.dta 3 6 IPI00031423.1 "Keratin, type I cuticular Ha3-II" 128 47325 5 5 5 5 5460 6208 1 0 1 752.8895 1503.7644 2 1503.7681 -0.0038 0 57.74 3.90E-06 R QNQEYQVLLDVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6743.6743.2.dta 3 6 IPI00031423.1 "Keratin, type I cuticular Ha3-II" 128 47325 5 5 5 5 7950 6028 1 0 1 702.3581 2104.0525 3 2104.0549 -0.0024 1 37.45 0.00031 R SDLERQNQEYQVLLDVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6563.6563.3.dta 3 7 IPI00008692.1 "Keratin, type I cuticular Ha6" 35 53354 2 2 2 2 732 3828 1 0 0 404.2035 806.3924 2 806.3923 0.0001 0 30.02 0.0038 K LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4258.4258.2.dta 3 7 IPI00008692.1 "Keratin, type I cuticular Ha6" 35 53354 2 2 2 2 5297 2632 1 0 1 737.3672 1472.7198 2 1472.7219 -0.0021 1 23.4 0.022 R QLERENAELESR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2926.2926.2.dta 3 IPI00383111.2 57 kDa protein 421 56699 17 17 14 14 732 3828 1 0 0 404.2035 806.3924 2 806.3923 0.0001 0 30.02 0.0038 R LAADDFR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4258.4258.2.dta 3 IPI00383111.2 57 kDa protein 421 56699 17 17 14 14 761 3600 1 0 0 405.2239 808.4332 2 808.433 0.0002 0 36.78 0.0022 R LASYLDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4007.4007.2.dta 3 IPI00383111.2 57 kDa protein 421 56699 17 17 14 14 1860 3550 1 0 1 497.2534 992.4922 2 992.4927 -0.0005 0 43.35 0.00017 K YENEVALR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3951.3951.2.dta 3 IPI00383111.2 57 kDa protein 421 56699 17 17 14 14 1873 3640 1 0 1 498.263 994.5115 2 994.5123 -0.0008 1 28.42 0.027 K IKEWYEK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4050.4050.2.dta 3 IPI00383111.2 57 kDa protein 421 56699 17 17 14 14 1874 3639 1 0 1 332.512 994.5142 3 994.5123 0.0019 1 30.56 0.016 K IKEWYEK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4049.4049.3.dta 3 IPI00383111.2 57 kDa protein 421 56699 17 17 14 14 2119 5380 1 0 1 516.303 1030.5915 2 1030.591 0.0005 0 39.22 0.00021 R VLDELTLTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5915.5915.2.dta 3 IPI00383111.2 57 kDa protein 421 56699 17 17 14 14 2355 3960 1 0 0 355.5416 1063.603 3 1063.6026 0.0004 1 26.37 0.0041 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4401.4401.3.dta 3 IPI00383111.2 57 kDa protein 421 56699 17 17 14 14 2356 3952 1 0 0 532.8097 1063.6048 2 1063.6026 0.0023 1 49.01 8.90E-05 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4392.4392.2.dta 3 IPI00383111.2 57 kDa protein 421 56699 17 17 14 14 2640 1905 1 0 0 553.7666 1105.5187 2 1105.5186 0.0001 0 60.85 1.50E-05 K VTMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2136.2136.2.dta 3 IPI00383111.2 57 kDa protein 421 56699 17 17 14 14 2659 5647 1 0 1 555.2476 1108.4807 2 1108.4825 -0.0018 0 50.5 9.30E-05 K DAEAWFNEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6182.6182.2.dta 3 IPI00383111.2 57 kDa protein 421 56699 17 17 14 14 2733 6306 1 0 1 559.7571 1117.4997 2 1117.5013 -0.0016 0 40.7 0.00015 K HGNSHQGEPR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.684.684.2.dta 3 IPI00383111.2 57 kDa protein 421 56699 17 17 14 14 3584 3817 1 0 1 412.2311 1233.6716 3 1233.6717 -0.0001 1 46.68 0.00011 R LKYENEVALR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4246.4246.3.dta 3 IPI00383111.2 57 kDa protein 421 56699 17 17 14 14 4068 2242 1 0 1 434.2032 1299.5877 3 1299.5877 0 1 21.3 0.011 K NHEEEMKDLR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2504.2504.3.dta 3 IPI00383111.2 57 kDa protein 421 56699 17 17 14 14 5039 4424 1 0 1 717.8865 1433.7584 2 1433.7626 -0.0042 1 47.66 0.00012 K IRLENEIQTYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4903.4903.2.dta 3 IPI00383111.2 57 kDa protein 421 56699 17 17 14 14 5040 4422 1 0 1 478.9276 1433.761 3 1433.7626 -0.0016 1 28 0.027 K IRLENEIQTYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4901.4901.3.dta 3 IPI00383111.2 57 kDa protein 421 56699 17 17 14 14 5424 2689 1 0 1 747.3696 1492.7247 2 1492.727 -0.0023 1 56.05 1.00E-05 R SQYEQLAEQNRK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2989.2989.2.dta 3 IPI00383111.2 57 kDa protein 421 56699 17 17 14 14 6694 5659 1 0 1 854.387 1706.7595 2 1706.7649 -0.0054 0 105.58 1.30E-10 K GSLGGGFSSGGFSGGSFSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6195.6195.2.dta 3 IPI00217963.3 "Keratin, type I cytoskeletal 16" 206 51578 7 7 6 6 732 3828 1 0 0 404.2035 806.3924 2 806.3923 0.0001 0 30.02 0.0038 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4258.4258.2.dta 3 IPI00217963.3 "Keratin, type I cytoskeletal 16" 206 51578 7 7 6 6 761 3600 1 0 0 405.2239 808.4332 2 808.433 0.0002 0 36.78 0.0022 R LASYLDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4007.4007.2.dta 3 IPI00217963.3 "Keratin, type I cytoskeletal 16" 206 51578 7 7 6 6 2355 3960 1 0 0 355.5416 1063.603 3 1063.6026 0.0004 1 26.37 0.0041 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4401.4401.3.dta 3 IPI00217963.3 "Keratin, type I cytoskeletal 16" 206 51578 7 7 6 6 2356 3952 1 0 0 532.8097 1063.6048 2 1063.6026 0.0023 1 49.01 8.90E-05 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4392.4392.2.dta 3 IPI00217963.3 "Keratin, type I cytoskeletal 16" 206 51578 7 7 6 6 2640 1905 1 0 0 553.7666 1105.5187 2 1105.5186 0.0001 0 60.85 1.50E-05 K VTMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2136.2136.2.dta 3 IPI00217963.3 "Keratin, type I cytoskeletal 16" 206 51578 7 7 6 6 2642 3558 1 0 1 553.7838 1105.553 2 1105.555 -0.002 0 58.31 1.80E-05 R ISSVLAGGSCR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3960.3960.2.dta 3 IPI00217963.3 "Keratin, type I cytoskeletal 16" 206 51578 7 7 6 6 4079 4206 1 0 1 651.332 1300.6494 2 1300.651 -0.0016 0 73.81 8.40E-07 R ALEEANADLEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4667.4667.2.dta 3 IPI00791852.1 42 kDa protein 138 41729 7 7 6 6 732 3828 1 0 0 404.2035 806.3924 2 806.3923 0.0001 0 30.02 0.0038 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4258.4258.2.dta 3 IPI00791852.1 42 kDa protein 138 41729 7 7 6 6 761 3600 1 0 0 405.2239 808.4332 2 808.433 0.0002 0 36.78 0.0022 R LASYLDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4007.4007.2.dta 3 IPI00791852.1 42 kDa protein 138 41729 7 7 6 6 1799 2730 1 0 1 492.7537 983.4928 2 983.4924 0.0004 0 15.96 0.032 R QFTSSSSIK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3034.3034.2.dta 3 IPI00791852.1 42 kDa protein 138 41729 7 7 6 6 2136 2715 1 0 1 517.7555 1033.4964 2 1033.4975 -0.001 0 43.79 0.001 R LSGGLGAGSCR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3017.3017.2.dta 3 IPI00791852.1 42 kDa protein 138 41729 7 7 6 6 2355 3960 1 0 0 355.5416 1063.603 3 1063.6026 0.0004 1 26.37 0.0041 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4401.4401.3.dta 3 IPI00791852.1 42 kDa protein 138 41729 7 7 6 6 2356 3952 1 0 0 532.8097 1063.6048 2 1063.6026 0.0023 1 49.01 8.90E-05 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4392.4392.2.dta 3 IPI00791852.1 42 kDa protein 138 41729 7 7 6 6 4523 3048 1 0 0 681.3478 1360.681 2 1360.6834 -0.0024 0 51.42 3.50E-05 R EVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3381.3381.2.dta 3 IPI00290077.1 "Keratin, type I cytoskeletal 15" 134 49365 5 5 4 4 732 3828 1 0 0 404.2035 806.3924 2 806.3923 0.0001 0 30.02 0.0038 R LAADDFR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4258.4258.2.dta 3 IPI00290077.1 "Keratin, type I cytoskeletal 15" 134 49365 5 5 4 4 761 3600 1 0 0 405.2239 808.4332 2 808.433 0.0002 0 36.78 0.0022 R LASYLDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4007.4007.2.dta 3 IPI00290077.1 "Keratin, type I cytoskeletal 15" 134 49365 5 5 4 4 2355 3960 1 0 0 355.5416 1063.603 3 1063.6026 0.0004 1 26.37 0.0041 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4401.4401.3.dta 3 IPI00290077.1 "Keratin, type I cytoskeletal 15" 134 49365 5 5 4 4 2356 3952 1 0 0 532.8097 1063.6048 2 1063.6026 0.0023 1 49.01 8.90E-05 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4392.4392.2.dta 3 IPI00290077.1 "Keratin, type I cytoskeletal 15" 134 49365 5 5 4 4 4079 4206 1 0 1 651.332 1300.6494 2 1300.651 -0.0016 0 73.81 8.40E-07 R ALEEANADLEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4667.4667.2.dta 3 IPI00794807.1 15 kDa protein 122 15435 3 3 3 3 1691 3420 1 0 1 483.2379 964.4612 2 964.4614 -0.0002 0 34.81 0.0067 R AQYDELAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3805.3805.2.dta 3 IPI00794807.1 15 kDa protein 122 15435 3 3 3 3 4948 6304 1 0 1 710.3767 1418.7389 2 1418.7405 -0.0016 0 54.8 7.80E-05 R QAQEYEALLNIK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6838.6838.2.dta 3 IPI00794807.1 15 kDa protein 122 15435 3 3 3 3 5470 6757 1 0 1 753.8763 1505.7381 2 1505.7395 -0.0014 0 84.02 7.90E-08 R TVQSLEIDLDSMR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7292.7292.2.dta 3 IPI00789750.1 27 kDa protein 119 26775 4 4 4 4 732 3828 1 0 0 404.2035 806.3924 2 806.3923 0.0001 0 30.02 0.0038 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4258.4258.2.dta 3 IPI00789750.1 27 kDa protein 119 26775 4 4 4 4 761 3600 1 0 0 405.2239 808.4332 2 808.433 0.0002 0 36.78 0.0022 R LASYLDK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4007.4007.2.dta 3 IPI00789750.1 27 kDa protein 119 26775 4 4 4 4 2640 1905 1 0 0 553.7666 1105.5187 2 1105.5186 0.0001 0 60.85 1.50E-05 K VTMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2136.2136.2.dta 3 IPI00789750.1 27 kDa protein 119 26775 4 4 4 4 2642 3558 1 0 1 553.7838 1105.553 2 1105.555 -0.002 0 58.31 1.80E-05 R ISSVLAGGSCR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3960.3960.2.dta 3 IPI00297632.3 "Keratin, type I cuticular Ha3-I" 116 47161 4 4 4 4 1917 4116 1 0 1 500.2954 998.5763 2 998.576 0.0003 0 51.77 6.90E-05 R LVVQIDNAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4570.4570.2.dta 3 IPI00297632.3 "Keratin, type I cuticular Ha3-I" 116 47161 4 4 4 4 3251 3742 1 0 1 599.28 1196.5454 2 1196.5495 -0.0042 0 21.5 0.016 R LECEINTYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4164.4164.2.dta 3 IPI00297632.3 "Keratin, type I cuticular Ha3-I" 116 47161 4 4 4 4 5460 6208 1 0 1 752.8895 1503.7644 2 1503.7681 -0.0038 0 57.74 3.90E-06 R QNQEYQVLLDVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6743.6743.2.dta 3 IPI00297632.3 "Keratin, type I cuticular Ha3-I" 116 47161 4 4 4 4 7950 6028 1 0 1 702.3581 2104.0525 3 2104.0549 -0.0024 1 37.45 0.00031 R SDLERQNQEYQVLLDVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6563.6563.3.dta 3 IPI00794267.1 18 kDa protein 113 18099 3 3 3 3 732 3828 1 0 0 404.2035 806.3924 2 806.3923 0.0001 0 30.02 0.0038 R LAADDFR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4258.4258.2.dta 3 IPI00794267.1 18 kDa protein 113 18099 3 3 3 3 2177 4805 1 0 1 521.3058 1040.5971 2 1040.5978 -0.0007 0 45.74 0.00015 R IVLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5316.5316.2.dta 3 IPI00794267.1 18 kDa protein 113 18099 3 3 3 3 4258 4425 1 0 1 660.3373 1318.6601 2 1318.6629 -0.0028 0 78.08 2.30E-07 R AQIFANTVDNAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4904.4904.2.dta 3 IPI00184195.2 19 kDa protein 110 18696 5 5 4 4 732 3828 1 0 0 404.2035 806.3924 2 806.3923 0.0001 0 30.02 0.0038 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4258.4258.2.dta 3 IPI00184195.2 19 kDa protein 110 18696 5 5 4 4 761 3600 1 0 0 405.2239 808.4332 2 808.433 0.0002 0 36.78 0.0022 R LASYLDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4007.4007.2.dta 3 IPI00184195.2 19 kDa protein 110 18696 5 5 4 4 2177 4805 1 0 1 521.3058 1040.5971 2 1040.5978 -0.0007 0 45.74 0.00015 R IVLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5316.5316.2.dta 3 IPI00184195.2 19 kDa protein 110 18696 5 5 4 4 2355 3960 1 0 0 355.5416 1063.603 3 1063.6026 0.0004 1 26.37 0.0041 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4401.4401.3.dta 3 IPI00184195.2 19 kDa protein 110 18696 5 5 4 4 2356 3952 1 0 0 532.8097 1063.6048 2 1063.6026 0.0023 1 49.01 8.90E-05 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4392.4392.2.dta 3 IPI00791348.1 20 kDa protein 108 19811 2 2 2 2 2642 3558 1 0 1 553.7838 1105.553 2 1105.555 -0.002 0 58.31 1.80E-05 R ISSVLAGGSCR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3960.3960.2.dta 3 IPI00791348.1 20 kDa protein 108 19811 2 2 2 2 4079 4206 1 0 1 651.332 1300.6494 2 1300.651 -0.0016 0 73.81 8.40E-07 R ALEEANADLEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4667.4667.2.dta 3 IPI00180956.6 49 kDa protein 107 49001 5 5 4 4 761 3600 1 0 0 405.2239 808.4332 2 808.433 0.0002 0 36.78 0.0022 R LASYLDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4007.4007.2.dta 3 IPI00180956.6 49 kDa protein 107 49001 5 5 4 4 1799 2730 1 0 1 492.7537 983.4928 2 983.4924 0.0004 0 15.96 0.032 R QFTSSSSIK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3034.3034.2.dta 3 IPI00180956.6 49 kDa protein 107 49001 5 5 4 4 2355 3960 1 0 0 355.5416 1063.603 3 1063.6026 0.0004 1 26.37 0.0041 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4401.4401.3.dta 3 IPI00180956.6 49 kDa protein 107 49001 5 5 4 4 2356 3952 1 0 0 532.8097 1063.6048 2 1063.6026 0.0023 1 49.01 8.90E-05 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4392.4392.2.dta 3 IPI00180956.6 49 kDa protein 107 49001 5 5 4 4 4523 3048 1 0 0 681.3478 1360.681 2 1360.6834 -0.0024 0 51.42 3.50E-05 R EVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3381.3381.2.dta 3 IPI00791156.1 31 kDa protein 105 30866 6 6 5 5 732 3828 1 0 0 404.2035 806.3924 2 806.3923 0.0001 0 30.02 0.0038 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4258.4258.2.dta 3 IPI00791156.1 31 kDa protein 105 30866 6 6 5 5 761 3600 1 0 0 405.2239 808.4332 2 808.433 0.0002 0 36.78 0.0022 R LASYLDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4007.4007.2.dta 3 IPI00791156.1 31 kDa protein 105 30866 6 6 5 5 1799 2730 1 0 1 492.7537 983.4928 2 983.4924 0.0004 0 15.96 0.032 R QFTSSSSIK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3034.3034.2.dta 3 IPI00791156.1 31 kDa protein 105 30866 6 6 5 5 2136 2715 1 0 1 517.7555 1033.4964 2 1033.4975 -0.001 0 43.79 0.001 R LSGGLGAGSCR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3017.3017.2.dta 3 IPI00791156.1 31 kDa protein 105 30866 6 6 5 5 2355 3960 1 0 0 355.5416 1063.603 3 1063.6026 0.0004 1 26.37 0.0041 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4401.4401.3.dta 3 IPI00791156.1 31 kDa protein 105 30866 6 6 5 5 2356 3952 1 0 0 532.8097 1063.6048 2 1063.6026 0.0023 1 49.01 8.90E-05 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4392.4392.2.dta 3 IPI00418663.3 Keratin-28 97 53733 3 3 3 3 732 3828 1 0 0 404.2035 806.3924 2 806.3923 0.0001 0 30.02 0.0038 R LAADDFR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4258.4258.2.dta 3 IPI00418663.3 Keratin-28 97 53733 3 3 3 3 2640 1905 1 0 0 553.7666 1105.5187 2 1105.5186 0.0001 0 60.85 1.50E-05 K VTMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2136.2136.2.dta 3 IPI00418663.3 Keratin-28 97 53733 3 3 3 3 2659 5647 1 0 1 555.2476 1108.4807 2 1108.4825 -0.0018 0 50.5 9.30E-05 K DAEAWFNEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6182.6182.2.dta 3 IPI00328103.2 Keratin-27 87 50419 2 2 2 2 2640 1905 1 0 0 553.7666 1105.5187 2 1105.5186 0.0001 0 60.85 1.50E-05 K VTMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2136.2136.2.dta 3 IPI00328103.2 Keratin-27 87 50419 2 2 2 2 2659 5647 1 0 1 555.2476 1108.4807 2 1108.4825 -0.0018 0 50.5 9.30E-05 R DAEAWFNEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6182.6182.2.dta 3 IPI00791927.1 32 kDa protein 85 32658 3 3 3 3 3251 3742 1 0 1 599.28 1196.5454 2 1196.5495 -0.0042 0 21.5 0.016 R LECEINTYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4164.4164.2.dta 3 IPI00791927.1 32 kDa protein 85 32658 3 3 3 3 5460 6208 1 0 1 752.8895 1503.7644 2 1503.7681 -0.0038 0 57.74 3.90E-06 R QNQEYQVLLDVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6743.6743.2.dta 3 IPI00791927.1 32 kDa protein 85 32658 3 3 3 3 7950 6028 1 0 1 702.3581 2104.0525 3 2104.0549 -0.0024 1 37.45 0.00031 R SDLERQNQEYQVLLDVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6563.6563.3.dta 3 IPI00171196.2 keratin 13 isoform b 82 46181 2 2 2 2 732 3828 1 0 0 404.2035 806.3924 2 806.3923 0.0001 0 30.02 0.0038 R LAADDFR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4258.4258.2.dta 3 IPI00171196.2 keratin 13 isoform b 82 46181 2 2 2 2 4079 4206 1 0 1 651.332 1300.6494 2 1300.651 -0.0016 0 73.81 8.40E-07 R ALEEANADLEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4667.4667.2.dta 3 IPI00294649.5 keratin 35 76 51640 3 3 3 3 732 3828 1 0 0 404.2035 806.3924 2 806.3923 0.0001 0 30.02 0.0038 K LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4258.4258.2.dta 3 IPI00294649.5 keratin 35 76 51640 3 3 3 3 3251 3742 1 0 1 599.28 1196.5454 2 1196.5495 -0.0042 0 21.5 0.016 R LECEINTYR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4164.4164.2.dta 3 IPI00294649.5 keratin 35 76 51640 3 3 3 3 5460 6208 1 0 1 752.8895 1503.7644 2 1503.7681 -0.0038 0 57.74 3.90E-06 R QNQEYQVLLDVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6743.6743.2.dta 3 IPI00792629.1 18 kDa protein 74 18074 4 4 3 3 761 3600 1 0 0 405.2239 808.4332 2 808.433 0.0002 0 36.78 0.0022 R LASYLDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4007.4007.2.dta 3 IPI00792629.1 18 kDa protein 74 18074 4 4 3 3 1799 2730 1 0 1 492.7537 983.4928 2 983.4924 0.0004 0 15.96 0.032 R QFTSSSSIK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3034.3034.2.dta 3 IPI00792629.1 18 kDa protein 74 18074 4 4 3 3 2355 3960 1 0 0 355.5416 1063.603 3 1063.6026 0.0004 1 26.37 0.0041 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4401.4401.3.dta 3 IPI00792629.1 18 kDa protein 74 18074 4 4 3 3 2356 3952 1 0 0 532.8097 1063.6048 2 1063.6026 0.0023 1 49.01 8.90E-05 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4392.4392.2.dta 3 IPI00009866.6 "Isoform 1 of Keratin, type I cytoskeletal 13" 74 49898 1 1 1 1 4079 4206 1 0 1 651.332 1300.6494 2 1300.651 -0.0016 0 73.81 8.40E-07 R ALEEANADLEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4667.4667.2.dta 3 IPI00015309.1 "Keratin, type I cytoskeletal 12" 73 53592 3 3 2 2 761 3600 1 0 0 405.2239 808.4332 2 808.433 0.0002 0 36.78 0.0022 R LASYLDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4007.4007.2.dta 3 IPI00015309.1 "Keratin, type I cytoskeletal 12" 73 53592 3 3 2 2 2355 3960 1 0 0 355.5416 1063.603 3 1063.6026 0.0004 1 26.37 0.0041 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4401.4401.3.dta 3 IPI00015309.1 "Keratin, type I cytoskeletal 12" 73 53592 3 3 2 2 2356 3952 1 0 0 532.8097 1063.6048 2 1063.6026 0.0023 1 49.01 8.90E-05 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4392.4392.2.dta 3 IPI00747707.1 KRT17 protein 71 41332 3 3 3 3 732 3828 1 0 0 404.2035 806.3924 2 806.3923 0.0001 0 30.02 0.0038 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4258.4258.2.dta 3 IPI00747707.1 KRT17 protein 71 41332 3 3 3 3 4523 3048 1 0 0 681.3478 1360.681 2 1360.6834 -0.0024 0 51.42 3.50E-05 R EVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3381.3381.2.dta 3 IPI00747707.1 KRT17 protein 71 41332 3 3 3 3 6376 4514 1 0 1 553.9684 1658.8835 3 1658.8839 -0.0004 1 23.61 0.0061 R TIVEEVQDGKVISSR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5001.5001.3.dta 3 IPI00291540.3 "Keratin, type I cuticular Ha2" 71 51769 2 2 2 2 732 3828 1 0 0 404.2035 806.3924 2 806.3923 0.0001 0 30.02 0.0038 K LAADDFR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4258.4258.2.dta 3 IPI00291540.3 "Keratin, type I cuticular Ha2" 71 51769 2 2 2 2 5460 6208 1 0 1 752.8895 1503.7644 2 1503.7681 -0.0038 0 57.74 3.90E-06 R QNQEYQVLLDVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6743.6743.2.dta 3 IPI00292715.3 keratin 34 63 50818 2 2 2 2 3251 3742 1 0 1 599.28 1196.5454 2 1196.5495 -0.0042 0 21.5 0.016 R LECEINTYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4164.4164.2.dta 3 IPI00292715.3 keratin 34 63 50818 2 2 2 2 5460 6208 1 0 1 752.8895 1503.7644 2 1503.7681 -0.0038 0 57.74 3.90E-06 R QNQEYQVLLDVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6743.6743.2.dta 3 IPI00797594.1 18 kDa protein 61 19009 2 2 2 2 732 3828 1 0 0 404.2035 806.3924 2 806.3923 0.0001 0 30.02 0.0038 K LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4258.4258.2.dta 3 IPI00797594.1 18 kDa protein 61 19009 2 2 2 2 1917 4116 1 0 1 500.2954 998.5763 2 998.576 0.0003 0 51.77 6.90E-05 R LVVQIDNAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4570.4570.2.dta 3 IPI00375910.2 Keratin-26 61 52620 1 1 1 1 2640 1905 1 0 0 553.7666 1105.5187 2 1105.5186 0.0001 0 60.85 1.50E-05 K VTMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2136.2136.2.dta 3 IPI00795353.1 11 kDa protein 55 10894 1 1 1 1 4948 6304 1 0 1 710.3767 1418.7389 2 1418.7405 -0.0016 0 54.8 7.80E-05 R QAQEYEALLNIK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6838.6838.2.dta 3 IPI00792454.1 30 kDa protein 51 30075 1 1 1 1 4523 3048 1 0 0 681.3478 1360.681 2 1360.6834 -0.0024 0 51.42 3.50E-05 R EVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3381.3381.2.dta 3 IPI00790298.1 20 kDa protein 37 19591 1 1 1 1 761 3600 1 0 0 405.2239 808.4332 2 808.433 0.0002 0 36.78 0.0022 R LASYLDK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4007.4007.2.dta 3 IPI00004550.5 Keratin-24 30 55567 1 1 1 1 732 3828 1 0 0 404.2035 806.3924 2 806.3923 0.0001 0 30.02 0.0038 R LAADDFR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4258.4258.2.dta 4 1 IPI00021405.3 Isoform A of Lamin-A/C 1526 74380 45 45 38 38 867 4742 1 1 1 415.753 829.4915 2 829.4909 0.0006 0 27.9 0.022 R LQLELSK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5248.5248.2.dta 4 1 IPI00021405.3 Isoform A of Lamin-A/C 1526 74380 45 45 38 38 996 4507 1 1 1 425.2451 848.4756 2 848.4756 0 0 40.72 0.00085 R LAVYIDR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4993.4993.2.dta 4 1 IPI00021405.3 Isoform A of Lamin-A/C 1526 74380 45 45 38 38 1043 1775 1 1 1 429.7557 857.4968 2 857.497 -0.0002 1 39.11 0.0034 R LLAEKER E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1995.1995.2.dta 4 1 IPI00021405.3 Isoform A of Lamin-A/C 1526 74380 45 45 38 38 1060 1749 1 1 1 431.2559 860.4972 2 860.4967 0.0004 1 41.31 0.0008 R KTLDSVAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1967.1967.2.dta 4 1 IPI00021405.3 Isoform A of Lamin-A/C 1526 74380 45 45 38 38 1397 4409 1 1 1 459.7299 917.4453 2 917.4454 -0.0001 0 43.84 0.00095 R DLEDSLAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4887.4887.2.dta 4 1 IPI00021405.3 Isoform A of Lamin-A/C 1526 74380 45 45 38 38 1400 1376 1 1 1 460.2231 918.4316 2 918.4308 0.0008 0 46.39 0.0005 R SSFSQHAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1564.1564.2.dta 4 1 IPI00021405.3 Isoform A of Lamin-A/C 1526 74380 45 45 38 38 1588 1076 1 1 1 475.2506 948.4867 2 948.4876 -0.0009 1 53.31 5.60E-05 R KLESTESR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1239.1239.2.dta 4 1 IPI00021405.3 Isoform A of Lamin-A/C 1526 74380 45 45 38 38 1735 1918 1 1 1 486.7594 971.5042 2 971.5036 0.0006 0 20.64 0.034 R LSPSPTSQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2150.2150.2.dta 4 1 IPI00021405.3 Isoform A of Lamin-A/C 1526 74380 45 45 38 38 2096 5325 1 1 1 514.7909 1027.5672 2 1027.5662 0.0011 0 75.49 6.50E-07 R LADALQELR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5859.5859.2.dta 4 1 IPI00021405.3 Isoform A of Lamin-A/C 1526 74380 45 45 38 38 2105 2572 1 1 1 515.2996 1028.5847 2 1028.5866 -0.0019 1 32.14 0.011 K LEAALGEAKK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2861.2861.2.dta 4 1 IPI00021405.3 Isoform A of Lamin-A/C 1526 74380 45 45 38 38 2193 3578 1 1 1 522.2778 1042.541 2 1042.5407 0.0003 0 61.07 1.30E-05 K EGDLIAAQAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3983.3983.2.dta 4 1 IPI00021405.3 Isoform A of Lamin-A/C 1526 74380 45 45 38 38 2305 4243 1 1 1 529.3226 1056.6307 2 1056.6291 0.0016 1 23.4 0.032 R ARLQLELSK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4707.4707.2.dta 4 1 IPI00021405.3 Isoform A of Lamin-A/C 1526 74380 45 45 38 38 3040 3776 1 1 1 583.2764 1164.5382 2 1164.5411 -0.0029 0 96.79 4.10E-09 K AAYEAELGDAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4201.4201.2.dta 4 1 IPI00021405.3 Isoform A of Lamin-A/C 1526 74380 45 45 38 38 3083 2518 1 1 1 586.3239 1170.6333 2 1170.6357 -0.0024 1 32.77 0.015 R LVEIDNGKQR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2803.2803.2.dta 4 1 IPI00021405.3 Isoform A of Lamin-A/C 1526 74380 45 45 38 38 3085 2983 1 1 1 586.326 1170.6375 2 1170.6357 0.0019 1 70.74 1.80E-06 K KEGDLIAAQAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3311.3311.2.dta 4 1 IPI00021405.3 Isoform A of Lamin-A/C 1526 74380 45 45 38 38 3188 4228 1 1 1 396.5519 1186.6339 3 1186.6306 0.0033 1 48.38 0.0003 K LRDLEDSLAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4691.4691.3.dta 4 1 IPI00021405.3 Isoform A of Lamin-A/C 1526 74380 45 45 38 38 3642 3689 1 1 1 622.3383 1242.6621 2 1242.6568 0.0053 1 31.92 0.0019 K LLEGEEERLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4105.4105.2.dta 4 1 IPI00021405.3 Isoform A of Lamin-A/C 1526 74380 45 45 38 38 3645 5956 1 1 1 415.2466 1242.718 3 1242.7183 -0.0003 1 25.58 0.0044 R LKDLEALLNSK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6490.6490.3.dta 4 1 IPI00021405.3 Isoform A of Lamin-A/C 1526 74380 45 45 38 38 3913 3699 1 1 1 638.3496 1274.6847 2 1274.683 0.0017 1 57.86 1.60E-05 K EAALSTALSEKR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4117.4117.2.dta 4 1 IPI00021405.3 Isoform A of Lamin-A/C 1526 74380 45 45 38 38 4033 3126 1 1 1 647.3241 1292.6336 2 1292.636 -0.0024 1 50.05 0.00023 K AAYEAELGDARK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3465.3465.2.dta 4 1 IPI00021405.3 Isoform A of Lamin-A/C 1526 74380 45 45 38 38 4507 2846 1 1 1 680.3474 1358.6803 2 1358.679 0.0013 0 59.64 2.60E-06 R SGAQASSTPLSPTR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3159.3159.2.dta 4 1 IPI00021405.3 Isoform A of Lamin-A/C 1526 74380 45 45 38 38 4535 3865 1 1 1 682.3119 1362.6092 2 1362.6099 -0.0007 0 65.81 6.70E-07 K AQNTWGCGNSLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4298.4298.2.dta 4 1 IPI00021405.3 Isoform A of Lamin-A/C 1526 74380 45 45 38 38 4862 2783 1 1 1 703.8204 1405.6262 2 1405.633 -0.0068 0 83.93 3.50E-08 R TVLCGTCGQPADK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3091.3091.2.dta 4 1 IPI00021405.3 Isoform A of Lamin-A/C 1526 74380 45 45 38 38 4935 3819 1 1 1 709.3845 1416.7545 2 1416.7572 -0.0027 1 50.03 8.50E-05 R LRITESEEVVSR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4248.4248.2.dta 4 1 IPI00021405.3 Isoform A of Lamin-A/C 1526 74380 45 45 38 38 5016 5870 1 1 1 715.8958 1429.777 2 1429.7776 -0.0007 0 56.3 2.70E-05 R IDSLSAQLSQLQK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6406.6406.2.dta 4 1 IPI00021405.3 Isoform A of Lamin-A/C 1526 74380 45 45 38 38 5414 4752 1 1 1 746.3768 1490.739 2 1490.7399 -0.0009 0 87.54 6.20E-09 R TALINSTGEEVAMR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5259.5259.2.dta 4 1 IPI00021405.3 Isoform A of Lamin-A/C 1526 74380 45 45 38 38 5453 1568 1 1 1 501.5789 1501.7147 3 1501.7161 -0.0014 1 68.87 2.20E-06 R AQHEDQVEQYKK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1771.1771.3.dta 4 1 IPI00021405.3 Isoform A of Lamin-A/C 1526 74380 45 45 38 38 5475 4023 1 1 1 754.3728 1506.7311 2 1506.7348 -0.0037 0 75.63 5.50E-07 R TALINSTGEEVAMR K Oxidation (M) 0.00000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4469.4469.2.dta 4 1 IPI00021405.3 Isoform A of Lamin-A/C 1526 74380 45 45 38 38 5518 141 1 1 1 759.861 1517.7074 2 1517.707 0.0003 0 101.55 3.00E-10 R ASSHSSQTQGGGSVTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1017.1017.2.dta 4 1 IPI00021405.3 Isoform A of Lamin-A/C 1526 74380 45 45 38 38 5993 4226 1 1 1 803.4089 1604.8033 2 1604.8046 -0.0013 1 87.69 6.00E-09 R VAVEEVDEEGKFVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4689.4689.2.dta 4 1 IPI00021405.3 Isoform A of Lamin-A/C 1526 74380 45 45 38 38 6136 3614 1 1 1 543.9402 1628.7987 3 1628.8005 -0.0018 1 46.75 0.00026 R LQEKEDLQELNDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4022.4022.3.dta 4 1 IPI00021405.3 Isoform A of Lamin-A/C 1526 74380 45 45 38 38 6137 3619 1 1 1 815.407 1628.7995 2 1628.8005 -0.001 1 74.94 5.50E-07 R LQEKEDLQELNDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4027.4027.2.dta 4 1 IPI00021405.3 Isoform A of Lamin-A/C 1526 74380 45 45 38 38 6294 7454 1 1 1 823.9085 1645.8025 2 1645.802 0.0005 1 22.25 0.024 R ASSHSSQTQGGGSVTKK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.804.804.2.dta 4 1 IPI00021405.3 Isoform A of Lamin-A/C 1526 74380 45 45 38 38 6619 4154 1 1 1 564.9293 1691.7661 3 1691.7685 -0.0024 1 27.64 0.0026 K SNEDQSMGNWQIKR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4611.4611.3.dta 4 1 IPI00021405.3 Isoform A of Lamin-A/C 1526 74380 45 45 38 38 6662 6103 1 1 1 567.3261 1698.9565 3 1698.9628 -0.0063 1 46.09 4.80E-05 R IRIDSLSAQLSQLQK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6638.6638.3.dta 4 1 IPI00021405.3 Isoform A of Lamin-A/C 1526 74380 45 45 38 38 6663 6112 1 1 1 850.4871 1698.9596 2 1698.9628 -0.0032 1 122.32 3.20E-12 R IRIDSLSAQLSQLQK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6646.6646.2.dta 4 1 IPI00021405.3 Isoform A of Lamin-A/C 1526 74380 45 45 38 38 6704 3214 1 1 1 570.2593 1707.756 3 1707.7635 -0.0075 1 21.58 0.0095 K SNEDQSMGNWQIKR Q Oxidation (M) 0.00000010000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3572.3572.3.dta 4 1 IPI00021405.3 Isoform A of Lamin-A/C 1526 74380 45 45 38 38 6800 8723 1 1 1 866.421 1730.8274 2 1730.8296 -0.0022 1 42.72 9.90E-05 R GRASSHSSQTQGGGSVTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.935.935.2.dta 4 1 IPI00021405.3 Isoform A of Lamin-A/C 1526 74380 45 45 38 38 6801 8665 1 1 1 577.9501 1730.8284 3 1730.8296 -0.0012 1 71.96 5.40E-07 R GRASSHSSQTQGGGSVTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.929.929.3.dta 4 1 IPI00021405.3 Isoform A of Lamin-A/C 1526 74380 45 45 38 38 6903 4142 1 1 1 584.9589 1751.8548 3 1751.855 -0.0003 0 45.8 5.10E-05 R NSNLVGAAHEELQQSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4598.4598.3.dta 4 1 IPI00021405.3 Isoform A of Lamin-A/C 1526 74380 45 45 38 38 6904 4149 1 1 1 876.9347 1751.8548 2 1751.855 -0.0002 0 78.11 4.70E-08 R NSNLVGAAHEELQQSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4605.4605.2.dta 4 1 IPI00021405.3 Isoform A of Lamin-A/C 1526 74380 45 45 38 38 7483 7109 1 1 1 947.4661 1892.9176 2 1892.9189 -0.0014 0 92.17 8.50E-09 R MQQQLDEYQELLDIK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7655.7655.2.dta 4 1 IPI00021405.3 Isoform A of Lamin-A/C 1526 74380 45 45 38 38 8283 3869 1 1 1 581.7883 2323.124 4 2323.1264 -0.0025 1 30.3 0.0022 R QSAERNSNLVGAAHEELQQSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4302.4302.4.dta 4 1 IPI00021405.3 Isoform A of Lamin-A/C 1526 74380 45 45 38 38 8284 3873 1 1 1 775.3828 2323.1266 3 2323.1264 0.0002 1 35.55 0.00046 R QSAERNSNLVGAAHEELQQSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4306.4306.3.dta 4 1 IPI00021405.3 Isoform A of Lamin-A/C 1526 74380 45 45 38 38 8320 3845 1 1 1 789.0573 2364.1499 3 2364.1517 -0.0018 0 35.47 0.00047 K ASASGSGAQVGGPISSGSSASSVTVTR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4276.4276.3.dta 4 IPI00644087.1 Progerin 1506 69492 44 44 37 37 867 4742 1 0 1 415.753 829.4915 2 829.4909 0.0006 0 27.9 0.022 R LQLELSK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5248.5248.2.dta 4 IPI00644087.1 Progerin 1506 69492 44 44 37 37 996 4507 1 0 1 425.2451 848.4756 2 848.4756 0 0 40.72 0.00085 R LAVYIDR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4993.4993.2.dta 4 IPI00644087.1 Progerin 1506 69492 44 44 37 37 1043 1775 1 0 1 429.7557 857.4968 2 857.497 -0.0002 1 39.11 0.0034 R LLAEKER E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1995.1995.2.dta 4 IPI00644087.1 Progerin 1506 69492 44 44 37 37 1060 1749 1 0 1 431.2559 860.4972 2 860.4967 0.0004 1 41.31 0.0008 R KTLDSVAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1967.1967.2.dta 4 IPI00644087.1 Progerin 1506 69492 44 44 37 37 1397 4409 1 0 1 459.7299 917.4453 2 917.4454 -0.0001 0 43.84 0.00095 R DLEDSLAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4887.4887.2.dta 4 IPI00644087.1 Progerin 1506 69492 44 44 37 37 1400 1376 1 0 1 460.2231 918.4316 2 918.4308 0.0008 0 46.39 0.0005 R SSFSQHAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1564.1564.2.dta 4 IPI00644087.1 Progerin 1506 69492 44 44 37 37 1588 1076 1 0 1 475.2506 948.4867 2 948.4876 -0.0009 1 53.31 5.60E-05 R KLESTESR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1239.1239.2.dta 4 IPI00644087.1 Progerin 1506 69492 44 44 37 37 1735 1918 1 0 1 486.7594 971.5042 2 971.5036 0.0006 0 20.64 0.034 R LSPSPTSQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2150.2150.2.dta 4 IPI00644087.1 Progerin 1506 69492 44 44 37 37 2096 5325 1 0 1 514.7909 1027.5672 2 1027.5662 0.0011 0 75.49 6.50E-07 R LADALQELR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5859.5859.2.dta 4 IPI00644087.1 Progerin 1506 69492 44 44 37 37 2105 2572 1 0 1 515.2996 1028.5847 2 1028.5866 -0.0019 1 32.14 0.011 K LEAALGEAKK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2861.2861.2.dta 4 IPI00644087.1 Progerin 1506 69492 44 44 37 37 2193 3578 1 0 1 522.2778 1042.541 2 1042.5407 0.0003 0 61.07 1.30E-05 K EGDLIAAQAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3983.3983.2.dta 4 IPI00644087.1 Progerin 1506 69492 44 44 37 37 2305 4243 1 0 1 529.3226 1056.6307 2 1056.6291 0.0016 1 23.4 0.032 R ARLQLELSK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4707.4707.2.dta 4 IPI00644087.1 Progerin 1506 69492 44 44 37 37 3040 3776 1 0 1 583.2764 1164.5382 2 1164.5411 -0.0029 0 96.79 4.10E-09 K AAYEAELGDAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4201.4201.2.dta 4 IPI00644087.1 Progerin 1506 69492 44 44 37 37 3083 2518 1 0 1 586.3239 1170.6333 2 1170.6357 -0.0024 1 32.77 0.015 R LVEIDNGKQR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2803.2803.2.dta 4 IPI00644087.1 Progerin 1506 69492 44 44 37 37 3085 2983 1 0 1 586.326 1170.6375 2 1170.6357 0.0019 1 70.74 1.80E-06 K KEGDLIAAQAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3311.3311.2.dta 4 IPI00644087.1 Progerin 1506 69492 44 44 37 37 3188 4228 1 0 1 396.5519 1186.6339 3 1186.6306 0.0033 1 48.38 0.0003 K LRDLEDSLAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4691.4691.3.dta 4 IPI00644087.1 Progerin 1506 69492 44 44 37 37 3642 3689 1 0 1 622.3383 1242.6621 2 1242.6568 0.0053 1 31.92 0.0019 K LLEGEEERLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4105.4105.2.dta 4 IPI00644087.1 Progerin 1506 69492 44 44 37 37 3645 5956 1 0 1 415.2466 1242.718 3 1242.7183 -0.0003 1 25.58 0.0044 R LKDLEALLNSK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6490.6490.3.dta 4 IPI00644087.1 Progerin 1506 69492 44 44 37 37 3913 3699 1 0 1 638.3496 1274.6847 2 1274.683 0.0017 1 57.86 1.60E-05 K EAALSTALSEKR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4117.4117.2.dta 4 IPI00644087.1 Progerin 1506 69492 44 44 37 37 4033 3126 1 0 1 647.3241 1292.6336 2 1292.636 -0.0024 1 50.05 0.00023 K AAYEAELGDARK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3465.3465.2.dta 4 IPI00644087.1 Progerin 1506 69492 44 44 37 37 4507 2846 1 0 1 680.3474 1358.6803 2 1358.679 0.0013 0 59.64 2.60E-06 R SGAQASSTPLSPTR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3159.3159.2.dta 4 IPI00644087.1 Progerin 1506 69492 44 44 37 37 4535 3865 1 0 1 682.3119 1362.6092 2 1362.6099 -0.0007 0 65.81 6.70E-07 K AQNTWGCGNSLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4298.4298.2.dta 4 IPI00644087.1 Progerin 1506 69492 44 44 37 37 4862 2783 1 0 1 703.8204 1405.6262 2 1405.633 -0.0068 0 83.93 3.50E-08 R TVLCGTCGQPADK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3091.3091.2.dta 4 IPI00644087.1 Progerin 1506 69492 44 44 37 37 4935 3819 1 0 1 709.3845 1416.7545 2 1416.7572 -0.0027 1 50.03 8.50E-05 R LRITESEEVVSR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4248.4248.2.dta 4 IPI00644087.1 Progerin 1506 69492 44 44 37 37 5016 5870 1 0 1 715.8958 1429.777 2 1429.7776 -0.0007 0 56.3 2.70E-05 R IDSLSAQLSQLQK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6406.6406.2.dta 4 IPI00644087.1 Progerin 1506 69492 44 44 37 37 5414 4752 1 0 1 746.3768 1490.739 2 1490.7399 -0.0009 0 87.54 6.20E-09 R TALINSTGEEVAMR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5259.5259.2.dta 4 IPI00644087.1 Progerin 1506 69492 44 44 37 37 5453 1568 1 0 1 501.5789 1501.7147 3 1501.7161 -0.0014 1 68.87 2.20E-06 R AQHEDQVEQYKK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1771.1771.3.dta 4 IPI00644087.1 Progerin 1506 69492 44 44 37 37 5475 4023 1 0 1 754.3728 1506.7311 2 1506.7348 -0.0037 0 75.63 5.50E-07 R TALINSTGEEVAMR K Oxidation (M) 0.00000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4469.4469.2.dta 4 IPI00644087.1 Progerin 1506 69492 44 44 37 37 5518 141 1 0 1 759.861 1517.7074 2 1517.707 0.0003 0 101.55 3.00E-10 R ASSHSSQTQGGGSVTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1017.1017.2.dta 4 IPI00644087.1 Progerin 1506 69492 44 44 37 37 5993 4226 1 0 1 803.4089 1604.8033 2 1604.8046 -0.0013 1 87.69 6.00E-09 R VAVEEVDEEGKFVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4689.4689.2.dta 4 IPI00644087.1 Progerin 1506 69492 44 44 37 37 6136 3614 1 0 1 543.9402 1628.7987 3 1628.8005 -0.0018 1 46.75 0.00026 R LQEKEDLQELNDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4022.4022.3.dta 4 IPI00644087.1 Progerin 1506 69492 44 44 37 37 6137 3619 1 0 1 815.407 1628.7995 2 1628.8005 -0.001 1 74.94 5.50E-07 R LQEKEDLQELNDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4027.4027.2.dta 4 IPI00644087.1 Progerin 1506 69492 44 44 37 37 6294 7454 1 0 1 823.9085 1645.8025 2 1645.802 0.0005 1 22.25 0.024 R ASSHSSQTQGGGSVTKK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.804.804.2.dta 4 IPI00644087.1 Progerin 1506 69492 44 44 37 37 6619 4154 1 0 1 564.9293 1691.7661 3 1691.7685 -0.0024 1 27.64 0.0026 K SNEDQSMGNWQIKR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4611.4611.3.dta 4 IPI00644087.1 Progerin 1506 69492 44 44 37 37 6662 6103 1 0 1 567.3261 1698.9565 3 1698.9628 -0.0063 1 46.09 4.80E-05 R IRIDSLSAQLSQLQK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6638.6638.3.dta 4 IPI00644087.1 Progerin 1506 69492 44 44 37 37 6663 6112 1 0 1 850.4871 1698.9596 2 1698.9628 -0.0032 1 122.32 3.20E-12 R IRIDSLSAQLSQLQK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6646.6646.2.dta 4 IPI00644087.1 Progerin 1506 69492 44 44 37 37 6704 3214 1 0 1 570.2593 1707.756 3 1707.7635 -0.0075 1 21.58 0.0095 K SNEDQSMGNWQIKR Q Oxidation (M) 0.00000010000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3572.3572.3.dta 4 IPI00644087.1 Progerin 1506 69492 44 44 37 37 6800 8723 1 0 1 866.421 1730.8274 2 1730.8296 -0.0022 1 42.72 9.90E-05 R GRASSHSSQTQGGGSVTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.935.935.2.dta 4 IPI00644087.1 Progerin 1506 69492 44 44 37 37 6801 8665 1 0 1 577.9501 1730.8284 3 1730.8296 -0.0012 1 71.96 5.40E-07 R GRASSHSSQTQGGGSVTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.929.929.3.dta 4 IPI00644087.1 Progerin 1506 69492 44 44 37 37 6903 4142 1 0 1 584.9589 1751.8548 3 1751.855 -0.0003 0 45.8 5.10E-05 R NSNLVGAAHEELQQSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4598.4598.3.dta 4 IPI00644087.1 Progerin 1506 69492 44 44 37 37 6904 4149 1 0 1 876.9347 1751.8548 2 1751.855 -0.0002 0 78.11 4.70E-08 R NSNLVGAAHEELQQSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4605.4605.2.dta 4 IPI00644087.1 Progerin 1506 69492 44 44 37 37 7483 7109 1 0 1 947.4661 1892.9176 2 1892.9189 -0.0014 0 92.17 8.50E-09 R MQQQLDEYQELLDIK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7655.7655.2.dta 4 IPI00644087.1 Progerin 1506 69492 44 44 37 37 8283 3869 1 0 1 581.7883 2323.124 4 2323.1264 -0.0025 1 30.3 0.0022 R QSAERNSNLVGAAHEELQQSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4302.4302.4.dta 4 IPI00644087.1 Progerin 1506 69492 44 44 37 37 8284 3873 1 0 1 775.3828 2323.1266 3 2323.1264 0.0002 1 35.55 0.00046 R QSAERNSNLVGAAHEELQQSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4306.4306.3.dta 4 IPI00216952.1 Isoform C of Lamin-A/C 1444 65153 43 43 36 36 867 4742 1 0 1 415.753 829.4915 2 829.4909 0.0006 0 27.9 0.022 R LQLELSK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5248.5248.2.dta 4 IPI00216952.1 Isoform C of Lamin-A/C 1444 65153 43 43 36 36 996 4507 1 0 1 425.2451 848.4756 2 848.4756 0 0 40.72 0.00085 R LAVYIDR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4993.4993.2.dta 4 IPI00216952.1 Isoform C of Lamin-A/C 1444 65153 43 43 36 36 1043 1775 1 0 1 429.7557 857.4968 2 857.497 -0.0002 1 39.11 0.0034 R LLAEKER E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1995.1995.2.dta 4 IPI00216952.1 Isoform C of Lamin-A/C 1444 65153 43 43 36 36 1060 1749 1 0 1 431.2559 860.4972 2 860.4967 0.0004 1 41.31 0.0008 R KTLDSVAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1967.1967.2.dta 4 IPI00216952.1 Isoform C of Lamin-A/C 1444 65153 43 43 36 36 1397 4409 1 0 1 459.7299 917.4453 2 917.4454 -0.0001 0 43.84 0.00095 R DLEDSLAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4887.4887.2.dta 4 IPI00216952.1 Isoform C of Lamin-A/C 1444 65153 43 43 36 36 1400 1376 1 0 1 460.2231 918.4316 2 918.4308 0.0008 0 46.39 0.0005 R SSFSQHAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1564.1564.2.dta 4 IPI00216952.1 Isoform C of Lamin-A/C 1444 65153 43 43 36 36 1588 1076 1 0 1 475.2506 948.4867 2 948.4876 -0.0009 1 53.31 5.60E-05 R KLESTESR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1239.1239.2.dta 4 IPI00216952.1 Isoform C of Lamin-A/C 1444 65153 43 43 36 36 1735 1918 1 0 1 486.7594 971.5042 2 971.5036 0.0006 0 20.64 0.034 R LSPSPTSQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2150.2150.2.dta 4 IPI00216952.1 Isoform C of Lamin-A/C 1444 65153 43 43 36 36 2096 5325 1 0 1 514.7909 1027.5672 2 1027.5662 0.0011 0 75.49 6.50E-07 R LADALQELR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5859.5859.2.dta 4 IPI00216952.1 Isoform C of Lamin-A/C 1444 65153 43 43 36 36 2105 2572 1 0 1 515.2996 1028.5847 2 1028.5866 -0.0019 1 32.14 0.011 K LEAALGEAKK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2861.2861.2.dta 4 IPI00216952.1 Isoform C of Lamin-A/C 1444 65153 43 43 36 36 2193 3578 1 0 1 522.2778 1042.541 2 1042.5407 0.0003 0 61.07 1.30E-05 K EGDLIAAQAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3983.3983.2.dta 4 IPI00216952.1 Isoform C of Lamin-A/C 1444 65153 43 43 36 36 2305 4243 1 0 1 529.3226 1056.6307 2 1056.6291 0.0016 1 23.4 0.032 R ARLQLELSK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4707.4707.2.dta 4 IPI00216952.1 Isoform C of Lamin-A/C 1444 65153 43 43 36 36 3040 3776 1 0 1 583.2764 1164.5382 2 1164.5411 -0.0029 0 96.79 4.10E-09 K AAYEAELGDAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4201.4201.2.dta 4 IPI00216952.1 Isoform C of Lamin-A/C 1444 65153 43 43 36 36 3083 2518 1 0 1 586.3239 1170.6333 2 1170.6357 -0.0024 1 32.77 0.015 R LVEIDNGKQR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2803.2803.2.dta 4 IPI00216952.1 Isoform C of Lamin-A/C 1444 65153 43 43 36 36 3085 2983 1 0 1 586.326 1170.6375 2 1170.6357 0.0019 1 70.74 1.80E-06 K KEGDLIAAQAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3311.3311.2.dta 4 IPI00216952.1 Isoform C of Lamin-A/C 1444 65153 43 43 36 36 3188 4228 1 0 1 396.5519 1186.6339 3 1186.6306 0.0033 1 48.38 0.0003 K LRDLEDSLAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4691.4691.3.dta 4 IPI00216952.1 Isoform C of Lamin-A/C 1444 65153 43 43 36 36 3642 3689 1 0 1 622.3383 1242.6621 2 1242.6568 0.0053 1 31.92 0.0019 K LLEGEEERLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4105.4105.2.dta 4 IPI00216952.1 Isoform C of Lamin-A/C 1444 65153 43 43 36 36 3645 5956 1 0 1 415.2466 1242.718 3 1242.7183 -0.0003 1 25.58 0.0044 R LKDLEALLNSK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6490.6490.3.dta 4 IPI00216952.1 Isoform C of Lamin-A/C 1444 65153 43 43 36 36 3913 3699 1 0 1 638.3496 1274.6847 2 1274.683 0.0017 1 57.86 1.60E-05 K EAALSTALSEKR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4117.4117.2.dta 4 IPI00216952.1 Isoform C of Lamin-A/C 1444 65153 43 43 36 36 4033 3126 1 0 1 647.3241 1292.6336 2 1292.636 -0.0024 1 50.05 0.00023 K AAYEAELGDARK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3465.3465.2.dta 4 IPI00216952.1 Isoform C of Lamin-A/C 1444 65153 43 43 36 36 4507 2846 1 0 1 680.3474 1358.6803 2 1358.679 0.0013 0 59.64 2.60E-06 R SGAQASSTPLSPTR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3159.3159.2.dta 4 IPI00216952.1 Isoform C of Lamin-A/C 1444 65153 43 43 36 36 4535 3865 1 0 1 682.3119 1362.6092 2 1362.6099 -0.0007 0 65.81 6.70E-07 K AQNTWGCGNSLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4298.4298.2.dta 4 IPI00216952.1 Isoform C of Lamin-A/C 1444 65153 43 43 36 36 4935 3819 1 0 1 709.3845 1416.7545 2 1416.7572 -0.0027 1 50.03 8.50E-05 R LRITESEEVVSR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4248.4248.2.dta 4 IPI00216952.1 Isoform C of Lamin-A/C 1444 65153 43 43 36 36 5016 5870 1 0 1 715.8958 1429.777 2 1429.7776 -0.0007 0 56.3 2.70E-05 R IDSLSAQLSQLQK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6406.6406.2.dta 4 IPI00216952.1 Isoform C of Lamin-A/C 1444 65153 43 43 36 36 5414 4752 1 0 1 746.3768 1490.739 2 1490.7399 -0.0009 0 87.54 6.20E-09 R TALINSTGEEVAMR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5259.5259.2.dta 4 IPI00216952.1 Isoform C of Lamin-A/C 1444 65153 43 43 36 36 5453 1568 1 0 1 501.5789 1501.7147 3 1501.7161 -0.0014 1 68.87 2.20E-06 R AQHEDQVEQYKK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1771.1771.3.dta 4 IPI00216952.1 Isoform C of Lamin-A/C 1444 65153 43 43 36 36 5475 4023 1 0 1 754.3728 1506.7311 2 1506.7348 -0.0037 0 75.63 5.50E-07 R TALINSTGEEVAMR K Oxidation (M) 0.00000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4469.4469.2.dta 4 IPI00216952.1 Isoform C of Lamin-A/C 1444 65153 43 43 36 36 5518 141 1 0 1 759.861 1517.7074 2 1517.707 0.0003 0 101.55 3.00E-10 R ASSHSSQTQGGGSVTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1017.1017.2.dta 4 IPI00216952.1 Isoform C of Lamin-A/C 1444 65153 43 43 36 36 5993 4226 1 0 1 803.4089 1604.8033 2 1604.8046 -0.0013 1 87.69 6.00E-09 R VAVEEVDEEGKFVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4689.4689.2.dta 4 IPI00216952.1 Isoform C of Lamin-A/C 1444 65153 43 43 36 36 6136 3614 1 0 1 543.9402 1628.7987 3 1628.8005 -0.0018 1 46.75 0.00026 R LQEKEDLQELNDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4022.4022.3.dta 4 IPI00216952.1 Isoform C of Lamin-A/C 1444 65153 43 43 36 36 6137 3619 1 0 1 815.407 1628.7995 2 1628.8005 -0.001 1 74.94 5.50E-07 R LQEKEDLQELNDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4027.4027.2.dta 4 IPI00216952.1 Isoform C of Lamin-A/C 1444 65153 43 43 36 36 6294 7454 1 0 1 823.9085 1645.8025 2 1645.802 0.0005 1 22.25 0.024 R ASSHSSQTQGGGSVTKK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.804.804.2.dta 4 IPI00216952.1 Isoform C of Lamin-A/C 1444 65153 43 43 36 36 6619 4154 1 0 1 564.9293 1691.7661 3 1691.7685 -0.0024 1 27.64 0.0026 K SNEDQSMGNWQIKR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4611.4611.3.dta 4 IPI00216952.1 Isoform C of Lamin-A/C 1444 65153 43 43 36 36 6662 6103 1 0 1 567.3261 1698.9565 3 1698.9628 -0.0063 1 46.09 4.80E-05 R IRIDSLSAQLSQLQK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6638.6638.3.dta 4 IPI00216952.1 Isoform C of Lamin-A/C 1444 65153 43 43 36 36 6663 6112 1 0 1 850.4871 1698.9596 2 1698.9628 -0.0032 1 122.32 3.20E-12 R IRIDSLSAQLSQLQK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6646.6646.2.dta 4 IPI00216952.1 Isoform C of Lamin-A/C 1444 65153 43 43 36 36 6704 3214 1 0 1 570.2593 1707.756 3 1707.7635 -0.0075 1 21.58 0.0095 K SNEDQSMGNWQIKR Q Oxidation (M) 0.00000010000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3572.3572.3.dta 4 IPI00216952.1 Isoform C of Lamin-A/C 1444 65153 43 43 36 36 6800 8723 1 0 1 866.421 1730.8274 2 1730.8296 -0.0022 1 42.72 9.90E-05 R GRASSHSSQTQGGGSVTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.935.935.2.dta 4 IPI00216952.1 Isoform C of Lamin-A/C 1444 65153 43 43 36 36 6801 8665 1 0 1 577.9501 1730.8284 3 1730.8296 -0.0012 1 71.96 5.40E-07 R GRASSHSSQTQGGGSVTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.929.929.3.dta 4 IPI00216952.1 Isoform C of Lamin-A/C 1444 65153 43 43 36 36 6903 4142 1 0 1 584.9589 1751.8548 3 1751.855 -0.0003 0 45.8 5.10E-05 R NSNLVGAAHEELQQSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4598.4598.3.dta 4 IPI00216952.1 Isoform C of Lamin-A/C 1444 65153 43 43 36 36 6904 4149 1 0 1 876.9347 1751.8548 2 1751.855 -0.0002 0 78.11 4.70E-08 R NSNLVGAAHEELQQSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4605.4605.2.dta 4 IPI00216952.1 Isoform C of Lamin-A/C 1444 65153 43 43 36 36 7483 7109 1 0 1 947.4661 1892.9176 2 1892.9189 -0.0014 0 92.17 8.50E-09 R MQQQLDEYQELLDIK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7655.7655.2.dta 4 IPI00216952.1 Isoform C of Lamin-A/C 1444 65153 43 43 36 36 8283 3869 1 0 1 581.7883 2323.124 4 2323.1264 -0.0025 1 30.3 0.0022 R QSAERNSNLVGAAHEELQQSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4302.4302.4.dta 4 IPI00216952.1 Isoform C of Lamin-A/C 1444 65153 43 43 36 36 8284 3873 1 0 1 775.3828 2323.1266 3 2323.1264 0.0002 1 35.55 0.00046 R QSAERNSNLVGAAHEELQQSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4306.4306.3.dta 4 IPI00216953.1 Isoform ADelta10 of Lamin-A/C 1407 70903 43 43 37 37 867 4742 1 0 1 415.753 829.4915 2 829.4909 0.0006 0 27.9 0.022 R LQLELSK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5248.5248.2.dta 4 IPI00216953.1 Isoform ADelta10 of Lamin-A/C 1407 70903 43 43 37 37 996 4507 1 0 1 425.2451 848.4756 2 848.4756 0 0 40.72 0.00085 R LAVYIDR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4993.4993.2.dta 4 IPI00216953.1 Isoform ADelta10 of Lamin-A/C 1407 70903 43 43 37 37 1043 1775 1 0 1 429.7557 857.4968 2 857.497 -0.0002 1 39.11 0.0034 R LLAEKER E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1995.1995.2.dta 4 IPI00216953.1 Isoform ADelta10 of Lamin-A/C 1407 70903 43 43 37 37 1060 1749 1 0 1 431.2559 860.4972 2 860.4967 0.0004 1 41.31 0.0008 R KTLDSVAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1967.1967.2.dta 4 IPI00216953.1 Isoform ADelta10 of Lamin-A/C 1407 70903 43 43 37 37 1397 4409 1 0 1 459.7299 917.4453 2 917.4454 -0.0001 0 43.84 0.00095 R DLEDSLAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4887.4887.2.dta 4 IPI00216953.1 Isoform ADelta10 of Lamin-A/C 1407 70903 43 43 37 37 1400 1376 1 0 1 460.2231 918.4316 2 918.4308 0.0008 0 46.39 0.0005 R SSFSQHAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1564.1564.2.dta 4 IPI00216953.1 Isoform ADelta10 of Lamin-A/C 1407 70903 43 43 37 37 1588 1076 1 0 1 475.2506 948.4867 2 948.4876 -0.0009 1 53.31 5.60E-05 R KLESTESR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1239.1239.2.dta 4 IPI00216953.1 Isoform ADelta10 of Lamin-A/C 1407 70903 43 43 37 37 1735 1918 1 0 1 486.7594 971.5042 2 971.5036 0.0006 0 20.64 0.034 R LSPSPTSQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2150.2150.2.dta 4 IPI00216953.1 Isoform ADelta10 of Lamin-A/C 1407 70903 43 43 37 37 2096 5325 1 0 1 514.7909 1027.5672 2 1027.5662 0.0011 0 75.49 6.50E-07 R LADALQELR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5859.5859.2.dta 4 IPI00216953.1 Isoform ADelta10 of Lamin-A/C 1407 70903 43 43 37 37 2105 2572 1 0 1 515.2996 1028.5847 2 1028.5866 -0.0019 1 32.14 0.011 K LEAALGEAKK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2861.2861.2.dta 4 IPI00216953.1 Isoform ADelta10 of Lamin-A/C 1407 70903 43 43 37 37 2193 3578 1 0 1 522.2778 1042.541 2 1042.5407 0.0003 0 61.07 1.30E-05 K EGDLIAAQAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3983.3983.2.dta 4 IPI00216953.1 Isoform ADelta10 of Lamin-A/C 1407 70903 43 43 37 37 2305 4243 1 0 1 529.3226 1056.6307 2 1056.6291 0.0016 1 23.4 0.032 R ARLQLELSK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4707.4707.2.dta 4 IPI00216953.1 Isoform ADelta10 of Lamin-A/C 1407 70903 43 43 37 37 3040 3776 1 0 1 583.2764 1164.5382 2 1164.5411 -0.0029 0 96.79 4.10E-09 K AAYEAELGDAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4201.4201.2.dta 4 IPI00216953.1 Isoform ADelta10 of Lamin-A/C 1407 70903 43 43 37 37 3083 2518 1 0 1 586.3239 1170.6333 2 1170.6357 -0.0024 1 32.77 0.015 R LVEIDNGKQR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2803.2803.2.dta 4 IPI00216953.1 Isoform ADelta10 of Lamin-A/C 1407 70903 43 43 37 37 3085 2983 1 0 1 586.326 1170.6375 2 1170.6357 0.0019 1 70.74 1.80E-06 K KEGDLIAAQAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3311.3311.2.dta 4 IPI00216953.1 Isoform ADelta10 of Lamin-A/C 1407 70903 43 43 37 37 3188 4228 1 0 1 396.5519 1186.6339 3 1186.6306 0.0033 1 48.38 0.0003 K LRDLEDSLAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4691.4691.3.dta 4 IPI00216953.1 Isoform ADelta10 of Lamin-A/C 1407 70903 43 43 37 37 3642 3689 1 0 1 622.3383 1242.6621 2 1242.6568 0.0053 1 31.92 0.0019 K LLEGEEERLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4105.4105.2.dta 4 IPI00216953.1 Isoform ADelta10 of Lamin-A/C 1407 70903 43 43 37 37 3645 5956 1 0 1 415.2466 1242.718 3 1242.7183 -0.0003 1 25.58 0.0044 R LKDLEALLNSK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6490.6490.3.dta 4 IPI00216953.1 Isoform ADelta10 of Lamin-A/C 1407 70903 43 43 37 37 3913 3699 1 0 1 638.3496 1274.6847 2 1274.683 0.0017 1 57.86 1.60E-05 K EAALSTALSEKR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4117.4117.2.dta 4 IPI00216953.1 Isoform ADelta10 of Lamin-A/C 1407 70903 43 43 37 37 4033 3126 1 0 1 647.3241 1292.6336 2 1292.636 -0.0024 1 50.05 0.00023 K AAYEAELGDARK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3465.3465.2.dta 4 IPI00216953.1 Isoform ADelta10 of Lamin-A/C 1407 70903 43 43 37 37 4507 2846 1 0 1 680.3474 1358.6803 2 1358.679 0.0013 0 59.64 2.60E-06 R SGAQASSTPLSPTR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3159.3159.2.dta 4 IPI00216953.1 Isoform ADelta10 of Lamin-A/C 1407 70903 43 43 37 37 4535 3865 1 0 1 682.3119 1362.6092 2 1362.6099 -0.0007 0 65.81 6.70E-07 K AQNTWGCGNSLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4298.4298.2.dta 4 IPI00216953.1 Isoform ADelta10 of Lamin-A/C 1407 70903 43 43 37 37 4862 2783 1 0 1 703.8204 1405.6262 2 1405.633 -0.0068 0 83.93 3.50E-08 R TVLCGTCGQPADK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3091.3091.2.dta 4 IPI00216953.1 Isoform ADelta10 of Lamin-A/C 1407 70903 43 43 37 37 4935 3819 1 0 1 709.3845 1416.7545 2 1416.7572 -0.0027 1 50.03 8.50E-05 R LRITESEEVVSR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4248.4248.2.dta 4 IPI00216953.1 Isoform ADelta10 of Lamin-A/C 1407 70903 43 43 37 37 5016 5870 1 0 1 715.8958 1429.777 2 1429.7776 -0.0007 0 56.3 2.70E-05 R IDSLSAQLSQLQK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6406.6406.2.dta 4 IPI00216953.1 Isoform ADelta10 of Lamin-A/C 1407 70903 43 43 37 37 5453 1568 1 0 1 501.5789 1501.7147 3 1501.7161 -0.0014 1 68.87 2.20E-06 R AQHEDQVEQYKK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1771.1771.3.dta 4 IPI00216953.1 Isoform ADelta10 of Lamin-A/C 1407 70903 43 43 37 37 5518 141 1 0 1 759.861 1517.7074 2 1517.707 0.0003 0 101.55 3.00E-10 R ASSHSSQTQGGGSVTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1017.1017.2.dta 4 IPI00216953.1 Isoform ADelta10 of Lamin-A/C 1407 70903 43 43 37 37 5993 4226 1 0 1 803.4089 1604.8033 2 1604.8046 -0.0013 1 87.69 6.00E-09 R VAVEEVDEEGKFVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4689.4689.2.dta 4 IPI00216953.1 Isoform ADelta10 of Lamin-A/C 1407 70903 43 43 37 37 6136 3614 1 0 1 543.9402 1628.7987 3 1628.8005 -0.0018 1 46.75 0.00026 R LQEKEDLQELNDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4022.4022.3.dta 4 IPI00216953.1 Isoform ADelta10 of Lamin-A/C 1407 70903 43 43 37 37 6137 3619 1 0 1 815.407 1628.7995 2 1628.8005 -0.001 1 74.94 5.50E-07 R LQEKEDLQELNDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4027.4027.2.dta 4 IPI00216953.1 Isoform ADelta10 of Lamin-A/C 1407 70903 43 43 37 37 6294 7454 1 0 1 823.9085 1645.8025 2 1645.802 0.0005 1 22.25 0.024 R ASSHSSQTQGGGSVTKK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.804.804.2.dta 4 IPI00216953.1 Isoform ADelta10 of Lamin-A/C 1407 70903 43 43 37 37 6619 4154 1 0 1 564.9293 1691.7661 3 1691.7685 -0.0024 1 27.64 0.0026 K SNEDQSMGNWQIKR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4611.4611.3.dta 4 IPI00216953.1 Isoform ADelta10 of Lamin-A/C 1407 70903 43 43 37 37 6662 6103 1 0 1 567.3261 1698.9565 3 1698.9628 -0.0063 1 46.09 4.80E-05 R IRIDSLSAQLSQLQK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6638.6638.3.dta 4 IPI00216953.1 Isoform ADelta10 of Lamin-A/C 1407 70903 43 43 37 37 6663 6112 1 0 1 850.4871 1698.9596 2 1698.9628 -0.0032 1 122.32 3.20E-12 R IRIDSLSAQLSQLQK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6646.6646.2.dta 4 IPI00216953.1 Isoform ADelta10 of Lamin-A/C 1407 70903 43 43 37 37 6704 3214 1 0 1 570.2593 1707.756 3 1707.7635 -0.0075 1 21.58 0.0095 K SNEDQSMGNWQIKR Q Oxidation (M) 0.00000010000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3572.3572.3.dta 4 IPI00216953.1 Isoform ADelta10 of Lamin-A/C 1407 70903 43 43 37 37 6800 8723 1 0 1 866.421 1730.8274 2 1730.8296 -0.0022 1 42.72 9.90E-05 R GRASSHSSQTQGGGSVTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.935.935.2.dta 4 IPI00216953.1 Isoform ADelta10 of Lamin-A/C 1407 70903 43 43 37 37 6801 8665 1 0 1 577.9501 1730.8284 3 1730.8296 -0.0012 1 71.96 5.40E-07 R GRASSHSSQTQGGGSVTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.929.929.3.dta 4 IPI00216953.1 Isoform ADelta10 of Lamin-A/C 1407 70903 43 43 37 37 6903 4142 1 0 1 584.9589 1751.8548 3 1751.855 -0.0003 0 45.8 5.10E-05 R NSNLVGAAHEELQQSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4598.4598.3.dta 4 IPI00216953.1 Isoform ADelta10 of Lamin-A/C 1407 70903 43 43 37 37 6904 4149 1 0 1 876.9347 1751.8548 2 1751.855 -0.0002 0 78.11 4.70E-08 R NSNLVGAAHEELQQSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4605.4605.2.dta 4 IPI00216953.1 Isoform ADelta10 of Lamin-A/C 1407 70903 43 43 37 37 7483 7109 1 0 1 947.4661 1892.9176 2 1892.9189 -0.0014 0 92.17 8.50E-09 R MQQQLDEYQELLDIK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7655.7655.2.dta 4 IPI00216953.1 Isoform ADelta10 of Lamin-A/C 1407 70903 43 43 37 37 8283 3869 1 0 1 581.7883 2323.124 4 2323.1264 -0.0025 1 30.3 0.0022 R QSAERNSNLVGAAHEELQQSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4302.4302.4.dta 4 IPI00216953.1 Isoform ADelta10 of Lamin-A/C 1407 70903 43 43 37 37 8284 3873 1 0 1 775.3828 2323.1266 3 2323.1264 0.0002 1 35.55 0.00046 R QSAERNSNLVGAAHEELQQSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4306.4306.3.dta 4 IPI00216953.1 Isoform ADelta10 of Lamin-A/C 1407 70903 43 43 37 37 8320 3845 1 0 1 789.0573 2364.1499 3 2364.1517 -0.0018 0 35.47 0.00047 K ASASGSGAQVGGPISSGSSASSVTVTR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4276.4276.3.dta 4 IPI00655812.1 Rhabdomyosarcoma antigen MU-RMS-40.12 1305 55605 39 39 33 33 867 4742 1 0 1 415.753 829.4915 2 829.4909 0.0006 0 27.9 0.022 R LQLELSK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5248.5248.2.dta 4 IPI00655812.1 Rhabdomyosarcoma antigen MU-RMS-40.12 1305 55605 39 39 33 33 996 4507 1 0 1 425.2451 848.4756 2 848.4756 0 0 40.72 0.00085 R LAVYIDR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4993.4993.2.dta 4 IPI00655812.1 Rhabdomyosarcoma antigen MU-RMS-40.12 1305 55605 39 39 33 33 1043 1775 1 0 1 429.7557 857.4968 2 857.497 -0.0002 1 39.11 0.0034 R LLAEKER E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1995.1995.2.dta 4 IPI00655812.1 Rhabdomyosarcoma antigen MU-RMS-40.12 1305 55605 39 39 33 33 1060 1749 1 0 1 431.2559 860.4972 2 860.4967 0.0004 1 41.31 0.0008 R KTLDSVAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1967.1967.2.dta 4 IPI00655812.1 Rhabdomyosarcoma antigen MU-RMS-40.12 1305 55605 39 39 33 33 1397 4409 1 0 1 459.7299 917.4453 2 917.4454 -0.0001 0 43.84 0.00095 R DLEDSLAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4887.4887.2.dta 4 IPI00655812.1 Rhabdomyosarcoma antigen MU-RMS-40.12 1305 55605 39 39 33 33 1400 1376 1 0 1 460.2231 918.4316 2 918.4308 0.0008 0 46.39 0.0005 R SSFSQHAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1564.1564.2.dta 4 IPI00655812.1 Rhabdomyosarcoma antigen MU-RMS-40.12 1305 55605 39 39 33 33 1588 1076 1 0 1 475.2506 948.4867 2 948.4876 -0.0009 1 53.31 5.60E-05 R KLESTESR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1239.1239.2.dta 4 IPI00655812.1 Rhabdomyosarcoma antigen MU-RMS-40.12 1305 55605 39 39 33 33 1735 1918 1 0 1 486.7594 971.5042 2 971.5036 0.0006 0 20.64 0.034 R LSPSPTSQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2150.2150.2.dta 4 IPI00655812.1 Rhabdomyosarcoma antigen MU-RMS-40.12 1305 55605 39 39 33 33 2096 5325 1 0 1 514.7909 1027.5672 2 1027.5662 0.0011 0 75.49 6.50E-07 R LADALQELR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5859.5859.2.dta 4 IPI00655812.1 Rhabdomyosarcoma antigen MU-RMS-40.12 1305 55605 39 39 33 33 2105 2572 1 0 1 515.2996 1028.5847 2 1028.5866 -0.0019 1 32.14 0.011 K LEAALGEAKK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2861.2861.2.dta 4 IPI00655812.1 Rhabdomyosarcoma antigen MU-RMS-40.12 1305 55605 39 39 33 33 2193 3578 1 0 1 522.2778 1042.541 2 1042.5407 0.0003 0 61.07 1.30E-05 K EGDLIAAQAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3983.3983.2.dta 4 IPI00655812.1 Rhabdomyosarcoma antigen MU-RMS-40.12 1305 55605 39 39 33 33 2305 4243 1 0 1 529.3226 1056.6307 2 1056.6291 0.0016 1 23.4 0.032 R ARLQLELSK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4707.4707.2.dta 4 IPI00655812.1 Rhabdomyosarcoma antigen MU-RMS-40.12 1305 55605 39 39 33 33 3040 3776 1 0 1 583.2764 1164.5382 2 1164.5411 -0.0029 0 96.79 4.10E-09 K AAYEAELGDAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4201.4201.2.dta 4 IPI00655812.1 Rhabdomyosarcoma antigen MU-RMS-40.12 1305 55605 39 39 33 33 3083 2518 1 0 1 586.3239 1170.6333 2 1170.6357 -0.0024 1 32.77 0.015 R LVEIDNGKQR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2803.2803.2.dta 4 IPI00655812.1 Rhabdomyosarcoma antigen MU-RMS-40.12 1305 55605 39 39 33 33 3085 2983 1 0 1 586.326 1170.6375 2 1170.6357 0.0019 1 70.74 1.80E-06 K KEGDLIAAQAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3311.3311.2.dta 4 IPI00655812.1 Rhabdomyosarcoma antigen MU-RMS-40.12 1305 55605 39 39 33 33 3188 4228 1 0 1 396.5519 1186.6339 3 1186.6306 0.0033 1 48.38 0.0003 K LRDLEDSLAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4691.4691.3.dta 4 IPI00655812.1 Rhabdomyosarcoma antigen MU-RMS-40.12 1305 55605 39 39 33 33 3642 3689 1 0 1 622.3383 1242.6621 2 1242.6568 0.0053 1 31.92 0.0019 K LLEGEEERLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4105.4105.2.dta 4 IPI00655812.1 Rhabdomyosarcoma antigen MU-RMS-40.12 1305 55605 39 39 33 33 3645 5956 1 0 1 415.2466 1242.718 3 1242.7183 -0.0003 1 25.58 0.0044 R LKDLEALLNSK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6490.6490.3.dta 4 IPI00655812.1 Rhabdomyosarcoma antigen MU-RMS-40.12 1305 55605 39 39 33 33 3913 3699 1 0 1 638.3496 1274.6847 2 1274.683 0.0017 1 57.86 1.60E-05 K EAALSTALSEKR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4117.4117.2.dta 4 IPI00655812.1 Rhabdomyosarcoma antigen MU-RMS-40.12 1305 55605 39 39 33 33 4033 3126 1 0 1 647.3241 1292.6336 2 1292.636 -0.0024 1 50.05 0.00023 K AAYEAELGDARK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3465.3465.2.dta 4 IPI00655812.1 Rhabdomyosarcoma antigen MU-RMS-40.12 1305 55605 39 39 33 33 4507 2846 1 0 1 680.3474 1358.6803 2 1358.679 0.0013 0 59.64 2.60E-06 R SGAQASSTPLSPTR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3159.3159.2.dta 4 IPI00655812.1 Rhabdomyosarcoma antigen MU-RMS-40.12 1305 55605 39 39 33 33 4935 3819 1 0 1 709.3845 1416.7545 2 1416.7572 -0.0027 1 50.03 8.50E-05 R LRITESEEVVSR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4248.4248.2.dta 4 IPI00655812.1 Rhabdomyosarcoma antigen MU-RMS-40.12 1305 55605 39 39 33 33 5016 5870 1 0 1 715.8958 1429.777 2 1429.7776 -0.0007 0 56.3 2.70E-05 R IDSLSAQLSQLQK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6406.6406.2.dta 4 IPI00655812.1 Rhabdomyosarcoma antigen MU-RMS-40.12 1305 55605 39 39 33 33 5414 4752 1 0 1 746.3768 1490.739 2 1490.7399 -0.0009 0 87.54 6.20E-09 R TALINSTGEEVAMR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5259.5259.2.dta 4 IPI00655812.1 Rhabdomyosarcoma antigen MU-RMS-40.12 1305 55605 39 39 33 33 5453 1568 1 0 1 501.5789 1501.7147 3 1501.7161 -0.0014 1 68.87 2.20E-06 R AQHEDQVEQYKK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1771.1771.3.dta 4 IPI00655812.1 Rhabdomyosarcoma antigen MU-RMS-40.12 1305 55605 39 39 33 33 5475 4023 1 0 1 754.3728 1506.7311 2 1506.7348 -0.0037 0 75.63 5.50E-07 R TALINSTGEEVAMR K Oxidation (M) 0.00000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4469.4469.2.dta 4 IPI00655812.1 Rhabdomyosarcoma antigen MU-RMS-40.12 1305 55605 39 39 33 33 5518 141 1 0 1 759.861 1517.7074 2 1517.707 0.0003 0 101.55 3.00E-10 R ASSHSSQTQGGGSVTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1017.1017.2.dta 4 IPI00655812.1 Rhabdomyosarcoma antigen MU-RMS-40.12 1305 55605 39 39 33 33 6136 3614 1 0 1 543.9402 1628.7987 3 1628.8005 -0.0018 1 46.75 0.00026 R LQEKEDLQELNDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4022.4022.3.dta 4 IPI00655812.1 Rhabdomyosarcoma antigen MU-RMS-40.12 1305 55605 39 39 33 33 6137 3619 1 0 1 815.407 1628.7995 2 1628.8005 -0.001 1 74.94 5.50E-07 R LQEKEDLQELNDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4027.4027.2.dta 4 IPI00655812.1 Rhabdomyosarcoma antigen MU-RMS-40.12 1305 55605 39 39 33 33 6294 7454 1 0 1 823.9085 1645.8025 2 1645.802 0.0005 1 22.25 0.024 R ASSHSSQTQGGGSVTKK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.804.804.2.dta 4 IPI00655812.1 Rhabdomyosarcoma antigen MU-RMS-40.12 1305 55605 39 39 33 33 6662 6103 1 0 1 567.3261 1698.9565 3 1698.9628 -0.0063 1 46.09 4.80E-05 R IRIDSLSAQLSQLQK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6638.6638.3.dta 4 IPI00655812.1 Rhabdomyosarcoma antigen MU-RMS-40.12 1305 55605 39 39 33 33 6663 6112 1 0 1 850.4871 1698.9596 2 1698.9628 -0.0032 1 122.32 3.20E-12 R IRIDSLSAQLSQLQK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6646.6646.2.dta 4 IPI00655812.1 Rhabdomyosarcoma antigen MU-RMS-40.12 1305 55605 39 39 33 33 6800 8723 1 0 1 866.421 1730.8274 2 1730.8296 -0.0022 1 42.72 9.90E-05 R GRASSHSSQTQGGGSVTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.935.935.2.dta 4 IPI00655812.1 Rhabdomyosarcoma antigen MU-RMS-40.12 1305 55605 39 39 33 33 6801 8665 1 0 1 577.9501 1730.8284 3 1730.8296 -0.0012 1 71.96 5.40E-07 R GRASSHSSQTQGGGSVTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.929.929.3.dta 4 IPI00655812.1 Rhabdomyosarcoma antigen MU-RMS-40.12 1305 55605 39 39 33 33 6903 4142 1 0 1 584.9589 1751.8548 3 1751.855 -0.0003 0 45.8 5.10E-05 R NSNLVGAAHEELQQSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4598.4598.3.dta 4 IPI00655812.1 Rhabdomyosarcoma antigen MU-RMS-40.12 1305 55605 39 39 33 33 6904 4149 1 0 1 876.9347 1751.8548 2 1751.855 -0.0002 0 78.11 4.70E-08 R NSNLVGAAHEELQQSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4605.4605.2.dta 4 IPI00655812.1 Rhabdomyosarcoma antigen MU-RMS-40.12 1305 55605 39 39 33 33 7483 7109 1 0 1 947.4661 1892.9176 2 1892.9189 -0.0014 0 92.17 8.50E-09 R MQQQLDEYQELLDIK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7655.7655.2.dta 4 IPI00655812.1 Rhabdomyosarcoma antigen MU-RMS-40.12 1305 55605 39 39 33 33 8283 3869 1 0 1 581.7883 2323.124 4 2323.1264 -0.0025 1 30.3 0.0022 R QSAERNSNLVGAAHEELQQSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4302.4302.4.dta 4 IPI00655812.1 Rhabdomyosarcoma antigen MU-RMS-40.12 1305 55605 39 39 33 33 8284 3873 1 0 1 775.3828 2323.1266 3 2323.1264 0.0002 1 35.55 0.00046 R QSAERNSNLVGAAHEELQQSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4306.4306.3.dta 4 IPI00514204.3 Lamin A/C 1185 53219 37 37 32 32 867 4742 1 0 1 415.753 829.4915 2 829.4909 0.0006 0 27.9 0.022 R LQLELSK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5248.5248.2.dta 4 IPI00514204.3 Lamin A/C 1185 53219 37 37 32 32 996 4507 1 0 1 425.2451 848.4756 2 848.4756 0 0 40.72 0.00085 R LAVYIDR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4993.4993.2.dta 4 IPI00514204.3 Lamin A/C 1185 53219 37 37 32 32 1043 1775 1 0 1 429.7557 857.4968 2 857.497 -0.0002 1 39.11 0.0034 R LLAEKER E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1995.1995.2.dta 4 IPI00514204.3 Lamin A/C 1185 53219 37 37 32 32 1060 1749 1 0 1 431.2559 860.4972 2 860.4967 0.0004 1 41.31 0.0008 R KTLDSVAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1967.1967.2.dta 4 IPI00514204.3 Lamin A/C 1185 53219 37 37 32 32 1397 4409 1 0 1 459.7299 917.4453 2 917.4454 -0.0001 0 43.84 0.00095 R DLEDSLAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4887.4887.2.dta 4 IPI00514204.3 Lamin A/C 1185 53219 37 37 32 32 1400 1376 1 0 1 460.2231 918.4316 2 918.4308 0.0008 0 46.39 0.0005 R SSFSQHAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1564.1564.2.dta 4 IPI00514204.3 Lamin A/C 1185 53219 37 37 32 32 1588 1076 1 0 1 475.2506 948.4867 2 948.4876 -0.0009 1 53.31 5.60E-05 R KLESTESR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1239.1239.2.dta 4 IPI00514204.3 Lamin A/C 1185 53219 37 37 32 32 1735 1918 1 0 1 486.7594 971.5042 2 971.5036 0.0006 0 20.64 0.034 R LSPSPTSQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2150.2150.2.dta 4 IPI00514204.3 Lamin A/C 1185 53219 37 37 32 32 2096 5325 1 0 1 514.7909 1027.5672 2 1027.5662 0.0011 0 75.49 6.50E-07 R LADALQELR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5859.5859.2.dta 4 IPI00514204.3 Lamin A/C 1185 53219 37 37 32 32 2105 2572 1 0 1 515.2996 1028.5847 2 1028.5866 -0.0019 1 32.14 0.011 K LEAALGEAKK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2861.2861.2.dta 4 IPI00514204.3 Lamin A/C 1185 53219 37 37 32 32 2193 3578 1 0 1 522.2778 1042.541 2 1042.5407 0.0003 0 61.07 1.30E-05 K EGDLIAAQAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3983.3983.2.dta 4 IPI00514204.3 Lamin A/C 1185 53219 37 37 32 32 2305 4243 1 0 1 529.3226 1056.6307 2 1056.6291 0.0016 1 23.4 0.032 R ARLQLELSK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4707.4707.2.dta 4 IPI00514204.3 Lamin A/C 1185 53219 37 37 32 32 3040 3776 1 0 1 583.2764 1164.5382 2 1164.5411 -0.0029 0 96.79 4.10E-09 K AAYEAELGDAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4201.4201.2.dta 4 IPI00514204.3 Lamin A/C 1185 53219 37 37 32 32 3083 2518 1 0 1 586.3239 1170.6333 2 1170.6357 -0.0024 1 32.77 0.015 R LVEIDNGKQR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2803.2803.2.dta 4 IPI00514204.3 Lamin A/C 1185 53219 37 37 32 32 3085 2983 1 0 1 586.326 1170.6375 2 1170.6357 0.0019 1 70.74 1.80E-06 K KEGDLIAAQAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3311.3311.2.dta 4 IPI00514204.3 Lamin A/C 1185 53219 37 37 32 32 3188 4228 1 0 1 396.5519 1186.6339 3 1186.6306 0.0033 1 48.38 0.0003 K LRDLEDSLAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4691.4691.3.dta 4 IPI00514204.3 Lamin A/C 1185 53219 37 37 32 32 3642 3689 1 0 1 622.3383 1242.6621 2 1242.6568 0.0053 1 31.92 0.0019 K LLEGEEERLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4105.4105.2.dta 4 IPI00514204.3 Lamin A/C 1185 53219 37 37 32 32 3645 5956 1 0 1 415.2466 1242.718 3 1242.7183 -0.0003 1 25.58 0.0044 R LKDLEALLNSK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6490.6490.3.dta 4 IPI00514204.3 Lamin A/C 1185 53219 37 37 32 32 3913 3699 1 0 1 638.3496 1274.6847 2 1274.683 0.0017 1 57.86 1.60E-05 K EAALSTALSEKR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4117.4117.2.dta 4 IPI00514204.3 Lamin A/C 1185 53219 37 37 32 32 4033 3126 1 0 1 647.3241 1292.6336 2 1292.636 -0.0024 1 50.05 0.00023 K AAYEAELGDARK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3465.3465.2.dta 4 IPI00514204.3 Lamin A/C 1185 53219 37 37 32 32 4507 2846 1 0 1 680.3474 1358.6803 2 1358.679 0.0013 0 59.64 2.60E-06 R SGAQASSTPLSPTR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3159.3159.2.dta 4 IPI00514204.3 Lamin A/C 1185 53219 37 37 32 32 4935 3819 1 0 1 709.3845 1416.7545 2 1416.7572 -0.0027 1 50.03 8.50E-05 R LRITESEEVVSR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4248.4248.2.dta 4 IPI00514204.3 Lamin A/C 1185 53219 37 37 32 32 5016 5870 1 0 1 715.8958 1429.777 2 1429.7776 -0.0007 0 56.3 2.70E-05 R IDSLSAQLSQLQK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6406.6406.2.dta 4 IPI00514204.3 Lamin A/C 1185 53219 37 37 32 32 5453 1568 1 0 1 501.5789 1501.7147 3 1501.7161 -0.0014 1 68.87 2.20E-06 R AQHEDQVEQYKK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1771.1771.3.dta 4 IPI00514204.3 Lamin A/C 1185 53219 37 37 32 32 5518 141 1 0 1 759.861 1517.7074 2 1517.707 0.0003 0 101.55 3.00E-10 R ASSHSSQTQGGGSVTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1017.1017.2.dta 4 IPI00514204.3 Lamin A/C 1185 53219 37 37 32 32 6136 3614 1 0 1 543.9402 1628.7987 3 1628.8005 -0.0018 1 46.75 0.00026 R LQEKEDLQELNDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4022.4022.3.dta 4 IPI00514204.3 Lamin A/C 1185 53219 37 37 32 32 6137 3619 1 0 1 815.407 1628.7995 2 1628.8005 -0.001 1 74.94 5.50E-07 R LQEKEDLQELNDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4027.4027.2.dta 4 IPI00514204.3 Lamin A/C 1185 53219 37 37 32 32 6294 7454 1 0 1 823.9085 1645.8025 2 1645.802 0.0005 1 22.25 0.024 R ASSHSSQTQGGGSVTKK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.804.804.2.dta 4 IPI00514204.3 Lamin A/C 1185 53219 37 37 32 32 6662 6103 1 0 1 567.3261 1698.9565 3 1698.9628 -0.0063 1 46.09 4.80E-05 R IRIDSLSAQLSQLQK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6638.6638.3.dta 4 IPI00514204.3 Lamin A/C 1185 53219 37 37 32 32 6663 6112 1 0 1 850.4871 1698.9596 2 1698.9628 -0.0032 1 122.32 3.20E-12 R IRIDSLSAQLSQLQK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6646.6646.2.dta 4 IPI00514204.3 Lamin A/C 1185 53219 37 37 32 32 6800 8723 1 0 1 866.421 1730.8274 2 1730.8296 -0.0022 1 42.72 9.90E-05 R GRASSHSSQTQGGGSVTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.935.935.2.dta 4 IPI00514204.3 Lamin A/C 1185 53219 37 37 32 32 6801 8665 1 0 1 577.9501 1730.8284 3 1730.8296 -0.0012 1 71.96 5.40E-07 R GRASSHSSQTQGGGSVTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.929.929.3.dta 4 IPI00514204.3 Lamin A/C 1185 53219 37 37 32 32 6903 4142 1 0 1 584.9589 1751.8548 3 1751.855 -0.0003 0 45.8 5.10E-05 R NSNLVGAAHEELQQSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4598.4598.3.dta 4 IPI00514204.3 Lamin A/C 1185 53219 37 37 32 32 6904 4149 1 0 1 876.9347 1751.8548 2 1751.855 -0.0002 0 78.11 4.70E-08 R NSNLVGAAHEELQQSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4605.4605.2.dta 4 IPI00514204.3 Lamin A/C 1185 53219 37 37 32 32 7483 7109 1 0 1 947.4661 1892.9176 2 1892.9189 -0.0014 0 92.17 8.50E-09 R MQQQLDEYQELLDIK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7655.7655.2.dta 4 IPI00514204.3 Lamin A/C 1185 53219 37 37 32 32 8283 3869 1 0 1 581.7883 2323.124 4 2323.1264 -0.0025 1 30.3 0.0022 R QSAERNSNLVGAAHEELQQSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4302.4302.4.dta 4 IPI00514204.3 Lamin A/C 1185 53219 37 37 32 32 8284 3873 1 0 1 775.3828 2323.1266 3 2323.1264 0.0002 1 35.55 0.00046 R QSAERNSNLVGAAHEELQQSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4306.4306.3.dta 4 IPI00514320.3 Lamin A/C 1160 57897 33 33 27 27 1043 1775 1 0 1 429.7557 857.4968 2 857.497 -0.0002 1 39.11 0.0034 R LLAEKER E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1995.1995.2.dta 4 IPI00514320.3 Lamin A/C 1160 57897 33 33 27 27 1397 4409 1 0 1 459.7299 917.4453 2 917.4454 -0.0001 0 43.84 0.00095 R DLEDSLAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4887.4887.2.dta 4 IPI00514320.3 Lamin A/C 1160 57897 33 33 27 27 1400 1376 1 0 1 460.2231 918.4316 2 918.4308 0.0008 0 46.39 0.0005 R SSFSQHAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1564.1564.2.dta 4 IPI00514320.3 Lamin A/C 1160 57897 33 33 27 27 1588 1076 1 0 1 475.2506 948.4867 2 948.4876 -0.0009 1 53.31 5.60E-05 R KLESTESR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1239.1239.2.dta 4 IPI00514320.3 Lamin A/C 1160 57897 33 33 27 27 1735 1918 1 0 1 486.7594 971.5042 2 971.5036 0.0006 0 20.64 0.034 R LSPSPTSQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2150.2150.2.dta 4 IPI00514320.3 Lamin A/C 1160 57897 33 33 27 27 2096 5325 1 0 1 514.7909 1027.5672 2 1027.5662 0.0011 0 75.49 6.50E-07 R LADALQELR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5859.5859.2.dta 4 IPI00514320.3 Lamin A/C 1160 57897 33 33 27 27 2105 2572 1 0 1 515.2996 1028.5847 2 1028.5866 -0.0019 1 32.14 0.011 K LEAALGEAKK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2861.2861.2.dta 4 IPI00514320.3 Lamin A/C 1160 57897 33 33 27 27 2193 3578 1 0 1 522.2778 1042.541 2 1042.5407 0.0003 0 61.07 1.30E-05 K EGDLIAAQAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3983.3983.2.dta 4 IPI00514320.3 Lamin A/C 1160 57897 33 33 27 27 3083 2518 1 0 1 586.3239 1170.6333 2 1170.6357 -0.0024 1 32.77 0.015 R LVEIDNGKQR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2803.2803.2.dta 4 IPI00514320.3 Lamin A/C 1160 57897 33 33 27 27 3085 2983 1 0 1 586.326 1170.6375 2 1170.6357 0.0019 1 70.74 1.80E-06 K KEGDLIAAQAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3311.3311.2.dta 4 IPI00514320.3 Lamin A/C 1160 57897 33 33 27 27 3188 4228 1 0 1 396.5519 1186.6339 3 1186.6306 0.0033 1 48.38 0.0003 K LRDLEDSLAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4691.4691.3.dta 4 IPI00514320.3 Lamin A/C 1160 57897 33 33 27 27 3642 3689 1 0 1 622.3383 1242.6621 2 1242.6568 0.0053 1 31.92 0.0019 K LLEGEEERLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4105.4105.2.dta 4 IPI00514320.3 Lamin A/C 1160 57897 33 33 27 27 3645 5956 1 0 1 415.2466 1242.718 3 1242.7183 -0.0003 1 25.58 0.0044 R LKDLEALLNSK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6490.6490.3.dta 4 IPI00514320.3 Lamin A/C 1160 57897 33 33 27 27 3913 3699 1 0 1 638.3496 1274.6847 2 1274.683 0.0017 1 57.86 1.60E-05 K EAALSTALSEKR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4117.4117.2.dta 4 IPI00514320.3 Lamin A/C 1160 57897 33 33 27 27 4535 3865 1 0 1 682.3119 1362.6092 2 1362.6099 -0.0007 0 65.81 6.70E-07 K AQNTWGCGNSLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4298.4298.2.dta 4 IPI00514320.3 Lamin A/C 1160 57897 33 33 27 27 5016 5870 1 0 1 715.8958 1429.777 2 1429.7776 -0.0007 0 56.3 2.70E-05 R IDSLSAQLSQLQK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6406.6406.2.dta 4 IPI00514320.3 Lamin A/C 1160 57897 33 33 27 27 5414 4752 1 0 1 746.3768 1490.739 2 1490.7399 -0.0009 0 87.54 6.20E-09 R TALINSTGEEVAMR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5259.5259.2.dta 4 IPI00514320.3 Lamin A/C 1160 57897 33 33 27 27 5453 1568 1 0 1 501.5789 1501.7147 3 1501.7161 -0.0014 1 68.87 2.20E-06 R AQHEDQVEQYKK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1771.1771.3.dta 4 IPI00514320.3 Lamin A/C 1160 57897 33 33 27 27 5475 4023 1 0 1 754.3728 1506.7311 2 1506.7348 -0.0037 0 75.63 5.50E-07 R TALINSTGEEVAMR K Oxidation (M) 0.00000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4469.4469.2.dta 4 IPI00514320.3 Lamin A/C 1160 57897 33 33 27 27 5518 141 1 0 1 759.861 1517.7074 2 1517.707 0.0003 0 101.55 3.00E-10 R ASSHSSQTQGGGSVTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1017.1017.2.dta 4 IPI00514320.3 Lamin A/C 1160 57897 33 33 27 27 5993 4226 1 0 1 803.4089 1604.8033 2 1604.8046 -0.0013 1 87.69 6.00E-09 R VAVEEVDEEGKFVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4689.4689.2.dta 4 IPI00514320.3 Lamin A/C 1160 57897 33 33 27 27 6294 7454 1 0 1 823.9085 1645.8025 2 1645.802 0.0005 1 22.25 0.024 R ASSHSSQTQGGGSVTKK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.804.804.2.dta 4 IPI00514320.3 Lamin A/C 1160 57897 33 33 27 27 6619 4154 1 0 1 564.9293 1691.7661 3 1691.7685 -0.0024 1 27.64 0.0026 K SNEDQSMGNWQIKR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4611.4611.3.dta 4 IPI00514320.3 Lamin A/C 1160 57897 33 33 27 27 6662 6103 1 0 1 567.3261 1698.9565 3 1698.9628 -0.0063 1 46.09 4.80E-05 R IRIDSLSAQLSQLQK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6638.6638.3.dta 4 IPI00514320.3 Lamin A/C 1160 57897 33 33 27 27 6663 6112 1 0 1 850.4871 1698.9596 2 1698.9628 -0.0032 1 122.32 3.20E-12 R IRIDSLSAQLSQLQK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6646.6646.2.dta 4 IPI00514320.3 Lamin A/C 1160 57897 33 33 27 27 6704 3214 1 0 1 570.2593 1707.756 3 1707.7635 -0.0075 1 21.58 0.0095 K SNEDQSMGNWQIKR Q Oxidation (M) 0.00000010000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3572.3572.3.dta 4 IPI00514320.3 Lamin A/C 1160 57897 33 33 27 27 6800 8723 1 0 1 866.421 1730.8274 2 1730.8296 -0.0022 1 42.72 9.90E-05 R GRASSHSSQTQGGGSVTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.935.935.2.dta 4 IPI00514320.3 Lamin A/C 1160 57897 33 33 27 27 6801 8665 1 0 1 577.9501 1730.8284 3 1730.8296 -0.0012 1 71.96 5.40E-07 R GRASSHSSQTQGGGSVTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.929.929.3.dta 4 IPI00514320.3 Lamin A/C 1160 57897 33 33 27 27 6903 4142 1 0 1 584.9589 1751.8548 3 1751.855 -0.0003 0 45.8 5.10E-05 R NSNLVGAAHEELQQSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4598.4598.3.dta 4 IPI00514320.3 Lamin A/C 1160 57897 33 33 27 27 6904 4149 1 0 1 876.9347 1751.8548 2 1751.855 -0.0002 0 78.11 4.70E-08 R NSNLVGAAHEELQQSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4605.4605.2.dta 4 IPI00514320.3 Lamin A/C 1160 57897 33 33 27 27 7483 7109 1 0 1 947.4661 1892.9176 2 1892.9189 -0.0014 0 92.17 8.50E-09 R MQQQLDEYQELLDIK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7655.7655.2.dta 4 IPI00514320.3 Lamin A/C 1160 57897 33 33 27 27 8283 3869 1 0 1 581.7883 2323.124 4 2323.1264 -0.0025 1 30.3 0.0022 R QSAERNSNLVGAAHEELQQSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4302.4302.4.dta 4 IPI00514320.3 Lamin A/C 1160 57897 33 33 27 27 8284 3873 1 0 1 775.3828 2323.1266 3 2323.1264 0.0002 1 35.55 0.00046 R QSAERNSNLVGAAHEELQQSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4306.4306.3.dta 5 1 IPI00479186.5 Isoform M2 of Pyruvate kinase isozymes M1/M2 1041 58470 36 36 28 28 32 3181 1 1 1 304.1553 606.2961 2 606.2982 -0.002 0 23.39 0.029 K MMIGR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3532.3532.2.dta 5 1 IPI00479186.5 Isoform M2 of Pyruvate kinase isozymes M1/M2 1041 58470 36 36 28 28 384 1822 1 1 1 359.2114 716.4082 2 716.4069 0.0014 0 31.41 0.026 K VVEVGSK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2046.2046.2.dta 5 1 IPI00479186.5 Isoform M2 of Pyruvate kinase isozymes M1/M2 1041 58470 36 36 28 28 439 2063 1 1 1 367.6848 733.3551 2 733.3541 0.001 0 49.09 0.00038 K SGMNVAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2308.2308.2.dta 5 1 IPI00479186.5 Isoform M2 of Pyruvate kinase isozymes M1/M2 1041 58470 36 36 28 28 581 7628 1 1 1 384.7095 767.4045 2 767.4038 0.0007 0 40.87 0.00054 R SAHQVAR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.824.824.2.dta 5 1 IPI00479186.5 Isoform M2 of Pyruvate kinase isozymes M1/M2 1041 58470 36 36 28 28 1086 2565 1 1 1 434.7447 867.4748 2 867.4749 0 0 42.76 0.00071 R MQHLIAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2854.2854.2.dta 5 1 IPI00479186.5 Isoform M2 of Pyruvate kinase isozymes M1/M2 1041 58470 36 36 28 28 1197 2041 1 1 1 442.7422 883.4699 2 883.4698 0.0001 0 47.34 0.00024 R MQHLIAR E Oxidation (M) 0.1000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2284.2284.2.dta 5 1 IPI00479186.5 Isoform M2 of Pyruvate kinase isozymes M1/M2 1041 58470 36 36 28 28 1490 6505 1 1 1 467.2654 932.5162 2 932.5154 0.0008 0 26.91 0.048 R GIFPVLCK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7036.7036.2.dta 5 1 IPI00479186.5 Isoform M2 of Pyruvate kinase isozymes M1/M2 1041 58470 36 36 28 28 2054 4788 1 1 1 510.2621 1018.5096 2 1018.5083 0.0013 0 59.37 3.00E-05 K GDYPLEAVR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5298.5298.2.dta 5 1 IPI00479186.5 Isoform M2 of Pyruvate kinase isozymes M1/M2 1041 58470 36 36 28 28 2168 1087 1 1 1 520.7779 1039.5412 2 1039.541 0.0002 1 64.51 5.30E-06 R KASDVHEVR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1251.1251.2.dta 5 1 IPI00479186.5 Isoform M2 of Pyruvate kinase isozymes M1/M2 1041 58470 36 36 28 28 2170 773 1 1 1 520.7781 1039.5417 2 1039.541 0.0007 1 28.01 0.023 K ASDVHEVRK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1109.1109.2.dta 5 1 IPI00479186.5 Isoform M2 of Pyruvate kinase isozymes M1/M2 1041 58470 36 36 28 28 2734 2278 1 1 1 559.806 1117.5975 2 1117.5979 -0.0004 1 57.78 2.10E-05 K GSGTAEVELKK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2543.2543.2.dta 5 1 IPI00479186.5 Isoform M2 of Pyruvate kinase isozymes M1/M2 1041 58470 36 36 28 28 2897 5440 1 1 1 571.3083 1140.6021 2 1140.6026 -0.0005 0 48.98 0.00017 R GDLGIEIPAEK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5975.5975.2.dta 5 1 IPI00479186.5 Isoform M2 of Pyruvate kinase isozymes M1/M2 1041 58470 36 36 28 28 3138 5930 1 1 1 589.3282 1176.6419 2 1176.6424 -0.0004 1 47.96 0.00026 R SVETLKEMIK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6464.6464.2.dta 5 1 IPI00479186.5 Isoform M2 of Pyruvate kinase isozymes M1/M2 1041 58470 36 36 28 28 3219 3462 1 1 1 597.3247 1192.6349 2 1192.6373 -0.0024 1 48.79 0.0002 R SVETLKEMIK S Oxidation (M) 0.0000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3851.3851.2.dta 5 1 IPI00479186.5 Isoform M2 of Pyruvate kinase isozymes M1/M2 1041 58470 36 36 28 28 3220 3476 1 1 1 597.3252 1192.6358 2 1192.6373 -0.0015 1 38.76 0.0021 R SVETLKEMIK S Oxidation (M) 0.0000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3867.3867.2.dta 5 1 IPI00479186.5 Isoform M2 of Pyruvate kinase isozymes M1/M2 1041 58470 36 36 28 28 3255 4935 1 1 1 599.3295 1196.6444 2 1196.6401 0.0043 0 67.34 2.90E-06 R LDIDSPPITAR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5458.5458.2.dta 5 1 IPI00479186.5 Isoform M2 of Pyruvate kinase isozymes M1/M2 1041 58470 36 36 28 28 3401 4100 1 1 1 607.2923 1212.57 2 1212.5696 0.0004 0 33.03 0.0014 K ITLDNAYMEK C Oxidation (M) 0.0000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4552.4552.2.dta 5 1 IPI00479186.5 Isoform M2 of Pyruvate kinase isozymes M1/M2 1041 58470 36 36 28 28 3449 5171 1 1 1 611.3195 1220.6245 2 1220.6257 -0.0012 0 82.25 1.90E-08 K CCSGAIIVLTK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5702.5702.2.dta 5 1 IPI00479186.5 Isoform M2 of Pyruvate kinase isozymes M1/M2 1041 58470 36 36 28 28 4509 4812 1 1 1 680.3553 1358.696 2 1358.6976 -0.0016 0 70.17 1.20E-06 R NTGIICTIGPASR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5324.5324.2.dta 5 1 IPI00479186.5 Isoform M2 of Pyruvate kinase isozymes M1/M2 1041 58470 36 36 28 28 4794 2325 1 1 1 697.8909 1393.7673 2 1393.7677 -0.0004 1 53.48 2.10E-05 K IISKIENHEGVR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2594.2594.2.dta 5 1 IPI00479186.5 Isoform M2 of Pyruvate kinase isozymes M1/M2 1041 58470 36 36 28 28 5240 6921 1 1 1 731.9107 1461.8069 2 1461.8079 -0.001 0 76.41 6.80E-08 K IYVDDGLISLQVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7456.7456.2.dta 5 1 IPI00479186.5 Isoform M2 of Pyruvate kinase isozymes M1/M2 1041 58470 36 36 28 28 6239 6082 1 1 1 818.9482 1635.8818 2 1635.8832 -0.0014 0 57.82 4.30E-06 K GVNLPGAAVDLPAVSEK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6617.6617.2.dta 5 1 IPI00479186.5 Isoform M2 of Pyruvate kinase isozymes M1/M2 1041 58470 36 36 28 28 7010 6636 1 1 1 890.4407 1778.8668 2 1778.8687 -0.0019 0 94.71 1.30E-09 K GADFLVTEVENGGSLGSK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7171.7171.2.dta 5 1 IPI00479186.5 Isoform M2 of Pyruvate kinase isozymes M1/M2 1041 58470 36 36 28 28 7011 6651 1 1 1 593.9635 1778.8687 3 1778.8687 0 0 38.28 0.00026 K GADFLVTEVENGGSLGSK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7187.7187.3.dta 5 1 IPI00479186.5 Isoform M2 of Pyruvate kinase isozymes M1/M2 1041 58470 36 36 28 28 7187 7031 1 1 1 914.514 1827.0134 2 1827.0142 -0.0008 1 53.29 1.20E-05 R GDLGIEIPAEKVFLAQK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7570.7570.2.dta 5 1 IPI00479186.5 Isoform M2 of Pyruvate kinase isozymes M1/M2 1041 58470 36 36 28 28 7188 6927 1 1 1 610.0118 1827.0137 3 1827.0142 -0.0005 1 20.21 0.014 R GDLGIEIPAEKVFLAQK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7462.7462.3.dta 5 1 IPI00479186.5 Isoform M2 of Pyruvate kinase isozymes M1/M2 1041 58470 36 36 28 28 7189 7058 1 1 1 610.0128 1827.0166 3 1827.0142 0.0024 1 26.54 0.0032 R GDLGIEIPAEKVFLAQK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7600.7600.3.dta 5 1 IPI00479186.5 Isoform M2 of Pyruvate kinase isozymes M1/M2 1041 58470 36 36 28 28 7453 3045 1 1 1 628.6374 1882.8903 3 1882.8962 -0.0058 0 53.05 1.10E-05 R LNFSHGTHEYHAETIK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3378.3378.3.dta 5 1 IPI00479186.5 Isoform M2 of Pyruvate kinase isozymes M1/M2 1041 58470 36 36 28 28 7454 3040 1 1 1 471.7308 1882.8941 4 1882.8962 -0.0021 0 37.28 0.0018 R LNFSHGTHEYHAETIK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3373.3373.4.dta 5 1 IPI00479186.5 Isoform M2 of Pyruvate kinase isozymes M1/M2 1041 58470 36 36 28 28 7519 6087 1 1 1 636.661 1906.961 3 1906.9636 -0.0026 1 28 0.0076 K GADFLVTEVENGGSLGSKK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6621.6621.3.dta 5 1 IPI00479186.5 Isoform M2 of Pyruvate kinase isozymes M1/M2 1041 58470 36 36 28 28 7762 6709 1 1 1 661.9805 1982.9196 3 1982.923 -0.0034 1 37.76 0.00029 K CDENILWLDYKNICK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7245.7245.3.dta 5 1 IPI00479186.5 Isoform M2 of Pyruvate kinase isozymes M1/M2 1041 58470 36 36 28 28 7860 5948 1 1 1 679.3479 2035.0219 3 2035.0222 -0.0003 1 66.89 5.30E-07 K QKGADFLVTEVENGGSLGSK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6482.6482.3.dta 5 1 IPI00479186.5 Isoform M2 of Pyruvate kinase isozymes M1/M2 1041 58470 36 36 28 28 8003 7138 1 1 1 1088.0619 2174.1092 2 2174.1107 -0.0014 0 88.08 5.50E-09 R LAPITSDPTEATAVGAVEASFK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7685.7685.2.dta 5 1 IPI00479186.5 Isoform M2 of Pyruvate kinase isozymes M1/M2 1041 58470 36 36 28 28 8004 7135 1 1 1 725.7109 2174.111 3 2174.1107 0.0003 0 64.47 1.10E-06 R LAPITSDPTEATAVGAVEASFK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7681.7681.3.dta 5 1 IPI00479186.5 Isoform M2 of Pyruvate kinase isozymes M1/M2 1041 58470 36 36 28 28 8657 7808 1 1 1 832.0499 2493.128 3 2493.1363 -0.0084 0 26.1 0.0036 R AEGSDVANAVLDGADCIMLSGETAK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8433.8433.3.dta 5 1 IPI00479186.5 Isoform M2 of Pyruvate kinase isozymes M1/M2 1041 58470 36 36 28 28 9069 6886 1 1 1 755.1534 3016.5844 4 3016.5869 -0.0025 1 20.42 0.012 R TATESFASDPILYRPVAVALDTKGPEIR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7420.7420.4.dta 5 IPI00784179.1 58 kDa protein 1006 58474 35 35 27 27 32 3181 1 0 1 304.1553 606.2961 2 606.2982 -0.002 0 23.39 0.029 K MMIGR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3532.3532.2.dta 5 IPI00784179.1 58 kDa protein 1006 58474 35 35 27 27 384 1822 1 0 1 359.2114 716.4082 2 716.4069 0.0014 0 31.41 0.026 K VVEVGSK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2046.2046.2.dta 5 IPI00784179.1 58 kDa protein 1006 58474 35 35 27 27 439 2063 1 0 1 367.6848 733.3551 2 733.3541 0.001 0 49.09 0.00038 K SGMNVAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2308.2308.2.dta 5 IPI00784179.1 58 kDa protein 1006 58474 35 35 27 27 581 7628 1 0 1 384.7095 767.4045 2 767.4038 0.0007 0 40.87 0.00054 R SAHQVAR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.824.824.2.dta 5 IPI00784179.1 58 kDa protein 1006 58474 35 35 27 27 1086 2565 1 0 1 434.7447 867.4748 2 867.4749 0 0 42.76 0.00071 R MQHLIAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2854.2854.2.dta 5 IPI00784179.1 58 kDa protein 1006 58474 35 35 27 27 1197 2041 1 0 1 442.7422 883.4699 2 883.4698 0.0001 0 47.34 0.00024 R MQHLIAR E Oxidation (M) 0.1000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2284.2284.2.dta 5 IPI00784179.1 58 kDa protein 1006 58474 35 35 27 27 1490 6505 1 0 1 467.2654 932.5162 2 932.5154 0.0008 0 26.91 0.048 R GIFPVLCK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7036.7036.2.dta 5 IPI00784179.1 58 kDa protein 1006 58474 35 35 27 27 2054 4788 1 0 1 510.2621 1018.5096 2 1018.5083 0.0013 0 59.37 3.00E-05 K GDYPLEAVR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5298.5298.2.dta 5 IPI00784179.1 58 kDa protein 1006 58474 35 35 27 27 2168 1087 1 0 1 520.7779 1039.5412 2 1039.541 0.0002 1 64.51 5.30E-06 R KASDVHEVR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1251.1251.2.dta 5 IPI00784179.1 58 kDa protein 1006 58474 35 35 27 27 2170 773 1 0 1 520.7781 1039.5417 2 1039.541 0.0007 1 28.01 0.023 K ASDVHEVRK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1109.1109.2.dta 5 IPI00784179.1 58 kDa protein 1006 58474 35 35 27 27 2734 2278 1 0 1 559.806 1117.5975 2 1117.5979 -0.0004 1 57.78 2.10E-05 K GSGTAEVELKK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2543.2543.2.dta 5 IPI00784179.1 58 kDa protein 1006 58474 35 35 27 27 2897 5440 1 0 1 571.3083 1140.6021 2 1140.6026 -0.0005 0 48.98 0.00017 R GDLGIEIPAEK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5975.5975.2.dta 5 IPI00784179.1 58 kDa protein 1006 58474 35 35 27 27 3138 5930 1 0 1 589.3282 1176.6419 2 1176.6424 -0.0004 1 47.96 0.00026 R SVETLKEMIK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6464.6464.2.dta 5 IPI00784179.1 58 kDa protein 1006 58474 35 35 27 27 3219 3462 1 0 1 597.3247 1192.6349 2 1192.6373 -0.0024 1 48.79 0.0002 R SVETLKEMIK S Oxidation (M) 0.0000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3851.3851.2.dta 5 IPI00784179.1 58 kDa protein 1006 58474 35 35 27 27 3220 3476 1 0 1 597.3252 1192.6358 2 1192.6373 -0.0015 1 38.76 0.0021 R SVETLKEMIK S Oxidation (M) 0.0000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3867.3867.2.dta 5 IPI00784179.1 58 kDa protein 1006 58474 35 35 27 27 3255 4935 1 0 1 599.3295 1196.6444 2 1196.6401 0.0043 0 67.34 2.90E-06 R LDIDSPPITAR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5458.5458.2.dta 5 IPI00784179.1 58 kDa protein 1006 58474 35 35 27 27 3401 4100 1 0 1 607.2923 1212.57 2 1212.5696 0.0004 0 33.03 0.0014 K ITLDNAYMEK C Oxidation (M) 0.0000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4552.4552.2.dta 5 IPI00784179.1 58 kDa protein 1006 58474 35 35 27 27 3449 5171 1 0 1 611.3195 1220.6245 2 1220.6257 -0.0012 0 82.25 1.90E-08 K CCSGAIIVLTK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5702.5702.2.dta 5 IPI00784179.1 58 kDa protein 1006 58474 35 35 27 27 4509 4812 1 0 1 680.3553 1358.696 2 1358.6976 -0.0016 0 70.17 1.20E-06 R NTGIICTIGPASR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5324.5324.2.dta 5 IPI00784179.1 58 kDa protein 1006 58474 35 35 27 27 5240 6921 1 0 1 731.9107 1461.8069 2 1461.8079 -0.001 0 76.41 6.80E-08 K IYVDDGLISLQVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7456.7456.2.dta 5 IPI00784179.1 58 kDa protein 1006 58474 35 35 27 27 6239 6082 1 0 1 818.9482 1635.8818 2 1635.8832 -0.0014 0 57.82 4.30E-06 K GVNLPGAAVDLPAVSEK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6617.6617.2.dta 5 IPI00784179.1 58 kDa protein 1006 58474 35 35 27 27 7010 6636 1 0 1 890.4407 1778.8668 2 1778.8687 -0.0019 0 94.71 1.30E-09 K GADFLVTEVENGGSLGSK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7171.7171.2.dta 5 IPI00784179.1 58 kDa protein 1006 58474 35 35 27 27 7011 6651 1 0 1 593.9635 1778.8687 3 1778.8687 0 0 38.28 0.00026 K GADFLVTEVENGGSLGSK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7187.7187.3.dta 5 IPI00784179.1 58 kDa protein 1006 58474 35 35 27 27 7187 7031 1 0 1 914.514 1827.0134 2 1827.0142 -0.0008 1 53.29 1.20E-05 R GDLGIEIPAEKVFLAQK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7570.7570.2.dta 5 IPI00784179.1 58 kDa protein 1006 58474 35 35 27 27 7188 6927 1 0 1 610.0118 1827.0137 3 1827.0142 -0.0005 1 20.21 0.014 R GDLGIEIPAEKVFLAQK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7462.7462.3.dta 5 IPI00784179.1 58 kDa protein 1006 58474 35 35 27 27 7189 7058 1 0 1 610.0128 1827.0166 3 1827.0142 0.0024 1 26.54 0.0032 R GDLGIEIPAEKVFLAQK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7600.7600.3.dta 5 IPI00784179.1 58 kDa protein 1006 58474 35 35 27 27 7453 3045 1 0 1 628.6374 1882.8903 3 1882.8962 -0.0058 0 53.05 1.10E-05 R LNFSHGTHEYHAETIK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3378.3378.3.dta 5 IPI00784179.1 58 kDa protein 1006 58474 35 35 27 27 7454 3040 1 0 1 471.7308 1882.8941 4 1882.8962 -0.0021 0 37.28 0.0018 R LNFSHGTHEYHAETIK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3373.3373.4.dta 5 IPI00784179.1 58 kDa protein 1006 58474 35 35 27 27 7519 6087 1 0 1 636.661 1906.961 3 1906.9636 -0.0026 1 28 0.0076 K GADFLVTEVENGGSLGSKK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6621.6621.3.dta 5 IPI00784179.1 58 kDa protein 1006 58474 35 35 27 27 7762 6709 1 0 1 661.9805 1982.9196 3 1982.923 -0.0034 1 37.76 0.00029 K CDENILWLDYKNICK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7245.7245.3.dta 5 IPI00784179.1 58 kDa protein 1006 58474 35 35 27 27 7860 5948 1 0 1 679.3479 2035.0219 3 2035.0222 -0.0003 1 66.89 5.30E-07 K QKGADFLVTEVENGGSLGSK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6482.6482.3.dta 5 IPI00784179.1 58 kDa protein 1006 58474 35 35 27 27 8003 7138 1 0 1 1088.0619 2174.1092 2 2174.1107 -0.0014 0 88.08 5.50E-09 R LAPITSDPTEATAVGAVEASFK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7685.7685.2.dta 5 IPI00784179.1 58 kDa protein 1006 58474 35 35 27 27 8004 7135 1 0 1 725.7109 2174.111 3 2174.1107 0.0003 0 64.47 1.10E-06 R LAPITSDPTEATAVGAVEASFK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7681.7681.3.dta 5 IPI00784179.1 58 kDa protein 1006 58474 35 35 27 27 8657 7808 1 0 1 832.0499 2493.128 3 2493.1363 -0.0084 0 26.1 0.0036 R AEGSDVANAVLDGADCIMLSGETAK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8433.8433.3.dta 5 IPI00784179.1 58 kDa protein 1006 58474 35 35 27 27 9069 6886 1 0 1 755.1534 3016.5844 4 3016.5869 -0.0025 1 20.42 0.012 R TATESFASDPILYRPVAVALDTKGPEIR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7420.7420.4.dta 5 IPI00220644.8 Isoform M1 of Pyruvate kinase isozymes M1/M2 859 58538 33 33 26 26 32 3181 1 0 1 304.1553 606.2961 2 606.2982 -0.002 0 23.39 0.029 K MMIGR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3532.3532.2.dta 5 IPI00220644.8 Isoform M1 of Pyruvate kinase isozymes M1/M2 859 58538 33 33 26 26 384 1822 1 0 1 359.2114 716.4082 2 716.4069 0.0014 0 31.41 0.026 K VVEVGSK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2046.2046.2.dta 5 IPI00220644.8 Isoform M1 of Pyruvate kinase isozymes M1/M2 859 58538 33 33 26 26 439 2063 1 0 1 367.6848 733.3551 2 733.3541 0.001 0 49.09 0.00038 K SGMNVAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2308.2308.2.dta 5 IPI00220644.8 Isoform M1 of Pyruvate kinase isozymes M1/M2 859 58538 33 33 26 26 581 7628 1 0 1 384.7095 767.4045 2 767.4038 0.0007 0 40.87 0.00054 R SAHQVAR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.824.824.2.dta 5 IPI00220644.8 Isoform M1 of Pyruvate kinase isozymes M1/M2 859 58538 33 33 26 26 1086 2565 1 0 1 434.7447 867.4748 2 867.4749 0 0 42.76 0.00071 R MQHLIAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2854.2854.2.dta 5 IPI00220644.8 Isoform M1 of Pyruvate kinase isozymes M1/M2 859 58538 33 33 26 26 1197 2041 1 0 1 442.7422 883.4699 2 883.4698 0.0001 0 47.34 0.00024 R MQHLIAR E Oxidation (M) 0.1000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2284.2284.2.dta 5 IPI00220644.8 Isoform M1 of Pyruvate kinase isozymes M1/M2 859 58538 33 33 26 26 1490 6505 1 0 1 467.2654 932.5162 2 932.5154 0.0008 0 26.91 0.048 R GIFPVLCK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7036.7036.2.dta 5 IPI00220644.8 Isoform M1 of Pyruvate kinase isozymes M1/M2 859 58538 33 33 26 26 2054 4788 1 0 1 510.2621 1018.5096 2 1018.5083 0.0013 0 59.37 3.00E-05 K GDYPLEAVR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5298.5298.2.dta 5 IPI00220644.8 Isoform M1 of Pyruvate kinase isozymes M1/M2 859 58538 33 33 26 26 2168 1087 1 0 1 520.7779 1039.5412 2 1039.541 0.0002 1 64.51 5.30E-06 R KASDVHEVR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1251.1251.2.dta 5 IPI00220644.8 Isoform M1 of Pyruvate kinase isozymes M1/M2 859 58538 33 33 26 26 2170 773 1 0 1 520.7781 1039.5417 2 1039.541 0.0007 1 28.01 0.023 K ASDVHEVRK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1109.1109.2.dta 5 IPI00220644.8 Isoform M1 of Pyruvate kinase isozymes M1/M2 859 58538 33 33 26 26 2734 2278 1 0 1 559.806 1117.5975 2 1117.5979 -0.0004 1 57.78 2.10E-05 K GSGTAEVELKK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2543.2543.2.dta 5 IPI00220644.8 Isoform M1 of Pyruvate kinase isozymes M1/M2 859 58538 33 33 26 26 2897 5440 1 0 1 571.3083 1140.6021 2 1140.6026 -0.0005 0 48.98 0.00017 R GDLGIEIPAEK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5975.5975.2.dta 5 IPI00220644.8 Isoform M1 of Pyruvate kinase isozymes M1/M2 859 58538 33 33 26 26 3138 5930 1 0 1 589.3282 1176.6419 2 1176.6424 -0.0004 1 47.96 0.00026 R SVETLKEMIK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6464.6464.2.dta 5 IPI00220644.8 Isoform M1 of Pyruvate kinase isozymes M1/M2 859 58538 33 33 26 26 3219 3462 1 0 1 597.3247 1192.6349 2 1192.6373 -0.0024 1 48.79 0.0002 R SVETLKEMIK S Oxidation (M) 0.0000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3851.3851.2.dta 5 IPI00220644.8 Isoform M1 of Pyruvate kinase isozymes M1/M2 859 58538 33 33 26 26 3220 3476 1 0 1 597.3252 1192.6358 2 1192.6373 -0.0015 1 38.76 0.0021 R SVETLKEMIK S Oxidation (M) 0.0000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3867.3867.2.dta 5 IPI00220644.8 Isoform M1 of Pyruvate kinase isozymes M1/M2 859 58538 33 33 26 26 3255 4935 1 0 1 599.3295 1196.6444 2 1196.6401 0.0043 0 67.34 2.90E-06 R LDIDSPPITAR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5458.5458.2.dta 5 IPI00220644.8 Isoform M1 of Pyruvate kinase isozymes M1/M2 859 58538 33 33 26 26 3401 4100 1 0 1 607.2923 1212.57 2 1212.5696 0.0004 0 33.03 0.0014 K ITLDNAYMEK C Oxidation (M) 0.0000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4552.4552.2.dta 5 IPI00220644.8 Isoform M1 of Pyruvate kinase isozymes M1/M2 859 58538 33 33 26 26 4509 4812 1 0 1 680.3553 1358.696 2 1358.6976 -0.0016 0 70.17 1.20E-06 R NTGIICTIGPASR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5324.5324.2.dta 5 IPI00220644.8 Isoform M1 of Pyruvate kinase isozymes M1/M2 859 58538 33 33 26 26 4794 2325 1 0 1 697.8909 1393.7673 2 1393.7677 -0.0004 1 53.48 2.10E-05 K IISKIENHEGVR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2594.2594.2.dta 5 IPI00220644.8 Isoform M1 of Pyruvate kinase isozymes M1/M2 859 58538 33 33 26 26 5240 6921 1 0 1 731.9107 1461.8069 2 1461.8079 -0.001 0 76.41 6.80E-08 K IYVDDGLISLQVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7456.7456.2.dta 5 IPI00220644.8 Isoform M1 of Pyruvate kinase isozymes M1/M2 859 58538 33 33 26 26 6239 6082 1 0 1 818.9482 1635.8818 2 1635.8832 -0.0014 0 57.82 4.30E-06 K GVNLPGAAVDLPAVSEK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6617.6617.2.dta 5 IPI00220644.8 Isoform M1 of Pyruvate kinase isozymes M1/M2 859 58538 33 33 26 26 7010 6636 1 0 1 890.4407 1778.8668 2 1778.8687 -0.0019 0 94.71 1.30E-09 K GADFLVTEVENGGSLGSK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7171.7171.2.dta 5 IPI00220644.8 Isoform M1 of Pyruvate kinase isozymes M1/M2 859 58538 33 33 26 26 7011 6651 1 0 1 593.9635 1778.8687 3 1778.8687 0 0 38.28 0.00026 K GADFLVTEVENGGSLGSK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7187.7187.3.dta 5 IPI00220644.8 Isoform M1 of Pyruvate kinase isozymes M1/M2 859 58538 33 33 26 26 7187 7031 1 0 1 914.514 1827.0134 2 1827.0142 -0.0008 1 53.29 1.20E-05 R GDLGIEIPAEKVFLAQK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7570.7570.2.dta 5 IPI00220644.8 Isoform M1 of Pyruvate kinase isozymes M1/M2 859 58538 33 33 26 26 7188 6927 1 0 1 610.0118 1827.0137 3 1827.0142 -0.0005 1 20.21 0.014 R GDLGIEIPAEKVFLAQK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7462.7462.3.dta 5 IPI00220644.8 Isoform M1 of Pyruvate kinase isozymes M1/M2 859 58538 33 33 26 26 7189 7058 1 0 1 610.0128 1827.0166 3 1827.0142 0.0024 1 26.54 0.0032 R GDLGIEIPAEKVFLAQK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7600.7600.3.dta 5 IPI00220644.8 Isoform M1 of Pyruvate kinase isozymes M1/M2 859 58538 33 33 26 26 7453 3045 1 0 1 628.6374 1882.8903 3 1882.8962 -0.0058 0 53.05 1.10E-05 R LNFSHGTHEYHAETIK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3378.3378.3.dta 5 IPI00220644.8 Isoform M1 of Pyruvate kinase isozymes M1/M2 859 58538 33 33 26 26 7454 3040 1 0 1 471.7308 1882.8941 4 1882.8962 -0.0021 0 37.28 0.0018 R LNFSHGTHEYHAETIK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3373.3373.4.dta 5 IPI00220644.8 Isoform M1 of Pyruvate kinase isozymes M1/M2 859 58538 33 33 26 26 7519 6087 1 0 1 636.661 1906.961 3 1906.9636 -0.0026 1 28 0.0076 K GADFLVTEVENGGSLGSKK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6621.6621.3.dta 5 IPI00220644.8 Isoform M1 of Pyruvate kinase isozymes M1/M2 859 58538 33 33 26 26 7762 6709 1 0 1 661.9805 1982.9196 3 1982.923 -0.0034 1 37.76 0.00029 K CDENILWLDYKNICK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7245.7245.3.dta 5 IPI00220644.8 Isoform M1 of Pyruvate kinase isozymes M1/M2 859 58538 33 33 26 26 7860 5948 1 0 1 679.3479 2035.0219 3 2035.0222 -0.0003 1 66.89 5.30E-07 K QKGADFLVTEVENGGSLGSK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6482.6482.3.dta 5 IPI00220644.8 Isoform M1 of Pyruvate kinase isozymes M1/M2 859 58538 33 33 26 26 8657 7808 1 0 1 832.0499 2493.128 3 2493.1363 -0.0084 0 26.1 0.0036 R AEGSDVANAVLDGADCIMLSGETAK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8433.8433.3.dta 5 IPI00220644.8 Isoform M1 of Pyruvate kinase isozymes M1/M2 859 58538 33 33 26 26 9069 6886 1 0 1 755.1534 3016.5844 4 3016.5869 -0.0025 1 20.42 0.012 R TATESFASDPILYRPVAVALDTKGPEIR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7420.7420.4.dta 5 IPI00783061.1 58 kDa protein 825 58542 32 32 25 25 32 3181 1 0 1 304.1553 606.2961 2 606.2982 -0.002 0 23.39 0.029 K MMIGR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3532.3532.2.dta 5 IPI00783061.1 58 kDa protein 825 58542 32 32 25 25 384 1822 1 0 1 359.2114 716.4082 2 716.4069 0.0014 0 31.41 0.026 K VVEVGSK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2046.2046.2.dta 5 IPI00783061.1 58 kDa protein 825 58542 32 32 25 25 439 2063 1 0 1 367.6848 733.3551 2 733.3541 0.001 0 49.09 0.00038 K SGMNVAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2308.2308.2.dta 5 IPI00783061.1 58 kDa protein 825 58542 32 32 25 25 581 7628 1 0 1 384.7095 767.4045 2 767.4038 0.0007 0 40.87 0.00054 R SAHQVAR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.824.824.2.dta 5 IPI00783061.1 58 kDa protein 825 58542 32 32 25 25 1086 2565 1 0 1 434.7447 867.4748 2 867.4749 0 0 42.76 0.00071 R MQHLIAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2854.2854.2.dta 5 IPI00783061.1 58 kDa protein 825 58542 32 32 25 25 1197 2041 1 0 1 442.7422 883.4699 2 883.4698 0.0001 0 47.34 0.00024 R MQHLIAR E Oxidation (M) 0.1000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2284.2284.2.dta 5 IPI00783061.1 58 kDa protein 825 58542 32 32 25 25 1490 6505 1 0 1 467.2654 932.5162 2 932.5154 0.0008 0 26.91 0.048 R GIFPVLCK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7036.7036.2.dta 5 IPI00783061.1 58 kDa protein 825 58542 32 32 25 25 2054 4788 1 0 1 510.2621 1018.5096 2 1018.5083 0.0013 0 59.37 3.00E-05 K GDYPLEAVR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5298.5298.2.dta 5 IPI00783061.1 58 kDa protein 825 58542 32 32 25 25 2168 1087 1 0 1 520.7779 1039.5412 2 1039.541 0.0002 1 64.51 5.30E-06 R KASDVHEVR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1251.1251.2.dta 5 IPI00783061.1 58 kDa protein 825 58542 32 32 25 25 2170 773 1 0 1 520.7781 1039.5417 2 1039.541 0.0007 1 28.01 0.023 K ASDVHEVRK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1109.1109.2.dta 5 IPI00783061.1 58 kDa protein 825 58542 32 32 25 25 2734 2278 1 0 1 559.806 1117.5975 2 1117.5979 -0.0004 1 57.78 2.10E-05 K GSGTAEVELKK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2543.2543.2.dta 5 IPI00783061.1 58 kDa protein 825 58542 32 32 25 25 2897 5440 1 0 1 571.3083 1140.6021 2 1140.6026 -0.0005 0 48.98 0.00017 R GDLGIEIPAEK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5975.5975.2.dta 5 IPI00783061.1 58 kDa protein 825 58542 32 32 25 25 3138 5930 1 0 1 589.3282 1176.6419 2 1176.6424 -0.0004 1 47.96 0.00026 R SVETLKEMIK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6464.6464.2.dta 5 IPI00783061.1 58 kDa protein 825 58542 32 32 25 25 3219 3462 1 0 1 597.3247 1192.6349 2 1192.6373 -0.0024 1 48.79 0.0002 R SVETLKEMIK S Oxidation (M) 0.0000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3851.3851.2.dta 5 IPI00783061.1 58 kDa protein 825 58542 32 32 25 25 3220 3476 1 0 1 597.3252 1192.6358 2 1192.6373 -0.0015 1 38.76 0.0021 R SVETLKEMIK S Oxidation (M) 0.0000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3867.3867.2.dta 5 IPI00783061.1 58 kDa protein 825 58542 32 32 25 25 3255 4935 1 0 1 599.3295 1196.6444 2 1196.6401 0.0043 0 67.34 2.90E-06 R LDIDSPPITAR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5458.5458.2.dta 5 IPI00783061.1 58 kDa protein 825 58542 32 32 25 25 3401 4100 1 0 1 607.2923 1212.57 2 1212.5696 0.0004 0 33.03 0.0014 K ITLDNAYMEK C Oxidation (M) 0.0000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4552.4552.2.dta 5 IPI00783061.1 58 kDa protein 825 58542 32 32 25 25 4509 4812 1 0 1 680.3553 1358.696 2 1358.6976 -0.0016 0 70.17 1.20E-06 R NTGIICTIGPASR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5324.5324.2.dta 5 IPI00783061.1 58 kDa protein 825 58542 32 32 25 25 5240 6921 1 0 1 731.9107 1461.8069 2 1461.8079 -0.001 0 76.41 6.80E-08 K IYVDDGLISLQVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7456.7456.2.dta 5 IPI00783061.1 58 kDa protein 825 58542 32 32 25 25 6239 6082 1 0 1 818.9482 1635.8818 2 1635.8832 -0.0014 0 57.82 4.30E-06 K GVNLPGAAVDLPAVSEK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6617.6617.2.dta 5 IPI00783061.1 58 kDa protein 825 58542 32 32 25 25 7010 6636 1 0 1 890.4407 1778.8668 2 1778.8687 -0.0019 0 94.71 1.30E-09 K GADFLVTEVENGGSLGSK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7171.7171.2.dta 5 IPI00783061.1 58 kDa protein 825 58542 32 32 25 25 7011 6651 1 0 1 593.9635 1778.8687 3 1778.8687 0 0 38.28 0.00026 K GADFLVTEVENGGSLGSK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7187.7187.3.dta 5 IPI00783061.1 58 kDa protein 825 58542 32 32 25 25 7187 7031 1 0 1 914.514 1827.0134 2 1827.0142 -0.0008 1 53.29 1.20E-05 R GDLGIEIPAEKVFLAQK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7570.7570.2.dta 5 IPI00783061.1 58 kDa protein 825 58542 32 32 25 25 7188 6927 1 0 1 610.0118 1827.0137 3 1827.0142 -0.0005 1 20.21 0.014 R GDLGIEIPAEKVFLAQK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7462.7462.3.dta 5 IPI00783061.1 58 kDa protein 825 58542 32 32 25 25 7189 7058 1 0 1 610.0128 1827.0166 3 1827.0142 0.0024 1 26.54 0.0032 R GDLGIEIPAEKVFLAQK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7600.7600.3.dta 5 IPI00783061.1 58 kDa protein 825 58542 32 32 25 25 7453 3045 1 0 1 628.6374 1882.8903 3 1882.8962 -0.0058 0 53.05 1.10E-05 R LNFSHGTHEYHAETIK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3378.3378.3.dta 5 IPI00783061.1 58 kDa protein 825 58542 32 32 25 25 7454 3040 1 0 1 471.7308 1882.8941 4 1882.8962 -0.0021 0 37.28 0.0018 R LNFSHGTHEYHAETIK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3373.3373.4.dta 5 IPI00783061.1 58 kDa protein 825 58542 32 32 25 25 7519 6087 1 0 1 636.661 1906.961 3 1906.9636 -0.0026 1 28 0.0076 K GADFLVTEVENGGSLGSKK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6621.6621.3.dta 5 IPI00783061.1 58 kDa protein 825 58542 32 32 25 25 7762 6709 1 0 1 661.9805 1982.9196 3 1982.923 -0.0034 1 37.76 0.00029 K CDENILWLDYKNICK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7245.7245.3.dta 5 IPI00783061.1 58 kDa protein 825 58542 32 32 25 25 7860 5948 1 0 1 679.3479 2035.0219 3 2035.0222 -0.0003 1 66.89 5.30E-07 K QKGADFLVTEVENGGSLGSK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6482.6482.3.dta 5 IPI00783061.1 58 kDa protein 825 58542 32 32 25 25 8657 7808 1 0 1 832.0499 2493.128 3 2493.1363 -0.0084 0 26.1 0.0036 R AEGSDVANAVLDGADCIMLSGETAK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8433.8433.3.dta 5 IPI00783061.1 58 kDa protein 825 58542 32 32 25 25 9069 6886 1 0 1 755.1534 3016.5844 4 3016.5869 -0.0025 1 20.42 0.012 R TATESFASDPILYRPVAVALDTKGPEIR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7420.7420.4.dta 5 IPI00607698.1 PKM2 protein 590 30540 19 19 15 15 384 1822 1 0 1 359.2114 716.4082 2 716.4069 0.0014 0 31.41 0.026 K VVEVGSK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2046.2046.2.dta 5 IPI00607698.1 PKM2 protein 590 30540 19 19 15 15 439 2063 1 0 1 367.6848 733.3551 2 733.3541 0.001 0 49.09 0.00038 K SGMNVAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2308.2308.2.dta 5 IPI00607698.1 PKM2 protein 590 30540 19 19 15 15 2734 2278 1 0 1 559.806 1117.5975 2 1117.5979 -0.0004 1 57.78 2.10E-05 K GSGTAEVELKK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2543.2543.2.dta 5 IPI00607698.1 PKM2 protein 590 30540 19 19 15 15 3138 5930 1 0 1 589.3282 1176.6419 2 1176.6424 -0.0004 1 47.96 0.00026 R SVETLKEMIK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6464.6464.2.dta 5 IPI00607698.1 PKM2 protein 590 30540 19 19 15 15 3219 3462 1 0 1 597.3247 1192.6349 2 1192.6373 -0.0024 1 48.79 0.0002 R SVETLKEMIK S Oxidation (M) 0.0000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3851.3851.2.dta 5 IPI00607698.1 PKM2 protein 590 30540 19 19 15 15 3220 3476 1 0 1 597.3252 1192.6358 2 1192.6373 -0.0015 1 38.76 0.0021 R SVETLKEMIK S Oxidation (M) 0.0000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3867.3867.2.dta 5 IPI00607698.1 PKM2 protein 590 30540 19 19 15 15 3255 4935 1 0 1 599.3295 1196.6444 2 1196.6401 0.0043 0 67.34 2.90E-06 R LDIDSPPITAR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5458.5458.2.dta 5 IPI00607698.1 PKM2 protein 590 30540 19 19 15 15 3401 4100 1 0 1 607.2923 1212.57 2 1212.5696 0.0004 0 33.03 0.0014 K ITLDNAYMEK C Oxidation (M) 0.0000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4552.4552.2.dta 5 IPI00607698.1 PKM2 protein 590 30540 19 19 15 15 4509 4812 1 0 1 680.3553 1358.696 2 1358.6976 -0.0016 0 70.17 1.20E-06 R NTGIICTIGPASR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5324.5324.2.dta 5 IPI00607698.1 PKM2 protein 590 30540 19 19 15 15 5240 6921 1 0 1 731.9107 1461.8069 2 1461.8079 -0.001 0 76.41 6.80E-08 K IYVDDGLISLQVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7456.7456.2.dta 5 IPI00607698.1 PKM2 protein 590 30540 19 19 15 15 6239 6082 1 0 1 818.9482 1635.8818 2 1635.8832 -0.0014 0 57.82 4.30E-06 K GVNLPGAAVDLPAVSEK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6617.6617.2.dta 5 IPI00607698.1 PKM2 protein 590 30540 19 19 15 15 7010 6636 1 0 1 890.4407 1778.8668 2 1778.8687 -0.0019 0 94.71 1.30E-09 K GADFLVTEVENGGSLGSK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7171.7171.2.dta 5 IPI00607698.1 PKM2 protein 590 30540 19 19 15 15 7011 6651 1 0 1 593.9635 1778.8687 3 1778.8687 0 0 38.28 0.00026 K GADFLVTEVENGGSLGSK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7187.7187.3.dta 5 IPI00607698.1 PKM2 protein 590 30540 19 19 15 15 7453 3045 1 0 1 628.6374 1882.8903 3 1882.8962 -0.0058 0 53.05 1.10E-05 R LNFSHGTHEYHAETIK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3378.3378.3.dta 5 IPI00607698.1 PKM2 protein 590 30540 19 19 15 15 7454 3040 1 0 1 471.7308 1882.8941 4 1882.8962 -0.0021 0 37.28 0.0018 R LNFSHGTHEYHAETIK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3373.3373.4.dta 5 IPI00607698.1 PKM2 protein 590 30540 19 19 15 15 7519 6087 1 0 1 636.661 1906.961 3 1906.9636 -0.0026 1 28 0.0076 K GADFLVTEVENGGSLGSKK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6621.6621.3.dta 5 IPI00607698.1 PKM2 protein 590 30540 19 19 15 15 7762 6709 1 0 1 661.9805 1982.9196 3 1982.923 -0.0034 1 37.76 0.00029 K CDENILWLDYKNICK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7245.7245.3.dta 5 IPI00607698.1 PKM2 protein 590 30540 19 19 15 15 7860 5948 1 0 1 679.3479 2035.0219 3 2035.0222 -0.0003 1 66.89 5.30E-07 K QKGADFLVTEVENGGSLGSK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6482.6482.3.dta 5 IPI00607698.1 PKM2 protein 590 30540 19 19 15 15 9069 6886 1 0 1 755.1534 3016.5844 4 3016.5869 -0.0025 1 20.42 0.012 R TATESFASDPILYRPVAVALDTKGPEIR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7420.7420.4.dta 5 IPI00789727.1 23 kDa protein 550 22939 18 18 14 14 384 1822 1 0 1 359.2114 716.4082 2 716.4069 0.0014 0 31.41 0.026 K VVEVGSK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2046.2046.2.dta 5 IPI00789727.1 23 kDa protein 550 22939 18 18 14 14 439 2063 1 0 1 367.6848 733.3551 2 733.3541 0.001 0 49.09 0.00038 K SGMNVAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2308.2308.2.dta 5 IPI00789727.1 23 kDa protein 550 22939 18 18 14 14 2734 2278 1 0 1 559.806 1117.5975 2 1117.5979 -0.0004 1 57.78 2.10E-05 K GSGTAEVELKK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2543.2543.2.dta 5 IPI00789727.1 23 kDa protein 550 22939 18 18 14 14 3138 5930 1 0 1 589.3282 1176.6419 2 1176.6424 -0.0004 1 47.96 0.00026 R SVETLKEMIK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6464.6464.2.dta 5 IPI00789727.1 23 kDa protein 550 22939 18 18 14 14 3219 3462 1 0 1 597.3247 1192.6349 2 1192.6373 -0.0024 1 48.79 0.0002 R SVETLKEMIK S Oxidation (M) 0.0000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3851.3851.2.dta 5 IPI00789727.1 23 kDa protein 550 22939 18 18 14 14 3220 3476 1 0 1 597.3252 1192.6358 2 1192.6373 -0.0015 1 38.76 0.0021 R SVETLKEMIK S Oxidation (M) 0.0000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3867.3867.2.dta 5 IPI00789727.1 23 kDa protein 550 22939 18 18 14 14 3255 4935 1 0 1 599.3295 1196.6444 2 1196.6401 0.0043 0 67.34 2.90E-06 R LDIDSPPITAR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5458.5458.2.dta 5 IPI00789727.1 23 kDa protein 550 22939 18 18 14 14 3401 4100 1 0 1 607.2923 1212.57 2 1212.5696 0.0004 0 33.03 0.0014 K ITLDNAYMEK C Oxidation (M) 0.0000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4552.4552.2.dta 5 IPI00789727.1 23 kDa protein 550 22939 18 18 14 14 4509 4812 1 0 1 680.3553 1358.696 2 1358.6976 -0.0016 0 70.17 1.20E-06 R NTGIICTIGPASR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5324.5324.2.dta 5 IPI00789727.1 23 kDa protein 550 22939 18 18 14 14 5240 6921 1 0 1 731.9107 1461.8069 2 1461.8079 -0.001 0 76.41 6.80E-08 K IYVDDGLISLQVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7456.7456.2.dta 5 IPI00789727.1 23 kDa protein 550 22939 18 18 14 14 7010 6636 1 0 1 890.4407 1778.8668 2 1778.8687 -0.0019 0 94.71 1.30E-09 K GADFLVTEVENGGSLGSK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7171.7171.2.dta 5 IPI00789727.1 23 kDa protein 550 22939 18 18 14 14 7011 6651 1 0 1 593.9635 1778.8687 3 1778.8687 0 0 38.28 0.00026 K GADFLVTEVENGGSLGSK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7187.7187.3.dta 5 IPI00789727.1 23 kDa protein 550 22939 18 18 14 14 7453 3045 1 0 1 628.6374 1882.8903 3 1882.8962 -0.0058 0 53.05 1.10E-05 R LNFSHGTHEYHAETIK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3378.3378.3.dta 5 IPI00789727.1 23 kDa protein 550 22939 18 18 14 14 7454 3040 1 0 1 471.7308 1882.8941 4 1882.8962 -0.0021 0 37.28 0.0018 R LNFSHGTHEYHAETIK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3373.3373.4.dta 5 IPI00789727.1 23 kDa protein 550 22939 18 18 14 14 7519 6087 1 0 1 636.661 1906.961 3 1906.9636 -0.0026 1 28 0.0076 K GADFLVTEVENGGSLGSKK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6621.6621.3.dta 5 IPI00789727.1 23 kDa protein 550 22939 18 18 14 14 7762 6709 1 0 1 661.9805 1982.9196 3 1982.923 -0.0034 1 37.76 0.00029 K CDENILWLDYKNICK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7245.7245.3.dta 5 IPI00789727.1 23 kDa protein 550 22939 18 18 14 14 7860 5948 1 0 1 679.3479 2035.0219 3 2035.0222 -0.0003 1 66.89 5.30E-07 K QKGADFLVTEVENGGSLGSK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6482.6482.3.dta 5 IPI00789727.1 23 kDa protein 550 22939 18 18 14 14 9069 6886 1 0 1 755.1534 3016.5844 4 3016.5869 -0.0025 1 20.42 0.012 R TATESFASDPILYRPVAVALDTKGPEIR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7420.7420.4.dta 5 IPI00792817.1 24 kDa protein 306 24489 11 11 8 8 439 2063 1 0 1 367.6848 733.3551 2 733.3541 0.001 0 49.09 0.00038 K SGMNVAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2308.2308.2.dta 5 IPI00792817.1 24 kDa protein 306 24489 11 11 8 8 2734 2278 1 0 1 559.806 1117.5975 2 1117.5979 -0.0004 1 57.78 2.10E-05 K GSGTAEVELKK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2543.2543.2.dta 5 IPI00792817.1 24 kDa protein 306 24489 11 11 8 8 3138 5930 1 0 1 589.3282 1176.6419 2 1176.6424 -0.0004 1 47.96 0.00026 R SVETLKEMIK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6464.6464.2.dta 5 IPI00792817.1 24 kDa protein 306 24489 11 11 8 8 3219 3462 1 0 1 597.3247 1192.6349 2 1192.6373 -0.0024 1 48.79 0.0002 R SVETLKEMIK S Oxidation (M) 0.0000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3851.3851.2.dta 5 IPI00792817.1 24 kDa protein 306 24489 11 11 8 8 3220 3476 1 0 1 597.3252 1192.6358 2 1192.6373 -0.0015 1 38.76 0.0021 R SVETLKEMIK S Oxidation (M) 0.0000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3867.3867.2.dta 5 IPI00792817.1 24 kDa protein 306 24489 11 11 8 8 3255 4935 1 0 1 599.3295 1196.6444 2 1196.6401 0.0043 0 67.34 2.90E-06 R LDIDSPPITAR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5458.5458.2.dta 5 IPI00792817.1 24 kDa protein 306 24489 11 11 8 8 3401 4100 1 0 1 607.2923 1212.57 2 1212.5696 0.0004 0 33.03 0.0014 K ITLDNAYMEK C Oxidation (M) 0.0000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4552.4552.2.dta 5 IPI00792817.1 24 kDa protein 306 24489 11 11 8 8 4509 4812 1 0 1 680.3553 1358.696 2 1358.6976 -0.0016 0 70.17 1.20E-06 R NTGIICTIGPASR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5324.5324.2.dta 5 IPI00792817.1 24 kDa protein 306 24489 11 11 8 8 7453 3045 1 0 1 628.6374 1882.8903 3 1882.8962 -0.0058 0 53.05 1.10E-05 R LNFSHGTHEYHAETIK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3378.3378.3.dta 5 IPI00792817.1 24 kDa protein 306 24489 11 11 8 8 7454 3040 1 0 1 471.7308 1882.8941 4 1882.8962 -0.0021 0 37.28 0.0018 R LNFSHGTHEYHAETIK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3373.3373.4.dta 5 IPI00792817.1 24 kDa protein 306 24489 11 11 8 8 9069 6886 1 0 1 755.1534 3016.5844 4 3016.5869 -0.0025 1 20.42 0.012 R TATESFASDPILYRPVAVALDTKGPEIR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7420.7420.4.dta 5 IPI00797668.1 19 kDa protein 256 19086 9 9 6 6 439 2063 1 0 1 367.6848 733.3551 2 733.3541 0.001 0 49.09 0.00038 K SGMNVAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2308.2308.2.dta 5 IPI00797668.1 19 kDa protein 256 19086 9 9 6 6 3138 5930 1 0 1 589.3282 1176.6419 2 1176.6424 -0.0004 1 47.96 0.00026 R SVETLKEMIK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6464.6464.2.dta 5 IPI00797668.1 19 kDa protein 256 19086 9 9 6 6 3219 3462 1 0 1 597.3247 1192.6349 2 1192.6373 -0.0024 1 48.79 0.0002 R SVETLKEMIK S Oxidation (M) 0.0000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3851.3851.2.dta 5 IPI00797668.1 19 kDa protein 256 19086 9 9 6 6 3220 3476 1 0 1 597.3252 1192.6358 2 1192.6373 -0.0015 1 38.76 0.0021 R SVETLKEMIK S Oxidation (M) 0.0000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3867.3867.2.dta 5 IPI00797668.1 19 kDa protein 256 19086 9 9 6 6 3255 4935 1 0 1 599.3295 1196.6444 2 1196.6401 0.0043 0 67.34 2.90E-06 R LDIDSPPITAR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5458.5458.2.dta 5 IPI00797668.1 19 kDa protein 256 19086 9 9 6 6 4509 4812 1 0 1 680.3553 1358.696 2 1358.6976 -0.0016 0 70.17 1.20E-06 R NTGIICTIGPASR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5324.5324.2.dta 5 IPI00797668.1 19 kDa protein 256 19086 9 9 6 6 7453 3045 1 0 1 628.6374 1882.8903 3 1882.8962 -0.0058 0 53.05 1.10E-05 R LNFSHGTHEYHAETIK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3378.3378.3.dta 5 IPI00797668.1 19 kDa protein 256 19086 9 9 6 6 7454 3040 1 0 1 471.7308 1882.8941 4 1882.8962 -0.0021 0 37.28 0.0018 R LNFSHGTHEYHAETIK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3373.3373.4.dta 5 IPI00797668.1 19 kDa protein 256 19086 9 9 6 6 9069 6886 1 0 1 755.1534 3016.5844 4 3016.5869 -0.0025 1 20.42 0.012 R TATESFASDPILYRPVAVALDTKGPEIR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7420.7420.4.dta 5 IPI00604528.2 PKM2 protein 255 40882 13 13 10 10 32 3181 1 0 1 304.1553 606.2961 2 606.2982 -0.002 0 23.39 0.029 K MMIGR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3532.3532.2.dta 5 IPI00604528.2 PKM2 protein 255 40882 13 13 10 10 581 7628 1 0 1 384.7095 767.4045 2 767.4038 0.0007 0 40.87 0.00054 R SAHQVAR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.824.824.2.dta 5 IPI00604528.2 PKM2 protein 255 40882 13 13 10 10 1086 2565 1 0 1 434.7447 867.4748 2 867.4749 0 0 42.76 0.00071 R MQHLIAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2854.2854.2.dta 5 IPI00604528.2 PKM2 protein 255 40882 13 13 10 10 1197 2041 1 0 1 442.7422 883.4699 2 883.4698 0.0001 0 47.34 0.00024 R MQHLIAR E Oxidation (M) 0.1000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2284.2284.2.dta 5 IPI00604528.2 PKM2 protein 255 40882 13 13 10 10 1490 6505 1 0 1 467.2654 932.5162 2 932.5154 0.0008 0 26.91 0.048 R GIFPVLCK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7036.7036.2.dta 5 IPI00604528.2 PKM2 protein 255 40882 13 13 10 10 2054 4788 1 0 1 510.2621 1018.5096 2 1018.5083 0.0013 0 59.37 3.00E-05 K GDYPLEAVR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5298.5298.2.dta 5 IPI00604528.2 PKM2 protein 255 40882 13 13 10 10 2168 1087 1 0 1 520.7779 1039.5412 2 1039.541 0.0002 1 64.51 5.30E-06 R KASDVHEVR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1251.1251.2.dta 5 IPI00604528.2 PKM2 protein 255 40882 13 13 10 10 2170 773 1 0 1 520.7781 1039.5417 2 1039.541 0.0007 1 28.01 0.023 K ASDVHEVRK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1109.1109.2.dta 5 IPI00604528.2 PKM2 protein 255 40882 13 13 10 10 2897 5440 1 0 1 571.3083 1140.6021 2 1140.6026 -0.0005 0 48.98 0.00017 R GDLGIEIPAEK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5975.5975.2.dta 5 IPI00604528.2 PKM2 protein 255 40882 13 13 10 10 7187 7031 1 0 1 914.514 1827.0134 2 1827.0142 -0.0008 1 53.29 1.20E-05 R GDLGIEIPAEKVFLAQK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7570.7570.2.dta 5 IPI00604528.2 PKM2 protein 255 40882 13 13 10 10 7188 6927 1 0 1 610.0118 1827.0137 3 1827.0142 -0.0005 1 20.21 0.014 R GDLGIEIPAEKVFLAQK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7462.7462.3.dta 5 IPI00604528.2 PKM2 protein 255 40882 13 13 10 10 7189 7058 1 0 1 610.0128 1827.0166 3 1827.0142 0.0024 1 26.54 0.0032 R GDLGIEIPAEKVFLAQK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7600.7600.3.dta 5 IPI00604528.2 PKM2 protein 255 40882 13 13 10 10 8657 7808 1 0 1 832.0499 2493.128 3 2493.1363 -0.0084 0 26.1 0.0036 R AEGSDVANAVLDGADCIMLSGETAK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8433.8433.3.dta 5 IPI00798295.1 10 kDa protein 200 10259 6 6 4 4 439 2063 1 0 1 367.6848 733.3551 2 733.3541 0.001 0 49.09 0.00038 K SGMNVAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2308.2308.2.dta 5 IPI00798295.1 10 kDa protein 200 10259 6 6 4 4 3138 5930 1 0 1 589.3282 1176.6419 2 1176.6424 -0.0004 1 47.96 0.00026 R SVETLKEMIK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6464.6464.2.dta 5 IPI00798295.1 10 kDa protein 200 10259 6 6 4 4 3219 3462 1 0 1 597.3247 1192.6349 2 1192.6373 -0.0024 1 48.79 0.0002 R SVETLKEMIK S Oxidation (M) 0.0000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3851.3851.2.dta 5 IPI00798295.1 10 kDa protein 200 10259 6 6 4 4 3220 3476 1 0 1 597.3252 1192.6358 2 1192.6373 -0.0015 1 38.76 0.0021 R SVETLKEMIK S Oxidation (M) 0.0000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3867.3867.2.dta 5 IPI00798295.1 10 kDa protein 200 10259 6 6 4 4 3255 4935 1 0 1 599.3295 1196.6444 2 1196.6401 0.0043 0 67.34 2.90E-06 R LDIDSPPITAR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5458.5458.2.dta 5 IPI00798295.1 10 kDa protein 200 10259 6 6 4 4 4509 4812 1 0 1 680.3553 1358.696 2 1358.6976 -0.0016 0 70.17 1.20E-06 R NTGIICTIGPASR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5324.5324.2.dta 5 IPI00027165.3 Isoform R-type of Pyruvate kinase isozymes R/L 100 62191 5 5 3 3 32 3181 1 0 1 304.1553 606.2961 2 606.2982 -0.002 0 23.39 0.029 K MMIGR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3532.3532.2.dta 5 IPI00027165.3 Isoform R-type of Pyruvate kinase isozymes R/L 100 62191 5 5 3 3 2897 5440 1 0 1 571.3083 1140.6021 2 1140.6026 -0.0005 0 48.98 0.00017 R GDLGIEIPAEK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5975.5975.2.dta 5 IPI00027165.3 Isoform R-type of Pyruvate kinase isozymes R/L 100 62191 5 5 3 3 7187 7031 1 0 1 914.514 1827.0134 2 1827.0142 -0.0008 1 53.29 1.20E-05 R GDLGIEIPAEKVFLAQK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7570.7570.2.dta 5 IPI00027165.3 Isoform R-type of Pyruvate kinase isozymes R/L 100 62191 5 5 3 3 7188 6927 1 0 1 610.0118 1827.0137 3 1827.0142 -0.0005 1 20.21 0.014 R GDLGIEIPAEKVFLAQK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7462.7462.3.dta 5 IPI00027165.3 Isoform R-type of Pyruvate kinase isozymes R/L 100 62191 5 5 3 3 7189 7058 1 0 1 610.0128 1827.0166 3 1827.0142 0.0024 1 26.54 0.0032 R GDLGIEIPAEKVFLAQK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7600.7600.3.dta 5 IPI00743867.1 "Similar to Pyruvate kinase, isozymes M1/M2" 66 10664 2 2 1 1 1086 2565 1 0 1 434.7447 867.4748 2 867.4749 0 0 42.76 0.00071 - MQHLIAR X C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2854.2854.2.dta 5 IPI00743867.1 "Similar to Pyruvate kinase, isozymes M1/M2" 66 10664 2 2 1 1 1197 2041 1 0 1 442.7422 883.4699 2 883.4698 0.0001 0 47.34 0.00024 - MQHLIAR X Oxidation (M) 0.1000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2284.2284.2.dta 6 1 IPI00171903.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein M 931 77749 37 37 30 30 243 1620 1 1 1 339.6666 677.3186 2 677.3166 0.0019 0 34.77 0.011 R MGSVER M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1827.1827.2.dta 6 1 IPI00171903.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein M 931 77749 37 37 30 30 383 1739 1 1 1 359.1982 716.3819 2 716.3817 0.0002 0 55.87 9.10E-05 R IGSGVER M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1956.1956.2.dta 6 1 IPI00171903.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein M 931 77749 37 37 30 30 464 2115 1 1 1 372.7172 743.4199 2 743.4177 0.0022 0 37.98 0.0037 K AAEVLNK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2365.2365.2.dta 6 1 IPI00171903.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein M 931 77749 37 37 30 30 465 2740 1 1 1 373.1881 744.3617 2 744.3589 0.0028 0 52.6 6.00E-05 R MGPGIDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3045.3045.2.dta 6 1 IPI00171903.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein M 931 77749 37 37 30 30 599 3047 1 1 1 387.2022 772.3898 2 772.3901 -0.0003 0 26.19 0.0099 R MGPAIER M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3380.3380.2.dta 6 1 IPI00171903.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein M 931 77749 37 37 30 30 666 2024 1 1 1 395.209 788.4035 2 788.4028 0.0007 0 52.41 0.0002 R VGSEIER M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2266.2266.2.dta 6 1 IPI00171903.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein M 931 77749 37 37 30 30 716 1940 1 1 1 401.7245 801.4344 2 801.4345 0 0 58.82 5.70E-05 R VGQTIER M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2174.2174.2.dta 6 1 IPI00171903.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein M 931 77749 37 37 30 30 724 3199 1 1 1 403.1882 804.3619 2 804.3622 -0.0004 0 52.28 8.00E-05 R MGPVMDR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3556.3556.2.dta 6 1 IPI00171903.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein M 931 77749 37 37 30 30 1021 1925 1 1 1 426.6887 851.3628 2 851.3629 -0.0001 0 50.22 8.00E-05 R MGQTMER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2157.2157.2.dta 6 1 IPI00171903.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein M 931 77749 37 37 30 30 1162 2720 1 1 1 439.2137 876.4128 2 876.4123 0.0004 0 63.88 2.40E-06 R MGANSLER M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3023.3023.2.dta 6 1 IPI00171903.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein M 931 77749 37 37 30 30 1226 1943 1 1 1 447.2106 892.4067 2 892.4072 -0.0005 0 53.81 7.50E-05 R MGANSLER M Oxidation (M) 0.10000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2177.2177.2.dta 6 1 IPI00171903.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein M 931 77749 37 37 30 30 1228 4168 1 1 1 447.2365 892.4585 2 892.4589 -0.0004 0 35.55 0.0067 K ACQIFVR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4626.4626.2.dta 6 1 IPI00171903.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein M 931 77749 37 37 30 30 1345 4179 1 1 1 455.2284 908.4423 2 908.4426 -0.0003 0 51.15 0.00016 R GCAVVEFK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4638.4638.2.dta 6 1 IPI00171903.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein M 931 77749 37 37 30 30 1403 1792 1 1 1 460.7166 919.4186 2 919.4181 0.0005 0 32.36 0.0088 R MGANNLER M Oxidation (M) 0.10000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2013.2013.2.dta 6 1 IPI00171903.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein M 931 77749 37 37 30 30 1815 1588 1 1 1 494.7023 987.3901 2 987.3902 -0.0002 0 35.41 0.00035 R FGSGMNMGR I 2 Oxidation (M) 0.000010100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1792.1792.2.dta 6 1 IPI00171903.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein M 931 77749 37 37 30 30 1870 1583 1 1 1 497.7931 993.5717 2 993.5719 -0.0003 0 30.27 0.0071 K HSLSGRPLK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1787.1787.2.dta 6 1 IPI00171903.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein M 931 77749 37 37 30 30 1871 1571 1 1 1 332.1983 993.5731 3 993.5719 0.0011 0 22.48 0.028 K HSLSGRPLK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1774.1774.3.dta 6 1 IPI00171903.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein M 931 77749 37 37 30 30 2067 3378 1 1 1 511.2836 1020.5526 2 1020.5539 -0.0012 1 69.68 2.30E-06 R KACQIFVR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3760.3760.2.dta 6 1 IPI00171903.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein M 931 77749 37 37 30 30 2706 5621 1 1 1 557.8264 1113.6383 2 1113.6393 -0.001 0 60.26 1.20E-05 R INEILSNALK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6157.6157.2.dta 6 1 IPI00171903.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein M 931 77749 37 37 30 30 2784 5715 1 1 1 563.2621 1124.5096 2 1124.5107 -0.0011 0 62.1 1.50E-06 R MGAGMGFGLER M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6250.6250.2.dta 6 1 IPI00171903.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein M 931 77749 37 37 30 30 3190 4607 1 1 1 594.7956 1187.5766 2 1187.5791 -0.0025 0 32.16 0.00098 R MVPAGMGAGLER M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5101.5101.2.dta 6 1 IPI00171903.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein M 931 77749 37 37 30 30 3837 7070 1 1 1 632.8503 1263.6861 2 1263.6863 -0.0002 0 50.24 0.00013 R AFITNIPFDVK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7614.7614.2.dta 6 1 IPI00171903.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein M 931 77749 37 37 30 30 3949 3148 1 1 1 642.8168 1283.619 2 1283.6219 -0.0029 0 77.16 2.10E-07 K QGGGGGGGSVPGIER M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3489.3489.2.dta 6 1 IPI00171903.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein M 931 77749 37 37 30 30 4677 5239 1 1 1 692.3099 1382.6052 2 1382.6071 -0.0019 0 61.89 1.60E-06 R MGLAMGGGGGASFDR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5771.5771.2.dta 6 1 IPI00171903.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein M 931 77749 37 37 30 30 4678 5222 1 1 1 692.3101 1382.6057 2 1382.6071 -0.0014 0 50.68 1.80E-05 R MGLAMGGGGGASFDR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5754.5754.2.dta 6 1 IPI00171903.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein M 931 77749 37 37 30 30 4993 6225 1 1 1 713.8823 1425.75 2 1425.7504 -0.0004 0 73.34 1.30E-07 R LGSTVFVANLDYK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6760.6760.2.dta 6 1 IPI00171903.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein M 931 77749 37 37 30 30 4997 5421 1 1 1 714.3591 1426.7037 2 1426.7061 -0.0024 0 31.12 0.013 R MGPAMGPALGAGIER M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5956.5956.2.dta 6 1 IPI00171903.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein M 931 77749 37 37 30 30 5127 4618 1 1 1 722.3572 1442.6999 2 1442.701 -0.0011 0 44.09 0.00017 R MGPAMGPALGAGIER M Oxidation (M) 0.000010000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5113.5113.2.dta 6 1 IPI00171903.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein M 931 77749 37 37 30 30 5176 3339 1 1 1 484.2402 1449.6987 3 1449.7001 -0.0014 1 21.21 0.029 R GGNRFEPYANPTK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3717.3717.3.dta 6 1 IPI00171903.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein M 931 77749 37 37 30 30 5219 4151 1 1 1 730.3551 1458.6957 2 1458.6959 -0.0003 0 38.08 0.0013 R MGPAMGPALGAGIER M 2 Oxidation (M) 0.100010000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4607.4607.2.dta 6 1 IPI00171903.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein M 931 77749 37 37 30 30 6029 5767 1 1 1 538.5978 1612.7717 3 1612.7701 0.0016 0 47.3 5.70E-05 R MGPLGLDHMASSIER M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6302.6302.3.dta 6 1 IPI00171903.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein M 931 77749 37 37 30 30 6400 4241 1 1 1 555.2754 1662.8043 3 1662.8036 0.0008 1 41.58 0.00013 K GCGVVKFESPEVAER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4705.4705.3.dta 6 1 IPI00171903.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein M 931 77749 37 37 30 30 6401 4274 1 1 1 555.2767 1662.8084 3 1662.8036 0.0048 1 41.67 0.0003 K GCGVVKFESPEVAER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4741.4741.3.dta 6 1 IPI00171903.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein M 931 77749 37 37 30 30 6905 7929 1 1 1 876.9401 1751.8656 2 1751.8651 0.0004 0 14.18 0.047 K VGEVTYVELLMDAEGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8559.8559.2.dta 6 1 IPI00171903.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein M 931 77749 37 37 30 30 6976 7404 1 1 1 884.9354 1767.8563 2 1767.8601 -0.0038 0 53.09 3.10E-05 K VGEVTYVELLMDAEGK S Oxidation (M) 0.0000000000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7985.7985.2.dta 6 1 IPI00171903.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein M 931 77749 37 37 30 30 7118 4577 1 1 1 603.6253 1807.8541 3 1807.8563 -0.0022 1 25.81 0.0038 K DKFNECGHVLYADIK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5069.5069.3.dta 6 1 IPI00171903.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein M 931 77749 37 37 30 30 7855 5200 1 1 1 678.9882 2033.9426 3 2033.9457 -0.003 0 42.97 9.30E-05 R GNFGGSFAGSFGGAGGHAPGVAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5731.5731.3.dta 6 IPI00645920.1 18 kDa protein 79 18173 2 2 2 2 1228 4168 1 0 1 447.2365 892.4585 2 892.4589 -0.0004 0 35.55 0.0067 K ACQIFVR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4626.4626.2.dta 6 IPI00645920.1 18 kDa protein 79 18173 2 2 2 2 2067 3378 1 0 1 511.2836 1020.5526 2 1020.5539 -0.0012 1 69.68 2.30E-06 R KACQIFVR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3760.3760.2.dta 7 1 IPI00643920.2 Transketolase 782 68519 36 36 25 25 23 3067 1 1 1 301.6971 601.3796 2 601.3799 -0.0003 1 30.33 0.022 R GLITKA - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3401.3401.2.dta 7 1 IPI00643920.2 Transketolase 782 68519 36 36 25 25 514 8907 1 1 1 378.1955 754.3765 2 754.3722 0.0043 0 37.66 0.0023 K LGHASDR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.955.955.2.dta 7 1 IPI00643920.2 Transketolase 782 68519 36 36 25 25 661 4069 1 1 1 394.2384 786.4623 2 786.4599 0.0023 0 36.85 0.0064 K LILDSAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4519.4519.2.dta 7 1 IPI00643920.2 Transketolase 782 68519 36 36 25 25 823 2561 1 1 1 411.2293 820.4441 2 820.4443 -0.0002 0 52.56 0.00011 K AYGQALAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2850.2850.2.dta 7 1 IPI00643920.2 Transketolase 782 68519 36 36 25 25 1521 3727 1 1 1 469.7353 937.4561 2 937.4579 -0.0018 0 45.5 0.00038 R MPSLPSYK V Oxidation (M) 0.10000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4147.4147.2.dta 7 1 IPI00643920.2 Transketolase 782 68519 36 36 25 25 1546 2874 1 1 1 471.7845 941.5544 2 941.5546 -0.0001 0 41.85 0.00066 R SGKPAELLK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3190.3190.2.dta 7 1 IPI00643920.2 Transketolase 782 68519 36 36 25 25 1547 2883 1 1 1 314.8588 941.5545 3 941.5546 -0.0001 0 37.25 0.0019 R SGKPAELLK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3201.3201.3.dta 7 1 IPI00643920.2 Transketolase 782 68519 36 36 25 25 1564 4152 1 1 1 473.2657 944.5169 2 944.5179 -0.001 0 35.73 0.0028 R IIALDGDTK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4609.4609.2.dta 7 1 IPI00643920.2 Transketolase 782 68519 36 36 25 25 1589 1952 1 1 1 475.2763 948.5381 2 948.5392 -0.0012 1 50.35 0.00013 R KAYGQALAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2187.2187.2.dta 7 1 IPI00643920.2 Transketolase 782 68519 36 36 25 25 1590 1954 1 1 1 317.1876 948.5409 3 948.5392 0.0016 1 46.95 0.00028 R KAYGQALAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2189.2189.3.dta 7 1 IPI00643920.2 Transketolase 782 68519 36 36 25 25 1774 2391 1 1 1 489.7907 977.5669 2 977.5658 0.0011 0 45.04 6.00E-05 K HQPTAIIAK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2665.2665.2.dta 7 1 IPI00643920.2 Transketolase 782 68519 36 36 25 25 2237 2821 1 1 1 350.5073 1048.5001 3 1048.4978 0.0024 1 20.56 0.018 K YFDKASYR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3132.3132.3.dta 7 1 IPI00643920.2 Transketolase 782 68519 36 36 25 25 2402 6235 1 1 1 536.7697 1071.5248 2 1071.5237 0.0011 0 22.24 0.0082 K NSTFSEIFK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6770.6770.2.dta 7 1 IPI00643920.2 Transketolase 782 68519 36 36 25 25 2808 2326 1 1 1 565.3197 1128.6249 2 1128.6251 -0.0002 1 64.38 9.40E-06 K LQALKDTANR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2595.2595.2.dta 7 1 IPI00643920.2 Transketolase 782 68519 36 36 25 25 3276 5197 1 1 1 400.8807 1199.6203 3 1199.6186 0.0017 1 25.39 0.0044 K NSTFSEIFKK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5729.5729.3.dta 7 1 IPI00643920.2 Transketolase 782 68519 36 36 25 25 3833 3056 1 1 1 632.8284 1263.6423 2 1263.6459 -0.0036 0 57.78 3.40E-05 K ISSDLDGHPVPK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3390.3390.2.dta 7 1 IPI00643920.2 Transketolase 782 68519 36 36 25 25 3834 3050 1 1 1 422.2227 1263.6464 3 1263.6459 0.0005 0 39.06 0.00098 K ISSDLDGHPVPK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3384.3384.3.dta 7 1 IPI00643920.2 Transketolase 782 68519 36 36 25 25 3835 2881 1 1 1 422.2231 1263.6475 3 1263.6459 0.0016 0 26.49 0.0067 K ISSDLDGHPVPK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3198.3198.3.dta 7 1 IPI00643920.2 Transketolase 782 68519 36 36 25 25 4571 7782 1 1 1 684.8956 1367.7767 2 1367.7772 -0.0005 0 66.1 7.10E-07 K LDNLVAILDINR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8407.8407.2.dta 7 1 IPI00643920.2 Transketolase 782 68519 36 36 25 25 4767 2722 1 1 1 464.9202 1391.7389 3 1391.7409 -0.002 1 19.34 0.015 R KISSDLDGHPVPK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3025.3025.3.dta 7 1 IPI00643920.2 Transketolase 782 68519 36 36 25 25 4768 2736 1 1 1 696.8771 1391.7396 2 1391.7409 -0.0013 1 26.29 0.0034 R KISSDLDGHPVPK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3040.3040.2.dta 7 1 IPI00643920.2 Transketolase 782 68519 36 36 25 25 4910 6502 1 1 1 707.4079 1412.8012 2 1412.8028 -0.0015 0 38.89 0.00067 R VLDPFTIKPLDR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7033.7033.2.dta 7 1 IPI00643920.2 Transketolase 782 68519 36 36 25 25 4911 6494 1 1 1 471.9411 1412.8016 3 1412.8028 -0.0012 0 23.55 0.026 R VLDPFTIKPLDR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7025.7025.3.dta 7 1 IPI00643920.2 Transketolase 782 68519 36 36 25 25 5774 6016 1 1 1 781.9059 1561.7973 2 1561.8035 -0.0061 1 52.99 1.10E-05 K MFGIDRDAIAQAVR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6550.6550.2.dta 7 1 IPI00643920.2 Transketolase 782 68519 36 36 25 25 5776 6000 1 1 1 521.6084 1561.8034 3 1561.8035 -0.0001 1 45.29 0.00014 K MFGIDRDAIAQAVR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6535.6535.3.dta 7 1 IPI00643920.2 Transketolase 782 68519 36 36 25 25 5909 5430 1 1 1 789.9048 1577.795 2 1577.7984 -0.0034 1 38.23 0.00048 K MFGIDRDAIAQAVR G Oxidation (M) 0.10000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5965.5965.2.dta 7 1 IPI00643920.2 Transketolase 782 68519 36 36 25 25 5910 5410 1 1 1 526.9406 1577.7998 3 1577.7984 0.0014 1 41.38 0.00031 K MFGIDRDAIAQAVR G Oxidation (M) 0.10000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5945.5945.3.dta 7 1 IPI00643920.2 Transketolase 782 68519 36 36 25 25 6337 8537 1 1 1 826.4003 1650.786 2 1650.7865 -0.0005 0 20.61 0.012 R TVPFCSTFAAFFTR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.9161.9161.2.dta 7 1 IPI00643920.2 Transketolase 782 68519 36 36 25 25 6531 4013 1 1 1 561.3 1680.8781 3 1680.8795 -0.0014 1 34.75 0.00055 K LGHASDRIIALDGDTK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4458.4458.3.dta 7 1 IPI00643920.2 Transketolase 782 68519 36 36 25 25 7459 5213 1 1 1 942.964 1883.9134 2 1883.9153 -0.0019 0 51.62 1.40E-05 R SVPTSTVFYPSDGVATEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5744.5744.2.dta 7 1 IPI00643920.2 Transketolase 782 68519 36 36 25 25 7838 5934 1 1 1 1010.5379 2019.0613 2 2019.0636 -0.0024 0 96.05 9.90E-10 K ILATPPQEDAPSVDIANIR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6469.6469.2.dta 7 1 IPI00643920.2 Transketolase 782 68519 36 36 25 25 7839 5933 1 1 1 674.0282 2019.0628 3 2019.0636 -0.0009 0 67.4 4.80E-07 K ILATPPQEDAPSVDIANIR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6468.6468.3.dta 7 1 IPI00643920.2 Transketolase 782 68519 36 36 25 25 7901 4692 1 1 1 690.3412 2068.0017 3 2068.0048 -0.003 0 28.54 0.0021 R LGQSDPAPLQHQMDIYQK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5194.5194.3.dta 7 1 IPI00643920.2 Transketolase 782 68519 36 36 25 25 7915 3764 1 1 1 695.6721 2083.9943 3 2083.9997 -0.0053 0 16.3 0.03 R LGQSDPAPLQHQMDIYQK R Oxidation (M) 0.000000000000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4188.4188.3.dta 7 1 IPI00643920.2 Transketolase 782 68519 36 36 25 25 7980 5409 1 1 1 716.7262 2147.1568 3 2147.1586 -0.0018 1 28.22 0.0023 K KILATPPQEDAPSVDIANIR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5944.5944.3.dta 7 1 IPI00643920.2 Transketolase 782 68519 36 36 25 25 8670 4704 1 1 1 836.7412 2507.2016 3 2507.204 -0.0024 0 39.94 0.00018 R TSRPENAIIYNNNEDFQVGQAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5207.5207.3.dta 7 IPI00792641.1 Hypothetical protein DKFZp686J13123 705 59571 31 31 23 23 23 3067 1 0 1 301.6971 601.3796 2 601.3799 -0.0003 1 30.33 0.022 R GLITKA - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3401.3401.2.dta 7 IPI00792641.1 Hypothetical protein DKFZp686J13123 705 59571 31 31 23 23 514 8907 1 0 1 378.1955 754.3765 2 754.3722 0.0043 0 37.66 0.0023 K LGHASDR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.955.955.2.dta 7 IPI00792641.1 Hypothetical protein DKFZp686J13123 705 59571 31 31 23 23 661 4069 1 0 1 394.2384 786.4623 2 786.4599 0.0023 0 36.85 0.0064 K LILDSAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4519.4519.2.dta 7 IPI00792641.1 Hypothetical protein DKFZp686J13123 705 59571 31 31 23 23 823 2561 1 0 1 411.2293 820.4441 2 820.4443 -0.0002 0 52.56 0.00011 K AYGQALAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2850.2850.2.dta 7 IPI00792641.1 Hypothetical protein DKFZp686J13123 705 59571 31 31 23 23 1521 3727 1 0 1 469.7353 937.4561 2 937.4579 -0.0018 0 45.5 0.00038 R MPSLPSYK V Oxidation (M) 0.10000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4147.4147.2.dta 7 IPI00792641.1 Hypothetical protein DKFZp686J13123 705 59571 31 31 23 23 1546 2874 1 0 1 471.7845 941.5544 2 941.5546 -0.0001 0 41.85 0.00066 R SGKPAELLK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3190.3190.2.dta 7 IPI00792641.1 Hypothetical protein DKFZp686J13123 705 59571 31 31 23 23 1547 2883 1 0 1 314.8588 941.5545 3 941.5546 -0.0001 0 37.25 0.0019 R SGKPAELLK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3201.3201.3.dta 7 IPI00792641.1 Hypothetical protein DKFZp686J13123 705 59571 31 31 23 23 1564 4152 1 0 1 473.2657 944.5169 2 944.5179 -0.001 0 35.73 0.0028 R IIALDGDTK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4609.4609.2.dta 7 IPI00792641.1 Hypothetical protein DKFZp686J13123 705 59571 31 31 23 23 1589 1952 1 0 1 475.2763 948.5381 2 948.5392 -0.0012 1 50.35 0.00013 R KAYGQALAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2187.2187.2.dta 7 IPI00792641.1 Hypothetical protein DKFZp686J13123 705 59571 31 31 23 23 1590 1954 1 0 1 317.1876 948.5409 3 948.5392 0.0016 1 46.95 0.00028 R KAYGQALAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2189.2189.3.dta 7 IPI00792641.1 Hypothetical protein DKFZp686J13123 705 59571 31 31 23 23 1774 2391 1 0 1 489.7907 977.5669 2 977.5658 0.0011 0 45.04 6.00E-05 K HQPTAIIAK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2665.2665.2.dta 7 IPI00792641.1 Hypothetical protein DKFZp686J13123 705 59571 31 31 23 23 2237 2821 1 0 1 350.5073 1048.5001 3 1048.4978 0.0024 1 20.56 0.018 K YFDKASYR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3132.3132.3.dta 7 IPI00792641.1 Hypothetical protein DKFZp686J13123 705 59571 31 31 23 23 2402 6235 1 0 1 536.7697 1071.5248 2 1071.5237 0.0011 0 22.24 0.0082 K NSTFSEIFK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6770.6770.2.dta 7 IPI00792641.1 Hypothetical protein DKFZp686J13123 705 59571 31 31 23 23 2808 2326 1 0 1 565.3197 1128.6249 2 1128.6251 -0.0002 1 64.38 9.40E-06 K LQALKDTANR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2595.2595.2.dta 7 IPI00792641.1 Hypothetical protein DKFZp686J13123 705 59571 31 31 23 23 3276 5197 1 0 1 400.8807 1199.6203 3 1199.6186 0.0017 1 25.39 0.0044 K NSTFSEIFKK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5729.5729.3.dta 7 IPI00792641.1 Hypothetical protein DKFZp686J13123 705 59571 31 31 23 23 4571 7782 1 0 1 684.8956 1367.7767 2 1367.7772 -0.0005 0 66.1 7.10E-07 K LDNLVAILDINR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8407.8407.2.dta 7 IPI00792641.1 Hypothetical protein DKFZp686J13123 705 59571 31 31 23 23 4910 6502 1 0 1 707.4079 1412.8012 2 1412.8028 -0.0015 0 38.89 0.00067 R VLDPFTIKPLDR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7033.7033.2.dta 7 IPI00792641.1 Hypothetical protein DKFZp686J13123 705 59571 31 31 23 23 4911 6494 1 0 1 471.9411 1412.8016 3 1412.8028 -0.0012 0 23.55 0.026 R VLDPFTIKPLDR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7025.7025.3.dta 7 IPI00792641.1 Hypothetical protein DKFZp686J13123 705 59571 31 31 23 23 5774 6016 1 0 1 781.9059 1561.7973 2 1561.8035 -0.0061 1 52.99 1.10E-05 K MFGIDRDAIAQAVR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6550.6550.2.dta 7 IPI00792641.1 Hypothetical protein DKFZp686J13123 705 59571 31 31 23 23 5776 6000 1 0 1 521.6084 1561.8034 3 1561.8035 -0.0001 1 45.29 0.00014 K MFGIDRDAIAQAVR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6535.6535.3.dta 7 IPI00792641.1 Hypothetical protein DKFZp686J13123 705 59571 31 31 23 23 5909 5430 1 0 1 789.9048 1577.795 2 1577.7984 -0.0034 1 38.23 0.00048 K MFGIDRDAIAQAVR G Oxidation (M) 0.10000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5965.5965.2.dta 7 IPI00792641.1 Hypothetical protein DKFZp686J13123 705 59571 31 31 23 23 5910 5410 1 0 1 526.9406 1577.7998 3 1577.7984 0.0014 1 41.38 0.00031 K MFGIDRDAIAQAVR G Oxidation (M) 0.10000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5945.5945.3.dta 7 IPI00792641.1 Hypothetical protein DKFZp686J13123 705 59571 31 31 23 23 6337 8537 1 0 1 826.4003 1650.786 2 1650.7865 -0.0005 0 20.61 0.012 R TVPFCSTFAAFFTR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.9161.9161.2.dta 7 IPI00792641.1 Hypothetical protein DKFZp686J13123 705 59571 31 31 23 23 6531 4013 1 0 1 561.3 1680.8781 3 1680.8795 -0.0014 1 34.75 0.00055 K LGHASDRIIALDGDTK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4458.4458.3.dta 7 IPI00792641.1 Hypothetical protein DKFZp686J13123 705 59571 31 31 23 23 7459 5213 1 0 1 942.964 1883.9134 2 1883.9153 -0.0019 0 51.62 1.40E-05 R SVPTSTVFYPSDGVATEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5744.5744.2.dta 7 IPI00792641.1 Hypothetical protein DKFZp686J13123 705 59571 31 31 23 23 7838 5934 1 0 1 1010.5379 2019.0613 2 2019.0636 -0.0024 0 96.05 9.90E-10 K ILATPPQEDAPSVDIANIR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6469.6469.2.dta 7 IPI00792641.1 Hypothetical protein DKFZp686J13123 705 59571 31 31 23 23 7839 5933 1 0 1 674.0282 2019.0628 3 2019.0636 -0.0009 0 67.4 4.80E-07 K ILATPPQEDAPSVDIANIR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6468.6468.3.dta 7 IPI00792641.1 Hypothetical protein DKFZp686J13123 705 59571 31 31 23 23 7901 4692 1 0 1 690.3412 2068.0017 3 2068.0048 -0.003 0 28.54 0.0021 R LGQSDPAPLQHQMDIYQK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5194.5194.3.dta 7 IPI00792641.1 Hypothetical protein DKFZp686J13123 705 59571 31 31 23 23 7915 3764 1 0 1 695.6721 2083.9943 3 2083.9997 -0.0053 0 16.3 0.03 R LGQSDPAPLQHQMDIYQK R Oxidation (M) 0.000000000000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4188.4188.3.dta 7 IPI00792641.1 Hypothetical protein DKFZp686J13123 705 59571 31 31 23 23 7980 5409 1 0 1 716.7262 2147.1568 3 2147.1586 -0.0018 1 28.22 0.0023 K KILATPPQEDAPSVDIANIR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5944.5944.3.dta 7 IPI00792641.1 Hypothetical protein DKFZp686J13123 705 59571 31 31 23 23 8670 4704 1 0 1 836.7412 2507.2016 3 2507.204 -0.0024 0 39.94 0.00018 R TSRPENAIIYNNNEDFQVGQAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5207.5207.3.dta 7 IPI00793119.1 39 kDa protein 567 39205 25 25 18 18 23 3067 1 0 1 301.6971 601.3796 2 601.3799 -0.0003 1 30.33 0.022 R GLITKA - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3401.3401.2.dta 7 IPI00793119.1 39 kDa protein 567 39205 25 25 18 18 514 8907 1 0 1 378.1955 754.3765 2 754.3722 0.0043 0 37.66 0.0023 K LGHASDR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.955.955.2.dta 7 IPI00793119.1 39 kDa protein 567 39205 25 25 18 18 661 4069 1 0 1 394.2384 786.4623 2 786.4599 0.0023 0 36.85 0.0064 K LILDSAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4519.4519.2.dta 7 IPI00793119.1 39 kDa protein 567 39205 25 25 18 18 823 2561 1 0 1 411.2293 820.4441 2 820.4443 -0.0002 0 52.56 0.00011 K AYGQALAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2850.2850.2.dta 7 IPI00793119.1 39 kDa protein 567 39205 25 25 18 18 1521 3727 1 0 1 469.7353 937.4561 2 937.4579 -0.0018 0 45.5 0.00038 R MPSLPSYK V Oxidation (M) 0.10000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4147.4147.2.dta 7 IPI00793119.1 39 kDa protein 567 39205 25 25 18 18 1546 2874 1 0 1 471.7845 941.5544 2 941.5546 -0.0001 0 41.85 0.00066 R SGKPAELLK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3190.3190.2.dta 7 IPI00793119.1 39 kDa protein 567 39205 25 25 18 18 1547 2883 1 0 1 314.8588 941.5545 3 941.5546 -0.0001 0 37.25 0.0019 R SGKPAELLK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3201.3201.3.dta 7 IPI00793119.1 39 kDa protein 567 39205 25 25 18 18 1564 4152 1 0 1 473.2657 944.5169 2 944.5179 -0.001 0 35.73 0.0028 R IIALDGDTK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4609.4609.2.dta 7 IPI00793119.1 39 kDa protein 567 39205 25 25 18 18 1589 1952 1 0 1 475.2763 948.5381 2 948.5392 -0.0012 1 50.35 0.00013 R KAYGQALAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2187.2187.2.dta 7 IPI00793119.1 39 kDa protein 567 39205 25 25 18 18 1590 1954 1 0 1 317.1876 948.5409 3 948.5392 0.0016 1 46.95 0.00028 R KAYGQALAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2189.2189.3.dta 7 IPI00793119.1 39 kDa protein 567 39205 25 25 18 18 2402 6235 1 0 1 536.7697 1071.5248 2 1071.5237 0.0011 0 22.24 0.0082 K NSTFSEIFK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6770.6770.2.dta 7 IPI00793119.1 39 kDa protein 567 39205 25 25 18 18 3276 5197 1 0 1 400.8807 1199.6203 3 1199.6186 0.0017 1 25.39 0.0044 K NSTFSEIFKK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5729.5729.3.dta 7 IPI00793119.1 39 kDa protein 567 39205 25 25 18 18 4910 6502 1 0 1 707.4079 1412.8012 2 1412.8028 -0.0015 0 38.89 0.00067 R VLDPFTIKPLDR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7033.7033.2.dta 7 IPI00793119.1 39 kDa protein 567 39205 25 25 18 18 4911 6494 1 0 1 471.9411 1412.8016 3 1412.8028 -0.0012 0 23.55 0.026 R VLDPFTIKPLDR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7025.7025.3.dta 7 IPI00793119.1 39 kDa protein 567 39205 25 25 18 18 5774 6016 1 0 1 781.9059 1561.7973 2 1561.8035 -0.0061 1 52.99 1.10E-05 K MFGIDRDAIAQAVR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6550.6550.2.dta 7 IPI00793119.1 39 kDa protein 567 39205 25 25 18 18 5776 6000 1 0 1 521.6084 1561.8034 3 1561.8035 -0.0001 1 45.29 0.00014 K MFGIDRDAIAQAVR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6535.6535.3.dta 7 IPI00793119.1 39 kDa protein 567 39205 25 25 18 18 5909 5430 1 0 1 789.9048 1577.795 2 1577.7984 -0.0034 1 38.23 0.00048 K MFGIDRDAIAQAVR G Oxidation (M) 0.10000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5965.5965.2.dta 7 IPI00793119.1 39 kDa protein 567 39205 25 25 18 18 5910 5410 1 0 1 526.9406 1577.7998 3 1577.7984 0.0014 1 41.38 0.00031 K MFGIDRDAIAQAVR G Oxidation (M) 0.10000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5945.5945.3.dta 7 IPI00793119.1 39 kDa protein 567 39205 25 25 18 18 6337 8537 1 0 1 826.4003 1650.786 2 1650.7865 -0.0005 0 20.61 0.012 R TVPFCSTFAAFFTR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.9161.9161.2.dta 7 IPI00793119.1 39 kDa protein 567 39205 25 25 18 18 6531 4013 1 0 1 561.3 1680.8781 3 1680.8795 -0.0014 1 34.75 0.00055 K LGHASDRIIALDGDTK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4458.4458.3.dta 7 IPI00793119.1 39 kDa protein 567 39205 25 25 18 18 7459 5213 1 0 1 942.964 1883.9134 2 1883.9153 -0.0019 0 51.62 1.40E-05 R SVPTSTVFYPSDGVATEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5744.5744.2.dta 7 IPI00793119.1 39 kDa protein 567 39205 25 25 18 18 7838 5934 1 0 1 1010.5379 2019.0613 2 2019.0636 -0.0024 0 96.05 9.90E-10 K ILATPPQEDAPSVDIANIR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6469.6469.2.dta 7 IPI00793119.1 39 kDa protein 567 39205 25 25 18 18 7839 5933 1 0 1 674.0282 2019.0628 3 2019.0636 -0.0009 0 67.4 4.80E-07 K ILATPPQEDAPSVDIANIR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6468.6468.3.dta 7 IPI00793119.1 39 kDa protein 567 39205 25 25 18 18 7980 5409 1 0 1 716.7262 2147.1568 3 2147.1586 -0.0018 1 28.22 0.0023 K KILATPPQEDAPSVDIANIR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5944.5944.3.dta 7 IPI00793119.1 39 kDa protein 567 39205 25 25 18 18 8670 4704 1 0 1 836.7412 2507.2016 3 2507.204 -0.0024 0 39.94 0.00018 R TSRPENAIIYNNNEDFQVGQAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5207.5207.3.dta 7 IPI00789310.1 37 kDa protein 404 37045 21 21 15 15 23 3067 1 0 1 301.6971 601.3796 2 601.3799 -0.0003 1 30.33 0.022 R GLITKA - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3401.3401.2.dta 7 IPI00789310.1 37 kDa protein 404 37045 21 21 15 15 514 8907 1 0 1 378.1955 754.3765 2 754.3722 0.0043 0 37.66 0.0023 K LGHASDR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.955.955.2.dta 7 IPI00789310.1 37 kDa protein 404 37045 21 21 15 15 661 4069 1 0 1 394.2384 786.4623 2 786.4599 0.0023 0 36.85 0.0064 K LILDSAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4519.4519.2.dta 7 IPI00789310.1 37 kDa protein 404 37045 21 21 15 15 823 2561 1 0 1 411.2293 820.4441 2 820.4443 -0.0002 0 52.56 0.00011 K AYGQALAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2850.2850.2.dta 7 IPI00789310.1 37 kDa protein 404 37045 21 21 15 15 1546 2874 1 0 1 471.7845 941.5544 2 941.5546 -0.0001 0 41.85 0.00066 R SGKPAELLK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3190.3190.2.dta 7 IPI00789310.1 37 kDa protein 404 37045 21 21 15 15 1547 2883 1 0 1 314.8588 941.5545 3 941.5546 -0.0001 0 37.25 0.0019 R SGKPAELLK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3201.3201.3.dta 7 IPI00789310.1 37 kDa protein 404 37045 21 21 15 15 1564 4152 1 0 1 473.2657 944.5169 2 944.5179 -0.001 0 35.73 0.0028 R IIALDGDTK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4609.4609.2.dta 7 IPI00789310.1 37 kDa protein 404 37045 21 21 15 15 1589 1952 1 0 1 475.2763 948.5381 2 948.5392 -0.0012 1 50.35 0.00013 R KAYGQALAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2187.2187.2.dta 7 IPI00789310.1 37 kDa protein 404 37045 21 21 15 15 1590 1954 1 0 1 317.1876 948.5409 3 948.5392 0.0016 1 46.95 0.00028 R KAYGQALAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2189.2189.3.dta 7 IPI00789310.1 37 kDa protein 404 37045 21 21 15 15 2402 6235 1 0 1 536.7697 1071.5248 2 1071.5237 0.0011 0 22.24 0.0082 K NSTFSEIFK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6770.6770.2.dta 7 IPI00789310.1 37 kDa protein 404 37045 21 21 15 15 3276 5197 1 0 1 400.8807 1199.6203 3 1199.6186 0.0017 1 25.39 0.0044 K NSTFSEIFKK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5729.5729.3.dta 7 IPI00789310.1 37 kDa protein 404 37045 21 21 15 15 4910 6502 1 0 1 707.4079 1412.8012 2 1412.8028 -0.0015 0 38.89 0.00067 R VLDPFTIKPLDR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7033.7033.2.dta 7 IPI00789310.1 37 kDa protein 404 37045 21 21 15 15 4911 6494 1 0 1 471.9411 1412.8016 3 1412.8028 -0.0012 0 23.55 0.026 R VLDPFTIKPLDR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7025.7025.3.dta 7 IPI00789310.1 37 kDa protein 404 37045 21 21 15 15 5774 6016 1 0 1 781.9059 1561.7973 2 1561.8035 -0.0061 1 52.99 1.10E-05 K MFGIDRDAIAQAVR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6550.6550.2.dta 7 IPI00789310.1 37 kDa protein 404 37045 21 21 15 15 5776 6000 1 0 1 521.6084 1561.8034 3 1561.8035 -0.0001 1 45.29 0.00014 K MFGIDRDAIAQAVR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6535.6535.3.dta 7 IPI00789310.1 37 kDa protein 404 37045 21 21 15 15 5909 5430 1 0 1 789.9048 1577.795 2 1577.7984 -0.0034 1 38.23 0.00048 K MFGIDRDAIAQAVR G Oxidation (M) 0.10000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5965.5965.2.dta 7 IPI00789310.1 37 kDa protein 404 37045 21 21 15 15 5910 5410 1 0 1 526.9406 1577.7998 3 1577.7984 0.0014 1 41.38 0.00031 K MFGIDRDAIAQAVR G Oxidation (M) 0.10000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5945.5945.3.dta 7 IPI00789310.1 37 kDa protein 404 37045 21 21 15 15 6337 8537 1 0 1 826.4003 1650.786 2 1650.7865 -0.0005 0 20.61 0.012 R TVPFCSTFAAFFTR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.9161.9161.2.dta 7 IPI00789310.1 37 kDa protein 404 37045 21 21 15 15 6531 4013 1 0 1 561.3 1680.8781 3 1680.8795 -0.0014 1 34.75 0.00055 K LGHASDRIIALDGDTK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4458.4458.3.dta 7 IPI00789310.1 37 kDa protein 404 37045 21 21 15 15 7459 5213 1 0 1 942.964 1883.9134 2 1883.9153 -0.0019 0 51.62 1.40E-05 R SVPTSTVFYPSDGVATEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5744.5744.2.dta 7 IPI00789310.1 37 kDa protein 404 37045 21 21 15 15 8670 4704 1 0 1 836.7412 2507.2016 3 2507.204 -0.0024 0 39.94 0.00018 R TSRPENAIIYNNNEDFQVGQAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5207.5207.3.dta 8 1 IPI00216049.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein K 762 51230 31 31 22 22 857 1079 1 1 1 414.7142 827.4138 2 827.4137 0.0001 0 36.5 0.0032 R HESGASIK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1242.1242.2.dta 8 1 IPI00216049.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein K 762 51230 31 31 22 22 1136 5285 1 1 1 437.2559 872.4972 2 872.4967 0.0005 0 45.43 0.00075 K DLAGSIIGK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5819.5819.2.dta 8 1 IPI00216049.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein K 762 51230 31 31 22 22 1156 5364 1 1 1 438.7164 875.4183 2 875.4178 0.0005 1 29.78 0.024 K QYSGKFF - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5898.5898.2.dta 8 1 IPI00216049.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein K 762 51230 31 31 22 22 1729 1612 1 1 1 486.2848 970.555 2 970.556 -0.0009 1 51.88 6.00E-05 K NAGAVIGKGGK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1818.1818.2.dta 8 1 IPI00216049.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein K 762 51230 31 31 22 22 1890 4155 1 1 1 499.2233 996.432 2 996.4335 -0.0014 0 49.6 7.70E-05 R GGDLMAYDR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4612.4612.2.dta 8 1 IPI00216049.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein K 762 51230 31 31 22 22 1902 3146 1 1 1 499.6975 997.3804 2 997.3811 -0.0007 0 36.25 0.00038 R DYDDMSPR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3487.3487.2.dta 8 1 IPI00216049.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein K 762 51230 31 31 22 22 2271 3321 1 1 1 527.3239 1052.6333 2 1052.6342 -0.001 0 58.54 6.00E-06 R VVLIGGKPDR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3698.3698.2.dta 8 1 IPI00216049.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein K 762 51230 31 31 22 22 2593 4128 1 1 1 549.7291 1097.4436 2 1097.4448 -0.0012 0 51.4 1.90E-05 K GSDFDCELR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4583.4583.2.dta 8 1 IPI00216049.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein K 762 51230 31 31 22 22 2639 4396 1 1 1 553.7601 1105.5057 2 1105.5074 -0.0016 0 63.67 5.50E-06 R NTDEMVELR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4873.4873.2.dta 8 1 IPI00216049.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein K 762 51230 31 31 22 22 2970 3521 1 1 1 577.2736 1152.5327 2 1152.5346 -0.0019 1 26.31 0.032 R GGDLMAYDRR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3919.3919.2.dta 8 1 IPI00216049.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein K 762 51230 31 31 22 22 2973 3511 1 1 1 385.1862 1152.5369 3 1152.5346 0.0023 1 20.28 0.029 R GGDLMAYDRR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3907.3907.3.dta 8 1 IPI00216049.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein K 762 51230 31 31 22 22 2978 2554 1 1 1 577.7472 1153.4798 2 1153.4822 -0.0024 1 42.31 0.00029 R RDYDDMSPR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2842.2842.2.dta 8 1 IPI00216049.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein K 762 51230 31 31 22 22 3231 5037 1 1 1 597.8506 1193.6866 2 1193.6921 -0.0054 0 33.29 0.0012 R NLPLPPPPPPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5566.5566.2.dta 8 1 IPI00216049.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein K 762 51230 31 31 22 22 3233 4656 1 1 1 597.8535 1193.6924 2 1193.6921 0.0003 0 40.15 0.00056 R NLPLPPPPPPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5155.5155.2.dta 8 1 IPI00216049.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein K 762 51230 31 31 22 22 3234 4802 1 1 1 597.8535 1193.6925 2 1193.6921 0.0004 0 32.01 0.0037 R NLPLPPPPPPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5313.5313.2.dta 8 1 IPI00216049.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein K 762 51230 31 31 22 22 3235 5343 1 1 1 597.8536 1193.6926 2 1193.6921 0.0005 0 24.24 0.022 R NLPLPPPPPPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5877.5877.2.dta 8 1 IPI00216049.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein K 762 51230 31 31 22 22 4335 2244 1 1 1 666.8582 1331.7018 2 1331.7045 -0.0027 1 39 0.0028 K ELRENTQTTIK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2506.2506.2.dta 8 1 IPI00216049.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein K 762 51230 31 31 22 22 4376 7502 1 1 1 670.9052 1339.7959 2 1339.7962 -0.0004 0 71.08 2.90E-07 K IILDLISESPIK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8098.8098.2.dta 8 1 IPI00216049.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein K 762 51230 31 31 22 22 4377 7623 1 1 1 670.9056 1339.7966 2 1339.7962 0.0004 0 53.21 1.80E-05 K IILDLISESPIK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8233.8233.2.dta 8 1 IPI00216049.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein K 762 51230 31 31 22 22 4443 3760 1 1 1 675.3255 1348.6364 2 1348.6405 -0.004 1 58.85 2.60E-05 R SRNTDEMVELR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4184.4184.2.dta 8 1 IPI00216049.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein K 762 51230 31 31 22 22 4444 3761 1 1 1 450.5533 1348.6381 3 1348.6405 -0.0024 1 38.42 0.0029 R SRNTDEMVELR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4185.4185.3.dta 8 1 IPI00216049.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein K 762 51230 31 31 22 22 4550 2701 1 1 1 455.8857 1364.6351 3 1364.6354 -0.0003 1 39.89 0.0016 R SRNTDEMVELR I Oxidation (M) 0.00000010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3002.3002.3.dta 8 1 IPI00216049.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein K 762 51230 31 31 22 22 5524 5899 1 1 1 506.9836 1517.929 3 1517.9293 -0.0003 0 23.32 0.0058 R LLIHQSLAGGIIGVK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6434.6434.3.dta 8 1 IPI00216049.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein K 762 51230 31 31 22 22 5742 6725 1 1 1 777.4658 1552.9171 2 1552.9188 -0.0017 1 75.27 5.60E-08 K IILDLISESPIKGR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7261.7261.2.dta 8 1 IPI00216049.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein K 762 51230 31 31 22 22 5743 6699 1 1 1 518.6472 1552.9196 3 1552.9188 0.0008 1 34.88 0.00078 K IILDLISESPIKGR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7236.7236.3.dta 8 1 IPI00216049.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein K 762 51230 31 31 22 22 6812 3069 1 1 1 579.2718 1734.7935 3 1734.7995 -0.0059 1 49.06 4.00E-05 K RPAEDMEEEQAFKR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3403.3403.3.dta 8 1 IPI00216049.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein K 762 51230 31 31 22 22 7013 3818 1 1 1 594.2702 1779.7888 3 1779.7911 -0.0024 0 29.26 0.0018 R TDYNASVSVPDSSGPER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4247.4247.3.dta 8 1 IPI00216049.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein K 762 51230 31 31 22 22 7014 3804 1 1 1 890.9017 1779.7888 2 1779.7911 -0.0023 0 78.2 4.70E-08 R TDYNASVSVPDSSGPER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4232.4232.2.dta 8 1 IPI00216049.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein K 762 51230 31 31 22 22 7576 6471 1 1 1 639.6827 1916.0264 3 1916.0255 0.0009 0 53.45 3.40E-05 R GSYGDLGGPIITTQVTIPK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7002.7002.3.dta 8 1 IPI00216049.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein K 762 51230 31 31 22 22 7900 4077 1 1 1 690.3317 2067.9733 3 2067.9709 0.0025 1 36.01 0.00042 R HESGASIKIDEPLEGSEDR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4527.4527.3.dta 8 1 IPI00216049.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein K 762 51230 31 31 22 22 7962 3915 1 1 1 707.6774 2120.0105 3 2120.0134 -0.003 1 41.86 0.00067 K ALRTDYNASVSVPDSSGPER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4352.4352.3.dta 8 IPI00216746.1 Isoform 2 of Heterogeneous nuclear ribonucleoprotein K 758 51281 30 30 21 21 857 1079 1 0 1 414.7142 827.4138 2 827.4137 0.0001 0 36.5 0.0032 R HESGASIK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1242.1242.2.dta 8 IPI00216746.1 Isoform 2 of Heterogeneous nuclear ribonucleoprotein K 758 51281 30 30 21 21 1136 5285 1 0 1 437.2559 872.4972 2 872.4967 0.0005 0 45.43 0.00075 K DLAGSIIGK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5819.5819.2.dta 8 IPI00216746.1 Isoform 2 of Heterogeneous nuclear ribonucleoprotein K 758 51281 30 30 21 21 1729 1612 1 0 1 486.2848 970.555 2 970.556 -0.0009 1 51.88 6.00E-05 K NAGAVIGKGGK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1818.1818.2.dta 8 IPI00216746.1 Isoform 2 of Heterogeneous nuclear ribonucleoprotein K 758 51281 30 30 21 21 1890 4155 1 0 1 499.2233 996.432 2 996.4335 -0.0014 0 49.6 7.70E-05 R GGDLMAYDR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4612.4612.2.dta 8 IPI00216746.1 Isoform 2 of Heterogeneous nuclear ribonucleoprotein K 758 51281 30 30 21 21 1902 3146 1 0 1 499.6975 997.3804 2 997.3811 -0.0007 0 36.25 0.00038 R DYDDMSPR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3487.3487.2.dta 8 IPI00216746.1 Isoform 2 of Heterogeneous nuclear ribonucleoprotein K 758 51281 30 30 21 21 2271 3321 1 0 1 527.3239 1052.6333 2 1052.6342 -0.001 0 58.54 6.00E-06 R VVLIGGKPDR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3698.3698.2.dta 8 IPI00216746.1 Isoform 2 of Heterogeneous nuclear ribonucleoprotein K 758 51281 30 30 21 21 2593 4128 1 0 1 549.7291 1097.4436 2 1097.4448 -0.0012 0 51.4 1.90E-05 K GSDFDCELR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4583.4583.2.dta 8 IPI00216746.1 Isoform 2 of Heterogeneous nuclear ribonucleoprotein K 758 51281 30 30 21 21 2639 4396 1 0 1 553.7601 1105.5057 2 1105.5074 -0.0016 0 63.67 5.50E-06 R NTDEMVELR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4873.4873.2.dta 8 IPI00216746.1 Isoform 2 of Heterogeneous nuclear ribonucleoprotein K 758 51281 30 30 21 21 2970 3521 1 0 1 577.2736 1152.5327 2 1152.5346 -0.0019 1 26.31 0.032 R GGDLMAYDRR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3919.3919.2.dta 8 IPI00216746.1 Isoform 2 of Heterogeneous nuclear ribonucleoprotein K 758 51281 30 30 21 21 2973 3511 1 0 1 385.1862 1152.5369 3 1152.5346 0.0023 1 20.28 0.029 R GGDLMAYDRR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3907.3907.3.dta 8 IPI00216746.1 Isoform 2 of Heterogeneous nuclear ribonucleoprotein K 758 51281 30 30 21 21 2978 2554 1 0 1 577.7472 1153.4798 2 1153.4822 -0.0024 1 42.31 0.00029 R RDYDDMSPR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2842.2842.2.dta 8 IPI00216746.1 Isoform 2 of Heterogeneous nuclear ribonucleoprotein K 758 51281 30 30 21 21 3231 5037 1 0 1 597.8506 1193.6866 2 1193.6921 -0.0054 0 33.29 0.0012 R NLPLPPPPPPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5566.5566.2.dta 8 IPI00216746.1 Isoform 2 of Heterogeneous nuclear ribonucleoprotein K 758 51281 30 30 21 21 3233 4656 1 0 1 597.8535 1193.6924 2 1193.6921 0.0003 0 40.15 0.00056 R NLPLPPPPPPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5155.5155.2.dta 8 IPI00216746.1 Isoform 2 of Heterogeneous nuclear ribonucleoprotein K 758 51281 30 30 21 21 3234 4802 1 0 1 597.8535 1193.6925 2 1193.6921 0.0004 0 32.01 0.0037 R NLPLPPPPPPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5313.5313.2.dta 8 IPI00216746.1 Isoform 2 of Heterogeneous nuclear ribonucleoprotein K 758 51281 30 30 21 21 3235 5343 1 0 1 597.8536 1193.6926 2 1193.6921 0.0005 0 24.24 0.022 R NLPLPPPPPPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5877.5877.2.dta 8 IPI00216746.1 Isoform 2 of Heterogeneous nuclear ribonucleoprotein K 758 51281 30 30 21 21 4335 2244 1 0 1 666.8582 1331.7018 2 1331.7045 -0.0027 1 39 0.0028 K ELRENTQTTIK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2506.2506.2.dta 8 IPI00216746.1 Isoform 2 of Heterogeneous nuclear ribonucleoprotein K 758 51281 30 30 21 21 4376 7502 1 0 1 670.9052 1339.7959 2 1339.7962 -0.0004 0 71.08 2.90E-07 K IILDLISESPIK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8098.8098.2.dta 8 IPI00216746.1 Isoform 2 of Heterogeneous nuclear ribonucleoprotein K 758 51281 30 30 21 21 4377 7623 1 0 1 670.9056 1339.7966 2 1339.7962 0.0004 0 53.21 1.80E-05 K IILDLISESPIK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8233.8233.2.dta 8 IPI00216746.1 Isoform 2 of Heterogeneous nuclear ribonucleoprotein K 758 51281 30 30 21 21 4443 3760 1 0 1 675.3255 1348.6364 2 1348.6405 -0.004 1 58.85 2.60E-05 R SRNTDEMVELR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4184.4184.2.dta 8 IPI00216746.1 Isoform 2 of Heterogeneous nuclear ribonucleoprotein K 758 51281 30 30 21 21 4444 3761 1 0 1 450.5533 1348.6381 3 1348.6405 -0.0024 1 38.42 0.0029 R SRNTDEMVELR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4185.4185.3.dta 8 IPI00216746.1 Isoform 2 of Heterogeneous nuclear ribonucleoprotein K 758 51281 30 30 21 21 4550 2701 1 0 1 455.8857 1364.6351 3 1364.6354 -0.0003 1 39.89 0.0016 R SRNTDEMVELR I Oxidation (M) 0.00000010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3002.3002.3.dta 8 IPI00216746.1 Isoform 2 of Heterogeneous nuclear ribonucleoprotein K 758 51281 30 30 21 21 5524 5899 1 0 1 506.9836 1517.929 3 1517.9293 -0.0003 0 23.32 0.0058 R LLIHQSLAGGIIGVK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6434.6434.3.dta 8 IPI00216746.1 Isoform 2 of Heterogeneous nuclear ribonucleoprotein K 758 51281 30 30 21 21 5742 6725 1 0 1 777.4658 1552.9171 2 1552.9188 -0.0017 1 75.27 5.60E-08 K IILDLISESPIKGR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7261.7261.2.dta 8 IPI00216746.1 Isoform 2 of Heterogeneous nuclear ribonucleoprotein K 758 51281 30 30 21 21 5743 6699 1 0 1 518.6472 1552.9196 3 1552.9188 0.0008 1 34.88 0.00078 K IILDLISESPIKGR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7236.7236.3.dta 8 IPI00216746.1 Isoform 2 of Heterogeneous nuclear ribonucleoprotein K 758 51281 30 30 21 21 6812 3069 1 0 1 579.2718 1734.7935 3 1734.7995 -0.0059 1 49.06 4.00E-05 K RPAEDMEEEQAFKR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3403.3403.3.dta 8 IPI00216746.1 Isoform 2 of Heterogeneous nuclear ribonucleoprotein K 758 51281 30 30 21 21 7013 3818 1 0 1 594.2702 1779.7888 3 1779.7911 -0.0024 0 29.26 0.0018 R TDYNASVSVPDSSGPER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4247.4247.3.dta 8 IPI00216746.1 Isoform 2 of Heterogeneous nuclear ribonucleoprotein K 758 51281 30 30 21 21 7014 3804 1 0 1 890.9017 1779.7888 2 1779.7911 -0.0023 0 78.2 4.70E-08 R TDYNASVSVPDSSGPER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4232.4232.2.dta 8 IPI00216746.1 Isoform 2 of Heterogeneous nuclear ribonucleoprotein K 758 51281 30 30 21 21 7576 6471 1 0 1 639.6827 1916.0264 3 1916.0255 0.0009 0 53.45 3.40E-05 R GSYGDLGGPIITTQVTIPK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7002.7002.3.dta 8 IPI00216746.1 Isoform 2 of Heterogeneous nuclear ribonucleoprotein K 758 51281 30 30 21 21 7900 4077 1 0 1 690.3317 2067.9733 3 2067.9709 0.0025 1 36.01 0.00042 R HESGASIKIDEPLEGSEDR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4527.4527.3.dta 8 IPI00216746.1 Isoform 2 of Heterogeneous nuclear ribonucleoprotein K 758 51281 30 30 21 21 7962 3915 1 0 1 707.6774 2120.0105 3 2120.0134 -0.003 1 41.86 0.00067 K ALRTDYNASVSVPDSSGPER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4352.4352.3.dta 8 IPI00514561.1 Heterogeneous nuclear ribonucleoprotein K 732 47756 30 30 21 21 857 1079 1 0 1 414.7142 827.4138 2 827.4137 0.0001 0 36.5 0.0032 R HESGASIK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1242.1242.2.dta 8 IPI00514561.1 Heterogeneous nuclear ribonucleoprotein K 732 47756 30 30 21 21 1136 5285 1 0 1 437.2559 872.4972 2 872.4967 0.0005 0 45.43 0.00075 K DLAGSIIGK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5819.5819.2.dta 8 IPI00514561.1 Heterogeneous nuclear ribonucleoprotein K 732 47756 30 30 21 21 1156 5364 1 0 1 438.7164 875.4183 2 875.4178 0.0005 1 29.78 0.024 K QYSGKFF - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5898.5898.2.dta 8 IPI00514561.1 Heterogeneous nuclear ribonucleoprotein K 732 47756 30 30 21 21 1890 4155 1 0 1 499.2233 996.432 2 996.4335 -0.0014 0 49.6 7.70E-05 R GGDLMAYDR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4612.4612.2.dta 8 IPI00514561.1 Heterogeneous nuclear ribonucleoprotein K 732 47756 30 30 21 21 1902 3146 1 0 1 499.6975 997.3804 2 997.3811 -0.0007 0 36.25 0.00038 R DYDDMSPR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3487.3487.2.dta 8 IPI00514561.1 Heterogeneous nuclear ribonucleoprotein K 732 47756 30 30 21 21 2271 3321 1 0 1 527.3239 1052.6333 2 1052.6342 -0.001 0 58.54 6.00E-06 R VVLIGGKPDR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3698.3698.2.dta 8 IPI00514561.1 Heterogeneous nuclear ribonucleoprotein K 732 47756 30 30 21 21 2593 4128 1 0 1 549.7291 1097.4436 2 1097.4448 -0.0012 0 51.4 1.90E-05 K GSDFDCELR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4583.4583.2.dta 8 IPI00514561.1 Heterogeneous nuclear ribonucleoprotein K 732 47756 30 30 21 21 2639 4396 1 0 1 553.7601 1105.5057 2 1105.5074 -0.0016 0 63.67 5.50E-06 R NTDEMVELR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4873.4873.2.dta 8 IPI00514561.1 Heterogeneous nuclear ribonucleoprotein K 732 47756 30 30 21 21 2970 3521 1 0 1 577.2736 1152.5327 2 1152.5346 -0.0019 1 26.31 0.032 R GGDLMAYDRR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3919.3919.2.dta 8 IPI00514561.1 Heterogeneous nuclear ribonucleoprotein K 732 47756 30 30 21 21 2973 3511 1 0 1 385.1862 1152.5369 3 1152.5346 0.0023 1 20.28 0.029 R GGDLMAYDRR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3907.3907.3.dta 8 IPI00514561.1 Heterogeneous nuclear ribonucleoprotein K 732 47756 30 30 21 21 2978 2554 1 0 1 577.7472 1153.4798 2 1153.4822 -0.0024 1 42.31 0.00029 R RDYDDMSPR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2842.2842.2.dta 8 IPI00514561.1 Heterogeneous nuclear ribonucleoprotein K 732 47756 30 30 21 21 3231 5037 1 0 1 597.8506 1193.6866 2 1193.6921 -0.0054 0 33.29 0.0012 R NLPLPPPPPPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5566.5566.2.dta 8 IPI00514561.1 Heterogeneous nuclear ribonucleoprotein K 732 47756 30 30 21 21 3233 4656 1 0 1 597.8535 1193.6924 2 1193.6921 0.0003 0 40.15 0.00056 R NLPLPPPPPPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5155.5155.2.dta 8 IPI00514561.1 Heterogeneous nuclear ribonucleoprotein K 732 47756 30 30 21 21 3234 4802 1 0 1 597.8535 1193.6925 2 1193.6921 0.0004 0 32.01 0.0037 R NLPLPPPPPPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5313.5313.2.dta 8 IPI00514561.1 Heterogeneous nuclear ribonucleoprotein K 732 47756 30 30 21 21 3235 5343 1 0 1 597.8536 1193.6926 2 1193.6921 0.0005 0 24.24 0.022 R NLPLPPPPPPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5877.5877.2.dta 8 IPI00514561.1 Heterogeneous nuclear ribonucleoprotein K 732 47756 30 30 21 21 4335 2244 1 0 1 666.8582 1331.7018 2 1331.7045 -0.0027 1 39 0.0028 K ELRENTQTTIK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2506.2506.2.dta 8 IPI00514561.1 Heterogeneous nuclear ribonucleoprotein K 732 47756 30 30 21 21 4376 7502 1 0 1 670.9052 1339.7959 2 1339.7962 -0.0004 0 71.08 2.90E-07 K IILDLISESPIK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8098.8098.2.dta 8 IPI00514561.1 Heterogeneous nuclear ribonucleoprotein K 732 47756 30 30 21 21 4377 7623 1 0 1 670.9056 1339.7966 2 1339.7962 0.0004 0 53.21 1.80E-05 K IILDLISESPIK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8233.8233.2.dta 8 IPI00514561.1 Heterogeneous nuclear ribonucleoprotein K 732 47756 30 30 21 21 4443 3760 1 0 1 675.3255 1348.6364 2 1348.6405 -0.004 1 58.85 2.60E-05 R SRNTDEMVELR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4184.4184.2.dta 8 IPI00514561.1 Heterogeneous nuclear ribonucleoprotein K 732 47756 30 30 21 21 4444 3761 1 0 1 450.5533 1348.6381 3 1348.6405 -0.0024 1 38.42 0.0029 R SRNTDEMVELR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4185.4185.3.dta 8 IPI00514561.1 Heterogeneous nuclear ribonucleoprotein K 732 47756 30 30 21 21 4550 2701 1 0 1 455.8857 1364.6351 3 1364.6354 -0.0003 1 39.89 0.0016 R SRNTDEMVELR I Oxidation (M) 0.00000010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3002.3002.3.dta 8 IPI00514561.1 Heterogeneous nuclear ribonucleoprotein K 732 47756 30 30 21 21 5524 5899 1 0 1 506.9836 1517.929 3 1517.9293 -0.0003 0 23.32 0.0058 R LLIHQSLAGGIIGVK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6434.6434.3.dta 8 IPI00514561.1 Heterogeneous nuclear ribonucleoprotein K 732 47756 30 30 21 21 5742 6725 1 0 1 777.4658 1552.9171 2 1552.9188 -0.0017 1 75.27 5.60E-08 K IILDLISESPIKGR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7261.7261.2.dta 8 IPI00514561.1 Heterogeneous nuclear ribonucleoprotein K 732 47756 30 30 21 21 5743 6699 1 0 1 518.6472 1552.9196 3 1552.9188 0.0008 1 34.88 0.00078 K IILDLISESPIKGR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7236.7236.3.dta 8 IPI00514561.1 Heterogeneous nuclear ribonucleoprotein K 732 47756 30 30 21 21 6812 3069 1 0 1 579.2718 1734.7935 3 1734.7995 -0.0059 1 49.06 4.00E-05 K RPAEDMEEEQAFKR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3403.3403.3.dta 8 IPI00514561.1 Heterogeneous nuclear ribonucleoprotein K 732 47756 30 30 21 21 7013 3818 1 0 1 594.2702 1779.7888 3 1779.7911 -0.0024 0 29.26 0.0018 R TDYNASVSVPDSSGPER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4247.4247.3.dta 8 IPI00514561.1 Heterogeneous nuclear ribonucleoprotein K 732 47756 30 30 21 21 7014 3804 1 0 1 890.9017 1779.7888 2 1779.7911 -0.0023 0 78.2 4.70E-08 R TDYNASVSVPDSSGPER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4232.4232.2.dta 8 IPI00514561.1 Heterogeneous nuclear ribonucleoprotein K 732 47756 30 30 21 21 7576 6471 1 0 1 639.6827 1916.0264 3 1916.0255 0.0009 0 53.45 3.40E-05 R GSYGDLGGPIITTQVTIPK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7002.7002.3.dta 8 IPI00514561.1 Heterogeneous nuclear ribonucleoprotein K 732 47756 30 30 21 21 7900 4077 1 0 1 690.3317 2067.9733 3 2067.9709 0.0025 1 36.01 0.00042 R HESGASIKIDEPLEGSEDR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4527.4527.3.dta 8 IPI00514561.1 Heterogeneous nuclear ribonucleoprotein K 732 47756 30 30 21 21 7962 3915 1 0 1 707.6774 2120.0105 3 2120.0134 -0.003 1 41.86 0.00067 K ALRTDYNASVSVPDSSGPER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4352.4352.3.dta 8 IPI00647717.1 Heterogeneous nuclear ribonucleoprotein K 706 42009 27 27 18 18 1729 1612 1 0 1 486.2848 970.555 2 970.556 -0.0009 1 51.88 6.00E-05 K NAGAVIGKGGK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1818.1818.2.dta 8 IPI00647717.1 Heterogeneous nuclear ribonucleoprotein K 706 42009 27 27 18 18 1890 4155 1 0 1 499.2233 996.432 2 996.4335 -0.0014 0 49.6 7.70E-05 R GGDLMAYDR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4612.4612.2.dta 8 IPI00647717.1 Heterogeneous nuclear ribonucleoprotein K 706 42009 27 27 18 18 1902 3146 1 0 1 499.6975 997.3804 2 997.3811 -0.0007 0 36.25 0.00038 R DYDDMSPR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3487.3487.2.dta 8 IPI00647717.1 Heterogeneous nuclear ribonucleoprotein K 706 42009 27 27 18 18 2271 3321 1 0 1 527.3239 1052.6333 2 1052.6342 -0.001 0 58.54 6.00E-06 R VVLIGGKPDR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3698.3698.2.dta 8 IPI00647717.1 Heterogeneous nuclear ribonucleoprotein K 706 42009 27 27 18 18 2593 4128 1 0 1 549.7291 1097.4436 2 1097.4448 -0.0012 0 51.4 1.90E-05 K GSDFDCELR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4583.4583.2.dta 8 IPI00647717.1 Heterogeneous nuclear ribonucleoprotein K 706 42009 27 27 18 18 2639 4396 1 0 1 553.7601 1105.5057 2 1105.5074 -0.0016 0 63.67 5.50E-06 R NTDEMVELR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4873.4873.2.dta 8 IPI00647717.1 Heterogeneous nuclear ribonucleoprotein K 706 42009 27 27 18 18 2970 3521 1 0 1 577.2736 1152.5327 2 1152.5346 -0.0019 1 26.31 0.032 R GGDLMAYDRR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3919.3919.2.dta 8 IPI00647717.1 Heterogeneous nuclear ribonucleoprotein K 706 42009 27 27 18 18 2973 3511 1 0 1 385.1862 1152.5369 3 1152.5346 0.0023 1 20.28 0.029 R GGDLMAYDRR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3907.3907.3.dta 8 IPI00647717.1 Heterogeneous nuclear ribonucleoprotein K 706 42009 27 27 18 18 2978 2554 1 0 1 577.7472 1153.4798 2 1153.4822 -0.0024 1 42.31 0.00029 R RDYDDMSPR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2842.2842.2.dta 8 IPI00647717.1 Heterogeneous nuclear ribonucleoprotein K 706 42009 27 27 18 18 3231 5037 1 0 1 597.8506 1193.6866 2 1193.6921 -0.0054 0 33.29 0.0012 R NLPLPPPPPPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5566.5566.2.dta 8 IPI00647717.1 Heterogeneous nuclear ribonucleoprotein K 706 42009 27 27 18 18 3233 4656 1 0 1 597.8535 1193.6924 2 1193.6921 0.0003 0 40.15 0.00056 R NLPLPPPPPPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5155.5155.2.dta 8 IPI00647717.1 Heterogeneous nuclear ribonucleoprotein K 706 42009 27 27 18 18 3234 4802 1 0 1 597.8535 1193.6925 2 1193.6921 0.0004 0 32.01 0.0037 R NLPLPPPPPPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5313.5313.2.dta 8 IPI00647717.1 Heterogeneous nuclear ribonucleoprotein K 706 42009 27 27 18 18 3235 5343 1 0 1 597.8536 1193.6926 2 1193.6921 0.0005 0 24.24 0.022 R NLPLPPPPPPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5877.5877.2.dta 8 IPI00647717.1 Heterogeneous nuclear ribonucleoprotein K 706 42009 27 27 18 18 4335 2244 1 0 1 666.8582 1331.7018 2 1331.7045 -0.0027 1 39 0.0028 K ELRENTQTTIK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2506.2506.2.dta 8 IPI00647717.1 Heterogeneous nuclear ribonucleoprotein K 706 42009 27 27 18 18 4376 7502 1 0 1 670.9052 1339.7959 2 1339.7962 -0.0004 0 71.08 2.90E-07 K IILDLISESPIK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8098.8098.2.dta 8 IPI00647717.1 Heterogeneous nuclear ribonucleoprotein K 706 42009 27 27 18 18 4377 7623 1 0 1 670.9056 1339.7966 2 1339.7962 0.0004 0 53.21 1.80E-05 K IILDLISESPIK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8233.8233.2.dta 8 IPI00647717.1 Heterogeneous nuclear ribonucleoprotein K 706 42009 27 27 18 18 4443 3760 1 0 1 675.3255 1348.6364 2 1348.6405 -0.004 1 58.85 2.60E-05 R SRNTDEMVELR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4184.4184.2.dta 8 IPI00647717.1 Heterogeneous nuclear ribonucleoprotein K 706 42009 27 27 18 18 4444 3761 1 0 1 450.5533 1348.6381 3 1348.6405 -0.0024 1 38.42 0.0029 R SRNTDEMVELR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4185.4185.3.dta 8 IPI00647717.1 Heterogeneous nuclear ribonucleoprotein K 706 42009 27 27 18 18 4550 2701 1 0 1 455.8857 1364.6351 3 1364.6354 -0.0003 1 39.89 0.0016 R SRNTDEMVELR I Oxidation (M) 0.00000010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3002.3002.3.dta 8 IPI00647717.1 Heterogeneous nuclear ribonucleoprotein K 706 42009 27 27 18 18 5524 5899 1 0 1 506.9836 1517.929 3 1517.9293 -0.0003 0 23.32 0.0058 R LLIHQSLAGGIIGVK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6434.6434.3.dta 8 IPI00647717.1 Heterogeneous nuclear ribonucleoprotein K 706 42009 27 27 18 18 5742 6725 1 0 1 777.4658 1552.9171 2 1552.9188 -0.0017 1 75.27 5.60E-08 K IILDLISESPIKGR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7261.7261.2.dta 8 IPI00647717.1 Heterogeneous nuclear ribonucleoprotein K 706 42009 27 27 18 18 5743 6699 1 0 1 518.6472 1552.9196 3 1552.9188 0.0008 1 34.88 0.00078 K IILDLISESPIKGR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7236.7236.3.dta 8 IPI00647717.1 Heterogeneous nuclear ribonucleoprotein K 706 42009 27 27 18 18 6812 3069 1 0 1 579.2718 1734.7935 3 1734.7995 -0.0059 1 49.06 4.00E-05 K RPAEDMEEEQAFKR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3403.3403.3.dta 8 IPI00647717.1 Heterogeneous nuclear ribonucleoprotein K 706 42009 27 27 18 18 7013 3818 1 0 1 594.2702 1779.7888 3 1779.7911 -0.0024 0 29.26 0.0018 R TDYNASVSVPDSSGPER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4247.4247.3.dta 8 IPI00647717.1 Heterogeneous nuclear ribonucleoprotein K 706 42009 27 27 18 18 7014 3804 1 0 1 890.9017 1779.7888 2 1779.7911 -0.0023 0 78.2 4.70E-08 R TDYNASVSVPDSSGPER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4232.4232.2.dta 8 IPI00647717.1 Heterogeneous nuclear ribonucleoprotein K 706 42009 27 27 18 18 7576 6471 1 0 1 639.6827 1916.0264 3 1916.0255 0.0009 0 53.45 3.40E-05 R GSYGDLGGPIITTQVTIPK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7002.7002.3.dta 8 IPI00647717.1 Heterogeneous nuclear ribonucleoprotein K 706 42009 27 27 18 18 7962 3915 1 0 1 707.6774 2120.0105 3 2120.0134 -0.003 1 41.86 0.00067 K ALRTDYNASVSVPDSSGPER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4352.4352.3.dta 8 IPI00640296.1 Heterogeneous nuclear ribonucleoprotein K 415 34354 17 17 11 11 1890 4155 1 0 1 499.2233 996.432 2 996.4335 -0.0014 0 49.6 7.70E-05 R GGDLMAYDR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4612.4612.2.dta 8 IPI00640296.1 Heterogeneous nuclear ribonucleoprotein K 415 34354 17 17 11 11 1902 3146 1 0 1 499.6975 997.3804 2 997.3811 -0.0007 0 36.25 0.00038 R DYDDMSPR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3487.3487.2.dta 8 IPI00640296.1 Heterogeneous nuclear ribonucleoprotein K 415 34354 17 17 11 11 2271 3321 1 0 1 527.3239 1052.6333 2 1052.6342 -0.001 0 58.54 6.00E-06 R VVLIGGKPDR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3698.3698.2.dta 8 IPI00640296.1 Heterogeneous nuclear ribonucleoprotein K 415 34354 17 17 11 11 2593 4128 1 0 1 549.7291 1097.4436 2 1097.4448 -0.0012 0 51.4 1.90E-05 K GSDFDCELR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4583.4583.2.dta 8 IPI00640296.1 Heterogeneous nuclear ribonucleoprotein K 415 34354 17 17 11 11 2970 3521 1 0 1 577.2736 1152.5327 2 1152.5346 -0.0019 1 26.31 0.032 R GGDLMAYDRR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3919.3919.2.dta 8 IPI00640296.1 Heterogeneous nuclear ribonucleoprotein K 415 34354 17 17 11 11 2973 3511 1 0 1 385.1862 1152.5369 3 1152.5346 0.0023 1 20.28 0.029 R GGDLMAYDRR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3907.3907.3.dta 8 IPI00640296.1 Heterogeneous nuclear ribonucleoprotein K 415 34354 17 17 11 11 2978 2554 1 0 1 577.7472 1153.4798 2 1153.4822 -0.0024 1 42.31 0.00029 R RDYDDMSPR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2842.2842.2.dta 8 IPI00640296.1 Heterogeneous nuclear ribonucleoprotein K 415 34354 17 17 11 11 3231 5037 1 0 1 597.8506 1193.6866 2 1193.6921 -0.0054 0 33.29 0.0012 R NLPLPPPPPPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5566.5566.2.dta 8 IPI00640296.1 Heterogeneous nuclear ribonucleoprotein K 415 34354 17 17 11 11 3233 4656 1 0 1 597.8535 1193.6924 2 1193.6921 0.0003 0 40.15 0.00056 R NLPLPPPPPPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5155.5155.2.dta 8 IPI00640296.1 Heterogeneous nuclear ribonucleoprotein K 415 34354 17 17 11 11 3234 4802 1 0 1 597.8535 1193.6925 2 1193.6921 0.0004 0 32.01 0.0037 R NLPLPPPPPPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5313.5313.2.dta 8 IPI00640296.1 Heterogeneous nuclear ribonucleoprotein K 415 34354 17 17 11 11 3235 5343 1 0 1 597.8536 1193.6926 2 1193.6921 0.0005 0 24.24 0.022 R NLPLPPPPPPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5877.5877.2.dta 8 IPI00640296.1 Heterogeneous nuclear ribonucleoprotein K 415 34354 17 17 11 11 4335 2244 1 0 1 666.8582 1331.7018 2 1331.7045 -0.0027 1 39 0.0028 K ELRENTQTTIK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2506.2506.2.dta 8 IPI00640296.1 Heterogeneous nuclear ribonucleoprotein K 415 34354 17 17 11 11 4376 7502 1 0 1 670.9052 1339.7959 2 1339.7962 -0.0004 0 71.08 2.90E-07 K IILDLISESPIK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8098.8098.2.dta 8 IPI00640296.1 Heterogeneous nuclear ribonucleoprotein K 415 34354 17 17 11 11 4377 7623 1 0 1 670.9056 1339.7966 2 1339.7962 0.0004 0 53.21 1.80E-05 K IILDLISESPIK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8233.8233.2.dta 8 IPI00640296.1 Heterogeneous nuclear ribonucleoprotein K 415 34354 17 17 11 11 5524 5899 1 0 1 506.9836 1517.929 3 1517.9293 -0.0003 0 23.32 0.0058 R LLIHQSLAGGIIGVK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6434.6434.3.dta 8 IPI00640296.1 Heterogeneous nuclear ribonucleoprotein K 415 34354 17 17 11 11 5742 6725 1 0 1 777.4658 1552.9171 2 1552.9188 -0.0017 1 75.27 5.60E-08 K IILDLISESPIKGR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7261.7261.2.dta 8 IPI00640296.1 Heterogeneous nuclear ribonucleoprotein K 415 34354 17 17 11 11 5743 6699 1 0 1 518.6472 1552.9196 3 1552.9188 0.0008 1 34.88 0.00078 K IILDLISESPIKGR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7236.7236.3.dta 8 IPI00796697.1 42 kDa protein 247 42582 13 13 9 9 857 1079 1 0 1 414.7142 827.4138 2 827.4137 0.0001 0 36.5 0.0032 R HESGASIK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1242.1242.2.dta 8 IPI00796697.1 42 kDa protein 247 42582 13 13 9 9 1136 5285 1 0 1 437.2559 872.4972 2 872.4967 0.0005 0 45.43 0.00075 K DLAGSIIGK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5819.5819.2.dta 8 IPI00796697.1 42 kDa protein 247 42582 13 13 9 9 1729 1612 1 0 1 486.2848 970.555 2 970.556 -0.0009 1 51.88 6.00E-05 K NAGAVIGKGGK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1818.1818.2.dta 8 IPI00796697.1 42 kDa protein 247 42582 13 13 9 9 1890 4155 1 0 1 499.2233 996.432 2 996.4335 -0.0014 0 49.6 7.70E-05 R GGDLMAYDR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4612.4612.2.dta 8 IPI00796697.1 42 kDa protein 247 42582 13 13 9 9 1902 3146 1 0 1 499.6975 997.3804 2 997.3811 -0.0007 0 36.25 0.00038 R DYDDMSPR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3487.3487.2.dta 8 IPI00796697.1 42 kDa protein 247 42582 13 13 9 9 2593 4128 1 0 1 549.7291 1097.4436 2 1097.4448 -0.0012 0 51.4 1.90E-05 K GSDFDCELR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4583.4583.2.dta 8 IPI00796697.1 42 kDa protein 247 42582 13 13 9 9 2970 3521 1 0 1 577.2736 1152.5327 2 1152.5346 -0.0019 1 26.31 0.032 R GGDLMAYDRR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3919.3919.2.dta 8 IPI00796697.1 42 kDa protein 247 42582 13 13 9 9 2973 3511 1 0 1 385.1862 1152.5369 3 1152.5346 0.0023 1 20.28 0.029 R GGDLMAYDRR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3907.3907.3.dta 8 IPI00796697.1 42 kDa protein 247 42582 13 13 9 9 2978 2554 1 0 1 577.7472 1153.4798 2 1153.4822 -0.0024 1 42.31 0.00029 R RDYDDMSPR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2842.2842.2.dta 8 IPI00796697.1 42 kDa protein 247 42582 13 13 9 9 3231 5037 1 0 1 597.8506 1193.6866 2 1193.6921 -0.0054 0 33.29 0.0012 R NLPLPPPPPPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5566.5566.2.dta 8 IPI00796697.1 42 kDa protein 247 42582 13 13 9 9 3233 4656 1 0 1 597.8535 1193.6924 2 1193.6921 0.0003 0 40.15 0.00056 R NLPLPPPPPPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5155.5155.2.dta 8 IPI00796697.1 42 kDa protein 247 42582 13 13 9 9 3234 4802 1 0 1 597.8535 1193.6925 2 1193.6921 0.0004 0 32.01 0.0037 R NLPLPPPPPPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5313.5313.2.dta 8 IPI00796697.1 42 kDa protein 247 42582 13 13 9 9 3235 5343 1 0 1 597.8536 1193.6926 2 1193.6921 0.0005 0 24.24 0.022 R NLPLPPPPPPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5877.5877.2.dta 9 1 IPI00008524.1 Isoform 1 of Polyadenylate-binding protein 1 699 70854 26 26 22 22 336 2144 1 1 0 353.2249 704.4353 2 704.4334 0.002 1 24.99 0.0051 R KVFVGR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2397.2397.2.dta 9 1 IPI00008524.1 Isoform 1 of Polyadenylate-binding protein 1 699 70854 26 26 22 22 609 1174 2 1 1 387.7273 773.44 2 773.4395 0.0005 1 31.17 0.025 R QTELKR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1345.1345.2.dta 9 1 IPI00008524.1 Isoform 1 of Polyadenylate-binding protein 1 699 70854 26 26 22 22 1500 5649 1 1 1 467.7714 933.5282 2 933.5284 -0.0001 0 77.86 1.80E-07 K SGVGNIFIK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6184.6184.2.dta 9 1 IPI00008524.1 Isoform 1 of Polyadenylate-binding protein 1 699 70854 26 26 22 22 2021 4625 1 1 1 508.2745 1014.5345 2 1014.5346 -0.0001 0 37.08 0.00052 K AVNSATGVPTV - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5121.5121.2.dta 9 1 IPI00008524.1 Isoform 1 of Polyadenylate-binding protein 1 699 70854 26 26 22 22 2208 6819 1 1 1 523.2592 1044.5039 2 1044.5029 0.001 0 49.75 0.00021 K GFGFVSFER H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7354.7354.2.dta 9 1 IPI00008524.1 Isoform 1 of Polyadenylate-binding protein 1 699 70854 26 26 22 22 2225 1981 1 1 1 523.7769 1045.5393 2 1045.5404 -0.0011 1 35.67 0.0088 K NLDKSIDNK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2218.2218.2.dta 9 1 IPI00008524.1 Isoform 1 of Polyadenylate-binding protein 1 699 70854 26 26 22 22 2343 4565 1 1 1 531.8187 1061.6228 2 1061.6233 -0.0005 1 23.05 0.015 R KSGVGNIFIK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5056.5056.2.dta 9 1 IPI00008524.1 Isoform 1 of Polyadenylate-binding protein 1 699 70854 26 26 22 22 2501 4852 1 1 1 542.295 1082.5755 2 1082.576 -0.0005 0 50.36 0.00016 R YQGVNLYVK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5367.5367.2.dta 9 1 IPI00008524.1 Isoform 1 of Polyadenylate-binding protein 1 699 70854 26 26 22 22 3002 6338 1 1 1 579.3376 1156.6606 2 1156.6604 0.0002 0 66.73 2.90E-06 K FSPAGPILSIR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6871.6871.2.dta 9 1 IPI00008524.1 Isoform 1 of Polyadenylate-binding protein 1 699 70854 26 26 22 22 3398 4104 1 1 1 606.8347 1211.6548 2 1211.655 -0.0002 1 35.83 0.0006 R AKEFTNVYIK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4557.4557.2.dta 9 1 IPI00008524.1 Isoform 1 of Polyadenylate-binding protein 1 699 70854 26 26 22 22 3846 6560 1 1 1 633.8239 1265.6332 2 1265.6326 0.0006 0 83.68 8.10E-08 R ALDTMNFDVIK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7095.7095.2.dta 9 1 IPI00008524.1 Isoform 1 of Polyadenylate-binding protein 1 699 70854 26 26 22 22 3941 5662 1 1 1 641.8196 1281.6247 2 1281.6275 -0.0028 0 79.15 3.80E-08 R ALDTMNFDVIK G Oxidation (M) 0.00001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6198.6198.2.dta 9 1 IPI00008524.1 Isoform 1 of Polyadenylate-binding protein 1 699 70854 26 26 22 22 3951 6330 1 1 1 642.8255 1283.6364 2 1283.6398 -0.0033 0 39.6 0.00059 K EFSPFGTITSAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6863.6863.2.dta 9 1 IPI00008524.1 Isoform 1 of Polyadenylate-binding protein 1 699 70854 26 26 22 22 4740 2920 1 1 1 463.8936 1388.659 3 1388.6619 -0.0029 0 29.47 0.0017 R QAHLTNQYMQR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3242.3242.3.dta 9 1 IPI00008524.1 Isoform 1 of Polyadenylate-binding protein 1 699 70854 26 26 22 22 4906 5369 1 1 1 706.8745 1411.7345 2 1411.7347 -0.0003 1 37.81 0.00028 R KEFSPFGTITSAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5903.5903.2.dta 9 1 IPI00008524.1 Isoform 1 of Polyadenylate-binding protein 1 699 70854 26 26 22 22 4907 5367 1 1 1 471.5858 1411.7355 3 1411.7347 0.0008 1 38.28 0.00089 R KEFSPFGTITSAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5901.5901.3.dta 9 1 IPI00008524.1 Isoform 1 of Polyadenylate-binding protein 1 699 70854 26 26 22 22 5355 4209 1 1 1 493.6028 1477.7867 3 1477.7889 -0.0022 0 17.1 0.028 K VDEAVAVLQAHQAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4670.4670.3.dta 9 1 IPI00008524.1 Isoform 1 of Polyadenylate-binding protein 1 699 70854 26 26 22 22 5689 5445 1 1 1 771.971 1541.9275 2 1541.9293 -0.0019 0 36.07 0.00047 R IVATKPLYVALAQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5981.5981.2.dta 9 1 IPI00008524.1 Isoform 1 of Polyadenylate-binding protein 1 699 70854 26 26 22 22 5690 5427 1 1 1 514.9835 1541.9287 3 1541.9293 -0.0006 0 30.81 0.0016 R IVATKPLYVALAQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5962.5962.3.dta 9 1 IPI00008524.1 Isoform 1 of Polyadenylate-binding protein 1 699 70854 26 26 22 22 6388 6873 1 1 1 831.8768 1661.739 2 1661.7396 -0.0006 0 53.42 9.80E-06 K GFGFVCFSSPEEATK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7407.7407.2.dta 9 1 IPI00008524.1 Isoform 1 of Polyadenylate-binding protein 1 699 70854 26 26 22 22 6625 4411 1 1 1 565.3124 1692.9155 3 1692.9159 -0.0004 1 61.08 3.20E-06 R SKVDEAVAVLQAHQAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4889.4889.3.dta 9 1 IPI00008524.1 Isoform 1 of Polyadenylate-binding protein 1 699 70854 26 26 22 22 6835 5211 1 1 1 580.9374 1739.7905 3 1739.7903 0.0001 0 31.24 0.0017 K GYGFVHFETQEAAER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5742.5742.3.dta 9 1 IPI00008524.1 Isoform 1 of Polyadenylate-binding protein 1 699 70854 26 26 22 22 7107 8200 1 1 1 903.9391 1805.8637 2 1805.8658 -0.0021 0 19.31 0.017 K ALYDTFSAFGNILSCK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8828.8828.2.dta 9 1 IPI00008524.1 Isoform 1 of Polyadenylate-binding protein 1 699 70854 26 26 22 22 7433 5981 1 1 1 626.6286 1876.864 3 1876.8666 -0.0026 1 48.26 3.00E-05 R SKGFGFVCFSSPEEATK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6515.6515.3.dta 9 1 IPI00008524.1 Isoform 1 of Polyadenylate-binding protein 1 699 70854 26 26 22 22 7633 5859 1 1 1 964.9593 1927.904 2 1927.9064 -0.0024 0 69.68 2.90E-07 R SLGYAYVNFQQPADAER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6395.6395.2.dta 9 1 IPI00008524.1 Isoform 1 of Polyadenylate-binding protein 1 699 70854 26 26 22 22 7634 5873 1 1 1 643.6424 1927.9054 3 1927.9064 -0.0011 0 60.14 2.30E-06 R SLGYAYVNFQQPADAER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6409.6409.3.dta 9 IPI00790842.1 16 kDa protein 354 16493 9 9 7 7 1500 5649 1 0 1 467.7714 933.5282 2 933.5284 -0.0001 0 77.86 1.80E-07 K SGVGNIFIK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6184.6184.2.dta 9 IPI00790842.1 16 kDa protein 354 16493 9 9 7 7 2225 1981 1 0 1 523.7769 1045.5393 2 1045.5404 -0.0011 1 35.67 0.0088 K NLDKSIDNK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2218.2218.2.dta 9 IPI00790842.1 16 kDa protein 354 16493 9 9 7 7 2343 4565 1 0 1 531.8187 1061.6228 2 1061.6233 -0.0005 1 23.05 0.015 R KSGVGNIFIK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5056.5056.2.dta 9 IPI00790842.1 16 kDa protein 354 16493 9 9 7 7 3002 6338 1 0 1 579.3376 1156.6606 2 1156.6604 0.0002 0 66.73 2.90E-06 K FSPAGPILSIR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6871.6871.2.dta 9 IPI00790842.1 16 kDa protein 354 16493 9 9 7 7 3846 6560 1 0 1 633.8239 1265.6332 2 1265.6326 0.0006 0 83.68 8.10E-08 R ALDTMNFDVIK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7095.7095.2.dta 9 IPI00790842.1 16 kDa protein 354 16493 9 9 7 7 3941 5662 1 0 1 641.8196 1281.6247 2 1281.6275 -0.0028 0 79.15 3.80E-08 R ALDTMNFDVIK G Oxidation (M) 0.00001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6198.6198.2.dta 9 IPI00790842.1 16 kDa protein 354 16493 9 9 7 7 7107 8200 1 0 1 903.9391 1805.8637 2 1805.8658 -0.0021 0 19.31 0.017 K ALYDTFSAFGNILSCK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8828.8828.2.dta 9 IPI00790842.1 16 kDa protein 354 16493 9 9 7 7 7633 5859 1 0 1 964.9593 1927.904 2 1927.9064 -0.0024 0 69.68 2.90E-07 R SLGYAYVNFQQPADAER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6395.6395.2.dta 9 IPI00790842.1 16 kDa protein 354 16493 9 9 7 7 7634 5873 1 0 1 643.6424 1927.9054 3 1927.9064 -0.0011 0 60.14 2.30E-06 R SLGYAYVNFQQPADAER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6409.6409.3.dta 9 IPI00012726.4 Isoform 1 of Polyadenylate-binding protein 4 348 71080 10 10 8 8 336 2144 1 0 0 353.2249 704.4353 2 704.4334 0.002 1 24.99 0.0051 R KVFVGR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2397.2397.2.dta 9 IPI00012726.4 Isoform 1 of Polyadenylate-binding protein 4 348 71080 10 10 8 8 2225 1981 1 0 1 523.7769 1045.5393 2 1045.5404 -0.0011 1 35.67 0.0088 K NLDKSIDNK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2218.2218.2.dta 9 IPI00012726.4 Isoform 1 of Polyadenylate-binding protein 4 348 71080 10 10 8 8 3398 4104 1 0 1 606.8347 1211.6548 2 1211.655 -0.0002 1 35.83 0.0006 K AKEFTNVYIK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4557.4557.2.dta 9 IPI00012726.4 Isoform 1 of Polyadenylate-binding protein 4 348 71080 10 10 8 8 3846 6560 1 0 1 633.8239 1265.6332 2 1265.6326 0.0006 0 83.68 8.10E-08 R ALDTMNFDVIK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7095.7095.2.dta 9 IPI00012726.4 Isoform 1 of Polyadenylate-binding protein 4 348 71080 10 10 8 8 3941 5662 1 0 1 641.8196 1281.6247 2 1281.6275 -0.0028 0 79.15 3.80E-08 R ALDTMNFDVIK G Oxidation (M) 0.00001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6198.6198.2.dta 9 IPI00012726.4 Isoform 1 of Polyadenylate-binding protein 4 348 71080 10 10 8 8 6388 6873 1 0 1 831.8768 1661.739 2 1661.7396 -0.0006 0 53.42 9.80E-06 K GFGFVCFSSPEEATK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7407.7407.2.dta 9 IPI00012726.4 Isoform 1 of Polyadenylate-binding protein 4 348 71080 10 10 8 8 7107 8200 1 0 1 903.9391 1805.8637 2 1805.8658 -0.0021 0 19.31 0.017 K ALYDTFSAFGNILSCK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8828.8828.2.dta 9 IPI00012726.4 Isoform 1 of Polyadenylate-binding protein 4 348 71080 10 10 8 8 7433 5981 1 0 1 626.6286 1876.864 3 1876.8666 -0.0026 1 48.26 3.00E-05 R SKGFGFVCFSSPEEATK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6515.6515.3.dta 9 IPI00012726.4 Isoform 1 of Polyadenylate-binding protein 4 348 71080 10 10 8 8 7633 5859 1 0 1 964.9593 1927.904 2 1927.9064 -0.0024 0 69.68 2.90E-07 R SLGYAYVNFQQPADAER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6395.6395.2.dta 9 IPI00012726.4 Isoform 1 of Polyadenylate-binding protein 4 348 71080 10 10 8 8 7634 5873 1 0 1 643.6424 1927.9054 3 1927.9064 -0.0011 0 60.14 2.30E-06 R SLGYAYVNFQQPADAER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6409.6409.3.dta 9 IPI00794246.1 36 kDa protein 284 36083 13 13 11 11 336 2144 1 0 0 353.2249 704.4353 2 704.4334 0.002 1 24.99 0.0051 R KVFVGR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2397.2397.2.dta 9 IPI00794246.1 36 kDa protein 284 36083 13 13 11 11 609 1174 2 0 1 387.7273 773.44 2 773.4395 0.0005 1 31.17 0.025 R QTELKR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1345.1345.2.dta 9 IPI00794246.1 36 kDa protein 284 36083 13 13 11 11 2208 6819 1 0 1 523.2592 1044.5039 2 1044.5029 0.001 0 49.75 0.00021 K GFGFVSFER H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7354.7354.2.dta 9 IPI00794246.1 36 kDa protein 284 36083 13 13 11 11 2501 4852 1 0 1 542.295 1082.5755 2 1082.576 -0.0005 0 50.36 0.00016 R YQGVNLYVK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5367.5367.2.dta 9 IPI00794246.1 36 kDa protein 284 36083 13 13 11 11 3398 4104 1 0 1 606.8347 1211.6548 2 1211.655 -0.0002 1 35.83 0.0006 R AKEFTNVYIK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4557.4557.2.dta 9 IPI00794246.1 36 kDa protein 284 36083 13 13 11 11 3951 6330 1 0 1 642.8255 1283.6364 2 1283.6398 -0.0033 0 39.6 0.00059 K EFSPFGTITSAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6863.6863.2.dta 9 IPI00794246.1 36 kDa protein 284 36083 13 13 11 11 4740 2920 1 0 1 463.8936 1388.659 3 1388.6619 -0.0029 0 29.47 0.0017 R QAHLTNQYMQR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3242.3242.3.dta 9 IPI00794246.1 36 kDa protein 284 36083 13 13 11 11 4906 5369 1 0 1 706.8745 1411.7345 2 1411.7347 -0.0003 1 37.81 0.00028 R KEFSPFGTITSAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5903.5903.2.dta 9 IPI00794246.1 36 kDa protein 284 36083 13 13 11 11 4907 5367 1 0 1 471.5858 1411.7355 3 1411.7347 0.0008 1 38.28 0.00089 R KEFSPFGTITSAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5901.5901.3.dta 9 IPI00794246.1 36 kDa protein 284 36083 13 13 11 11 5689 5445 1 0 1 771.971 1541.9275 2 1541.9293 -0.0019 0 36.07 0.00047 R IVATKPLYVALAQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5981.5981.2.dta 9 IPI00794246.1 36 kDa protein 284 36083 13 13 11 11 5690 5427 1 0 1 514.9835 1541.9287 3 1541.9293 -0.0006 0 30.81 0.0016 R IVATKPLYVALAQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5962.5962.3.dta 9 IPI00794246.1 36 kDa protein 284 36083 13 13 11 11 6388 6873 1 0 1 831.8768 1661.739 2 1661.7396 -0.0006 0 53.42 9.80E-06 K GFGFVCFSSPEEATK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7407.7407.2.dta 9 IPI00794246.1 36 kDa protein 284 36083 13 13 11 11 7433 5981 1 0 1 626.6286 1876.864 3 1876.8666 -0.0026 1 48.26 3.00E-05 R SKGFGFVCFSSPEEATK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6515.6515.3.dta 9 IPI00301154.3 Polyadenylate-binding protein 3 261 70215 10 10 9 9 609 1174 2 0 1 387.7273 773.44 2 773.4395 0.0005 1 31.17 0.025 R QTELKR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1345.1345.2.dta 9 IPI00301154.3 Polyadenylate-binding protein 3 261 70215 10 10 9 9 2021 4625 1 0 1 508.2745 1014.5345 2 1014.5346 -0.0001 0 37.08 0.00052 K AVNSATGVPTV - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5121.5121.2.dta 9 IPI00301154.3 Polyadenylate-binding protein 3 261 70215 10 10 9 9 2208 6819 1 0 1 523.2592 1044.5039 2 1044.5029 0.001 0 49.75 0.00021 K GFGFVSFER H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7354.7354.2.dta 9 IPI00301154.3 Polyadenylate-binding protein 3 261 70215 10 10 9 9 3002 6338 1 0 1 579.3376 1156.6606 2 1156.6604 0.0002 0 66.73 2.90E-06 K FSPAGPILSIR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6871.6871.2.dta 9 IPI00301154.3 Polyadenylate-binding protein 3 261 70215 10 10 9 9 5355 4209 1 0 1 493.6028 1477.7867 3 1477.7889 -0.0022 0 17.1 0.028 K VDEAVAVLQAHQAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4670.4670.3.dta 9 IPI00301154.3 Polyadenylate-binding protein 3 261 70215 10 10 9 9 5689 5445 1 0 1 771.971 1541.9275 2 1541.9293 -0.0019 0 36.07 0.00047 R IVATKPLYVALAQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5981.5981.2.dta 9 IPI00301154.3 Polyadenylate-binding protein 3 261 70215 10 10 9 9 5690 5427 1 0 1 514.9835 1541.9287 3 1541.9293 -0.0006 0 30.81 0.0016 R IVATKPLYVALAQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5962.5962.3.dta 9 IPI00301154.3 Polyadenylate-binding protein 3 261 70215 10 10 9 9 6388 6873 1 0 1 831.8768 1661.739 2 1661.7396 -0.0006 0 53.42 9.80E-06 K GFGFVCFSSPEEATK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7407.7407.2.dta 9 IPI00301154.3 Polyadenylate-binding protein 3 261 70215 10 10 9 9 6625 4411 1 0 1 565.3124 1692.9155 3 1692.9159 -0.0004 1 61.08 3.20E-06 R SKVDEAVAVLQAHQAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4889.4889.3.dta 9 IPI00301154.3 Polyadenylate-binding protein 3 261 70215 10 10 9 9 7433 5981 1 0 1 626.6286 1876.864 3 1876.8666 -0.0026 1 48.26 3.00E-05 R SKGFGFVCFSSPEEATK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6515.6515.3.dta 9 IPI00644016.1 "Poly(A) binding protein, cytoplasmic 4" 250 14499 6 6 4 4 2225 1981 1 0 1 523.7769 1045.5393 2 1045.5404 -0.0011 1 35.67 0.0088 K NLDKSIDNK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2218.2218.2.dta 9 IPI00644016.1 "Poly(A) binding protein, cytoplasmic 4" 250 14499 6 6 4 4 3846 6560 1 0 1 633.8239 1265.6332 2 1265.6326 0.0006 0 83.68 8.10E-08 R ALDTMNFDVIK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7095.7095.2.dta 9 IPI00644016.1 "Poly(A) binding protein, cytoplasmic 4" 250 14499 6 6 4 4 3941 5662 1 0 1 641.8196 1281.6247 2 1281.6275 -0.0028 0 79.15 3.80E-08 R ALDTMNFDVIK G Oxidation (M) 0.00001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6198.6198.2.dta 9 IPI00644016.1 "Poly(A) binding protein, cytoplasmic 4" 250 14499 6 6 4 4 7107 8200 1 0 1 903.9391 1805.8637 2 1805.8658 -0.0021 0 19.31 0.017 K ALYDTFSAFGNILSCK - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8828.8828.2.dta 9 IPI00644016.1 "Poly(A) binding protein, cytoplasmic 4" 250 14499 6 6 4 4 7633 5859 1 0 1 964.9593 1927.904 2 1927.9064 -0.0024 0 69.68 2.90E-07 R SLGYAYVNFQQPADAER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6395.6395.2.dta 9 IPI00644016.1 "Poly(A) binding protein, cytoplasmic 4" 250 14499 6 6 4 4 7634 5873 1 0 1 643.6424 1927.9054 3 1927.9064 -0.0011 0 60.14 2.30E-06 R SLGYAYVNFQQPADAER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6409.6409.3.dta 9 IPI00556259.3 Polyadenylate-binding protein 1-like 187 68976 5 5 5 5 1500 5649 1 0 1 467.7714 933.5282 2 933.5284 -0.0001 0 77.86 1.80E-07 K SGVGNIFIK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6184.6184.2.dta 9 IPI00556259.3 Polyadenylate-binding protein 1-like 187 68976 5 5 5 5 2343 4565 1 0 1 531.8187 1061.6228 2 1061.6233 -0.0005 1 23.05 0.015 R KSGVGNIFIK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5056.5056.2.dta 9 IPI00556259.3 Polyadenylate-binding protein 1-like 187 68976 5 5 5 5 2501 4852 1 0 1 542.295 1082.5755 2 1082.576 -0.0005 0 50.36 0.00016 R YQGVNLYVK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5367.5367.2.dta 9 IPI00556259.3 Polyadenylate-binding protein 1-like 187 68976 5 5 5 5 3002 6338 1 0 1 579.3376 1156.6606 2 1156.6604 0.0002 0 66.73 2.90E-06 K FSPAGPILSIR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6871.6871.2.dta 9 IPI00556259.3 Polyadenylate-binding protein 1-like 187 68976 5 5 5 5 6388 6873 1 0 1 831.8768 1661.739 2 1661.7396 -0.0006 0 53.42 9.80E-06 K GFGFVCFSSPEEATK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7407.7407.2.dta 9 IPI00306870.2 Chromosome 20 open reading frame 119 151 37941 4 4 4 4 1500 5649 1 0 1 467.7714 933.5282 2 933.5284 -0.0001 0 77.86 1.80E-07 K SGVGNIFIK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6184.6184.2.dta 9 IPI00306870.2 Chromosome 20 open reading frame 119 151 37941 4 4 4 4 2343 4565 1 0 1 531.8187 1061.6228 2 1061.6233 -0.0005 1 23.05 0.015 R KSGVGNIFIK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5056.5056.2.dta 9 IPI00306870.2 Chromosome 20 open reading frame 119 151 37941 4 4 4 4 2501 4852 1 0 1 542.295 1082.5755 2 1082.576 -0.0005 0 50.36 0.00016 R YQGVNLYVK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5367.5367.2.dta 9 IPI00306870.2 Chromosome 20 open reading frame 119 151 37941 4 4 4 4 3002 6338 1 0 1 579.3376 1156.6606 2 1156.6604 0.0002 0 66.73 2.90E-06 K FSPAGPILSIR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6871.6871.2.dta 9 IPI00796139.1 8 kDa protein 94 8549 4 4 4 4 1500 5649 1 0 1 467.7714 933.5282 2 933.5284 -0.0001 0 77.86 1.80E-07 K SGVGNIFIK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6184.6184.2.dta 9 IPI00796139.1 8 kDa protein 94 8549 4 4 4 4 2225 1981 1 0 1 523.7769 1045.5393 2 1045.5404 -0.0011 1 35.67 0.0088 K NLDKSIDNK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2218.2218.2.dta 9 IPI00796139.1 8 kDa protein 94 8549 4 4 4 4 2343 4565 1 0 1 531.8187 1061.6228 2 1061.6233 -0.0005 1 23.05 0.015 R KSGVGNIFIK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5056.5056.2.dta 9 IPI00796139.1 8 kDa protein 94 8549 4 4 4 4 7107 8200 1 0 1 903.9391 1805.8637 2 1805.8658 -0.0021 0 19.31 0.017 K ALYDTFSAFGNILSCK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8828.8828.2.dta 9 IPI00061206.1 Polyadenylate-binding protein 5 81 43646 2 2 2 2 1500 5649 1 0 1 467.7714 933.5282 2 933.5284 -0.0001 0 77.86 1.80E-07 K SGVGNIFIK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6184.6184.2.dta 9 IPI00061206.1 Polyadenylate-binding protein 5 81 43646 2 2 2 2 2343 4565 1 0 1 531.8187 1061.6228 2 1061.6233 -0.0005 1 23.05 0.015 R KSGVGNIFIK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5056.5056.2.dta 9 IPI00217142.3 "Novel protein similar to poly(A)binding protein, cytoplasmic 1" 67 22956 1 1 1 1 3002 6338 1 0 1 579.3376 1156.6606 2 1156.6604 0.0002 0 66.73 2.90E-06 K FSPAGPILSIR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6871.6871.2.dta 9 IPI00432527.1 PABPCP2 protein 50 30256 1 1 1 1 2208 6819 1 0 1 523.2592 1044.5039 2 1044.5029 0.001 0 49.75 0.00021 K GFGFVSFER H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7354.7354.2.dta 9 IPI00411607.1 "CDNA FLJ45986 fis, clone PUAEN2000594, highly similar to Polyadenylate-binding protein 1" 39 15573 2 2 2 2 2021 4625 1 0 1 508.2745 1014.5345 2 1014.5346 -0.0001 0 37.08 0.00052 K AVNSATGVPTV - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5121.5121.2.dta 9 IPI00411607.1 "CDNA FLJ45986 fis, clone PUAEN2000594, highly similar to Polyadenylate-binding protein 1" 39 15573 2 2 2 2 5355 4209 1 0 1 493.6028 1477.7867 3 1477.7889 -0.0022 0 17.1 0.028 K VDEAVAVLQAHQAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4670.4670.3.dta 9 IPI00735942.1 similar to Polyadenylate-binding protein 1 37 30826 1 1 1 1 2021 4625 1 0 1 508.2745 1014.5345 2 1014.5346 -0.0001 0 37.08 0.00052 K AVNSATGVPTV - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5121.5121.2.dta 9 IPI00784455.2 "similar to poly(A) binding protein, cytoplasmic 4" 36 42056 1 1 1 1 2225 1981 1 0 1 523.7769 1045.5393 2 1045.5404 -0.0011 1 35.67 0.0088 K NLDKSIDNK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2218.2218.2.dta 10 1 IPI00465430.5 70 kDa protein 628 70111 26 26 22 22 804 2908 1 1 1 409.7128 817.411 2 817.4116 -0.0006 0 28.6 0.042 K EVAALCR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3229.3229.2.dta 10 1 IPI00465430.5 70 kDa protein 628 70111 26 26 22 22 1963 6156 1 1 1 503.2861 1004.5576 2 1004.5542 0.0034 0 45.69 0.00052 R ILELDQFK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6691.6691.2.dta 10 1 IPI00465430.5 70 kDa protein 628 70111 26 26 22 22 1976 5993 1 1 1 504.274 1006.5334 2 1006.5335 -0.0001 0 61.41 1.10E-05 R LGSLVDEFK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6527.6527.2.dta 10 1 IPI00465430.5 70 kDa protein 628 70111 26 26 22 22 2205 6120 1 1 1 522.8007 1043.5868 2 1043.5862 0.0005 0 38.05 0.0024 K QELLEALTK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6654.6654.2.dta 10 1 IPI00465430.5 70 kDa protein 628 70111 26 26 22 22 2212 1105 1 1 1 523.2795 1044.5444 2 1044.5451 -0.0007 1 26.03 0.033 R ETNEPVKTK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1270.1270.2.dta 10 1 IPI00465430.5 70 kDa protein 628 70111 26 26 22 22 2411 3269 1 1 1 537.2863 1072.558 2 1072.5587 -0.0007 0 32 0.0043 K IMATPEQVGK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3637.3637.2.dta 10 1 IPI00465430.5 70 kDa protein 628 70111 26 26 22 22 2545 2568 1 1 1 545.2828 1088.551 2 1088.5536 -0.0026 0 42.96 0.00038 K IMATPEQVGK M Oxidation (M) 0.0100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2857.2857.2.dta 10 1 IPI00465430.5 70 kDa protein 628 70111 26 26 22 22 3109 5126 1 1 1 586.8474 1171.6803 2 1171.6812 -0.0009 1 62.58 6.00E-06 K KQELLEALTK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5656.5656.2.dta 10 1 IPI00465430.5 70 kDa protein 628 70111 26 26 22 22 3110 5134 1 1 1 391.5679 1171.6818 3 1171.6812 0.0006 1 45.23 0.00038 K KQELLEALTK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5665.5665.3.dta 10 1 IPI00465430.5 70 kDa protein 628 70111 26 26 22 22 3373 7323 1 1 1 604.3323 1206.6501 2 1206.6496 0.0005 0 73.97 4.10E-07 R DSLIFLVDASK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7894.7894.2.dta 10 1 IPI00465430.5 70 kDa protein 628 70111 26 26 22 22 4192 5484 1 1 1 656.3229 1310.6312 2 1310.6327 -0.0015 1 52.04 1.30E-05 K HDNEGSGSKRPK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.602.602.2.dta 10 1 IPI00465430.5 70 kDa protein 628 70111 26 26 22 22 4440 4407 1 1 1 450.2285 1347.6636 3 1347.6639 -0.0002 1 41.41 0.00025 K CLEKEVAALCR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4885.4885.3.dta 10 1 IPI00465430.5 70 kDa protein 628 70111 26 26 22 22 4473 8331 1 1 1 677.8672 1353.7198 2 1353.718 0.0018 0 18.14 0.02 R DLLAVVFYGTEK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8957.8957.2.dta 10 1 IPI00465430.5 70 kDa protein 628 70111 26 26 22 22 4727 6626 1 1 1 694.8481 1387.6816 2 1387.6831 -0.0014 0 57.53 5.30E-06 R DIISIAEDEDLR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7160.7160.2.dta 10 1 IPI00465430.5 70 kDa protein 628 70111 26 26 22 22 4844 8064 1 1 1 701.8718 1401.7291 2 1401.7326 -0.0035 0 30.4 0.0028 R DTGIFLDLMHLK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8694.8694.2.dta 10 1 IPI00465430.5 70 kDa protein 628 70111 26 26 22 22 5881 6611 1 1 1 787.4143 1572.8141 2 1572.8147 -0.0007 0 98.34 3.20E-09 K NIYVLQELDNPGAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7145.7145.2.dta 10 1 IPI00465430.5 70 kDa protein 628 70111 26 26 22 22 6340 5912 1 1 1 826.4284 1650.8423 2 1650.8465 -0.0042 0 70.52 1.70E-06 R TFNTSTGGLLLPSDTK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6447.6447.2.dta 10 1 IPI00465430.5 70 kDa protein 628 70111 26 26 22 22 6573 3522 1 1 1 564.6204 1690.8393 3 1690.8413 -0.0021 1 28.8 0.026 K VEYSEEELKTHISK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3920.3920.3.dta 10 1 IPI00465430.5 70 kDa protein 628 70111 26 26 22 22 6574 3526 1 1 1 423.7188 1690.8461 4 1690.8413 0.0048 1 24.99 0.014 K VEYSEEELKTHISK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3924.3924.4.dta 10 1 IPI00465430.5 70 kDa protein 628 70111 26 26 22 22 6676 5318 1 1 1 852.4095 1702.8044 2 1702.8063 -0.0019 0 58.26 3.40E-06 R SDSFENPVLQQHFR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5851.5851.2.dta 10 1 IPI00465430.5 70 kDa protein 628 70111 26 26 22 22 6792 6019 1 1 1 865.4636 1728.9126 2 1728.9158 -0.0033 1 61.4 2.70E-06 K NIYVLQELDNPGAKR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6553.6553.2.dta 10 1 IPI00465430.5 70 kDa protein 628 70111 26 26 22 22 6793 6011 1 1 1 577.3123 1728.9151 3 1728.9158 -0.0007 1 25.56 0.004 K NIYVLQELDNPGAKR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6546.6546.3.dta 10 1 IPI00465430.5 70 kDa protein 628 70111 26 26 22 22 7114 5278 1 1 1 904.4799 1806.9452 2 1806.9476 -0.0024 1 42.37 0.00062 R TFNTSTGGLLLPSDTKR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5811.5811.2.dta 10 1 IPI00465430.5 70 kDa protein 628 70111 26 26 22 22 7506 4938 1 1 1 634.9573 1901.8502 3 1901.8578 -0.0076 0 31.76 0.0013 R IMLFTNEDNPHGNDSAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5461.5461.3.dta 10 1 IPI00465430.5 70 kDa protein 628 70111 26 26 22 22 7843 7741 1 1 1 676.0332 2025.0778 3 2025.0782 -0.0005 1 29.31 0.01 K IISSDRDLLAVVFYGTEK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8367.8367.3.dta 10 1 IPI00465430.5 70 kDa protein 628 70111 26 26 22 22 8674 8144 1 1 1 837.0873 2508.24 3 2508.2424 -0.0024 1 14.24 0.046 R LGSLVDEFKELVYPPDYNPEGK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8772.8772.3.dta 10 IPI00412259.2 similar to ATP-dependent DNA helicase 2 subunit 1 (ATP-dependent DNA helicase II 70 kDa subunit) (Lupus Ku autoantigen protein p70) (Ku70) (70 kDa subunit of Ku antigen) (Thyroid-lupus autoantigen) (TLAA) (CTC box-binding factor 75 kDa subunit) (CT. 300 54567 12 12 10 10 804 2908 1 0 1 409.7128 817.411 2 817.4116 -0.0006 0 28.6 0.042 K EVAALCR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3229.3229.2.dta 10 IPI00412259.2 similar to ATP-dependent DNA helicase 2 subunit 1 (ATP-dependent DNA helicase II 70 kDa subunit) (Lupus Ku autoantigen protein p70) (Ku70) (70 kDa subunit of Ku antigen) (Thyroid-lupus autoantigen) (TLAA) (CTC box-binding factor 75 kDa subunit) (CT. 300 54567 12 12 10 10 1976 5993 1 0 1 504.274 1006.5334 2 1006.5335 -0.0001 0 61.41 1.10E-05 R LGSLVDEFK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6527.6527.2.dta 10 IPI00412259.2 similar to ATP-dependent DNA helicase 2 subunit 1 (ATP-dependent DNA helicase II 70 kDa subunit) (Lupus Ku autoantigen protein p70) (Ku70) (70 kDa subunit of Ku antigen) (Thyroid-lupus autoantigen) (TLAA) (CTC box-binding factor 75 kDa subunit) (CT. 300 54567 12 12 10 10 2205 6120 1 0 1 522.8007 1043.5868 2 1043.5862 0.0005 0 38.05 0.0024 K QELLEALTK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6654.6654.2.dta 10 IPI00412259.2 similar to ATP-dependent DNA helicase 2 subunit 1 (ATP-dependent DNA helicase II 70 kDa subunit) (Lupus Ku autoantigen protein p70) (Ku70) (70 kDa subunit of Ku antigen) (Thyroid-lupus autoantigen) (TLAA) (CTC box-binding factor 75 kDa subunit) (CT. 300 54567 12 12 10 10 3109 5126 1 0 1 586.8474 1171.6803 2 1171.6812 -0.0009 1 62.58 6.00E-06 K KQELLEALTK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5656.5656.2.dta 10 IPI00412259.2 similar to ATP-dependent DNA helicase 2 subunit 1 (ATP-dependent DNA helicase II 70 kDa subunit) (Lupus Ku autoantigen protein p70) (Ku70) (70 kDa subunit of Ku antigen) (Thyroid-lupus autoantigen) (TLAA) (CTC box-binding factor 75 kDa subunit) (CT. 300 54567 12 12 10 10 3110 5134 1 0 1 391.5679 1171.6818 3 1171.6812 0.0006 1 45.23 0.00038 K KQELLEALTK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5665.5665.3.dta 10 IPI00412259.2 similar to ATP-dependent DNA helicase 2 subunit 1 (ATP-dependent DNA helicase II 70 kDa subunit) (Lupus Ku autoantigen protein p70) (Ku70) (70 kDa subunit of Ku antigen) (Thyroid-lupus autoantigen) (TLAA) (CTC box-binding factor 75 kDa subunit) (CT. 300 54567 12 12 10 10 4192 5484 1 0 1 656.3229 1310.6312 2 1310.6327 -0.0015 1 52.04 1.30E-05 K HDNEGSGSKRPK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.602.602.2.dta 10 IPI00412259.2 similar to ATP-dependent DNA helicase 2 subunit 1 (ATP-dependent DNA helicase II 70 kDa subunit) (Lupus Ku autoantigen protein p70) (Ku70) (70 kDa subunit of Ku antigen) (Thyroid-lupus autoantigen) (TLAA) (CTC box-binding factor 75 kDa subunit) (CT. 300 54567 12 12 10 10 4440 4407 1 0 1 450.2285 1347.6636 3 1347.6639 -0.0002 1 41.41 0.00025 K CLEKEVAALCR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4885.4885.3.dta 10 IPI00412259.2 similar to ATP-dependent DNA helicase 2 subunit 1 (ATP-dependent DNA helicase II 70 kDa subunit) (Lupus Ku autoantigen protein p70) (Ku70) (70 kDa subunit of Ku antigen) (Thyroid-lupus autoantigen) (TLAA) (CTC box-binding factor 75 kDa subunit) (CT. 300 54567 12 12 10 10 4727 6626 1 0 1 694.8481 1387.6816 2 1387.6831 -0.0014 0 57.53 5.30E-06 R DIISIAEDEDLR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7160.7160.2.dta 10 IPI00412259.2 similar to ATP-dependent DNA helicase 2 subunit 1 (ATP-dependent DNA helicase II 70 kDa subunit) (Lupus Ku autoantigen protein p70) (Ku70) (70 kDa subunit of Ku antigen) (Thyroid-lupus autoantigen) (TLAA) (CTC box-binding factor 75 kDa subunit) (CT. 300 54567 12 12 10 10 4844 8064 1 0 1 701.8718 1401.7291 2 1401.7326 -0.0035 0 30.4 0.0028 R DTGIFLDLMHLK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8694.8694.2.dta 10 IPI00412259.2 similar to ATP-dependent DNA helicase 2 subunit 1 (ATP-dependent DNA helicase II 70 kDa subunit) (Lupus Ku autoantigen protein p70) (Ku70) (70 kDa subunit of Ku antigen) (Thyroid-lupus autoantigen) (TLAA) (CTC box-binding factor 75 kDa subunit) (CT. 300 54567 12 12 10 10 6573 3522 1 0 1 564.6204 1690.8393 3 1690.8413 -0.0021 1 28.8 0.026 K VEYSEEELKTHISK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3920.3920.3.dta 10 IPI00412259.2 similar to ATP-dependent DNA helicase 2 subunit 1 (ATP-dependent DNA helicase II 70 kDa subunit) (Lupus Ku autoantigen protein p70) (Ku70) (70 kDa subunit of Ku antigen) (Thyroid-lupus autoantigen) (TLAA) (CTC box-binding factor 75 kDa subunit) (CT. 300 54567 12 12 10 10 6574 3526 1 0 1 423.7188 1690.8461 4 1690.8413 0.0048 1 24.99 0.014 K VEYSEEELKTHISK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3924.3924.4.dta 10 IPI00412259.2 similar to ATP-dependent DNA helicase 2 subunit 1 (ATP-dependent DNA helicase II 70 kDa subunit) (Lupus Ku autoantigen protein p70) (Ku70) (70 kDa subunit of Ku antigen) (Thyroid-lupus autoantigen) (TLAA) (CTC box-binding factor 75 kDa subunit) (CT. 300 54567 12 12 10 10 6676 5318 1 0 1 852.4095 1702.8044 2 1702.8063 -0.0019 0 58.26 3.40E-06 R SDSFENPVLQQHFR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5851.5851.2.dta 10 IPI00291939.1 Structural maintenance of chromosomes protein 1A 46 143771 1 1 1 1 1963 6156 1 0 1 503.2861 1004.5576 2 1004.5542 0.0034 0 45.69 0.00052 K LIEIENFK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6691.6691.2.dta 11 1 IPI00290770.3 "chaperonin containing TCP1, subunit 3 isoform b" 611 60994 23 23 21 21 234 2002 1 1 1 338.1788 674.3431 2 674.3421 0.001 0 28.53 0.033 R TCLGPK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2241.2241.2.dta 11 1 IPI00290770.3 "chaperonin containing TCP1, subunit 3 isoform b" 611 60994 23 23 21 21 323 4188 1 1 1 351.7296 701.4446 2 701.4436 0.0011 0 39.76 0.0014 R LLTSLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4648.4648.2.dta 11 1 IPI00290770.3 "chaperonin containing TCP1, subunit 3 isoform b" 611 60994 23 23 21 21 528 3297 1 1 1 379.7295 757.4444 2 757.4446 -0.0002 0 37.28 0.006 R ANITAIR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3671.3671.2.dta 11 1 IPI00290770.3 "chaperonin containing TCP1, subunit 3 isoform b" 611 60994 23 23 21 21 674 1350 1 1 1 395.7322 789.4499 2 789.4497 0.0002 1 31.5 0.0068 R YIKNPR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1535.1535.2.dta 11 1 IPI00290770.3 "chaperonin containing TCP1, subunit 3 isoform b" 611 60994 23 23 21 21 990 4661 1 1 1 423.7471 845.4797 2 845.4793 0.0004 0 41.64 0.0017 K ACTILLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5160.5160.2.dta 11 1 IPI00290770.3 "chaperonin containing TCP1, subunit 3 isoform b" 611 60994 23 23 21 21 1368 2482 1 1 1 457.7801 913.5456 2 913.5457 -0.0002 1 26.15 0.0077 R ANITAIRR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2764.2764.2.dta 11 1 IPI00290770.3 "chaperonin containing TCP1, subunit 3 isoform b" 611 60994 23 23 21 21 1751 4281 1 1 1 487.7621 973.5097 2 973.508 0.0017 0 53.55 0.00015 K EILSEVER N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4748.4748.2.dta 11 1 IPI00290770.3 "chaperonin containing TCP1, subunit 3 isoform b" 611 60994 23 23 21 21 1795 2731 1 1 1 328.5105 982.5097 3 982.5084 0.0013 0 21.69 0.023 R IDDIVSGHK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3035.3035.3.dta 11 1 IPI00290770.3 "chaperonin containing TCP1, subunit 3 isoform b" 611 60994 23 23 21 21 1930 1654 1 1 1 501.2722 1000.5299 2 1000.5301 -0.0002 0 37.69 0.0034 K VQSGNINAAK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1864.1864.2.dta 11 1 IPI00290770.3 "chaperonin containing TCP1, subunit 3 isoform b" 611 60994 23 23 21 21 2740 2070 1 1 1 560.8083 1119.6021 2 1119.6036 -0.0015 0 32.44 0.0071 R EIQVQHPAAK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2315.2315.2.dta 11 1 IPI00290770.3 "chaperonin containing TCP1, subunit 3 isoform b" 611 60994 23 23 21 21 2809 1366 1 1 1 565.3202 1128.6258 2 1128.6251 0.0007 1 85.2 4.40E-08 R KVQSGNINAAK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1553.1553.2.dta 11 1 IPI00290770.3 "chaperonin containing TCP1, subunit 3 isoform b" 611 60994 23 23 21 21 3051 5641 1 1 1 583.8472 1165.6799 2 1165.6819 -0.002 0 63.31 1.70E-06 R AVAQALEVIPR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6176.6176.2.dta 11 1 IPI00290770.3 "chaperonin containing TCP1, subunit 3 isoform b" 611 60994 23 23 21 21 3052 5686 1 1 1 583.8482 1165.6819 2 1165.6819 0 0 72.42 2.60E-07 R AVAQALEVIPR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6221.6221.2.dta 11 1 IPI00290770.3 "chaperonin containing TCP1, subunit 3 isoform b" 611 60994 23 23 21 21 3691 2664 1 1 1 625.7846 1249.5547 2 1249.5543 0.0003 0 23.92 0.04 R NLQDAMQVCR N Oxidation (M) 0.0000010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2962.2962.2.dta 11 1 IPI00290770.3 "chaperonin containing TCP1, subunit 3 isoform b" 611 60994 23 23 21 21 3731 7375 1 1 1 627.8574 1253.7003 2 1253.702 -0.0017 0 46.3 0.00011 K ELGIWEPLAVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7955.7955.2.dta 11 1 IPI00290770.3 "chaperonin containing TCP1, subunit 3 isoform b" 611 60994 23 23 21 21 3930 6377 1 1 1 640.3606 1278.7066 2 1278.7071 -0.0005 0 62.89 2.90E-06 R IVLLDSSLEYK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6910.6910.2.dta 11 1 IPI00290770.3 "chaperonin containing TCP1, subunit 3 isoform b" 611 60994 23 23 21 21 4242 4157 1 1 1 659.3525 1316.6905 2 1316.6936 -0.003 1 57.43 1.30E-05 R GASKEILSEVER N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4614.4614.2.dta 11 1 IPI00290770.3 "chaperonin containing TCP1, subunit 3 isoform b" 611 60994 23 23 21 21 4336 3883 1 1 1 667.3459 1332.6773 2 1332.682 -0.0046 0 70.05 1.50E-06 R TLIQNCGASTIR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4317.4317.2.dta 11 1 IPI00290770.3 "chaperonin containing TCP1, subunit 3 isoform b" 611 60994 23 23 21 21 4359 5510 1 1 1 669.318 1336.6214 2 1336.6234 -0.002 0 42.16 0.00027 K AMTGVEQWPYR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6046.6046.2.dta 11 1 IPI00290770.3 "chaperonin containing TCP1, subunit 3 isoform b" 611 60994 23 23 21 21 5005 5910 1 1 1 714.8803 1427.7461 2 1427.7442 0.0018 0 73.56 8.10E-07 K IPGGIIEDSCVLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6445.6445.2.dta 11 1 IPI00290770.3 "chaperonin containing TCP1, subunit 3 isoform b" 611 60994 23 23 21 21 7022 5536 1 1 1 595.657 1783.9491 3 1783.9502 -0.0011 1 61.56 1.70E-06 R VEKIPGGIIEDSCVLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6071.6071.3.dta 11 1 IPI00290770.3 "chaperonin containing TCP1, subunit 3 isoform b" 611 60994 23 23 21 21 8659 5599 1 1 1 832.7805 2495.3197 3 2495.3231 -0.0034 1 36.82 0.00038 R IVSRPEELREDDVGTGAGLLEIK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6135.6135.3.dta 11 1 IPI00290770.3 "chaperonin containing TCP1, subunit 3 isoform b" 611 60994 23 23 21 21 8660 5594 1 1 1 624.8383 2495.3242 4 2495.3231 0.0011 1 40.72 0.00017 R IVSRPEELREDDVGTGAGLLEIK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6130.6130.4.dta 11 IPI00552715.1 "chaperonin containing TCP1, subunit 3 isoform c" 599 56908 21 21 19 19 323 4188 1 0 1 351.7296 701.4446 2 701.4436 0.0011 0 39.76 0.0014 R LLTSLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4648.4648.2.dta 11 IPI00552715.1 "chaperonin containing TCP1, subunit 3 isoform c" 599 56908 21 21 19 19 528 3297 1 0 1 379.7295 757.4444 2 757.4446 -0.0002 0 37.28 0.006 R ANITAIR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3671.3671.2.dta 11 IPI00552715.1 "chaperonin containing TCP1, subunit 3 isoform c" 599 56908 21 21 19 19 674 1350 1 0 1 395.7322 789.4499 2 789.4497 0.0002 1 31.5 0.0068 R YIKNPR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1535.1535.2.dta 11 IPI00552715.1 "chaperonin containing TCP1, subunit 3 isoform c" 599 56908 21 21 19 19 990 4661 1 0 1 423.7471 845.4797 2 845.4793 0.0004 0 41.64 0.0017 K ACTILLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5160.5160.2.dta 11 IPI00552715.1 "chaperonin containing TCP1, subunit 3 isoform c" 599 56908 21 21 19 19 1368 2482 1 0 1 457.7801 913.5456 2 913.5457 -0.0002 1 26.15 0.0077 R ANITAIRR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2764.2764.2.dta 11 IPI00552715.1 "chaperonin containing TCP1, subunit 3 isoform c" 599 56908 21 21 19 19 1751 4281 1 0 1 487.7621 973.5097 2 973.508 0.0017 0 53.55 0.00015 K EILSEVER N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4748.4748.2.dta 11 IPI00552715.1 "chaperonin containing TCP1, subunit 3 isoform c" 599 56908 21 21 19 19 1795 2731 1 0 1 328.5105 982.5097 3 982.5084 0.0013 0 21.69 0.023 R IDDIVSGHK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3035.3035.3.dta 11 IPI00552715.1 "chaperonin containing TCP1, subunit 3 isoform c" 599 56908 21 21 19 19 1930 1654 1 0 1 501.2722 1000.5299 2 1000.5301 -0.0002 0 37.69 0.0034 K VQSGNINAAK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1864.1864.2.dta 11 IPI00552715.1 "chaperonin containing TCP1, subunit 3 isoform c" 599 56908 21 21 19 19 2809 1366 1 0 1 565.3202 1128.6258 2 1128.6251 0.0007 1 85.2 4.40E-08 R KVQSGNINAAK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1553.1553.2.dta 11 IPI00552715.1 "chaperonin containing TCP1, subunit 3 isoform c" 599 56908 21 21 19 19 3051 5641 1 0 1 583.8472 1165.6799 2 1165.6819 -0.002 0 63.31 1.70E-06 R AVAQALEVIPR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6176.6176.2.dta 11 IPI00552715.1 "chaperonin containing TCP1, subunit 3 isoform c" 599 56908 21 21 19 19 3052 5686 1 0 1 583.8482 1165.6819 2 1165.6819 0 0 72.42 2.60E-07 R AVAQALEVIPR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6221.6221.2.dta 11 IPI00552715.1 "chaperonin containing TCP1, subunit 3 isoform c" 599 56908 21 21 19 19 3691 2664 1 0 1 625.7846 1249.5547 2 1249.5543 0.0003 0 23.92 0.04 R NLQDAMQVCR N Oxidation (M) 0.0000010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2962.2962.2.dta 11 IPI00552715.1 "chaperonin containing TCP1, subunit 3 isoform c" 599 56908 21 21 19 19 3731 7375 1 0 1 627.8574 1253.7003 2 1253.702 -0.0017 0 46.3 0.00011 K ELGIWEPLAVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7955.7955.2.dta 11 IPI00552715.1 "chaperonin containing TCP1, subunit 3 isoform c" 599 56908 21 21 19 19 3930 6377 1 0 1 640.3606 1278.7066 2 1278.7071 -0.0005 0 62.89 2.90E-06 R IVLLDSSLEYK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6910.6910.2.dta 11 IPI00552715.1 "chaperonin containing TCP1, subunit 3 isoform c" 599 56908 21 21 19 19 4242 4157 1 0 1 659.3525 1316.6905 2 1316.6936 -0.003 1 57.43 1.30E-05 R GASKEILSEVER N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4614.4614.2.dta 11 IPI00552715.1 "chaperonin containing TCP1, subunit 3 isoform c" 599 56908 21 21 19 19 4336 3883 1 0 1 667.3459 1332.6773 2 1332.682 -0.0046 0 70.05 1.50E-06 R TLIQNCGASTIR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4317.4317.2.dta 11 IPI00552715.1 "chaperonin containing TCP1, subunit 3 isoform c" 599 56908 21 21 19 19 4359 5510 1 0 1 669.318 1336.6214 2 1336.6234 -0.002 0 42.16 0.00027 K AMTGVEQWPYR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6046.6046.2.dta 11 IPI00552715.1 "chaperonin containing TCP1, subunit 3 isoform c" 599 56908 21 21 19 19 5005 5910 1 0 1 714.8803 1427.7461 2 1427.7442 0.0018 0 73.56 8.10E-07 K IPGGIIEDSCVLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6445.6445.2.dta 11 IPI00552715.1 "chaperonin containing TCP1, subunit 3 isoform c" 599 56908 21 21 19 19 7022 5536 1 0 1 595.657 1783.9491 3 1783.9502 -0.0011 1 61.56 1.70E-06 R VEKIPGGIIEDSCVLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6071.6071.3.dta 11 IPI00552715.1 "chaperonin containing TCP1, subunit 3 isoform c" 599 56908 21 21 19 19 8659 5599 1 0 1 832.7805 2495.3197 3 2495.3231 -0.0034 1 36.82 0.00038 R IVSRPEELREDDVGTGAGLLEIK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6135.6135.3.dta 11 IPI00552715.1 "chaperonin containing TCP1, subunit 3 isoform c" 599 56908 21 21 19 19 8660 5594 1 0 1 624.8383 2495.3242 4 2495.3231 0.0011 1 40.72 0.00017 R IVSRPEELREDDVGTGAGLLEIK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6130.6130.4.dta 11 IPI00514032.1 "Chaperonin containing TCP1, subunit 3" 254 30970 8 8 8 8 234 2002 1 0 1 338.1788 674.3431 2 674.3421 0.001 0 28.53 0.033 R TCLGPK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2241.2241.2.dta 11 IPI00514032.1 "Chaperonin containing TCP1, subunit 3" 254 30970 8 8 8 8 674 1350 1 0 1 395.7322 789.4499 2 789.4497 0.0002 1 31.5 0.0068 R YIKNPR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1535.1535.2.dta 11 IPI00514032.1 "Chaperonin containing TCP1, subunit 3" 254 30970 8 8 8 8 1930 1654 1 0 1 501.2722 1000.5299 2 1000.5301 -0.0002 0 37.69 0.0034 K VQSGNINAAK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1864.1864.2.dta 11 IPI00514032.1 "Chaperonin containing TCP1, subunit 3" 254 30970 8 8 8 8 2740 2070 1 0 1 560.8083 1119.6021 2 1119.6036 -0.0015 0 32.44 0.0071 R EIQVQHPAAK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2315.2315.2.dta 11 IPI00514032.1 "Chaperonin containing TCP1, subunit 3" 254 30970 8 8 8 8 2809 1366 1 0 1 565.3202 1128.6258 2 1128.6251 0.0007 1 85.2 4.40E-08 R KVQSGNINAAK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1553.1553.2.dta 11 IPI00514032.1 "Chaperonin containing TCP1, subunit 3" 254 30970 8 8 8 8 3930 6377 1 0 1 640.3606 1278.7066 2 1278.7071 -0.0005 0 62.89 2.90E-06 R IVLLDSSLEYK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6910.6910.2.dta 11 IPI00514032.1 "Chaperonin containing TCP1, subunit 3" 254 30970 8 8 8 8 5005 5910 1 0 1 714.8803 1427.7461 2 1427.7442 0.0018 0 73.56 8.10E-07 K IPGGIIEDSCVLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6445.6445.2.dta 11 IPI00514032.1 "Chaperonin containing TCP1, subunit 3" 254 30970 8 8 8 8 7022 5536 1 0 1 595.657 1783.9491 3 1783.9502 -0.0011 1 61.56 1.70E-06 R VEKIPGGIIEDSCVLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6071.6071.3.dta 11 IPI00513703.1 "Chaperonin containing TCP1, subunit 3" 110 17700 4 4 4 4 234 2002 1 0 1 338.1788 674.3431 2 674.3421 0.001 0 28.53 0.033 R TCLGPK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2241.2241.2.dta 11 IPI00513703.1 "Chaperonin containing TCP1, subunit 3" 110 17700 4 4 4 4 1930 1654 1 0 1 501.2722 1000.5299 2 1000.5301 -0.0002 0 37.69 0.0034 K VQSGNINAAK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1864.1864.2.dta 11 IPI00513703.1 "Chaperonin containing TCP1, subunit 3" 110 17700 4 4 4 4 2740 2070 1 0 1 560.8083 1119.6021 2 1119.6036 -0.0015 0 32.44 0.0071 R EIQVQHPAAK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2315.2315.2.dta 11 IPI00513703.1 "Chaperonin containing TCP1, subunit 3" 110 17700 4 4 4 4 2809 1366 1 0 1 565.3202 1128.6258 2 1128.6251 0.0007 1 85.2 4.40E-08 R KVQSGNINAAK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1553.1553.2.dta 11 IPI00513814.1 "Chaperonin containing TCP1, subunit 3" 98 21051 2 2 2 2 1930 1654 1 0 1 501.2722 1000.5299 2 1000.5301 -0.0002 0 37.69 0.0034 K VQSGNINAAK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1864.1864.2.dta 11 IPI00513814.1 "Chaperonin containing TCP1, subunit 3" 98 21051 2 2 2 2 2809 1366 1 0 1 565.3202 1128.6258 2 1128.6251 0.0007 1 85.2 4.40E-08 R KVQSGNINAAK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1553.1553.2.dta 12 1 IPI00375441.2 Isoform 1 of Far upstream element-binding protein 1 607 67690 23 23 20 20 319 4282 1 1 1 351.2329 700.4513 2 700.4483 0.0029 0 41.44 0.0014 K TGLIIGK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4749.4749.2.dta 12 1 IPI00375441.2 Isoform 1 of Far upstream element-binding protein 1 607 67690 23 23 20 20 521 979 1 1 0 379.2379 756.4612 2 756.4606 0.0006 1 36.18 0.0044 R ARQIAAK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1139.1139.2.dta 12 1 IPI00375441.2 Isoform 1 of Far upstream element-binding protein 1 607 67690 23 23 20 20 1640 4730 1 1 1 479.2843 956.5541 2 956.5542 -0.0002 0 56.1 2.50E-05 R LLDQIVEK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5235.5235.2.dta 12 1 IPI00375441.2 Isoform 1 of Far upstream element-binding protein 1 607 67690 23 23 20 20 1923 1485 1 1 0 500.7805 999.5464 2 999.5461 0.0002 1 53.7 8.40E-05 K KIQNDAGVR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1681.1681.2.dta 12 1 IPI00375441.2 Isoform 1 of Far upstream element-binding protein 1 607 67690 23 23 20 20 1942 6671 1 1 1 501.7864 1001.5582 2 1001.5579 0.0003 0 32.33 0.017 K EMVLELIR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7207.7207.2.dta 12 1 IPI00375441.2 Isoform 1 of Far upstream element-binding protein 1 607 67690 23 23 20 20 2662 1483 1 1 1 555.2691 1108.5237 2 1108.5261 -0.0025 1 20.02 0.033 R EVRNEYGSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1678.1678.2.dta 12 1 IPI00375441.2 Isoform 1 of Far upstream element-binding protein 1 607 67690 23 23 20 20 2695 4537 1 1 1 557.3347 1112.6548 2 1112.6553 -0.0006 1 38.62 0.0015 K RLLDQIVEK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5026.5026.2.dta 12 1 IPI00375441.2 Isoform 1 of Far upstream element-binding protein 1 607 67690 23 23 20 20 2950 3109 1 1 1 574.7878 1147.5611 2 1147.5622 -0.001 0 40.43 0.00042 R GTPQQIDYAR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3446.3446.2.dta 12 1 IPI00375441.2 Isoform 1 of Far upstream element-binding protein 1 607 67690 23 23 20 20 3222 2136 1 1 1 597.7815 1193.5484 2 1193.5499 -0.0014 0 18.41 0.043 R NPPPNADPNMK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2388.2388.2.dta 12 1 IPI00375441.2 Isoform 1 of Far upstream element-binding protein 1 607 67690 23 23 20 20 3760 2904 1 1 0 629.8395 1257.6645 2 1257.6677 -0.0032 1 44.08 0.00085 K GGETIKQLQER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3224.3224.2.dta 12 1 IPI00375441.2 Isoform 1 of Far upstream element-binding protein 1 607 67690 23 23 20 20 3965 4133 1 1 1 643.8867 1285.7588 2 1285.7605 -0.0018 1 50.57 2.20E-05 K TGLIIGKGGETIK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4588.4588.2.dta 12 1 IPI00375441.2 Isoform 1 of Far upstream element-binding protein 1 607 67690 23 23 20 20 4157 1972 1 1 1 654.3253 1306.6361 2 1306.6378 -0.0017 0 74.21 2.40E-07 R SVQAGNPGGPGPGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2208.2208.2.dta 12 1 IPI00375441.2 Isoform 1 of Far upstream element-binding protein 1 607 67690 23 23 20 20 4356 5533 1 1 1 668.8641 1335.7136 2 1335.7147 -0.0011 0 69.22 1.20E-06 R IGGNEGIDVPIPR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6069.6069.2.dta 12 1 IPI00375441.2 Isoform 1 of Far upstream element-binding protein 1 607 67690 23 23 20 20 4434 2652 1 1 1 674.3654 1346.7162 2 1346.7194 -0.0032 1 70.02 4.20E-07 R ITGDPYKVQQAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2948.2948.2.dta 12 1 IPI00375441.2 Isoform 1 of Far upstream element-binding protein 1 607 67690 23 23 20 20 4462 4521 1 1 1 676.8606 1351.7066 2 1351.7096 -0.0029 0 83.32 7.30E-08 K IQIAPDSGGLPER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5008.5008.2.dta 12 1 IPI00375441.2 Isoform 1 of Far upstream element-binding protein 1 607 67690 23 23 20 20 5270 1503 1 1 1 490.251 1467.7313 3 1467.7318 -0.0005 1 36.54 0.00037 K RPLEDGDQPDAKK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1700.1700.3.dta 12 1 IPI00375441.2 Isoform 1 of Far upstream element-binding protein 1 607 67690 23 23 20 20 5457 3377 1 1 1 752.3746 1502.7346 2 1502.7365 -0.0019 0 51.93 1.80E-05 R IQFKPDDGTTPER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3758.3758.2.dta 12 1 IPI00375441.2 Isoform 1 of Far upstream element-binding protein 1 607 67690 23 23 20 20 5458 3340 1 1 1 501.9188 1502.7346 3 1502.7365 -0.0019 0 17.6 0.037 R IQFKPDDGTTPER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3718.3718.3.dta 12 1 IPI00375441.2 Isoform 1 of Far upstream element-binding protein 1 607 67690 23 23 20 20 5664 6929 1 1 1 770.4001 1538.7857 2 1538.7875 -0.0017 0 73.44 1.90E-07 R CQHAAEIITDLLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7464.7464.2.dta 12 1 IPI00375441.2 Isoform 1 of Far upstream element-binding protein 1 607 67690 23 23 20 20 5665 6909 1 1 1 513.9365 1538.7876 3 1538.7875 0.0001 0 38.84 0.0022 R CQHAAEIITDLLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7444.7444.3.dta 12 1 IPI00375441.2 Isoform 1 of Far upstream element-binding protein 1 607 67690 23 23 20 20 5666 6935 1 1 1 513.9368 1538.7887 3 1538.7875 0.0012 0 48.46 0.00023 R CQHAAEIITDLLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7470.7470.3.dta 12 1 IPI00375441.2 Isoform 1 of Far upstream element-binding protein 1 607 67690 23 23 20 20 7723 4218 1 1 1 657.6638 1969.9696 3 1969.9714 -0.0017 0 34.66 0.0008 K MVMIQDGPQNTGADKPLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4680.4680.3.dta 12 1 IPI00375441.2 Isoform 1 of Far upstream element-binding protein 1 607 67690 23 23 20 20 8220 4284 1 1 1 761.7186 2282.1341 3 2282.1325 0.0016 1 37.61 0.00041 R IQQESGCKIQIAPDSGGLPER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4752.4752.3.dta 12 2 IPI00479786.3 KH-type splicing regulatory protein 407 73355 12 12 11 11 521 979 1 0 0 379.2379 756.4612 2 756.4606 0.0006 1 36.18 0.0044 R ARQIAAK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1139.1139.2.dta 12 2 IPI00479786.3 KH-type splicing regulatory protein 407 73355 12 12 11 11 1421 3107 1 0 1 462.2752 922.5358 2 922.5349 0.0009 0 49.31 4.60E-05 R HSVGVVIGR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3444.3444.2.dta 12 2 IPI00479786.3 KH-type splicing regulatory protein 407 73355 12 12 11 11 1923 1485 1 0 0 500.7805 999.5464 2 999.5461 0.0002 1 53.7 8.40E-05 K KIQNDAGVR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1681.1681.2.dta 12 2 IPI00479786.3 KH-type splicing regulatory protein 407 73355 12 12 11 11 2469 5103 1 0 1 540.3138 1078.613 2 1078.6135 -0.0005 0 87.33 1.80E-08 R IGGGIDVPVPR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5633.5633.2.dta 12 2 IPI00479786.3 KH-type splicing regulatory protein 407 73355 12 12 11 11 2470 5108 1 0 1 540.314 1078.6134 2 1078.6135 -0.0001 0 67.5 1.40E-06 R IGGGIDVPVPR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5639.5639.2.dta 12 2 IPI00479786.3 KH-type splicing regulatory protein 407 73355 12 12 11 11 2479 1354 1 0 1 540.7745 1079.5345 2 1079.536 -0.0014 0 38.31 0.0014 R GSPQQIDHAK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1540.1540.2.dta 12 2 IPI00479786.3 KH-type splicing regulatory protein 407 73355 12 12 11 11 3176 6947 1 0 1 592.8536 1183.6926 2 1183.6924 0.0002 0 55.7 3.00E-05 R IINDLLQSLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7482.7482.2.dta 12 2 IPI00479786.3 KH-type splicing regulatory protein 407 73355 12 12 11 11 3760 2904 1 0 0 629.8395 1257.6645 2 1257.6677 -0.0032 1 44.08 0.00085 K GGETIKQLQER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3224.3224.2.dta 12 2 IPI00479786.3 KH-type splicing regulatory protein 407 73355 12 12 11 11 4087 3772 1 0 1 651.8472 1301.6798 2 1301.6827 -0.0029 0 41.75 0.0015 R SVSLTGAPESVQK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4197.4197.2.dta 12 2 IPI00479786.3 KH-type splicing regulatory protein 407 73355 12 12 11 11 4472 4061 1 0 1 677.8513 1353.688 2 1353.6888 -0.0009 0 60.84 2.00E-06 K VQISPDSGGLPER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4510.4510.2.dta 12 2 IPI00479786.3 KH-type splicing regulatory protein 407 73355 12 12 11 11 5616 5044 1 0 1 767.4069 1532.7992 2 1532.7947 0.0045 0 79.45 1.60E-07 K AINQQTGAFVEISR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5573.5573.2.dta 12 2 IPI00479786.3 KH-type splicing regulatory protein 407 73355 12 12 11 11 8259 5000 1 0 1 770.7085 2309.1037 3 2309.1037 0 1 34.4 0.00059 K IGGDAATTVNNSTPDFGFGGQKR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5527.5527.3.dta 12 3 IPI00377261.1 Isoform 1 of Far upstream element-binding protein 3 213 61944 10 10 9 9 1923 1485 1 0 0 500.7805 999.5464 2 999.5461 0.0002 1 53.7 8.40E-05 K KIQNDAGVR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1681.1681.2.dta 12 3 IPI00377261.1 Isoform 1 of Far upstream element-binding protein 3 213 61944 10 10 9 9 1942 6671 1 0 1 501.7864 1001.5582 2 1001.5579 0.0003 0 32.33 0.017 R EMVLEIIR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7207.7207.2.dta 12 3 IPI00377261.1 Isoform 1 of Far upstream element-binding protein 3 213 61944 10 10 9 9 2582 3785 1 0 1 548.8085 1095.6024 2 1095.6037 -0.0013 0 52.35 1.20E-05 R GVPQQIEVAR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4211.4211.2.dta 12 3 IPI00377261.1 Isoform 1 of Far upstream element-binding protein 3 213 61944 10 10 9 9 3760 2904 1 0 0 629.8395 1257.6645 2 1257.6677 -0.0032 1 44.08 0.00085 R GGETIKQLQER T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3224.3224.2.dta 12 3 IPI00377261.1 Isoform 1 of Far upstream element-binding protein 3 213 61944 10 10 9 9 5448 4199 1 0 1 751.3846 1500.7547 2 1500.7572 -0.0025 0 39.14 0.00021 R IQFKPDDGISPER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4659.4659.2.dta 12 3 IPI00377261.1 Isoform 1 of Far upstream element-binding protein 3 213 61944 10 10 9 9 5449 4178 1 0 1 501.2596 1500.7571 3 1500.7572 -0.0001 0 39.22 0.001 R IQFKPDDGISPER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4637.4637.3.dta 12 3 IPI00377261.1 Isoform 1 of Far upstream element-binding protein 3 213 61944 10 10 9 9 5796 2867 1 0 1 522.938 1565.7923 3 1565.791 0.0013 0 30.4 0.0031 K SINQQSGAHVELQR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3182.3182.3.dta 12 3 IPI00377261.1 Isoform 1 of Far upstream element-binding protein 3 213 61944 10 10 9 9 7677 5266 1 0 1 649.0161 1944.0263 3 1944.029 -0.0026 0 44.72 6.40E-05 K RPLDDGVGNQLGALVHQR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5798.5798.3.dta 12 3 IPI00377261.1 Isoform 1 of Far upstream element-binding protein 3 213 61944 10 10 9 9 8710 6621 1 0 1 856.4283 2566.2632 3 2566.2663 -0.0031 0 24.27 0.0069 R NGPGFHNDIDSNSTIQEILIPASK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7154.7154.3.dta 12 3 IPI00377261.1 Isoform 1 of Far upstream element-binding protein 3 213 61944 10 10 9 9 8860 6315 1 0 1 905.1312 2712.3717 3 2712.3759 -0.0042 0 30.31 0.0032 K IDSIPHLNNSTPLVDPSVYGYGVQK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6849.6849.3.dta 12 IPI00298363.2 Far upstream element-binding protein 2 372 73063 10 10 9 9 521 979 1 0 0 379.2379 756.4612 2 756.4606 0.0006 1 36.18 0.0044 R ARQIAAK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1139.1139.2.dta 12 IPI00298363.2 Far upstream element-binding protein 2 372 73063 10 10 9 9 1421 3107 1 0 1 462.2752 922.5358 2 922.5349 0.0009 0 49.31 4.60E-05 R HSVGVVIGR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3444.3444.2.dta 12 IPI00298363.2 Far upstream element-binding protein 2 372 73063 10 10 9 9 1923 1485 1 0 0 500.7805 999.5464 2 999.5461 0.0002 1 53.7 8.40E-05 K KIQNDAGVR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1681.1681.2.dta 12 IPI00298363.2 Far upstream element-binding protein 2 372 73063 10 10 9 9 2469 5103 1 0 1 540.3138 1078.613 2 1078.6135 -0.0005 0 87.33 1.80E-08 R IGGGIDVPVPR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5633.5633.2.dta 12 IPI00298363.2 Far upstream element-binding protein 2 372 73063 10 10 9 9 2470 5108 1 0 1 540.314 1078.6134 2 1078.6135 -0.0001 0 67.5 1.40E-06 R IGGGIDVPVPR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5639.5639.2.dta 12 IPI00298363.2 Far upstream element-binding protein 2 372 73063 10 10 9 9 3176 6947 1 0 1 592.8536 1183.6926 2 1183.6924 0.0002 0 55.7 3.00E-05 R IINDLLQSLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7482.7482.2.dta 12 IPI00298363.2 Far upstream element-binding protein 2 372 73063 10 10 9 9 3760 2904 1 0 0 629.8395 1257.6645 2 1257.6677 -0.0032 1 44.08 0.00085 K GGETIKQLQER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3224.3224.2.dta 12 IPI00298363.2 Far upstream element-binding protein 2 372 73063 10 10 9 9 4087 3772 1 0 1 651.8472 1301.6798 2 1301.6827 -0.0029 0 41.75 0.0015 R SVSLTGAPESVQK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4197.4197.2.dta 12 IPI00298363.2 Far upstream element-binding protein 2 372 73063 10 10 9 9 4472 4061 1 0 1 677.8513 1353.688 2 1353.6888 -0.0009 0 60.84 2.00E-06 K VQISPDSGGLPER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4510.4510.2.dta 12 IPI00298363.2 Far upstream element-binding protein 2 372 73063 10 10 9 9 5616 5044 1 0 1 767.4069 1532.7992 2 1532.7947 0.0045 0 79.45 1.60E-07 K AINQQTGAFVEISR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5573.5573.2.dta 12 IPI00641948.1 24 kDa protein 163 24143 5 5 5 5 521 979 1 0 0 379.2379 756.4612 2 756.4606 0.0006 1 36.18 0.0044 R ARQIAAK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1139.1139.2.dta 12 IPI00641948.1 24 kDa protein 163 24143 5 5 5 5 1640 4730 1 0 1 479.2843 956.5541 2 956.5542 -0.0002 0 56.1 2.50E-05 R LLDQIVEK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5235.5235.2.dta 12 IPI00641948.1 24 kDa protein 163 24143 5 5 5 5 2695 4537 1 0 1 557.3347 1112.6548 2 1112.6553 -0.0006 1 38.62 0.0015 K RLLDQIVEK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5026.5026.2.dta 12 IPI00641948.1 24 kDa protein 163 24143 5 5 5 5 4462 4521 1 0 1 676.8606 1351.7066 2 1351.7096 -0.0029 0 83.32 7.30E-08 K IQIAPDSGGLPER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5008.5008.2.dta 12 IPI00641948.1 24 kDa protein 163 24143 5 5 5 5 8220 4284 1 0 1 761.7186 2282.1341 3 2282.1325 0.0016 1 37.61 0.00041 R IQQESGCKIQIAPDSGGLPER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4752.4752.3.dta 12 IPI00063245.1 Isoform 2 of Far upstream element-binding protein 3 85 28645 4 4 4 4 1923 1485 1 0 0 500.7805 999.5464 2 999.5461 0.0002 1 53.7 8.40E-05 K KIQNDAGVR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1681.1681.2.dta 12 IPI00063245.1 Isoform 2 of Far upstream element-binding protein 3 85 28645 4 4 4 4 1942 6671 1 0 1 501.7864 1001.5582 2 1001.5579 0.0003 0 32.33 0.017 R EMVLEIIR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7207.7207.2.dta 12 IPI00063245.1 Isoform 2 of Far upstream element-binding protein 3 85 28645 4 4 4 4 3760 2904 1 0 0 629.8395 1257.6645 2 1257.6677 -0.0032 1 44.08 0.00085 R GGETIKQLQER T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3224.3224.2.dta 12 IPI00063245.1 Isoform 2 of Far upstream element-binding protein 3 85 28645 4 4 4 4 8710 6621 1 0 1 856.4283 2566.2632 3 2566.2663 -0.0031 0 24.27 0.0069 R NGPGFHNDIDSNSTIQEILIPASK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7154.7154.3.dta 13 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 599 57510 24 24 16 16 264 2443 1 1 0 343.24 684.4654 2 684.4646 0.0007 1 31.61 0.0032 R ILGVKR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2722.2722.2.dta 13 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 599 57510 24 24 16 16 1050 2598 1 1 1 430.7453 859.476 2 859.4763 -0.0003 1 36.73 0.0064 K SEDIKIR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2890.2890.2.dta 13 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 599 57510 24 24 16 16 1570 1231 1 1 1 473.7697 945.5249 2 945.5243 0.0006 1 42.44 0.001 K IRQDSVTK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1407.1407.2.dta 13 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 599 57510 24 24 16 16 2091 5608 1 1 1 514.7529 1027.4912 2 1027.4909 0.0003 0 47.28 6.80E-05 R QLNMYGFR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6144.6144.2.dta 13 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 599 57510 24 24 16 16 2200 4420 1 1 1 522.7496 1043.4847 2 1043.4858 -0.0011 0 32.22 0.0072 R QLNMYGFR K Oxidation (M) 0.00010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4899.4899.2.dta 13 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 599 57510 24 24 16 16 2275 3660 1 1 1 527.7566 1053.4986 2 1053.4992 -0.0005 0 44.56 0.00025 K HENEALWR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4072.4072.2.dta 13 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 599 57510 24 24 16 16 2429 3523 1 1 1 538.2581 1074.5016 2 1074.5029 -0.0013 0 36.31 0.00086 K HNNMASFVR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3921.3921.2.dta 13 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 599 57510 24 24 16 16 2443 4719 1 1 1 538.8049 1075.5952 2 1075.5947 0.0005 0 51.79 0.00014 K LLTDVQLMK G Oxidation (M) 0.000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5223.5223.2.dta 13 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 599 57510 24 24 16 16 2552 2345 1 1 1 546.2559 1090.4973 2 1090.4978 -0.0005 0 62.18 1.60E-06 K HNNMASFVR Q Oxidation (M) 0.000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2616.2616.2.dta 13 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 599 57510 24 24 16 16 4302 4227 1 1 1 664.3695 1326.7245 2 1326.7255 -0.0011 1 54.11 8.40E-06 R GQEQLLENIKR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4690.4690.2.dta 13 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 599 57510 24 24 16 16 4303 4224 1 1 1 443.2494 1326.7262 3 1326.7255 0.0007 1 29.42 0.0095 R GQEQLLENIKR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4687.4687.3.dta 13 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 599 57510 24 24 16 16 4867 3331 1 1 1 703.8892 1405.7639 2 1405.7664 -0.0025 1 42.03 0.00021 K VTSVSTLKSEDIK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3709.3709.2.dta 13 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 599 57510 24 24 16 16 5768 3314 1 1 1 520.9664 1559.8775 3 1559.8784 -0.0009 0 40.86 0.00015 K VVHIEQGGLVKPER D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3690.3690.3.dta 13 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 599 57510 24 24 16 16 5769 3310 1 1 1 390.977 1559.879 4 1559.8784 0.0006 0 39.55 0.00029 K VVHIEQGGLVKPER D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3686.3686.4.dta 13 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 599 57510 24 24 16 16 5784 5375 1 1 1 782.8452 1563.6758 2 1563.6776 -0.0019 0 67.58 4.60E-07 R DDTEFQHPCFLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5910.5910.2.dta 13 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 599 57510 24 24 16 16 5785 5366 1 1 1 522.2335 1563.6786 3 1563.6776 0.0009 0 21.38 0.035 R DDTEFQHPCFLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5900.5900.3.dta 13 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 599 57510 24 24 16 16 6033 4842 1 1 1 807.9005 1613.7865 2 1613.7897 -0.0032 0 91.64 2.80E-09 R ESEPAPASVTALTDAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5356.5356.2.dta 13 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 599 57510 24 24 16 16 6034 4863 1 1 1 538.9373 1613.7901 3 1613.7897 0.0005 0 45.86 9.70E-05 R ESEPAPASVTALTDAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5379.5379.3.dta 13 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 599 57510 24 24 16 16 6559 2759 1 1 1 423.0009 1687.9746 4 1687.9733 0.0012 1 32.14 0.0018 R KVVHIEQGGLVKPER D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3065.3065.4.dta 13 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 599 57510 24 24 16 16 6655 4959 1 1 1 566.6164 1696.8274 3 1696.8276 -0.0003 0 31.89 0.001 K IPLMLNDSGSAHSMPK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5484.5484.3.dta 13 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 599 57510 24 24 16 16 6708 5911 1 1 1 570.6287 1708.8642 3 1708.8645 -0.0003 1 19.99 0.013 K HENEALWREVASLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6446.6446.3.dta 13 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 599 57510 24 24 16 16 6790 3846 1 1 1 577.2791 1728.8153 3 1728.8175 -0.0021 0 54.04 8.60E-06 K IPLMLNDSGSAHSMPK Y 2 Oxidation (M) 0.0001000000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4277.4277.3.dta 13 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 599 57510 24 24 16 16 7257 3910 1 1 1 614.6458 1840.9156 3 1840.9175 -0.0019 1 32.43 0.00091 R KIPLMLNDSGSAHSMPK Y Oxidation (M) 0.00001000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4346.4346.3.dta 13 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 599 57510 24 24 16 16 7337 3395 1 1 1 619.9771 1856.9093 3 1856.9124 -0.0031 1 38.2 0.00026 R KIPLMLNDSGSAHSMPK Y 2 Oxidation (M) 0.00001000000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3778.3778.3.dta 13 IPI00012878.1 Heat shock factor protein 2 121 60482 4 4 2 2 2091 5608 1 0 1 514.7529 1027.4912 2 1027.4909 0.0003 0 47.28 6.80E-05 R QLNMYGFR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6144.6144.2.dta 13 IPI00012878.1 Heat shock factor protein 2 121 60482 4 4 2 2 2200 4420 1 0 1 522.7496 1043.4847 2 1043.4858 -0.0011 0 32.22 0.0072 R QLNMYGFR K Oxidation (M) 0.00010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4899.4899.2.dta 13 IPI00012878.1 Heat shock factor protein 2 121 60482 4 4 2 2 2429 3523 1 0 1 538.2581 1074.5016 2 1074.5029 -0.0013 0 36.31 0.00086 K HNNMASFVR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3921.3921.2.dta 13 IPI00012878.1 Heat shock factor protein 2 121 60482 4 4 2 2 2552 2345 1 0 1 546.2559 1090.4973 2 1090.4978 -0.0005 0 62.18 1.60E-06 K HNNMASFVR Q Oxidation (M) 0.000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2616.2616.2.dta 13 IPI00008456.1 Isoform HSF4B of Heat shock factor protein 4 59 53362 2 2 1 1 2091 5608 1 0 1 514.7529 1027.4912 2 1027.4909 0.0003 0 47.28 6.80E-05 R QLNMYGFR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6144.6144.2.dta 13 IPI00008456.1 Isoform HSF4B of Heat shock factor protein 4 59 53362 2 2 1 1 2200 4420 1 0 1 522.7496 1043.4847 2 1043.4858 -0.0011 0 32.22 0.0072 R QLNMYGFR K Oxidation (M) 0.00010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4899.4899.2.dta 14 1 IPI00017617.1 Probable ATP-dependent RNA helicase DDX5 595 69618 24 24 21 21 571 4408 1 1 1 384.2187 766.4228 2 766.4225 0.0003 0 26.45 0.012 R GYSSLLK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4886.4886.2.dta 14 1 IPI00017617.1 Probable ATP-dependent RNA helicase DDX5 595 69618 24 24 21 21 877 1769 1 1 1 416.7473 831.4801 2 831.4814 -0.0013 1 30.97 0.012 R SKEITVR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1988.1988.2.dta 14 1 IPI00017617.1 Probable ATP-dependent RNA helicase DDX5 595 69618 24 24 21 21 1139 3968 1 1 0 437.7293 873.444 2 873.4444 -0.0004 0 54.08 6.70E-05 R GLDVEDVK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4409.4409.2.dta 14 1 IPI00017617.1 Probable ATP-dependent RNA helicase DDX5 595 69618 24 24 21 21 1800 1747 1 1 1 492.7595 983.5044 2 983.5036 0.0009 0 32.93 0.00082 R EANQAINPK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1964.1964.2.dta 14 1 IPI00017617.1 Probable ATP-dependent RNA helicase DDX5 595 69618 24 24 21 21 2240 7001 1 1 1 525.7669 1049.5193 2 1049.5182 0.0011 0 39.36 0.0018 R DWVLNEFK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7538.7538.2.dta 14 1 IPI00017617.1 Probable ATP-dependent RNA helicase DDX5 595 69618 24 24 21 21 2262 3066 1 1 0 527.256 1052.4974 2 1052.4961 0.0013 0 41.64 0.00013 K STCIYGGAPK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3400.3400.2.dta 14 1 IPI00017617.1 Probable ATP-dependent RNA helicase DDX5 595 69618 24 24 21 21 2502 3266 1 1 0 542.2989 1082.5832 2 1082.5832 0 1 25.35 0.026 K GPQIRDLER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3634.3634.2.dta 14 1 IPI00017617.1 Probable ATP-dependent RNA helicase DDX5 595 69618 24 24 21 21 2503 3251 1 1 0 361.8689 1082.585 3 1082.5832 0.0017 1 29.2 0.007 K GPQIRDLER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3617.3617.3.dta 14 1 IPI00017617.1 Probable ATP-dependent RNA helicase DDX5 595 69618 24 24 21 21 2563 4064 1 1 1 546.8237 1091.6328 2 1091.6339 -0.0011 1 28.68 0.002 K TIVFVETKR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4513.4513.2.dta 14 1 IPI00017617.1 Probable ATP-dependent RNA helicase DDX5 595 69618 24 24 21 21 2580 2593 1 1 1 548.7665 1095.5185 2 1095.5196 -0.0011 0 76.8 2.00E-07 R TAQEVETYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2884.2884.2.dta 14 1 IPI00017617.1 Probable ATP-dependent RNA helicase DDX5 595 69618 24 24 21 21 2811 6830 1 1 1 565.332 1128.6495 2 1128.6503 -0.0008 0 53.15 6.30E-05 K QVSDLISVLR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7365.7365.2.dta 14 1 IPI00017617.1 Probable ATP-dependent RNA helicase DDX5 595 69618 24 24 21 21 3108 4978 1 1 0 586.8084 1171.6023 2 1171.6019 0.0003 0 29.26 0.014 R GVEICIATPGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5504.5504.2.dta 14 1 IPI00017617.1 Probable ATP-dependent RNA helicase DDX5 595 69618 24 24 21 21 4038 2973 1 1 0 647.8437 1293.6729 2 1293.6751 -0.0022 1 60.79 2.00E-06 R LKSTCIYGGAPK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3300.3300.2.dta 14 1 IPI00017617.1 Probable ATP-dependent RNA helicase DDX5 595 69618 24 24 21 21 4043 5582 1 1 1 648.3275 1294.6404 2 1294.6405 -0.0001 0 58.38 3.40E-06 R TTYLVLDEADR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6118.6118.2.dta 14 1 IPI00017617.1 Probable ATP-dependent RNA helicase DDX5 595 69618 24 24 21 21 4352 6566 1 1 0 668.8226 1335.6307 2 1335.6315 -0.0008 0 56.41 1.70E-05 R MLDMGFEPQIR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7100.7100.2.dta 14 1 IPI00017617.1 Probable ATP-dependent RNA helicase DDX5 595 69618 24 24 21 21 4388 4469 1 1 1 671.8734 1341.7322 2 1341.7364 -0.0043 1 41.79 0.00047 K LLQLVEDRGSGR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4952.4952.2.dta 14 1 IPI00017617.1 Probable ATP-dependent RNA helicase DDX5 595 69618 24 24 21 21 4389 4464 1 1 1 448.2528 1341.7365 3 1341.7364 0.0001 1 16.78 0.035 K LLQLVEDRGSGR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4947.4947.3.dta 14 1 IPI00017617.1 Probable ATP-dependent RNA helicase DDX5 595 69618 24 24 21 21 4441 6908 1 1 0 674.8392 1347.6639 2 1347.6645 -0.0006 0 39.92 0.0013 R QTLMWSATWPK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7443.7443.2.dta 14 1 IPI00017617.1 Probable ATP-dependent RNA helicase DDX5 595 69618 24 24 21 21 4570 6582 1 1 0 684.8695 1367.7245 2 1367.7231 0.0013 0 63.52 5.40E-06 R GDGPICLVLAPTR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7116.7116.2.dta 14 1 IPI00017617.1 Probable ATP-dependent RNA helicase DDX5 595 69618 24 24 21 21 4940 6453 1 1 1 709.8686 1417.7226 2 1417.7241 -0.0015 1 24.92 0.024 K WNLDELPKFEK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6984.6984.2.dta 14 1 IPI00017617.1 Probable ATP-dependent RNA helicase DDX5 595 69618 24 24 21 21 5889 6327 1 1 1 787.8943 1573.7741 2 1573.7777 -0.0035 0 70.03 6.40E-07 K TGTAYTFFTPNNIK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6860.6860.2.dta 14 1 IPI00017617.1 Probable ATP-dependent RNA helicase DDX5 595 69618 24 24 21 21 5911 6139 1 1 1 526.9491 1577.8255 3 1577.8235 0.0019 1 26.71 0.0031 R LIDFLECGKTNLR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6673.6673.3.dta 14 1 IPI00017617.1 Probable ATP-dependent RNA helicase DDX5 595 69618 24 24 21 21 7067 5876 1 1 1 896.9346 1791.8546 2 1791.8574 -0.0028 0 88.11 5.50E-09 R ELAQQVQQVAAEYCR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6411.6411.2.dta 14 1 IPI00017617.1 Probable ATP-dependent RNA helicase DDX5 595 69618 24 24 21 21 7068 5882 1 1 1 598.2932 1791.8576 3 1791.8574 0.0003 0 33.54 0.00072 R ELAQQVQQVAAEYCR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6418.6418.3.dta 14 2 IPI00023785.5 Isoform 1 of Probable ATP-dependent RNA helicase DDX17 514 72953 18 18 17 17 615 2104 1 0 1 388.6883 775.362 2 775.3613 0.0007 0 31.31 0.0015 K FGNPGER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2352.2352.2.dta 14 2 IPI00023785.5 Isoform 1 of Probable ATP-dependent RNA helicase DDX17 514 72953 18 18 17 17 1139 3968 1 0 0 437.7293 873.444 2 873.4444 -0.0004 0 54.08 6.70E-05 R GLDVEDVK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4409.4409.2.dta 14 2 IPI00023785.5 Isoform 1 of Probable ATP-dependent RNA helicase DDX17 514 72953 18 18 17 17 1995 3884 1 0 1 337.8512 1010.5319 3 1010.5331 -0.0013 0 25.27 0.01 K LMQLVDHR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4318.4318.3.dta 14 2 IPI00023785.5 Isoform 1 of Probable ATP-dependent RNA helicase DDX17 514 72953 18 18 17 17 2262 3066 1 0 0 527.256 1052.4974 2 1052.4961 0.0013 0 41.64 0.00013 K STCIYGGAPK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3400.3400.2.dta 14 2 IPI00023785.5 Isoform 1 of Probable ATP-dependent RNA helicase DDX17 514 72953 18 18 17 17 2460 7110 1 0 1 539.7697 1077.5248 2 1077.5243 0.0004 0 40.56 0.00041 R DWVLNEFR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7656.7656.2.dta 14 2 IPI00023785.5 Isoform 1 of Probable ATP-dependent RNA helicase DDX17 514 72953 18 18 17 17 2502 3266 1 0 0 542.2989 1082.5832 2 1082.5832 0 1 25.35 0.026 K GPQIRDLER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3634.3634.2.dta 14 2 IPI00023785.5 Isoform 1 of Probable ATP-dependent RNA helicase DDX17 514 72953 18 18 17 17 2503 3251 1 0 0 361.8689 1082.585 3 1082.5832 0.0017 1 29.2 0.007 K GPQIRDLER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3617.3617.3.dta 14 2 IPI00023785.5 Isoform 1 of Probable ATP-dependent RNA helicase DDX17 514 72953 18 18 17 17 3108 4978 1 0 0 586.8084 1171.6023 2 1171.6019 0.0003 0 29.26 0.014 R GVEICIATPGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5504.5504.2.dta 14 2 IPI00023785.5 Isoform 1 of Probable ATP-dependent RNA helicase DDX17 514 72953 18 18 17 17 3149 2642 1 0 1 590.2852 1178.5558 2 1178.5602 -0.0044 0 54.76 1.90E-05 R DMVGIAQTGSGK T Oxidation (M) 0.010000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2937.2937.2.dta 14 2 IPI00023785.5 Isoform 1 of Probable ATP-dependent RNA helicase DDX17 514 72953 18 18 17 17 3574 5243 1 0 1 617.8183 1233.622 2 1233.6241 -0.0021 0 17.77 0.034 R LTPYEVDELR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5775.5775.2.dta 14 2 IPI00023785.5 Isoform 1 of Probable ATP-dependent RNA helicase DDX17 514 72953 18 18 17 17 4038 2973 1 0 0 647.8437 1293.6729 2 1293.6751 -0.0022 1 60.79 2.00E-06 R LKSTCIYGGAPK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3300.3300.2.dta 14 2 IPI00023785.5 Isoform 1 of Probable ATP-dependent RNA helicase DDX17 514 72953 18 18 17 17 4352 6566 1 0 0 668.8226 1335.6307 2 1335.6315 -0.0008 0 56.41 1.70E-05 R MLDMGFEPQIR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7100.7100.2.dta 14 2 IPI00023785.5 Isoform 1 of Probable ATP-dependent RNA helicase DDX17 514 72953 18 18 17 17 4441 6908 1 0 0 674.8392 1347.6639 2 1347.6645 -0.0006 0 39.92 0.0013 R QTLMWSATWPK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7443.7443.2.dta 14 2 IPI00023785.5 Isoform 1 of Probable ATP-dependent RNA helicase DDX17 514 72953 18 18 17 17 4570 6582 1 0 0 684.8695 1367.7245 2 1367.7231 0.0013 0 63.52 5.40E-06 R GDGPICLVLAPTR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7116.7116.2.dta 14 2 IPI00023785.5 Isoform 1 of Probable ATP-dependent RNA helicase DDX17 514 72953 18 18 17 17 4925 6598 1 0 1 708.8614 1415.7083 2 1415.7085 -0.0002 0 58.74 3.10E-06 K GTAYTFFTPGNLK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7132.7132.2.dta 14 2 IPI00023785.5 Isoform 1 of Probable ATP-dependent RNA helicase DDX17 514 72953 18 18 17 17 5204 3525 1 0 1 728.3444 1454.6742 2 1454.675 -0.0008 0 79.43 3.60E-08 R SSQSSSQQFSGIGR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3923.3923.2.dta 14 2 IPI00023785.5 Isoform 1 of Probable ATP-dependent RNA helicase DDX17 514 72953 18 18 17 17 5446 4914 1 0 1 749.9316 1497.8487 2 1497.8515 -0.0027 1 47.44 3.60E-05 R SGKAPILIATDVASR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5434.5434.2.dta 14 2 IPI00023785.5 Isoform 1 of Probable ATP-dependent RNA helicase DDX17 514 72953 18 18 17 17 6572 5543 1 0 1 846.4144 1690.8142 2 1690.8162 -0.002 0 83.07 1.60E-08 R ELAQQVQQVADDYGK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6079.6079.2.dta 14 3 IPI00215637.5 ATP-dependent RNA helicase DDX3X 391 73597 10 10 10 10 696 3643 1 0 1 399.6984 797.3822 2 797.382 0.0002 0 41.08 0.0006 R FSGGFGAR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4053.4053.2.dta 14 3 IPI00215637.5 ATP-dependent RNA helicase DDX3X 391 73597 10 10 10 10 3036 2084 1 0 1 582.2984 1162.5823 2 1162.583 -0.0007 0 72.33 1.30E-06 R VGSTSENITQK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2331.2331.2.dta 14 3 IPI00215637.5 ATP-dependent RNA helicase DDX3X 391 73597 10 10 10 10 3069 5384 1 0 1 584.8557 1167.6969 2 1167.6975 -0.0007 0 64.93 1.30E-06 K SPILVATAVAAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5919.5919.2.dta 14 3 IPI00215637.5 ATP-dependent RNA helicase DDX3X 391 73597 10 10 10 10 4070 3027 1 0 1 434.2179 1299.6318 3 1299.632 -0.0002 1 23.18 0.038 R DREEALHQFR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3359.3359.3.dta 14 3 IPI00215637.5 ATP-dependent RNA helicase DDX3X 391 73597 10 10 10 10 4265 5690 1 0 1 660.8427 1319.6708 2 1319.6721 -0.0013 0 61.85 5.80E-06 R ELAVQIYEEAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6225.6225.2.dta 14 3 IPI00215637.5 ATP-dependent RNA helicase DDX3X 391 73597 10 10 10 10 4352 6566 1 0 0 668.8226 1335.6307 2 1335.6315 -0.0008 0 56.41 1.70E-05 R MLDMGFEPQIR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7100.7100.2.dta 14 3 IPI00215637.5 ATP-dependent RNA helicase DDX3X 391 73597 10 10 10 10 4494 6949 1 0 1 679.3954 1356.7763 2 1356.7765 -0.0002 0 48.49 0.00011 K QYPISLVLAPTR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7484.7484.2.dta 14 3 IPI00215637.5 ATP-dependent RNA helicase DDX3X 391 73597 10 10 10 10 4520 2026 1 0 1 681.2995 1360.5844 2 1360.5855 -0.0011 0 74.58 1.60E-07 R QSSGASSSSFSSSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2268.2268.2.dta 14 3 IPI00215637.5 ATP-dependent RNA helicase DDX3X 391 73597 10 10 10 10 5575 7239 1 0 1 762.8938 1523.773 2 1523.7732 -0.0002 0 64.08 9.80E-07 R VGNLGLATSFFNER N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7795.7795.2.dta 14 3 IPI00215637.5 ATP-dependent RNA helicase DDX3X 391 73597 10 10 10 10 7472 4674 1 0 1 629.9996 1886.9769 3 1886.9785 -0.0016 0 74.07 5.60E-07 R VRPCVVYGGADIGQQIR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5174.5174.3.dta 14 IPI00651677.1 Isoform 2 of Probable ATP-dependent RNA helicase DDX17 484 73123 17 17 16 16 615 2104 1 0 1 388.6883 775.362 2 775.3613 0.0007 0 31.31 0.0015 K FGNPGER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2352.2352.2.dta 14 IPI00651677.1 Isoform 2 of Probable ATP-dependent RNA helicase DDX17 484 73123 17 17 16 16 1995 3884 1 0 1 337.8512 1010.5319 3 1010.5331 -0.0013 0 25.27 0.01 K LMQLVDHR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4318.4318.3.dta 14 IPI00651677.1 Isoform 2 of Probable ATP-dependent RNA helicase DDX17 484 73123 17 17 16 16 2262 3066 1 0 0 527.256 1052.4974 2 1052.4961 0.0013 0 41.64 0.00013 K STCIYGGAPK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3400.3400.2.dta 14 IPI00651677.1 Isoform 2 of Probable ATP-dependent RNA helicase DDX17 484 73123 17 17 16 16 2460 7110 1 0 1 539.7697 1077.5248 2 1077.5243 0.0004 0 40.56 0.00041 R DWVLNEFR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7656.7656.2.dta 14 IPI00651677.1 Isoform 2 of Probable ATP-dependent RNA helicase DDX17 484 73123 17 17 16 16 2502 3266 1 0 0 542.2989 1082.5832 2 1082.5832 0 1 25.35 0.026 K GPQIRDLER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3634.3634.2.dta 14 IPI00651677.1 Isoform 2 of Probable ATP-dependent RNA helicase DDX17 484 73123 17 17 16 16 2503 3251 1 0 0 361.8689 1082.585 3 1082.5832 0.0017 1 29.2 0.007 K GPQIRDLER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3617.3617.3.dta 14 IPI00651677.1 Isoform 2 of Probable ATP-dependent RNA helicase DDX17 484 73123 17 17 16 16 3108 4978 1 0 0 586.8084 1171.6023 2 1171.6019 0.0003 0 29.26 0.014 R GVEICIATPGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5504.5504.2.dta 14 IPI00651677.1 Isoform 2 of Probable ATP-dependent RNA helicase DDX17 484 73123 17 17 16 16 3149 2642 1 0 1 590.2852 1178.5558 2 1178.5602 -0.0044 0 54.76 1.90E-05 R DMVGIAQTGSGK T Oxidation (M) 0.010000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2937.2937.2.dta 14 IPI00651677.1 Isoform 2 of Probable ATP-dependent RNA helicase DDX17 484 73123 17 17 16 16 3574 5243 1 0 1 617.8183 1233.622 2 1233.6241 -0.0021 0 17.77 0.034 R LTPYEVDELR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5775.5775.2.dta 14 IPI00651677.1 Isoform 2 of Probable ATP-dependent RNA helicase DDX17 484 73123 17 17 16 16 4038 2973 1 0 0 647.8437 1293.6729 2 1293.6751 -0.0022 1 60.79 2.00E-06 R LKSTCIYGGAPK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3300.3300.2.dta 14 IPI00651677.1 Isoform 2 of Probable ATP-dependent RNA helicase DDX17 484 73123 17 17 16 16 4352 6566 1 0 0 668.8226 1335.6307 2 1335.6315 -0.0008 0 56.41 1.70E-05 R MLDMGFEPQIR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7100.7100.2.dta 14 IPI00651677.1 Isoform 2 of Probable ATP-dependent RNA helicase DDX17 484 73123 17 17 16 16 4441 6908 1 0 0 674.8392 1347.6639 2 1347.6645 -0.0006 0 39.92 0.0013 R QTLMWSATWPK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7443.7443.2.dta 14 IPI00651677.1 Isoform 2 of Probable ATP-dependent RNA helicase DDX17 484 73123 17 17 16 16 4570 6582 1 0 0 684.8695 1367.7245 2 1367.7231 0.0013 0 63.52 5.40E-06 R GDGPICLVLAPTR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7116.7116.2.dta 14 IPI00651677.1 Isoform 2 of Probable ATP-dependent RNA helicase DDX17 484 73123 17 17 16 16 4925 6598 1 0 1 708.8614 1415.7083 2 1415.7085 -0.0002 0 58.74 3.10E-06 K GTAYTFFTPGNLK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7132.7132.2.dta 14 IPI00651677.1 Isoform 2 of Probable ATP-dependent RNA helicase DDX17 484 73123 17 17 16 16 5204 3525 1 0 1 728.3444 1454.6742 2 1454.675 -0.0008 0 79.43 3.60E-08 R SSQSSSQQFSGIGR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3923.3923.2.dta 14 IPI00651677.1 Isoform 2 of Probable ATP-dependent RNA helicase DDX17 484 73123 17 17 16 16 5446 4914 1 0 1 749.9316 1497.8487 2 1497.8515 -0.0027 1 47.44 3.60E-05 R SGKAPILIATDVASR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5434.5434.2.dta 14 IPI00651677.1 Isoform 2 of Probable ATP-dependent RNA helicase DDX17 484 73123 17 17 16 16 6572 5543 1 0 1 846.4144 1690.8142 2 1690.8162 -0.002 0 83.07 1.60E-08 R ELAQQVQQVADDYGK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6079.6079.2.dta 14 IPI00293616.3 ATP-dependent RNA helicase DDX3Y 289 73564 8 8 8 8 696 3643 1 0 1 399.6984 797.3822 2 797.382 0.0002 0 41.08 0.0006 R FSGGFGAR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4053.4053.2.dta 14 IPI00293616.3 ATP-dependent RNA helicase DDX3Y 289 73564 8 8 8 8 3036 2084 1 0 1 582.2984 1162.5823 2 1162.583 -0.0007 0 72.33 1.30E-06 R VGSTSENITQK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2331.2331.2.dta 14 IPI00293616.3 ATP-dependent RNA helicase DDX3Y 289 73564 8 8 8 8 3069 5384 1 0 1 584.8557 1167.6969 2 1167.6975 -0.0007 0 64.93 1.30E-06 K SPILVATAVAAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5919.5919.2.dta 14 IPI00293616.3 ATP-dependent RNA helicase DDX3Y 289 73564 8 8 8 8 4070 3027 1 0 1 434.2179 1299.6318 3 1299.632 -0.0002 1 23.18 0.038 R DREEALHQFR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3359.3359.3.dta 14 IPI00293616.3 ATP-dependent RNA helicase DDX3Y 289 73564 8 8 8 8 4265 5690 1 0 1 660.8427 1319.6708 2 1319.6721 -0.0013 0 61.85 5.80E-06 R ELAVQIYEEAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6225.6225.2.dta 14 IPI00293616.3 ATP-dependent RNA helicase DDX3Y 289 73564 8 8 8 8 4352 6566 1 0 0 668.8226 1335.6307 2 1335.6315 -0.0008 0 56.41 1.70E-05 R MLDMGFEPQIR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7100.7100.2.dta 14 IPI00293616.3 ATP-dependent RNA helicase DDX3Y 289 73564 8 8 8 8 4494 6949 1 0 1 679.3954 1356.7763 2 1356.7765 -0.0002 0 48.49 0.00011 K QYPISLVLAPTR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7484.7484.2.dta 14 IPI00293616.3 ATP-dependent RNA helicase DDX3Y 289 73564 8 8 8 8 7472 4674 1 0 1 629.9996 1886.9769 3 1886.9785 -0.0016 0 74.07 5.60E-07 R VRPCVVYGGADIGQQIR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5174.5174.3.dta 14 IPI00798375.1 23 kDa protein 144 23474 6 6 5 5 571 4408 1 0 1 384.2187 766.4228 2 766.4225 0.0003 0 26.45 0.012 R GYSSLLK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4886.4886.2.dta 14 IPI00798375.1 23 kDa protein 144 23474 6 6 5 5 1800 1747 1 0 1 492.7595 983.5044 2 983.5036 0.0009 0 32.93 0.00082 R EANQAINPK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1964.1964.2.dta 14 IPI00798375.1 23 kDa protein 144 23474 6 6 5 5 2811 6830 1 0 1 565.332 1128.6495 2 1128.6503 -0.0008 0 53.15 6.30E-05 K QVSDLISVLR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7365.7365.2.dta 14 IPI00798375.1 23 kDa protein 144 23474 6 6 5 5 4388 4469 1 0 1 671.8734 1341.7322 2 1341.7364 -0.0043 1 41.79 0.00047 K LLQLVEDRGSGR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4952.4952.2.dta 14 IPI00798375.1 23 kDa protein 144 23474 6 6 5 5 4389 4464 1 0 1 448.2528 1341.7365 3 1341.7364 0.0001 1 16.78 0.035 K LLQLVEDRGSGR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4947.4947.3.dta 14 IPI00798375.1 23 kDa protein 144 23474 6 6 5 5 5889 6327 1 0 1 787.8943 1573.7741 2 1573.7777 -0.0035 0 70.03 6.40E-07 K TGTAYTFFTPNNIK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6860.6860.2.dta 15 1 IPI00304596.3 Non-POU domain-containing octamer-binding protein 543 54311 28 28 21 21 180 3439 1 1 0 329.6977 657.3808 2 657.381 -0.0001 0 33.6 0.015 K QLELR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3825.3825.2.dta 15 1 IPI00304596.3 Non-POU domain-containing octamer-binding protein 543 54311 28 28 21 21 299 5907 1 1 0 348.6952 695.3758 2 695.3755 0.0003 0 29.46 0.019 K GFGFIR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6442.6442.2.dta 15 1 IPI00304596.3 Non-POU domain-containing octamer-binding protein 543 54311 28 28 21 21 471 3343 1 1 0 373.2266 744.4386 2 744.4381 0.0004 0 42.92 0.0013 R TLAEIAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3722.3722.2.dta 15 1 IPI00304596.3 Non-POU domain-containing octamer-binding protein 543 54311 28 28 21 21 1200 3624 1 1 0 443.7529 885.4912 2 885.492 -0.0007 0 35.02 0.00052 R AVVIVDDR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4033.4033.2.dta 15 1 IPI00304596.3 Non-POU domain-containing octamer-binding protein 543 54311 28 28 21 21 1223 1443 1 1 1 446.7348 891.4551 2 891.4563 -0.0012 1 35.73 0.0074 R RQQEGFK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1636.1636.2.dta 15 1 IPI00304596.3 Non-POU domain-containing octamer-binding protein 543 54311 28 28 21 21 1265 3111 1 1 1 300.8361 899.4865 3 899.4865 0 0 30.96 0.0085 K AGEVFIHK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3449.3449.3.dta 15 1 IPI00304596.3 Non-POU domain-containing octamer-binding protein 543 54311 28 28 21 21 1266 3112 1 1 1 450.7505 899.4865 2 899.4865 0 0 60.14 2.00E-05 K AGEVFIHK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3450.3450.2.dta 15 1 IPI00304596.3 Non-POU domain-containing octamer-binding protein 543 54311 28 28 21 21 1757 1269 1 1 1 488.272 974.5295 2 974.5297 -0.0003 1 26.63 0.037 K NFRKPGEK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1448.1448.2.dta 15 1 IPI00304596.3 Non-POU domain-containing octamer-binding protein 543 54311 28 28 21 21 2518 592 1 1 1 543.7753 1085.536 2 1085.5366 -0.0006 1 56.73 4.40E-05 K NQQFHKER E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1076.1076.2.dta 15 1 IPI00304596.3 Non-POU domain-containing octamer-binding protein 543 54311 28 28 21 21 2521 5212 1 1 1 543.7838 1085.5531 2 1085.5539 -0.0008 0 53.27 0.00011 K VELDNMPLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5743.5743.2.dta 15 1 IPI00304596.3 Non-POU domain-containing octamer-binding protein 543 54311 28 28 21 21 2613 4030 1 1 1 551.7808 1101.547 2 1101.5488 -0.0019 0 29.11 0.028 K VELDNMPLR G Oxidation (M) 0.000001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4476.4476.2.dta 15 1 IPI00304596.3 Non-POU domain-containing octamer-binding protein 543 54311 28 28 21 21 2915 2358 1 1 1 381.8764 1142.6073 3 1142.6084 -0.0011 1 34.23 0.0087 K AGEVFIHKDK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2630.2630.3.dta 15 1 IPI00304596.3 Non-POU domain-containing octamer-binding protein 543 54311 28 28 21 21 3486 2789 1 1 1 410.2193 1227.6361 3 1227.636 0.0001 1 24.95 0.034 R AAPGAEFAPNKR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3098.3098.3.dta 15 1 IPI00304596.3 Non-POU domain-containing octamer-binding protein 543 54311 28 28 21 21 3488 2825 1 1 1 614.8265 1227.6385 2 1227.636 0.0025 1 45.84 5.00E-05 R AAPGAEFAPNKR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3137.3137.2.dta 15 1 IPI00304596.3 Non-POU domain-containing octamer-binding protein 543 54311 28 28 21 21 3676 3191 1 1 1 624.8107 1247.6069 2 1247.6081 -0.0012 0 42.27 0.00011 R FACHSASLTVR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3544.3544.2.dta 15 1 IPI00304596.3 Non-POU domain-containing octamer-binding protein 543 54311 28 28 21 21 4350 4052 1 1 1 668.8146 1335.6146 2 1335.6162 -0.0016 1 47.29 7.80E-05 R EKLEMEMEAAR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4500.4500.2.dta 15 1 IPI00304596.3 Non-POU domain-containing octamer-binding protein 543 54311 28 28 21 21 5369 3957 1 1 1 494.2436 1479.7089 3 1479.7106 -0.0017 1 22.49 0.011 R QQEGFKGTFPDAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4397.4397.3.dta 15 1 IPI00304596.3 Non-POU domain-containing octamer-binding protein 543 54311 28 28 21 21 5370 3983 1 1 1 740.8618 1479.709 2 1479.7106 -0.0017 1 27.92 0.0031 R QQEGFKGTFPDAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4425.4425.2.dta 15 1 IPI00304596.3 Non-POU domain-containing octamer-binding protein 543 54311 28 28 21 21 5672 1956 1 1 1 514.2551 1539.7436 3 1539.7463 -0.0028 1 23.91 0.0065 R MEELHNQEVQKR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2191.2191.3.dta 15 1 IPI00304596.3 Non-POU domain-containing octamer-binding protein 543 54311 28 28 21 21 5757 1472 1 1 1 519.587 1555.7393 3 1555.7413 -0.002 1 26.01 0.0057 R RMEELHNQEVQK R Oxidation (M) 0.010000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1667.1667.3.dta 15 1 IPI00304596.3 Non-POU domain-containing octamer-binding protein 543 54311 28 28 21 21 6636 5960 1 1 1 848.376 1694.7375 2 1694.7399 -0.0023 0 83.99 1.30E-08 R FAQPGSFEYEYAMR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6495.6495.2.dta 15 1 IPI00304596.3 Non-POU domain-containing octamer-binding protein 543 54311 28 28 21 21 6716 5280 1 1 1 856.3732 1710.7319 2 1710.7348 -0.0029 0 50.44 1.90E-05 R FAQPGSFEYEYAMR W Oxidation (M) 0.00000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5813.5813.2.dta 15 1 IPI00304596.3 Non-POU domain-containing octamer-binding protein 543 54311 28 28 21 21 7132 7254 1 1 1 605.0009 1811.9807 3 1811.9815 -0.0007 1 22.86 0.0072 R TLAEIAKVELDNMPLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7810.7810.3.dta 15 1 IPI00304596.3 Non-POU domain-containing octamer-binding protein 543 54311 28 28 21 21 7194 3891 1 1 1 610.9704 1829.8894 3 1829.8941 -0.0048 1 40.17 0.00023 K ALIEMEKQQQDQVDR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4326.4326.3.dta 15 1 IPI00304596.3 Non-POU domain-containing octamer-binding protein 543 54311 28 28 21 21 7994 6487 1 1 1 1082.035 2162.0555 2 2162.0579 -0.0024 0 35.78 0.00044 R FGQAATMEGIGAIGGTPPAFNR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7019.7019.2.dta 15 1 IPI00304596.3 Non-POU domain-containing octamer-binding protein 543 54311 28 28 21 21 7995 6476 1 1 1 721.694 2162.0603 3 2162.0579 0.0024 0 63.64 1.10E-06 R FGQAATMEGIGAIGGTPPAFNR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7007.7007.3.dta 15 1 IPI00304596.3 Non-POU domain-containing octamer-binding protein 543 54311 28 28 21 21 8252 5780 1 1 1 768.3557 2302.0451 3 2302.0477 -0.0025 1 17.64 0.022 R EQPPRFAQPGSFEYEYAMR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6315.6315.3.dta 15 1 IPI00304596.3 Non-POU domain-containing octamer-binding protein 543 54311 28 28 21 21 8272 5252 1 1 1 773.6871 2318.0394 3 2318.0426 -0.0032 1 37.19 0.00033 R EQPPRFAQPGSFEYEYAMR W Oxidation (M) 0.0000000000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5784.5784.3.dta 15 2 IPI00010740.1 "Isoform Long of Splicing factor, proline- and glutamine-rich" 301 76216 13 13 11 11 211 5818 1 0 1 334.6918 667.3691 2 667.3694 -0.0003 0 36.83 0.002 K GFGFIK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6353.6353.2.dta 15 2 IPI00010740.1 "Isoform Long of Splicing factor, proline- and glutamine-rich" 301 76216 13 13 11 11 374 3180 3 0 1 358.2207 714.4269 2 714.4276 -0.0006 0 28.76 0.022 R ALAEIAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3531.3531.2.dta 15 2 IPI00010740.1 "Isoform Long of Splicing factor, proline- and glutamine-rich" 301 76216 13 13 11 11 652 5039 1 0 1 393.745 785.4755 2 785.4759 -0.0004 0 59.53 2.70E-05 K ANLSLLR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5568.5568.2.dta 15 2 IPI00010740.1 "Isoform Long of Splicing factor, proline- and glutamine-rich" 301 76216 13 13 11 11 687 1273 1 0 1 397.7118 793.409 2 793.4083 0.0007 0 60.28 1.40E-05 K QGPGPGGPK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1452.1452.2.dta 15 2 IPI00010740.1 "Isoform Long of Splicing factor, proline- and glutamine-rich" 301 76216 13 13 11 11 1200 3624 1 0 0 443.7529 885.4912 2 885.492 -0.0007 0 35.02 0.00052 R AVVIVDDR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4033.4033.2.dta 15 2 IPI00010740.1 "Isoform Long of Splicing factor, proline- and glutamine-rich" 301 76216 13 13 11 11 2600 3014 1 0 1 550.3132 1098.6118 2 1098.6146 -0.0028 1 32.97 0.00081 R AVVIVDDRGR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3345.3345.2.dta 15 2 IPI00010740.1 "Isoform Long of Splicing factor, proline- and glutamine-rich" 301 76216 13 13 11 11 2916 3528 1 0 1 572.316 1142.6175 2 1142.6196 -0.0021 0 45.24 0.00062 R FATHAAALSVR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3926.3926.2.dta 15 2 IPI00010740.1 "Isoform Long of Splicing factor, proline- and glutamine-rich" 301 76216 13 13 11 11 2918 3520 1 0 1 381.8815 1142.6228 3 1142.6196 0.0031 0 40.38 0.0024 R FATHAAALSVR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3918.3918.3.dta 15 2 IPI00010740.1 "Isoform Long of Splicing factor, proline- and glutamine-rich" 301 76216 13 13 11 11 3661 4011 1 0 1 623.35 1244.6854 2 1244.6877 -0.0023 0 75.83 4.40E-07 K GIVEFASKPAAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4456.4456.2.dta 15 2 IPI00010740.1 "Isoform Long of Splicing factor, proline- and glutamine-rich" 301 76216 13 13 11 11 3662 4010 1 0 1 415.904 1244.6901 3 1244.6877 0.0024 0 24.44 0.01 K GIVEFASKPAAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4455.4455.3.dta 15 2 IPI00010740.1 "Isoform Long of Splicing factor, proline- and glutamine-rich" 301 76216 13 13 11 11 4380 3087 1 0 1 671.3361 1340.6577 2 1340.6586 -0.0009 0 42.46 0.00012 R FGQGGAGPVGGQGPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3423.3423.2.dta 15 2 IPI00010740.1 "Isoform Long of Splicing factor, proline- and glutamine-rich" 301 76216 13 13 11 11 5088 4258 1 0 1 479.9173 1436.7302 3 1436.73 0.0002 1 44.29 0.00063 K YGEPGEVFINKGK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4723.4723.3.dta 15 2 IPI00010740.1 "Isoform Long of Splicing factor, proline- and glutamine-rich" 301 76216 13 13 11 11 7112 7376 1 0 1 904.4568 1806.8991 2 1806.904 -0.0048 0 31.15 0.0012 R LFVGNLPADITEDEFK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7956.7956.2.dta 15 3 IPI00103525.1 paraspeckle protein 1 252 58820 12 12 11 11 299 5907 1 0 0 348.6952 695.3758 2 695.3755 0.0003 0 29.46 0.019 R GFGFIR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6442.6442.2.dta 15 3 IPI00103525.1 paraspeckle protein 1 252 58820 12 12 11 11 471 3343 1 0 0 373.2266 744.4386 2 744.4381 0.0004 0 42.92 0.0013 R TLAEIAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3722.3722.2.dta 15 3 IPI00103525.1 paraspeckle protein 1 252 58820 12 12 11 11 1129 3150 1 0 1 436.7453 871.476 2 871.4763 -0.0003 0 19.81 0.014 K AVVVVDDR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3491.3491.2.dta 15 3 IPI00103525.1 paraspeckle protein 1 252 58820 12 12 11 11 2544 6995 1 0 1 545.2743 1088.534 2 1088.5363 -0.0023 1 41.11 0.0016 K TQQYHKER E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.753.753.2.dta 15 3 IPI00103525.1 paraspeckle protein 1 252 58820 12 12 11 11 4005 4640 1 0 1 430.5715 1288.6926 3 1288.6928 -0.0002 0 14.91 0.04 K GFVEFAAKPPAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5137.5137.3.dta 15 3 IPI00103525.1 paraspeckle protein 1 252 58820 12 12 11 11 4179 5098 1 0 1 655.8206 1309.6267 2 1309.6302 -0.0036 0 61.32 2.40E-06 R YGEPSEVFINR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5628.5628.2.dta 15 3 IPI00103525.1 paraspeckle protein 1 252 58820 12 12 11 11 4181 5082 1 0 1 655.8236 1309.6327 2 1309.6302 0.0024 0 41.14 0.00057 R YGEPSEVFINR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5612.5612.2.dta 15 3 IPI00103525.1 paraspeckle protein 1 252 58820 12 12 11 11 6317 6149 1 0 1 825.3811 1648.7477 2 1648.7522 -0.0045 0 58.28 3.40E-06 R FAQPGTFEFEYASR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6684.6684.2.dta 15 3 IPI00103525.1 paraspeckle protein 1 252 58820 12 12 11 11 6547 7319 1 0 1 562.6608 1684.9605 3 1684.9611 -0.0006 1 29.77 0.0039 R TLAEIAKAELDGTILK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7889.7889.3.dta 15 3 IPI00103525.1 paraspeckle protein 1 252 58820 12 12 11 11 7245 7221 1 0 1 919.4643 1836.914 2 1836.9146 -0.0005 0 45.01 6.00E-05 R LFVGNLPTDITEEDFK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7776.7776.2.dta 15 3 IPI00103525.1 paraspeckle protein 1 252 58820 12 12 11 11 7774 6577 1 0 1 665.3467 1993.0184 3 1993.0157 0.0027 1 40.93 0.00023 R LFVGNLPTDITEEDFKR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7111.7111.3.dta 15 3 IPI00103525.1 paraspeckle protein 1 252 58820 12 12 11 11 8138 5943 1 0 1 753.0247 2256.0523 3 2256.06 -0.0076 1 33.31 0.00075 R EQPPRFAQPGTFEFEYASR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6477.6477.3.dta 15 IPI00645010.1 30 kDa protein 357 29660 18 18 14 14 299 5907 1 0 0 348.6952 695.3758 2 695.3755 0.0003 0 29.46 0.019 K GFGFIR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6442.6442.2.dta 15 IPI00645010.1 30 kDa protein 357 29660 18 18 14 14 471 3343 1 0 0 373.2266 744.4386 2 744.4381 0.0004 0 42.92 0.0013 R TLAEIAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3722.3722.2.dta 15 IPI00645010.1 30 kDa protein 357 29660 18 18 14 14 1265 3111 1 0 1 300.8361 899.4865 3 899.4865 0 0 30.96 0.0085 K AGEVFIHK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3449.3449.3.dta 15 IPI00645010.1 30 kDa protein 357 29660 18 18 14 14 1266 3112 1 0 1 450.7505 899.4865 2 899.4865 0 0 60.14 2.00E-05 K AGEVFIHK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3450.3450.2.dta 15 IPI00645010.1 30 kDa protein 357 29660 18 18 14 14 1757 1269 1 0 1 488.272 974.5295 2 974.5297 -0.0003 1 26.63 0.037 K NFRKPGEK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1448.1448.2.dta 15 IPI00645010.1 30 kDa protein 357 29660 18 18 14 14 2521 5212 1 0 1 543.7838 1085.5531 2 1085.5539 -0.0008 0 53.27 0.00011 K VELDNMPLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5743.5743.2.dta 15 IPI00645010.1 30 kDa protein 357 29660 18 18 14 14 2613 4030 1 0 1 551.7808 1101.547 2 1101.5488 -0.0019 0 29.11 0.028 K VELDNMPLR G Oxidation (M) 0.000001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4476.4476.2.dta 15 IPI00645010.1 30 kDa protein 357 29660 18 18 14 14 2915 2358 1 0 1 381.8764 1142.6073 3 1142.6084 -0.0011 1 34.23 0.0087 K AGEVFIHKDK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2630.2630.3.dta 15 IPI00645010.1 30 kDa protein 357 29660 18 18 14 14 3676 3191 1 0 1 624.8107 1247.6069 2 1247.6081 -0.0012 0 42.27 0.00011 R FACHSASLTVR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3544.3544.2.dta 15 IPI00645010.1 30 kDa protein 357 29660 18 18 14 14 4350 4052 1 0 1 668.8146 1335.6146 2 1335.6162 -0.0016 1 47.29 7.80E-05 R EKLEMEMEAAR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4500.4500.2.dta 15 IPI00645010.1 30 kDa protein 357 29660 18 18 14 14 5672 1956 1 0 1 514.2551 1539.7436 3 1539.7463 -0.0028 1 23.91 0.0065 R MEELHNQEVQKR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2191.2191.3.dta 15 IPI00645010.1 30 kDa protein 357 29660 18 18 14 14 5757 1472 1 0 1 519.587 1555.7393 3 1555.7413 -0.002 1 26.01 0.0057 R RMEELHNQEVQK R Oxidation (M) 0.010000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1667.1667.3.dta 15 IPI00645010.1 30 kDa protein 357 29660 18 18 14 14 6636 5960 1 0 1 848.376 1694.7375 2 1694.7399 -0.0023 0 83.99 1.30E-08 R FAQPGSFEYEYAMR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6495.6495.2.dta 15 IPI00645010.1 30 kDa protein 357 29660 18 18 14 14 6716 5280 1 0 1 856.3732 1710.7319 2 1710.7348 -0.0029 0 50.44 1.90E-05 R FAQPGSFEYEYAMR W Oxidation (M) 0.00000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5813.5813.2.dta 15 IPI00645010.1 30 kDa protein 357 29660 18 18 14 14 7132 7254 1 0 1 605.0009 1811.9807 3 1811.9815 -0.0007 1 22.86 0.0072 R TLAEIAKVELDNMPLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7810.7810.3.dta 15 IPI00645010.1 30 kDa protein 357 29660 18 18 14 14 7194 3891 1 0 1 610.9704 1829.8894 3 1829.8941 -0.0048 1 40.17 0.00023 K ALIEMEKQQQDQVDR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4326.4326.3.dta 15 IPI00645010.1 30 kDa protein 357 29660 18 18 14 14 8252 5780 1 0 1 768.3557 2302.0451 3 2302.0477 -0.0025 1 17.64 0.022 R EQPPRFAQPGSFEYEYAMR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6315.6315.3.dta 15 IPI00645010.1 30 kDa protein 357 29660 18 18 14 14 8272 5252 1 0 1 773.6871 2318.0394 3 2318.0426 -0.0032 1 37.19 0.00033 R EQPPRFAQPGSFEYEYAMR W Oxidation (M) 0.0000000000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5784.5784.3.dta 15 IPI00644848.1 Protein 338 28341 16 16 13 13 180 3439 1 0 0 329.6977 657.3808 2 657.381 -0.0001 0 33.6 0.015 K QLELR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3825.3825.2.dta 15 IPI00644848.1 Protein 338 28341 16 16 13 13 299 5907 1 0 0 348.6952 695.3758 2 695.3755 0.0003 0 29.46 0.019 K GFGFIR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6442.6442.2.dta 15 IPI00644848.1 Protein 338 28341 16 16 13 13 1200 3624 1 0 0 443.7529 885.4912 2 885.492 -0.0007 0 35.02 0.00052 R AVVIVDDR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4033.4033.2.dta 15 IPI00644848.1 Protein 338 28341 16 16 13 13 1223 1443 1 0 1 446.7348 891.4551 2 891.4563 -0.0012 1 35.73 0.0074 R RQQEGFK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1636.1636.2.dta 15 IPI00644848.1 Protein 338 28341 16 16 13 13 1265 3111 1 0 1 300.8361 899.4865 3 899.4865 0 0 30.96 0.0085 K AGEVFIHK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3449.3449.3.dta 15 IPI00644848.1 Protein 338 28341 16 16 13 13 1266 3112 1 0 1 450.7505 899.4865 2 899.4865 0 0 60.14 2.00E-05 K AGEVFIHK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3450.3450.2.dta 15 IPI00644848.1 Protein 338 28341 16 16 13 13 2518 592 1 0 1 543.7753 1085.536 2 1085.5366 -0.0006 1 56.73 4.40E-05 K NQQFHKER E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1076.1076.2.dta 15 IPI00644848.1 Protein 338 28341 16 16 13 13 2915 2358 1 0 1 381.8764 1142.6073 3 1142.6084 -0.0011 1 34.23 0.0087 K AGEVFIHKDK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2630.2630.3.dta 15 IPI00644848.1 Protein 338 28341 16 16 13 13 4350 4052 1 0 1 668.8146 1335.6146 2 1335.6162 -0.0016 1 47.29 7.80E-05 R EKLEMEMEAAR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4500.4500.2.dta 15 IPI00644848.1 Protein 338 28341 16 16 13 13 5672 1956 1 0 1 514.2551 1539.7436 3 1539.7463 -0.0028 1 23.91 0.0065 R MEELHNQEVQKR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2191.2191.3.dta 15 IPI00644848.1 Protein 338 28341 16 16 13 13 5757 1472 1 0 1 519.587 1555.7393 3 1555.7413 -0.002 1 26.01 0.0057 R RMEELHNQEVQK R Oxidation (M) 0.010000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1667.1667.3.dta 15 IPI00644848.1 Protein 338 28341 16 16 13 13 6636 5960 1 0 1 848.376 1694.7375 2 1694.7399 -0.0023 0 83.99 1.30E-08 R FAQPGSFEYEYAMR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6495.6495.2.dta 15 IPI00644848.1 Protein 338 28341 16 16 13 13 6716 5280 1 0 1 856.3732 1710.7319 2 1710.7348 -0.0029 0 50.44 1.90E-05 R FAQPGSFEYEYAMR W Oxidation (M) 0.00000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5813.5813.2.dta 15 IPI00644848.1 Protein 338 28341 16 16 13 13 7194 3891 1 0 1 610.9704 1829.8894 3 1829.8941 -0.0048 1 40.17 0.00023 K ALIEMEKQQQDQVDR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4326.4326.3.dta 15 IPI00644848.1 Protein 338 28341 16 16 13 13 8252 5780 1 0 1 768.3557 2302.0451 3 2302.0477 -0.0025 1 17.64 0.022 R EQPPRFAQPGSFEYEYAMR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6315.6315.3.dta 15 IPI00644848.1 Protein 338 28341 16 16 13 13 8272 5252 1 0 1 773.6871 2318.0394 3 2318.0426 -0.0032 1 37.19 0.00033 R EQPPRFAQPGSFEYEYAMR W Oxidation (M) 0.0000000000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5784.5784.3.dta 15 IPI00216613.1 "Isoform Short of Splicing factor, proline- and glutamine-rich" 275 72332 12 12 10 10 211 5818 1 0 1 334.6918 667.3691 2 667.3694 -0.0003 0 36.83 0.002 K GFGFIK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6353.6353.2.dta 15 IPI00216613.1 "Isoform Short of Splicing factor, proline- and glutamine-rich" 275 72332 12 12 10 10 374 3180 3 0 1 358.2207 714.4269 2 714.4276 -0.0006 0 28.76 0.022 R ALAEIAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3531.3531.2.dta 15 IPI00216613.1 "Isoform Short of Splicing factor, proline- and glutamine-rich" 275 72332 12 12 10 10 652 5039 1 0 1 393.745 785.4755 2 785.4759 -0.0004 0 59.53 2.70E-05 K ANLSLLR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5568.5568.2.dta 15 IPI00216613.1 "Isoform Short of Splicing factor, proline- and glutamine-rich" 275 72332 12 12 10 10 687 1273 1 0 1 397.7118 793.409 2 793.4083 0.0007 0 60.28 1.40E-05 K QGPGPGGPK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1452.1452.2.dta 15 IPI00216613.1 "Isoform Short of Splicing factor, proline- and glutamine-rich" 275 72332 12 12 10 10 1200 3624 1 0 0 443.7529 885.4912 2 885.492 -0.0007 0 35.02 0.00052 R AVVIVDDR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4033.4033.2.dta 15 IPI00216613.1 "Isoform Short of Splicing factor, proline- and glutamine-rich" 275 72332 12 12 10 10 2600 3014 1 0 1 550.3132 1098.6118 2 1098.6146 -0.0028 1 32.97 0.00081 R AVVIVDDRGR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3345.3345.2.dta 15 IPI00216613.1 "Isoform Short of Splicing factor, proline- and glutamine-rich" 275 72332 12 12 10 10 2916 3528 1 0 1 572.316 1142.6175 2 1142.6196 -0.0021 0 45.24 0.00062 R FATHAAALSVR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3926.3926.2.dta 15 IPI00216613.1 "Isoform Short of Splicing factor, proline- and glutamine-rich" 275 72332 12 12 10 10 2918 3520 1 0 1 381.8815 1142.6228 3 1142.6196 0.0031 0 40.38 0.0024 R FATHAAALSVR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3918.3918.3.dta 15 IPI00216613.1 "Isoform Short of Splicing factor, proline- and glutamine-rich" 275 72332 12 12 10 10 3661 4011 1 0 1 623.35 1244.6854 2 1244.6877 -0.0023 0 75.83 4.40E-07 K GIVEFASKPAAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4456.4456.2.dta 15 IPI00216613.1 "Isoform Short of Splicing factor, proline- and glutamine-rich" 275 72332 12 12 10 10 3662 4010 1 0 1 415.904 1244.6901 3 1244.6877 0.0024 0 24.44 0.01 K GIVEFASKPAAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4455.4455.3.dta 15 IPI00216613.1 "Isoform Short of Splicing factor, proline- and glutamine-rich" 275 72332 12 12 10 10 5088 4258 1 0 1 479.9173 1436.7302 3 1436.73 0.0002 1 44.29 0.00063 K YGEPGEVFINKGK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4723.4723.3.dta 15 IPI00216613.1 "Isoform Short of Splicing factor, proline- and glutamine-rich" 275 72332 12 12 10 10 7112 7376 1 0 1 904.4568 1806.8991 2 1806.904 -0.0048 0 31.15 0.0012 R LFVGNLPADITEDEFK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7956.7956.2.dta 15 IPI00645966.1 24 kDa protein 181 23715 11 11 9 9 299 5907 1 0 0 348.6952 695.3758 2 695.3755 0.0003 0 29.46 0.019 K GFGFIR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6442.6442.2.dta 15 IPI00645966.1 24 kDa protein 181 23715 11 11 9 9 471 3343 1 0 0 373.2266 744.4386 2 744.4381 0.0004 0 42.92 0.0013 R TLAEIAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3722.3722.2.dta 15 IPI00645966.1 24 kDa protein 181 23715 11 11 9 9 1200 3624 1 0 0 443.7529 885.4912 2 885.492 -0.0007 0 35.02 0.00052 R AVVIVDDR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4033.4033.2.dta 15 IPI00645966.1 24 kDa protein 181 23715 11 11 9 9 1265 3111 1 0 1 300.8361 899.4865 3 899.4865 0 0 30.96 0.0085 K AGEVFIHK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3449.3449.3.dta 15 IPI00645966.1 24 kDa protein 181 23715 11 11 9 9 1266 3112 1 0 1 450.7505 899.4865 2 899.4865 0 0 60.14 2.00E-05 K AGEVFIHK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3450.3450.2.dta 15 IPI00645966.1 24 kDa protein 181 23715 11 11 9 9 1757 1269 1 0 1 488.272 974.5295 2 974.5297 -0.0003 1 26.63 0.037 K NFRKPGEK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1448.1448.2.dta 15 IPI00645966.1 24 kDa protein 181 23715 11 11 9 9 2521 5212 1 0 1 543.7838 1085.5531 2 1085.5539 -0.0008 0 53.27 0.00011 K VELDNMPLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5743.5743.2.dta 15 IPI00645966.1 24 kDa protein 181 23715 11 11 9 9 2613 4030 1 0 1 551.7808 1101.547 2 1101.5488 -0.0019 0 29.11 0.028 K VELDNMPLR G Oxidation (M) 0.000001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4476.4476.2.dta 15 IPI00645966.1 24 kDa protein 181 23715 11 11 9 9 2915 2358 1 0 1 381.8764 1142.6073 3 1142.6084 -0.0011 1 34.23 0.0087 K AGEVFIHKDK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2630.2630.3.dta 15 IPI00645966.1 24 kDa protein 181 23715 11 11 9 9 3676 3191 1 0 1 624.8107 1247.6069 2 1247.6081 -0.0012 0 42.27 0.00011 R FACHSASLTVR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3544.3544.2.dta 15 IPI00645966.1 24 kDa protein 181 23715 11 11 9 9 7132 7254 1 0 1 605.0009 1811.9807 3 1811.9815 -0.0007 1 22.86 0.0072 R TLAEIAKVELDNMPLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7810.7810.3.dta 15 IPI00642315.1 Paraspeckle component 1 176 27371 9 9 8 8 299 5907 1 0 0 348.6952 695.3758 2 695.3755 0.0003 0 29.46 0.019 R GFGFIR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6442.6442.2.dta 15 IPI00642315.1 Paraspeckle component 1 176 27371 9 9 8 8 471 3343 1 0 0 373.2266 744.4386 2 744.4381 0.0004 0 42.92 0.0013 R TLAEIAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3722.3722.2.dta 15 IPI00642315.1 Paraspeckle component 1 176 27371 9 9 8 8 1129 3150 1 0 1 436.7453 871.476 2 871.4763 -0.0003 0 19.81 0.014 K AVVVVDDR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3491.3491.2.dta 15 IPI00642315.1 Paraspeckle component 1 176 27371 9 9 8 8 4005 4640 1 0 1 430.5715 1288.6926 3 1288.6928 -0.0002 0 14.91 0.04 K GFVEFAAKPPAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5137.5137.3.dta 15 IPI00642315.1 Paraspeckle component 1 176 27371 9 9 8 8 4179 5098 1 0 1 655.8206 1309.6267 2 1309.6302 -0.0036 0 61.32 2.40E-06 R YGEPSEVFINR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5628.5628.2.dta 15 IPI00642315.1 Paraspeckle component 1 176 27371 9 9 8 8 4181 5082 1 0 1 655.8236 1309.6327 2 1309.6302 0.0024 0 41.14 0.00057 R YGEPSEVFINR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5612.5612.2.dta 15 IPI00642315.1 Paraspeckle component 1 176 27371 9 9 8 8 6547 7319 1 0 1 562.6608 1684.9605 3 1684.9611 -0.0006 1 29.77 0.0039 R TLAEIAKAELDGTILK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7889.7889.3.dta 15 IPI00642315.1 Paraspeckle component 1 176 27371 9 9 8 8 7245 7221 1 0 1 919.4643 1836.914 2 1836.9146 -0.0005 0 45.01 6.00E-05 R LFVGNLPTDITEEDFK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7776.7776.2.dta 15 IPI00642315.1 Paraspeckle component 1 176 27371 9 9 8 8 7774 6577 1 0 1 665.3467 1993.0184 3 1993.0157 0.0027 1 40.93 0.00023 R LFVGNLPTDITEEDFKR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7111.7111.3.dta 15 IPI00646520.1 15 kDa protein 80 14519 5 5 4 4 471 3343 1 0 0 373.2266 744.4386 2 744.4381 0.0004 0 42.92 0.0013 R TLAEIAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3722.3722.2.dta 15 IPI00646520.1 15 kDa protein 80 14519 5 5 4 4 1757 1269 1 0 1 488.272 974.5295 2 974.5297 -0.0003 1 26.63 0.037 K NFRKPGEK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1448.1448.2.dta 15 IPI00646520.1 15 kDa protein 80 14519 5 5 4 4 2521 5212 1 0 1 543.7838 1085.5531 2 1085.5539 -0.0008 0 53.27 0.00011 K VELDNMPLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5743.5743.2.dta 15 IPI00646520.1 15 kDa protein 80 14519 5 5 4 4 2613 4030 1 0 1 551.7808 1101.547 2 1101.5488 -0.0019 0 29.11 0.028 K VELDNMPLR G Oxidation (M) 0.000001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4476.4476.2.dta 15 IPI00646520.1 15 kDa protein 80 14519 5 5 4 4 7132 7254 1 0 1 605.0009 1811.9807 3 1811.9815 -0.0007 1 22.86 0.0072 R TLAEIAKVELDNMPLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7810.7810.3.dta 16 1 IPI00302925.3 "Chaperonin containing TCP1, subunit 8 (Theta) variant" 524 60311 16 16 16 16 202 2295 1 1 1 333.6781 665.3417 2 665.3418 -0.0001 0 35.44 0.006 R TSIMSK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2561.2561.2.dta 16 1 IPI00302925.3 "Chaperonin containing TCP1, subunit 8 (Theta) variant" 524 60311 16 16 16 16 1199 3303 1 1 1 443.2613 884.5081 2 884.508 0.0001 0 44.7 0.00041 K TVGATALPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3677.3677.2.dta 16 1 IPI00302925.3 "Chaperonin containing TCP1, subunit 8 (Theta) variant" 524 60311 16 16 16 16 1772 4078 1 1 1 489.7574 977.5003 2 977.5004 -0.0002 0 48.91 0.00023 K APGFAQMLK E Oxidation (M) 0.000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4528.4528.2.dta 16 1 IPI00302925.3 "Chaperonin containing TCP1, subunit 8 (Theta) variant" 524 60311 16 16 16 16 2800 4778 1 1 1 564.8407 1127.6668 2 1127.6662 0.0006 0 94.01 2.90E-09 K LATNAAVTVLR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5287.5287.2.dta 16 1 IPI00302925.3 "Chaperonin containing TCP1, subunit 8 (Theta) variant" 524 60311 16 16 16 16 2937 6590 1 1 1 573.8035 1145.5924 2 1145.5928 -0.0004 0 51.12 9.70E-05 R DIDEVSSLLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7124.7124.2.dta 16 1 IPI00302925.3 "Chaperonin containing TCP1, subunit 8 (Theta) variant" 524 60311 16 16 16 16 3010 2146 1 1 1 579.7997 1157.5848 2 1157.5829 0.0019 0 52.6 6.30E-05 K LYAVHQEGNK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2399.2399.2.dta 16 1 IPI00302925.3 "Chaperonin containing TCP1, subunit 8 (Theta) variant" 524 60311 16 16 16 16 3065 4929 1 1 1 584.804 1167.5934 2 1167.5924 0.0009 0 47.52 0.00017 K QYGNEVFLAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5451.5451.2.dta 16 1 IPI00302925.3 "Chaperonin containing TCP1, subunit 8 (Theta) variant" 524 60311 16 16 16 16 4155 4658 1 1 1 654.3219 1306.6292 2 1306.6306 -0.0013 0 59.11 2.90E-06 K HFSGLEEAVYR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5157.5157.2.dta 16 1 IPI00302925.3 "Chaperonin containing TCP1, subunit 8 (Theta) variant" 524 60311 16 16 16 16 4338 6434 1 1 1 667.3766 1332.7386 2 1332.7401 -0.0015 0 73.3 5.90E-07 K LFVTNDAATILR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6966.6966.2.dta 16 1 IPI00302925.3 "Chaperonin containing TCP1, subunit 8 (Theta) variant" 524 60311 16 16 16 16 4547 5665 1 1 1 683.2994 1364.5843 2 1364.5878 -0.0035 0 44.57 0.00017 R GSTDNLMDDIER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6200.6200.2.dta 16 1 IPI00302925.3 "Chaperonin containing TCP1, subunit 8 (Theta) variant" 524 60311 16 16 16 16 4597 3900 1 1 1 686.8746 1371.7347 2 1371.7358 -0.0011 0 100.72 9.70E-10 K AIADTGANVVVTGGK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4336.4336.2.dta 16 1 IPI00302925.3 "Chaperonin containing TCP1, subunit 8 (Theta) variant" 524 60311 16 16 16 16 5599 6484 1 1 1 765.4171 1528.8196 2 1528.8209 -0.0013 1 45.77 5.10E-05 K NLRDIDEVSSLLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7016.7016.2.dta 16 1 IPI00302925.3 "Chaperonin containing TCP1, subunit 8 (Theta) variant" 524 60311 16 16 16 16 5611 3125 1 1 1 511.6 1531.7782 3 1531.7776 0.0005 1 46.56 0.00048 R NIQACKELAQTTR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3464.3464.3.dta 16 1 IPI00302925.3 "Chaperonin containing TCP1, subunit 8 (Theta) variant" 524 60311 16 16 16 16 6139 3232 1 1 1 543.9651 1628.8736 3 1628.8733 0.0003 1 24.7 0.045 R ALAENSGVKANEVISK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3596.3596.3.dta 16 1 IPI00302925.3 "Chaperonin containing TCP1, subunit 8 (Theta) variant" 524 60311 16 16 16 16 7199 6641 1 1 1 916.4328 1830.851 2 1830.8532 -0.0022 0 51.65 1.40E-05 K IAVYSCPFDGMITETK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7177.7177.2.dta 16 1 IPI00302925.3 "Chaperonin containing TCP1, subunit 8 (Theta) variant" 524 60311 16 16 16 16 8014 4862 1 1 1 729.3633 2185.068 3 2185.0725 -0.0045 1 21.88 0.0089 K QITSYGETCPGLEQYAIKK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5378.5378.3.dta 16 IPI00797206.1 Protein 328 35913 9 9 9 9 202 2295 1 0 1 333.6781 665.3417 2 665.3418 -0.0001 0 35.44 0.006 R TSIMSK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2561.2561.2.dta 16 IPI00797206.1 Protein 328 35913 9 9 9 9 1199 3303 1 0 1 443.2613 884.5081 2 884.508 0.0001 0 44.7 0.00041 K TVGATALPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3677.3677.2.dta 16 IPI00797206.1 Protein 328 35913 9 9 9 9 2937 6590 1 0 1 573.8035 1145.5924 2 1145.5928 -0.0004 0 51.12 9.70E-05 R DIDEVSSLLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7124.7124.2.dta 16 IPI00797206.1 Protein 328 35913 9 9 9 9 3065 4929 1 0 1 584.804 1167.5934 2 1167.5924 0.0009 0 47.52 0.00017 K QYGNEVFLAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5451.5451.2.dta 16 IPI00797206.1 Protein 328 35913 9 9 9 9 4155 4658 1 0 1 654.3219 1306.6292 2 1306.6306 -0.0013 0 59.11 2.90E-06 K HFSGLEEAVYR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5157.5157.2.dta 16 IPI00797206.1 Protein 328 35913 9 9 9 9 4338 6434 1 0 1 667.3766 1332.7386 2 1332.7401 -0.0015 0 73.3 5.90E-07 K LFVTNDAATILR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6966.6966.2.dta 16 IPI00797206.1 Protein 328 35913 9 9 9 9 4597 3900 1 0 1 686.8746 1371.7347 2 1371.7358 -0.0011 0 100.72 9.70E-10 K AIADTGANVVVTGGK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4336.4336.2.dta 16 IPI00797206.1 Protein 328 35913 9 9 9 9 5599 6484 1 0 1 765.4171 1528.8196 2 1528.8209 -0.0013 1 45.77 5.10E-05 K NLRDIDEVSSLLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7016.7016.2.dta 16 IPI00797206.1 Protein 328 35913 9 9 9 9 5611 3125 1 0 1 511.6 1531.7782 3 1531.7776 0.0005 1 46.56 0.00048 R NIQACKELAQTTR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3464.3464.3.dta 16 IPI00794673.1 Protein 126 11522 3 3 3 3 2800 4778 1 0 1 564.8407 1127.6668 2 1127.6662 0.0006 0 94.01 2.90E-09 K LATNAAVTVLR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5287.5287.2.dta 16 IPI00794673.1 Protein 126 11522 3 3 3 3 3010 2146 1 0 1 579.7997 1157.5848 2 1157.5829 0.0019 0 52.6 6.30E-05 K LYAVHQEGNK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2399.2399.2.dta 16 IPI00794673.1 Protein 126 11522 3 3 3 3 6139 3232 1 0 1 543.9651 1628.8736 3 1628.8733 0.0003 1 24.7 0.045 R ALAENSGVKANEVISK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3596.3596.3.dta 16 IPI00386648.1 CCT8 protein 49 2893 1 1 1 1 1772 4078 1 0 1 489.7574 977.5003 2 977.5004 -0.0002 0 48.91 0.00023 K APGFAQMLK E Oxidation (M) 0.000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4528.4528.2.dta 17 1 IPI00018465.1 T-complex protein 1 subunit eta 499 59842 18 18 17 17 535 4217 1 1 1 380.2346 758.4547 2 758.4538 0.0009 0 33.87 0.0096 K TLVDIAK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4679.4679.2.dta 17 1 IPI00018465.1 T-complex protein 1 subunit eta 499 59842 18 18 17 17 648 6713 1 1 1 393.7166 785.4187 2 785.4184 0.0003 1 34.49 0.0038 K KYHNPK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.725.725.2.dta 17 1 IPI00018465.1 T-complex protein 1 subunit eta 499 59842 18 18 17 17 778 5173 1 1 1 406.2558 810.4971 2 810.4963 0.0008 0 53.41 2.30E-05 K ALEIIPR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5704.5704.2.dta 17 1 IPI00018465.1 T-complex protein 1 subunit eta 499 59842 18 18 17 17 1349 5209 1 1 1 455.7446 909.4746 2 909.4742 0.0004 0 34.06 0.0074 K TCTFILR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5740.5740.2.dta 17 1 IPI00018465.1 T-complex protein 1 subunit eta 499 59842 18 18 17 17 1565 2537 1 1 1 473.2719 944.5293 2 944.5291 0.0002 0 58.77 2.00E-05 R TATQLAVNK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2824.2824.2.dta 17 1 IPI00018465.1 T-complex protein 1 subunit eta 499 59842 18 18 17 17 1707 3259 1 1 1 484.7306 967.4466 2 967.4467 0 0 45.99 5.50E-05 K CAMTALSSK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3626.3626.2.dta 17 1 IPI00018465.1 T-complex protein 1 subunit eta 499 59842 18 18 17 17 1927 3459 1 1 1 334.218 999.632 3 999.6328 -0.0008 1 38.03 0.00031 K IKEIAVTVK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3847.3847.3.dta 17 1 IPI00018465.1 T-complex protein 1 subunit eta 499 59842 18 18 17 17 2627 4170 1 1 1 552.2971 1102.5796 2 1102.5805 -0.0009 1 39.81 0.0029 R GMDKLIVDGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4628.4628.2.dta 17 1 IPI00018465.1 T-complex protein 1 subunit eta 499 59842 18 18 17 17 2628 4181 1 1 1 368.5354 1102.5843 3 1102.5805 0.0038 1 21.37 0.012 R GMDKLIVDGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4640.4640.3.dta 17 1 IPI00018465.1 T-complex protein 1 subunit eta 499 59842 18 18 17 17 2633 5300 1 1 1 552.8246 1103.6347 2 1103.6339 0.0009 0 36.78 0.0024 K QQLLIGAYAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5833.5833.2.dta 17 1 IPI00018465.1 T-complex protein 1 subunit eta 499 59842 18 18 17 17 3344 4323 1 1 1 602.3333 1202.6521 2 1202.6506 0.0014 0 67.14 3.90E-06 K ATISNDGATILK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4794.4794.2.dta 17 1 IPI00018465.1 T-complex protein 1 subunit eta 499 59842 18 18 17 17 4735 3666 1 1 1 694.8908 1387.7671 2 1387.7671 0 1 64.08 9.80E-07 R GKATISNDGATILK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4078.4078.2.dta 17 1 IPI00018465.1 T-complex protein 1 subunit eta 499 59842 18 18 17 17 4856 6002 1 1 1 703.3263 1404.638 2 1404.6384 -0.0003 0 63.81 1.40E-06 K TFSYAGFEMQPK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6537.6537.2.dta 17 1 IPI00018465.1 T-complex protein 1 subunit eta 499 59842 18 18 17 17 5738 4597 1 1 1 776.8549 1551.6953 2 1551.6988 -0.0035 0 63.8 4.30E-06 R CQVFEETQIGGER Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5091.5091.2.dta 17 1 IPI00018465.1 T-complex protein 1 subunit eta 499 59842 18 18 17 17 7071 5968 1 1 1 897.4275 1792.8404 2 1792.8414 -0.001 0 104.8 5.90E-10 R QLCDNAGFDATNILNK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6502.6502.2.dta 17 1 IPI00018465.1 T-complex protein 1 subunit eta 499 59842 18 18 17 17 7577 5740 1 1 1 639.6854 1916.0344 3 1916.0367 -0.0023 1 41 0.00067 K VQGGALEDSQLVAGVAFKK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6275.6275.3.dta 17 1 IPI00018465.1 T-complex protein 1 subunit eta 499 59842 18 18 17 17 7834 5147 1 1 1 673.7167 2018.1282 3 2018.1313 -0.0031 0 37.53 0.00064 K QVKPYVEEGLHPQIIIR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5678.5678.3.dta 17 1 IPI00018465.1 T-complex protein 1 subunit eta 499 59842 18 18 17 17 7892 6993 1 1 1 688.3494 2062.0263 3 2062.0266 -0.0003 1 17.39 0.023 R QLCDNAGFDATNILNKLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7528.7528.3.dta 17 IPI00796210.1 28 kDa protein 319 28341 12 12 11 11 535 4217 1 0 1 380.2346 758.4547 2 758.4538 0.0009 0 33.87 0.0096 K TLVDIAK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4679.4679.2.dta 17 IPI00796210.1 28 kDa protein 319 28341 12 12 11 11 648 6713 1 0 1 393.7166 785.4187 2 785.4184 0.0003 1 34.49 0.0038 K KYHNPK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.725.725.2.dta 17 IPI00796210.1 28 kDa protein 319 28341 12 12 11 11 1565 2537 1 0 1 473.2719 944.5293 2 944.5291 0.0002 0 58.77 2.00E-05 R TATQLAVNK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2824.2824.2.dta 17 IPI00796210.1 28 kDa protein 319 28341 12 12 11 11 1707 3259 1 0 1 484.7306 967.4466 2 967.4467 0 0 45.99 5.50E-05 K CAMTALSSK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3626.3626.2.dta 17 IPI00796210.1 28 kDa protein 319 28341 12 12 11 11 1927 3459 1 0 1 334.218 999.632 3 999.6328 -0.0008 1 38.03 0.00031 K IKEIAVTVK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3847.3847.3.dta 17 IPI00796210.1 28 kDa protein 319 28341 12 12 11 11 2627 4170 1 0 1 552.2971 1102.5796 2 1102.5805 -0.0009 1 39.81 0.0029 R GMDKLIVDGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4628.4628.2.dta 17 IPI00796210.1 28 kDa protein 319 28341 12 12 11 11 2628 4181 1 0 1 368.5354 1102.5843 3 1102.5805 0.0038 1 21.37 0.012 R GMDKLIVDGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4640.4640.3.dta 17 IPI00796210.1 28 kDa protein 319 28341 12 12 11 11 3344 4323 1 0 1 602.3333 1202.6521 2 1202.6506 0.0014 0 67.14 3.90E-06 K ATISNDGATILK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4794.4794.2.dta 17 IPI00796210.1 28 kDa protein 319 28341 12 12 11 11 4735 3666 1 0 1 694.8908 1387.7671 2 1387.7671 0 1 64.08 9.80E-07 R GKATISNDGATILK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4078.4078.2.dta 17 IPI00796210.1 28 kDa protein 319 28341 12 12 11 11 4856 6002 1 0 1 703.3263 1404.638 2 1404.6384 -0.0003 0 63.81 1.40E-06 K TFSYAGFEMQPK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6537.6537.2.dta 17 IPI00796210.1 28 kDa protein 319 28341 12 12 11 11 7577 5740 1 0 1 639.6854 1916.0344 3 1916.0367 -0.0023 1 41 0.00067 K VQGGALEDSQLVAGVAFKK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6275.6275.3.dta 17 IPI00796210.1 28 kDa protein 319 28341 12 12 11 11 7834 5147 1 0 1 673.7167 2018.1282 3 2018.1313 -0.0031 0 37.53 0.00064 K QVKPYVEEGLHPQIIIR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5678.5678.3.dta 17 IPI00552072.1 "chaperonin containing TCP1, subunit 7 isoform b" 259 37874 8 8 8 8 648 6713 1 0 1 393.7166 785.4187 2 785.4184 0.0003 1 34.49 0.0038 K KYHNPK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.725.725.2.dta 17 IPI00552072.1 "chaperonin containing TCP1, subunit 7 isoform b" 259 37874 8 8 8 8 778 5173 1 0 1 406.2558 810.4971 2 810.4963 0.0008 0 53.41 2.30E-05 K ALEIIPR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5704.5704.2.dta 17 IPI00552072.1 "chaperonin containing TCP1, subunit 7 isoform b" 259 37874 8 8 8 8 1349 5209 1 0 1 455.7446 909.4746 2 909.4742 0.0004 0 34.06 0.0074 K TCTFILR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5740.5740.2.dta 17 IPI00552072.1 "chaperonin containing TCP1, subunit 7 isoform b" 259 37874 8 8 8 8 2633 5300 1 0 1 552.8246 1103.6347 2 1103.6339 0.0009 0 36.78 0.0024 K QQLLIGAYAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5833.5833.2.dta 17 IPI00552072.1 "chaperonin containing TCP1, subunit 7 isoform b" 259 37874 8 8 8 8 4856 6002 1 0 1 703.3263 1404.638 2 1404.6384 -0.0003 0 63.81 1.40E-06 K TFSYAGFEMQPK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6537.6537.2.dta 17 IPI00552072.1 "chaperonin containing TCP1, subunit 7 isoform b" 259 37874 8 8 8 8 5738 4597 1 0 1 776.8549 1551.6953 2 1551.6988 -0.0035 0 63.8 4.30E-06 R CQVFEETQIGGER Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5091.5091.2.dta 17 IPI00552072.1 "chaperonin containing TCP1, subunit 7 isoform b" 259 37874 8 8 8 8 7071 5968 1 0 1 897.4275 1792.8404 2 1792.8414 -0.001 0 104.8 5.90E-10 R QLCDNAGFDATNILNK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6502.6502.2.dta 17 IPI00552072.1 "chaperonin containing TCP1, subunit 7 isoform b" 259 37874 8 8 8 8 7892 6993 1 0 1 688.3494 2062.0263 3 2062.0266 -0.0003 1 17.39 0.023 R QLCDNAGFDATNILNKLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7528.7528.3.dta 17 IPI00796778.1 16 kDa protein 213 15873 8 8 7 7 535 4217 1 0 1 380.2346 758.4547 2 758.4538 0.0009 0 33.87 0.0096 K TLVDIAK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4679.4679.2.dta 17 IPI00796778.1 16 kDa protein 213 15873 8 8 7 7 1565 2537 1 0 1 473.2719 944.5293 2 944.5291 0.0002 0 58.77 2.00E-05 R TATQLAVNK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2824.2824.2.dta 17 IPI00796778.1 16 kDa protein 213 15873 8 8 7 7 1927 3459 1 0 1 334.218 999.632 3 999.6328 -0.0008 1 38.03 0.00031 K IKEIAVTVK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3847.3847.3.dta 17 IPI00796778.1 16 kDa protein 213 15873 8 8 7 7 2627 4170 1 0 1 552.2971 1102.5796 2 1102.5805 -0.0009 1 39.81 0.0029 R GMDKLIVDGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4628.4628.2.dta 17 IPI00796778.1 16 kDa protein 213 15873 8 8 7 7 2628 4181 1 0 1 368.5354 1102.5843 3 1102.5805 0.0038 1 21.37 0.012 R GMDKLIVDGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4640.4640.3.dta 17 IPI00796778.1 16 kDa protein 213 15873 8 8 7 7 3344 4323 1 0 1 602.3333 1202.6521 2 1202.6506 0.0014 0 67.14 3.90E-06 K ATISNDGATILK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4794.4794.2.dta 17 IPI00796778.1 16 kDa protein 213 15873 8 8 7 7 4735 3666 1 0 1 694.8908 1387.7671 2 1387.7671 0 1 64.08 9.80E-07 R GKATISNDGATILK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4078.4078.2.dta 17 IPI00796778.1 16 kDa protein 213 15873 8 8 7 7 7834 5147 1 0 1 673.7167 2018.1282 3 2018.1313 -0.0031 0 37.53 0.00064 K QVKPYVEEGLHPQIIIR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5678.5678.3.dta 17 IPI00795645.1 19 kDa protein 147 18922 5 5 5 5 648 6713 1 0 1 393.7166 785.4187 2 785.4184 0.0003 1 34.49 0.0038 K KYHNPK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.725.725.2.dta 17 IPI00795645.1 19 kDa protein 147 18922 5 5 5 5 1707 3259 1 0 1 484.7306 967.4466 2 967.4467 0 0 45.99 5.50E-05 K CAMTALSSK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3626.3626.2.dta 17 IPI00795645.1 19 kDa protein 147 18922 5 5 5 5 1927 3459 1 0 1 334.218 999.632 3 999.6328 -0.0008 1 38.03 0.00031 K IKEIAVTVK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3847.3847.3.dta 17 IPI00795645.1 19 kDa protein 147 18922 5 5 5 5 4856 6002 1 0 1 703.3263 1404.638 2 1404.6384 -0.0003 0 63.81 1.40E-06 K TFSYAGFEMQPK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6537.6537.2.dta 17 IPI00795645.1 19 kDa protein 147 18922 5 5 5 5 7577 5740 1 0 1 639.6854 1916.0344 3 1916.0367 -0.0023 1 41 0.00067 K VQGGALEDSQLVAGVAFKK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6275.6275.3.dta 18 1 IPI00027834.3 heterogeneous nuclear ribonucleoprotein L isoform a 493 64720 23 23 19 19 69 4267 1 1 0 310.6922 619.3698 2 619.3693 0.0004 0 34.6 0.0033 R LNVFK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4733.4733.2.dta 18 1 IPI00027834.3 heterogeneous nuclear ribonucleoprotein L isoform a 493 64720 23 23 19 19 157 5148 1 1 1 324.2155 646.4164 2 646.4166 -0.0002 0 23.1 0.019 R IVIFR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5679.5679.2.dta 18 1 IPI00027834.3 heterogeneous nuclear ribonucleoprotein L isoform a 493 64720 23 23 19 19 614 3736 1 1 1 388.2626 774.5107 2 774.5116 -0.0009 1 22.59 0.018 R IVIFRK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4158.4158.2.dta 18 1 IPI00027834.3 heterogeneous nuclear ribonucleoprotein L isoform a 493 64720 23 23 19 19 810 3110 1 1 0 410.2236 818.4326 2 818.432 0.0006 0 39.75 0.00096 K LNVCVSK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3448.3448.2.dta 18 1 IPI00027834.3 heterogeneous nuclear ribonucleoprotein L isoform a 493 64720 23 23 19 19 1338 2135 1 1 1 303.1574 906.4505 3 906.4494 0.0011 0 24.67 0.023 R MGPPVGGHR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2387.2387.3.dta 18 1 IPI00027834.3 heterogeneous nuclear ribonucleoprotein L isoform a 493 64720 23 23 19 19 1396 1060 1 1 1 459.714 917.4135 2 917.4138 -0.0002 0 51.24 6.80E-05 K MAAAGGGGGGGR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1221.1221.2.dta 18 1 IPI00027834.3 heterogeneous nuclear ribonucleoprotein L isoform a 493 64720 23 23 19 19 1417 1385 1 1 1 308.4884 922.4434 3 922.4443 -0.001 0 23.57 0.02 R MGPPVGGHR R Oxidation (M) 0.100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1573.1573.3.dta 18 1 IPI00027834.3 heterogeneous nuclear ribonucleoprotein L isoform a 493 64720 23 23 19 19 1768 2004 1 1 1 489.2744 976.5343 2 976.5341 0.0001 0 46.18 0.0004 K IEYAKPTR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2243.2243.2.dta 18 1 IPI00027834.3 heterogeneous nuclear ribonucleoprotein L isoform a 493 64720 23 23 19 19 1769 1993 1 1 1 326.519 976.5351 3 976.5341 0.001 0 29.82 0.018 K IEYAKPTR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2231.2231.3.dta 18 1 IPI00027834.3 heterogeneous nuclear ribonucleoprotein L isoform a 493 64720 23 23 19 19 1771 2657 1 1 1 489.7474 977.4802 2 977.4818 -0.0016 0 41.71 0.0014 R FSTPEQAAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2954.2954.2.dta 18 1 IPI00027834.3 heterogeneous nuclear ribonucleoprotein L isoform a 493 64720 23 23 19 19 1934 1840 1 1 1 501.7183 1001.422 2 1001.4203 0.0017 0 33.25 0.0014 R YYGGGSEGGR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2065.2065.2.dta 18 1 IPI00027834.3 heterogeneous nuclear ribonucleoprotein L isoform a 493 64720 23 23 19 19 2445 3271 1 1 1 359.5455 1075.6146 3 1075.6138 0.0008 0 59.69 2.50E-06 K TPASPVVHIR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3640.3640.3.dta 18 1 IPI00027834.3 heterogeneous nuclear ribonucleoprotein L isoform a 493 64720 23 23 19 19 2744 3771 1 1 1 561.2547 1120.4948 2 1120.4971 -0.0023 0 48.79 2.70E-05 K LCFSTAQHAS - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4196.4196.2.dta 18 1 IPI00027834.3 heterogeneous nuclear ribonucleoprotein L isoform a 493 64720 23 23 19 19 3348 1444 1 1 1 602.7804 1203.5462 2 1203.548 -0.0018 0 19.29 0.029 K ISRPGDSDDSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1637.1637.2.dta 18 1 IPI00027834.3 heterogeneous nuclear ribonucleoprotein L isoform a 493 64720 23 23 19 19 3452 5763 1 1 1 611.7997 1221.5848 2 1221.5877 -0.0029 0 55.76 4.80E-05 R SSSGLLEWESK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6299.6299.2.dta 18 1 IPI00027834.3 heterogeneous nuclear ribonucleoprotein L isoform a 493 64720 23 23 19 19 3829 4513 1 1 1 632.3209 1262.6273 2 1262.6295 -0.0022 0 27.65 0.014 K NPNGPYPYTLK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5000.5000.2.dta 18 1 IPI00027834.3 heterogeneous nuclear ribonucleoprotein L isoform a 493 64720 23 23 19 19 4055 1760 1 1 1 649.8089 1297.6032 2 1297.6051 -0.0019 1 70.95 2.20E-07 R YYGGGSEGGRAPK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1979.1979.2.dta 18 1 IPI00027834.3 heterogeneous nuclear ribonucleoprotein L isoform a 493 64720 23 23 19 19 4528 2349 1 1 1 681.8409 1361.6673 2 1361.6687 -0.0014 1 49.48 6.00E-05 R NNRFSTPEQAAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2620.2620.2.dta 18 1 IPI00027834.3 heterogeneous nuclear ribonucleoprotein L isoform a 493 64720 23 23 19 19 5938 7730 1 1 1 794.8947 1587.7749 2 1587.7756 -0.0007 0 85.09 7.00E-08 R VFNVFCLYGNVEK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8355.8355.2.dta 18 1 IPI00027834.3 heterogeneous nuclear ribonucleoprotein L isoform a 493 64720 23 23 19 19 7408 5199 1 1 1 623.2935 1866.8585 3 1866.8604 -0.0019 0 45.07 5.90E-05 K SKPGAAMVEMADGYAVDR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5730.5730.3.dta 18 1 IPI00027834.3 heterogeneous nuclear ribonucleoprotein L isoform a 493 64720 23 23 19 19 7449 6681 1 1 1 628.305 1881.8931 3 1881.8931 0.0001 0 23.29 0.0065 K SDALETLGFLNHYQMK N Oxidation (M) 0.0000000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7217.7217.3.dta 18 1 IPI00027834.3 heterogeneous nuclear ribonucleoprotein L isoform a 493 64720 23 23 19 19 7452 4223 1 1 1 628.6232 1882.8479 3 1882.8553 -0.0075 0 25.02 0.0045 K SKPGAAMVEMADGYAVDR A Oxidation (M) 0.000000000100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4685.4685.3.dta 18 1 IPI00027834.3 heterogeneous nuclear ribonucleoprotein L isoform a 493 64720 23 23 19 19 7501 3279 1 1 1 633.9558 1898.8456 3 1898.8502 -0.0046 0 43.37 8.60E-05 K SKPGAAMVEMADGYAVDR A 2 Oxidation (M) 0.000000100100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3650.3650.3.dta 18 2 IPI00103247.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein L-like 75 60900 3 3 3 3 614 3736 2 0 1 388.2626 774.5107 2 774.5116 -0.0009 1 19.63 0.036 R IVIFKR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4158.4158.2.dta 18 2 IPI00103247.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein L-like 75 60900 3 3 3 3 810 3110 1 0 0 410.2236 818.4326 2 818.432 0.0006 0 39.75 0.00096 R LNVCVSK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3448.3448.2.dta 18 2 IPI00103247.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein L-like 75 60900 3 3 3 3 1240 1430 1 0 1 448.7272 895.4399 2 895.4399 -0.0001 0 57.27 2.00E-05 R FTSAGQASK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1622.1622.2.dta 18 IPI00465225.1 heterogeneous nuclear ribonucleoprotein L isoform b 350 51156 19 19 15 15 69 4267 1 0 0 310.6922 619.3698 2 619.3693 0.0004 0 34.6 0.0033 R LNVFK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4733.4733.2.dta 18 IPI00465225.1 heterogeneous nuclear ribonucleoprotein L isoform b 350 51156 19 19 15 15 157 5148 1 0 1 324.2155 646.4164 2 646.4166 -0.0002 0 23.1 0.019 R IVIFR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5679.5679.2.dta 18 IPI00465225.1 heterogeneous nuclear ribonucleoprotein L isoform b 350 51156 19 19 15 15 614 3736 1 0 1 388.2626 774.5107 2 774.5116 -0.0009 1 22.59 0.018 R IVIFRK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4158.4158.2.dta 18 IPI00465225.1 heterogeneous nuclear ribonucleoprotein L isoform b 350 51156 19 19 15 15 810 3110 1 0 0 410.2236 818.4326 2 818.432 0.0006 0 39.75 0.00096 K LNVCVSK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3448.3448.2.dta 18 IPI00465225.1 heterogeneous nuclear ribonucleoprotein L isoform b 350 51156 19 19 15 15 1338 2135 1 0 1 303.1574 906.4505 3 906.4494 0.0011 0 24.67 0.023 R MGPPVGGHR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2387.2387.3.dta 18 IPI00465225.1 heterogeneous nuclear ribonucleoprotein L isoform b 350 51156 19 19 15 15 1417 1385 1 0 1 308.4884 922.4434 3 922.4443 -0.001 0 23.57 0.02 R MGPPVGGHR R Oxidation (M) 0.100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1573.1573.3.dta 18 IPI00465225.1 heterogeneous nuclear ribonucleoprotein L isoform b 350 51156 19 19 15 15 1768 2004 1 0 1 489.2744 976.5343 2 976.5341 0.0001 0 46.18 0.0004 K IEYAKPTR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2243.2243.2.dta 18 IPI00465225.1 heterogeneous nuclear ribonucleoprotein L isoform b 350 51156 19 19 15 15 1769 1993 1 0 1 326.519 976.5351 3 976.5341 0.001 0 29.82 0.018 K IEYAKPTR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2231.2231.3.dta 18 IPI00465225.1 heterogeneous nuclear ribonucleoprotein L isoform b 350 51156 19 19 15 15 1771 2657 1 0 1 489.7474 977.4802 2 977.4818 -0.0016 0 41.71 0.0014 R FSTPEQAAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2954.2954.2.dta 18 IPI00465225.1 heterogeneous nuclear ribonucleoprotein L isoform b 350 51156 19 19 15 15 2744 3771 1 0 1 561.2547 1120.4948 2 1120.4971 -0.0023 0 48.79 2.70E-05 K LCFSTAQHAS - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4196.4196.2.dta 18 IPI00465225.1 heterogeneous nuclear ribonucleoprotein L isoform b 350 51156 19 19 15 15 3348 1444 1 0 1 602.7804 1203.5462 2 1203.548 -0.0018 0 19.29 0.029 K ISRPGDSDDSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1637.1637.2.dta 18 IPI00465225.1 heterogeneous nuclear ribonucleoprotein L isoform b 350 51156 19 19 15 15 3452 5763 1 0 1 611.7997 1221.5848 2 1221.5877 -0.0029 0 55.76 4.80E-05 R SSSGLLEWESK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6299.6299.2.dta 18 IPI00465225.1 heterogeneous nuclear ribonucleoprotein L isoform b 350 51156 19 19 15 15 3829 4513 1 0 1 632.3209 1262.6273 2 1262.6295 -0.0022 0 27.65 0.014 K NPNGPYPYTLK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5000.5000.2.dta 18 IPI00465225.1 heterogeneous nuclear ribonucleoprotein L isoform b 350 51156 19 19 15 15 4528 2349 1 0 1 681.8409 1361.6673 2 1361.6687 -0.0014 1 49.48 6.00E-05 R NNRFSTPEQAAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2620.2620.2.dta 18 IPI00465225.1 heterogeneous nuclear ribonucleoprotein L isoform b 350 51156 19 19 15 15 5938 7730 1 0 1 794.8947 1587.7749 2 1587.7756 -0.0007 0 85.09 7.00E-08 R VFNVFCLYGNVEK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8355.8355.2.dta 18 IPI00465225.1 heterogeneous nuclear ribonucleoprotein L isoform b 350 51156 19 19 15 15 7408 5199 1 0 1 623.2935 1866.8585 3 1866.8604 -0.0019 0 45.07 5.90E-05 K SKPGAAMVEMADGYAVDR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5730.5730.3.dta 18 IPI00465225.1 heterogeneous nuclear ribonucleoprotein L isoform b 350 51156 19 19 15 15 7449 6681 1 0 1 628.305 1881.8931 3 1881.8931 0.0001 0 23.29 0.0065 K SDALETLGFLNHYQMK N Oxidation (M) 0.0000000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7217.7217.3.dta 18 IPI00465225.1 heterogeneous nuclear ribonucleoprotein L isoform b 350 51156 19 19 15 15 7452 4223 1 0 1 628.6232 1882.8479 3 1882.8553 -0.0075 0 25.02 0.0045 K SKPGAAMVEMADGYAVDR A Oxidation (M) 0.000000000100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4685.4685.3.dta 18 IPI00465225.1 heterogeneous nuclear ribonucleoprotein L isoform b 350 51156 19 19 15 15 7501 3279 1 0 1 633.9558 1898.8456 3 1898.8502 -0.0046 0 43.37 8.60E-05 K SKPGAAMVEMADGYAVDR A 2 Oxidation (M) 0.000000100100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3650.3650.3.dta 18 IPI00647473.1 19 kDa protein 191 19045 8 8 6 6 810 3110 1 0 0 410.2236 818.4326 2 818.432 0.0006 0 39.75 0.00096 K LNVCVSK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3448.3448.2.dta 18 IPI00647473.1 19 kDa protein 191 19045 8 8 6 6 1771 2657 1 0 1 489.7474 977.4802 2 977.4818 -0.0016 0 41.71 0.0014 R FSTPEQAAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2954.2954.2.dta 18 IPI00647473.1 19 kDa protein 191 19045 8 8 6 6 3452 5763 1 0 1 611.7997 1221.5848 2 1221.5877 -0.0029 0 55.76 4.80E-05 R SSSGLLEWESK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6299.6299.2.dta 18 IPI00647473.1 19 kDa protein 191 19045 8 8 6 6 4528 2349 1 0 1 681.8409 1361.6673 2 1361.6687 -0.0014 1 49.48 6.00E-05 R NNRFSTPEQAAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2620.2620.2.dta 18 IPI00647473.1 19 kDa protein 191 19045 8 8 6 6 7408 5199 1 0 1 623.2935 1866.8585 3 1866.8604 -0.0019 0 45.07 5.90E-05 K SKPGAAMVEMADGYAVDR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5730.5730.3.dta 18 IPI00647473.1 19 kDa protein 191 19045 8 8 6 6 7449 6681 1 0 1 628.305 1881.8931 3 1881.8931 0.0001 0 23.29 0.0065 K SDALETLGFLNHYQMK N Oxidation (M) 0.0000000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7217.7217.3.dta 18 IPI00647473.1 19 kDa protein 191 19045 8 8 6 6 7452 4223 1 0 1 628.6232 1882.8479 3 1882.8553 -0.0075 0 25.02 0.0045 K SKPGAAMVEMADGYAVDR A Oxidation (M) 0.000000000100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4685.4685.3.dta 18 IPI00647473.1 19 kDa protein 191 19045 8 8 6 6 7501 3279 1 0 1 633.9558 1898.8456 3 1898.8502 -0.0046 0 43.37 8.60E-05 K SKPGAAMVEMADGYAVDR A 2 Oxidation (M) 0.000000100100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3650.3650.3.dta 19 1 IPI00179452.1 Isoform 1 of Protein CBFA2T2 483 67889 15 15 13 13 261 1316 1 1 1 343.1767 684.3388 2 684.3377 0.0011 0 20.82 0.042 K MLEHR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1499.1499.2.dta 19 1 IPI00179452.1 Isoform 1 of Protein CBFA2T2 483 67889 15 15 13 13 1063 2627 1 1 1 431.7347 861.4549 2 861.4556 -0.0007 0 66.54 5.30E-06 K TGTELVSR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2921.2921.2.dta 19 1 IPI00179452.1 Isoform 1 of Protein CBFA2T2 483 67889 15 15 13 13 1253 2386 1 1 1 449.7321 897.4496 2 897.4491 0.0006 0 27.22 0.022 R ELLHCAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2660.2660.2.dta 19 1 IPI00179452.1 Isoform 1 of Protein CBFA2T2 483 67889 15 15 13 13 1922 2782 1 1 1 500.7655 999.5165 2 999.5172 -0.0007 0 44.43 0.00069 R VCTISPAPR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3090.3090.2.dta 19 1 IPI00179452.1 Isoform 1 of Protein CBFA2T2 483 67889 15 15 13 13 2133 2978 1 1 1 517.2701 1032.5256 2 1032.5274 -0.0018 0 44.88 0.00082 K IQAMSEVQK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3306.3306.2.dta 19 1 IPI00179452.1 Isoform 1 of Protein CBFA2T2 483 67889 15 15 13 13 2144 4789 1 1 1 518.2775 1034.5404 2 1034.5396 0.0007 0 76.55 1.30E-07 K AFEVIATER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5299.5299.2.dta 19 1 IPI00179452.1 Isoform 1 of Protein CBFA2T2 483 67889 15 15 13 13 3050 1966 1 1 1 583.7931 1165.5716 2 1165.5727 -0.0011 1 51.84 0.00012 R YNENTELRK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2202.2202.2.dta 19 1 IPI00179452.1 Isoform 1 of Protein CBFA2T2 483 67889 15 15 13 13 3201 2809 1 1 1 595.8127 1189.6108 2 1189.6125 -0.0017 1 76.36 6.40E-07 R MEQTIADVKR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3119.3119.2.dta 19 1 IPI00179452.1 Isoform 1 of Protein CBFA2T2 483 67889 15 15 13 13 3202 2802 1 1 1 397.5451 1189.6134 3 1189.6125 0.0009 1 27.12 0.012 R MEQTIADVKR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3112.3112.3.dta 19 1 IPI00179452.1 Isoform 1 of Protein CBFA2T2 483 67889 15 15 13 13 4286 2073 1 1 1 663.2823 1324.5501 2 1324.55 0.0002 0 65.18 1.20E-06 K ASETCSGCNIAR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2319.2319.2.dta 19 1 IPI00179452.1 Isoform 1 of Protein CBFA2T2 483 67889 15 15 13 13 5194 1673 1 1 1 485.222 1452.6443 3 1452.6449 -0.0006 1 60.26 9.50E-06 R KASETCSGCNIAR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1884.1884.3.dta 19 1 IPI00179452.1 Isoform 1 of Protein CBFA2T2 483 67889 15 15 13 13 6546 1936 1 1 1 843.3782 1684.7419 2 1684.7401 0.0018 0 55.02 6.90E-06 R QHSPGSADSLSNDSQR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2169.2169.2.dta 19 1 IPI00179452.1 Isoform 1 of Protein CBFA2T2 483 67889 15 15 13 13 7352 5964 1 1 1 931.4839 1860.9532 2 1860.9581 -0.0049 1 87.34 6.50E-09 K AVAEAEQKAFEVIATER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6499.6499.2.dta 19 1 IPI00179452.1 Isoform 1 of Protein CBFA2T2 483 67889 15 15 13 13 7353 5972 1 1 1 621.3276 1860.9611 3 1860.9581 0.003 1 55.96 5.70E-06 K AVAEAEQKAFEVIATER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6507.6507.3.dta 19 1 IPI00179452.1 Isoform 1 of Protein CBFA2T2 483 67889 15 15 13 13 7548 3939 1 1 1 639.304 1914.89 3 1914.8959 -0.0059 1 20.67 0.012 R EENSFDRDTIAPEPPAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4378.4378.3.dta 19 IPI00021473.1 MTG16 27 59566 1 1 1 1 1253 2386 1 0 1 449.7321 897.4496 2 897.4491 0.0006 0 27.22 0.022 R ELLHCAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2660.2660.2.dta 20 1 IPI00334775.6 85 kDa protein 479 85104 17 17 15 15 429 4346 1 1 0 365.7269 729.4392 2 729.4385 0.0008 0 41.82 0.0017 R LSELLR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4819.4819.2.dta 20 1 IPI00334775.6 85 kDa protein 479 85104 17 17 15 15 861 6623 1 1 1 415.2683 828.5221 2 828.5221 -0.0001 0 40.51 0.00068 R ALLFIPR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7158.7158.2.dta 20 1 IPI00334775.6 85 kDa protein 479 85104 17 17 15 15 1216 4500 1 1 1 446.2159 890.4173 2 890.4174 -0.0001 0 39.78 0.00042 K FYEAFSK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4986.4986.2.dta 20 1 IPI00334775.6 85 kDa protein 479 85104 17 17 15 15 1599 1634 1 1 1 476.2356 950.4567 2 950.457 -0.0003 0 32.51 0.0094 R ADHGEPIGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1842.1842.2.dta 20 1 IPI00334775.6 85 kDa protein 479 85104 17 17 15 15 1600 1636 1 1 1 317.8267 950.4582 3 950.457 0.0012 0 38.22 0.0026 R ADHGEPIGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1844.1844.3.dta 20 1 IPI00334775.6 85 kDa protein 479 85104 17 17 15 15 2893 2282 1 1 1 571.2832 1140.5519 2 1140.5523 -0.0005 0 32.64 0.0014 K LGIHEDSTNR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2547.2547.2.dta 20 1 IPI00334775.6 85 kDa protein 479 85104 17 17 15 15 2894 2277 1 1 1 381.1924 1140.5552 3 1140.5523 0.0029 0 40.6 0.0016 K LGIHEDSTNR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2542.2542.3.dta 20 1 IPI00334775.6 85 kDa protein 479 85104 17 17 15 15 2963 3284 1 1 0 576.2823 1150.5501 2 1150.5506 -0.0004 0 55.17 5.50E-05 K YIDQEELNK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3656.3656.2.dta 20 1 IPI00334775.6 85 kDa protein 479 85104 17 17 15 15 3021 4670 1 1 1 580.7953 1159.5761 2 1159.5761 0.0001 0 42.82 0.00037 K SIYYITGESK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5170.5170.2.dta 20 1 IPI00334775.6 85 kDa protein 479 85104 17 17 15 15 3610 6178 1 1 1 618.8215 1235.6285 2 1235.6299 -0.0013 1 28.81 0.028 R RAPFDLFENK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6713.6713.2.dta 20 1 IPI00334775.6 85 kDa protein 479 85104 17 17 15 15 3689 3733 1 1 1 625.3109 1248.6072 2 1248.6098 -0.0027 0 35.62 0.0013 K EQVANSAFVER V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4155.4155.2.dta 20 1 IPI00334775.6 85 kDa protein 479 85104 17 17 15 15 4557 5539 1 1 1 683.3675 1364.7204 2 1364.7221 -0.0017 0 102.52 9.80E-10 R TLTLVDTGIGMTK A Oxidation (M) 0.0000000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6074.6074.2.dta 20 1 IPI00334775.6 85 kDa protein 479 85104 17 17 15 15 5494 5959 1 1 0 757.3951 1512.7757 2 1512.7784 -0.0026 0 84.8 4.20E-08 R GVVDSEDLPLNISR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6494.6494.2.dta 20 1 IPI00334775.6 85 kDa protein 479 85104 17 17 15 15 7284 5505 1 1 1 924.4002 1846.7859 2 1846.7897 -0.0039 0 74.12 1.90E-07 R NPDDITQEEYGEFYK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6041.6041.2.dta 20 1 IPI00334775.6 85 kDa protein 479 85104 17 17 15 15 7816 4669 1 1 0 672.3517 2014.0332 3 2014.0371 -0.0039 1 47.9 3.60E-05 K VILHLKEDQTEYLEER R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5169.5169.3.dta 20 1 IPI00334775.6 85 kDa protein 479 85104 17 17 15 15 8005 5338 1 1 1 726.3197 2175.9373 3 2175.9379 -0.0006 0 50.88 3.90E-05 R YHTSQSGDEMTSLSEYVSR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5872.5872.3.dta 20 1 IPI00334775.6 85 kDa protein 479 85104 17 17 15 15 8546 5358 1 1 1 797.7307 2390.1703 3 2390.1754 -0.0051 1 38.47 0.00061 K SIYYITGESKEQVANSAFVER V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5891.5891.3.dta 20 2 IPI00382470.3 Heat shock protein HSP 90-alpha 2 283 98670 7 7 7 7 429 4346 1 0 0 365.7269 729.4392 2 729.4385 0.0008 0 41.82 0.0017 K LSELLR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4819.4819.2.dta 20 2 IPI00382470.3 Heat shock protein HSP 90-alpha 2 283 98670 7 7 7 7 2963 3284 1 0 0 576.2823 1150.5501 2 1150.5506 -0.0004 0 55.17 5.50E-05 K YIDQEELNK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3656.3656.2.dta 20 2 IPI00382470.3 Heat shock protein HSP 90-alpha 2 283 98670 7 7 7 7 3063 2180 1 0 1 390.1947 1167.5622 3 1167.5632 -0.001 0 31.69 0.0042 K LGIHEDSQNR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2437.2437.3.dta 20 2 IPI00382470.3 Heat shock protein HSP 90-alpha 2 283 98670 7 7 7 7 4557 5539 1 0 1 683.3675 1364.7204 2 1364.7221 -0.0017 0 102.52 9.80E-10 R TLTIVDTGIGMTK A Oxidation (M) 0.0000000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6074.6074.2.dta 20 2 IPI00382470.3 Heat shock protein HSP 90-alpha 2 283 98670 7 7 7 7 5494 5959 1 0 0 757.3951 1512.7757 2 1512.7784 -0.0026 0 84.8 4.20E-08 R GVVDSEDLPLNISR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6494.6494.2.dta 20 2 IPI00382470.3 Heat shock protein HSP 90-alpha 2 283 98670 7 7 7 7 7203 5432 1 0 1 917.3933 1832.7721 2 1832.7741 -0.002 0 49.76 2.60E-05 R NPDDITNEEYGEFYK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5967.5967.2.dta 20 2 IPI00382470.3 Heat shock protein HSP 90-alpha 2 283 98670 7 7 7 7 7816 4669 1 0 0 672.3517 2014.0332 3 2014.0371 -0.0039 1 47.9 3.60E-05 K VILHLKEDQTEYLEER R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5169.5169.3.dta 20 3 IPI00030275.5 "Heat shock protein 75 kDa, mitochondrial precursor" 198 80345 4 4 4 4 3090 5782 1 0 1 586.3374 1170.6603 2 1170.6608 -0.0005 0 54.51 5.30E-05 R ELLQESALIR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6317.6317.2.dta 20 3 IPI00030275.5 "Heat shock protein 75 kDa, mitochondrial precursor" 198 80345 4 4 4 4 4282 7659 1 0 1 662.8048 1323.5951 2 1323.5958 -0.0007 0 49.28 5.10E-05 K FFEDYGLFMR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8275.8275.2.dta 20 3 IPI00030275.5 "Heat shock protein 75 kDa, mitochondrial precursor" 198 80345 4 4 4 4 5494 5959 1 0 1 757.3951 1512.7757 2 1512.7784 -0.0026 0 84.8 4.20E-08 R GVVDSEDIPLNLSR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6494.6494.2.dta 20 3 IPI00030275.5 "Heat shock protein 75 kDa, mitochondrial precursor" 198 80345 4 4 4 4 5944 5984 1 0 1 796.898 1591.7815 2 1591.7842 -0.0027 0 72.43 1.60E-07 K AFLDALQNQAEASSK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6518.6518.2.dta 20 IPI00515119.3 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 240 19120 9 9 8 8 429 4346 1 0 0 365.7269 729.4392 2 729.4385 0.0008 0 41.82 0.0017 R LSELLR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4819.4819.2.dta 20 IPI00515119.3 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 240 19120 9 9 8 8 1216 4500 1 0 1 446.2159 890.4173 2 890.4174 -0.0001 0 39.78 0.00042 K FYEAFSK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4986.4986.2.dta 20 IPI00515119.3 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 240 19120 9 9 8 8 2893 2282 1 0 1 571.2832 1140.5519 2 1140.5523 -0.0005 0 32.64 0.0014 K LGIHEDSTNR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2547.2547.2.dta 20 IPI00515119.3 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 240 19120 9 9 8 8 2894 2277 1 0 1 381.1924 1140.5552 3 1140.5523 0.0029 0 40.6 0.0016 K LGIHEDSTNR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2542.2542.3.dta 20 IPI00515119.3 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 240 19120 9 9 8 8 3021 4670 1 0 1 580.7953 1159.5761 2 1159.5761 0.0001 0 42.82 0.00037 K SIYYITGESK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5170.5170.2.dta 20 IPI00515119.3 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 240 19120 9 9 8 8 3689 3733 1 0 1 625.3109 1248.6072 2 1248.6098 -0.0027 0 35.62 0.0013 K EQVANSAFVER C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4155.4155.2.dta 20 IPI00515119.3 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 240 19120 9 9 8 8 5494 5959 1 0 0 757.3951 1512.7757 2 1512.7784 -0.0026 0 84.8 4.20E-08 R GVVDSEDLPLNISR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6494.6494.2.dta 20 IPI00515119.3 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 240 19120 9 9 8 8 8005 5338 1 0 1 726.3197 2175.9373 3 2175.9379 -0.0006 0 50.88 3.90E-05 R YHTSQSGDEMTSLSEYVSR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5872.5872.3.dta 20 IPI00515119.3 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 240 19120 9 9 8 8 8546 5358 1 0 1 797.7307 2390.1703 3 2390.1754 -0.0051 1 38.47 0.00061 K SIYYITGESKEQVANSAFVER C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5891.5891.3.dta 20 IPI00640129.2 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 205 18245 7 7 6 6 429 4346 1 0 0 365.7269 729.4392 2 729.4385 0.0008 0 41.82 0.0017 R LSELLR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4819.4819.2.dta 20 IPI00640129.2 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 205 18245 7 7 6 6 1216 4500 1 0 1 446.2159 890.4173 2 890.4174 -0.0001 0 39.78 0.00042 K FYEAFSK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4986.4986.2.dta 20 IPI00640129.2 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 205 18245 7 7 6 6 2893 2282 1 0 1 571.2832 1140.5519 2 1140.5523 -0.0005 0 32.64 0.0014 K LGIHEDSTNR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2547.2547.2.dta 20 IPI00640129.2 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 205 18245 7 7 6 6 2894 2277 1 0 1 381.1924 1140.5552 3 1140.5523 0.0029 0 40.6 0.0016 K LGIHEDSTNR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2542.2542.3.dta 20 IPI00640129.2 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 205 18245 7 7 6 6 3021 4670 1 0 1 580.7953 1159.5761 2 1159.5761 0.0001 0 42.82 0.00037 K SIYYITGESK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5170.5170.2.dta 20 IPI00640129.2 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 205 18245 7 7 6 6 5494 5959 1 0 0 757.3951 1512.7757 2 1512.7784 -0.0026 0 84.8 4.20E-08 R GVVDSEDLPLNISR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6494.6494.2.dta 20 IPI00640129.2 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 205 18245 7 7 6 6 8005 5338 1 0 1 726.3197 2175.9373 3 2175.9379 -0.0006 0 50.88 3.90E-05 R YHTSQSGDEMTSLSEYVSR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5872.5872.3.dta 20 IPI00796844.1 Full-length cDNA clone CS0CAP007YF18 of Thymus of Homo sapiens 204 49669 6 6 6 6 429 4346 1 0 0 365.7269 729.4392 2 729.4385 0.0008 0 41.82 0.0017 K LSELLR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4819.4819.2.dta 20 IPI00796844.1 Full-length cDNA clone CS0CAP007YF18 of Thymus of Homo sapiens 204 49669 6 6 6 6 2963 3284 1 0 0 576.2823 1150.5501 2 1150.5506 -0.0004 0 55.17 5.50E-05 K YIDQEELNK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3656.3656.2.dta 20 IPI00796844.1 Full-length cDNA clone CS0CAP007YF18 of Thymus of Homo sapiens 204 49669 6 6 6 6 3063 2180 1 0 1 390.1947 1167.5622 3 1167.5632 -0.001 0 31.69 0.0042 K LGIHEDSQNR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2437.2437.3.dta 20 IPI00796844.1 Full-length cDNA clone CS0CAP007YF18 of Thymus of Homo sapiens 204 49669 6 6 6 6 5494 5959 1 0 0 757.3951 1512.7757 2 1512.7784 -0.0026 0 84.8 4.20E-08 R GVVDSEDLPLNISR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6494.6494.2.dta 20 IPI00796844.1 Full-length cDNA clone CS0CAP007YF18 of Thymus of Homo sapiens 204 49669 6 6 6 6 7203 5432 1 0 1 917.3933 1832.7721 2 1832.7741 -0.002 0 49.76 2.60E-05 R NPDDITNEEYGEFYK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5967.5967.2.dta 20 IPI00796844.1 Full-length cDNA clone CS0CAP007YF18 of Thymus of Homo sapiens 204 49669 6 6 6 6 7816 4669 1 0 0 672.3517 2014.0332 3 2014.0371 -0.0039 1 47.9 3.60E-05 K VILHLKEDQTEYLEER R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5169.5169.3.dta 20 IPI00514659.2 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 183 20112 6 6 5 5 429 4346 1 0 0 365.7269 729.4392 2 729.4385 0.0008 0 41.82 0.0017 R LSELLR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4819.4819.2.dta 20 IPI00514659.2 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 183 20112 6 6 5 5 1216 4500 1 0 1 446.2159 890.4173 2 890.4174 -0.0001 0 39.78 0.00042 K FYEAFSK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4986.4986.2.dta 20 IPI00514659.2 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 183 20112 6 6 5 5 2893 2282 1 0 1 571.2832 1140.5519 2 1140.5523 -0.0005 0 32.64 0.0014 K LGIHEDSTNR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2547.2547.2.dta 20 IPI00514659.2 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 183 20112 6 6 5 5 2894 2277 1 0 1 381.1924 1140.5552 3 1140.5523 0.0029 0 40.6 0.0016 K LGIHEDSTNR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2542.2542.3.dta 20 IPI00514659.2 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 183 20112 6 6 5 5 5494 5959 1 0 0 757.3951 1512.7757 2 1512.7784 -0.0026 0 84.8 4.20E-08 R GVVDSEDLPLNISR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6494.6494.2.dta 20 IPI00514659.2 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 183 20112 6 6 5 5 8005 5338 1 0 1 726.3197 2175.9373 3 2175.9379 -0.0006 0 50.88 3.90E-05 R YHTSQSGDEMTSLSEYVSR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5872.5872.3.dta 20 IPI00604607.2 Hsp89-alpha-delta-N 174 63839 5 5 5 5 429 4346 1 0 0 365.7269 729.4392 2 729.4385 0.0008 0 41.82 0.0017 K LSELLR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4819.4819.2.dta 20 IPI00604607.2 Hsp89-alpha-delta-N 174 63839 5 5 5 5 2963 3284 1 0 0 576.2823 1150.5501 2 1150.5506 -0.0004 0 55.17 5.50E-05 K YIDQEELNK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3656.3656.2.dta 20 IPI00604607.2 Hsp89-alpha-delta-N 174 63839 5 5 5 5 3063 2180 1 0 1 390.1947 1167.5622 3 1167.5632 -0.001 0 31.69 0.0042 K LGIHEDSQNR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2437.2437.3.dta 20 IPI00604607.2 Hsp89-alpha-delta-N 174 63839 5 5 5 5 5494 5959 1 0 0 757.3951 1512.7757 2 1512.7784 -0.0026 0 84.8 4.20E-08 R GVVDSEDLPLNISR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6494.6494.2.dta 20 IPI00604607.2 Hsp89-alpha-delta-N 174 63839 5 5 5 5 7203 5432 1 0 1 917.3933 1832.7721 2 1832.7741 -0.002 0 49.76 2.60E-05 R NPDDITNEEYGEFYK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5967.5967.2.dta 20 IPI00646055.1 57 kDa protein 144 57412 3 3 3 3 3090 5782 1 0 1 586.3374 1170.6603 2 1170.6608 -0.0005 0 54.51 5.30E-05 R ELLQESALIR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6317.6317.2.dta 20 IPI00646055.1 57 kDa protein 144 57412 3 3 3 3 4282 7659 1 0 1 662.8048 1323.5951 2 1323.5958 -0.0007 0 49.28 5.10E-05 K FFEDYGLFMR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8275.8275.2.dta 20 IPI00646055.1 57 kDa protein 144 57412 3 3 3 3 5494 5959 1 0 1 757.3951 1512.7757 2 1512.7784 -0.0026 0 84.8 4.20E-08 R GVVDSEDIPLNLSR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6494.6494.2.dta 20 IPI00796258.1 12 kDa protein 111 11880 3 3 3 3 429 4346 1 0 0 365.7269 729.4392 2 729.4385 0.0008 0 41.82 0.0017 K LSELLR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4819.4819.2.dta 20 IPI00796258.1 12 kDa protein 111 11880 3 3 3 3 3063 2180 1 0 1 390.1947 1167.5622 3 1167.5632 -0.001 0 31.69 0.0042 K LGIHEDSQNR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2437.2437.3.dta 20 IPI00796258.1 12 kDa protein 111 11880 3 3 3 3 5494 5959 1 0 0 757.3951 1512.7757 2 1512.7784 -0.0026 0 84.8 4.20E-08 R GVVDSEDLPLNISR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6494.6494.2.dta 20 IPI00411633.3 Heat shock protein beta 103 17005 1 1 1 1 4557 5539 1 0 1 683.3675 1364.7204 2 1364.7221 -0.0017 0 102.52 9.80E-10 R TLTLVDTGIGMTK A Oxidation (M) 0.0000000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6074.6074.2.dta 20 IPI00455599.3 Heat shock protein 90Bb 75 49505 2 2 2 2 2963 3284 1 0 0 576.2823 1150.5501 2 1150.5506 -0.0004 0 55.17 5.50E-05 K YIDQEELNK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3656.3656.2.dta 20 IPI00455599.3 Heat shock protein 90Bb 75 49505 2 2 2 2 3021 4670 1 0 1 580.7953 1159.5761 2 1159.5761 0.0001 0 42.82 0.00037 K SIYYITGESK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5170.5170.2.dta 20 IPI00514027.1 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 75 19123 3 3 2 2 1599 1634 1 0 1 476.2356 950.4567 2 950.457 -0.0003 0 32.51 0.0094 R ADHGEPIGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1842.1842.2.dta 20 IPI00514027.1 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 75 19123 3 3 2 2 1600 1636 1 0 1 317.8267 950.4582 3 950.457 0.0012 0 38.22 0.0026 R ADHGEPIGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1844.1844.3.dta 20 IPI00514027.1 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 75 19123 3 3 2 2 7816 4669 1 0 0 672.3517 2014.0332 3 2014.0371 -0.0039 1 47.9 3.60E-05 K VILHLKEDQTEYLEER R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5169.5169.3.dta 20 IPI00555614.1 Heat shock protein 90Bc 72 68624 3 3 3 3 3610 6178 1 0 1 618.8215 1235.6285 2 1235.6299 -0.0013 1 28.81 0.028 R RAPFDLFENK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6713.6713.2.dta 20 IPI00555614.1 Heat shock protein 90Bc 72 68624 3 3 3 3 3689 3733 1 0 1 625.3109 1248.6072 2 1248.6098 -0.0027 0 35.62 0.0013 K EQVANSAFVER V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4155.4155.2.dta 20 IPI00555614.1 Heat shock protein 90Bc 72 68624 3 3 3 3 7816 4669 1 0 0 672.3517 2014.0332 3 2014.0371 -0.0039 1 47.9 3.60E-05 K VILHLKEDQTEYLEER R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5169.5169.3.dta 20 IPI00031523.3 Heat shock protein 90 kDa alpha class A member 2 (Fragment) 55 35709 1 1 1 1 2963 3284 1 0 0 576.2823 1150.5501 2 1150.5506 -0.0004 0 55.17 5.50E-05 K YIDQEELNK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3656.3656.2.dta 20 IPI00555565.1 Heat shock protein 90Bd 48 58855 1 1 1 1 7816 4669 1 0 0 672.3517 2014.0332 3 2014.0371 -0.0039 1 47.9 3.60E-05 K VILHLKEDQTEYLEER W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5169.5169.3.dta 20 IPI00555915.1 Heat shock protein 90Bf 40 41833 1 1 1 1 1216 4500 1 0 1 446.2159 890.4173 2 890.4174 -0.0001 0 39.78 0.00042 K FYEAFSK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4986.4986.2.dta 20 IPI00742783.1 Similar to Heat shock protein HSP 90-beta 29 22067 1 1 1 1 3610 6178 1 0 1 618.8215 1235.6285 2 1235.6299 -0.0013 1 28.81 0.028 R RAPFDLFENK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6713.6713.2.dta 21 1 IPI00290566.1 T-complex protein 1 subunit alpha 439 60819 16 16 15 15 380 4161 1 1 1 358.7133 715.412 2 715.4116 0.0004 0 27.65 0.039 R IDDLIK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4618.4618.2.dta 21 1 IPI00290566.1 T-complex protein 1 subunit alpha 439 60819 16 16 15 15 1052 4436 1 1 1 430.7634 859.5122 2 859.5127 -0.0005 0 59.21 1.20E-05 R TSASIILR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4916.4916.2.dta 21 1 IPI00290566.1 T-complex protein 1 subunit alpha 439 60819 16 16 15 15 1737 4335 1 1 1 486.7722 971.5298 2 971.5288 0.001 0 47.76 0.00026 K SSLGPVGLDK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4807.4807.2.dta 21 1 IPI00290566.1 T-complex protein 1 subunit alpha 439 60819 16 16 15 15 2203 2099 1 1 1 522.7872 1043.5599 2 1043.5611 -0.0012 1 47.21 0.00033 K NADELVKQK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2347.2347.2.dta 21 1 IPI00290566.1 T-complex protein 1 subunit alpha 439 60819 16 16 15 15 2643 3079 1 1 1 369.5454 1105.6143 3 1105.6131 0.0012 0 22.97 0.007 K LLEVEHPAAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3414.3414.3.dta 21 1 IPI00290566.1 T-complex protein 1 subunit alpha 439 60819 16 16 15 15 2940 5298 1 1 1 573.8298 1145.6451 2 1145.6444 0.0007 0 32.47 0.0057 R YPVNSVNILK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5831.5831.2.dta 21 1 IPI00290566.1 T-complex protein 1 subunit alpha 439 60819 16 16 15 15 2943 6094 1 1 1 574.3076 1146.6006 2 1146.6033 -0.0027 0 57.7 2.40E-05 R EQLAIAEFAR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6629.6629.2.dta 21 1 IPI00290566.1 T-complex protein 1 subunit alpha 439 60819 16 16 15 15 3228 6077 1 1 1 597.8127 1193.6109 2 1193.6114 -0.0005 0 69.34 8.00E-07 K IACLDFSLQK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6612.6612.2.dta 21 1 IPI00290566.1 T-complex protein 1 subunit alpha 439 60819 16 16 15 15 3494 3875 1 1 1 615.3348 1228.6551 2 1228.6564 -0.0013 0 34.35 0.0006 K IHPTSVISGYR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4308.4308.2.dta 21 1 IPI00290566.1 T-complex protein 1 subunit alpha 439 60819 16 16 15 15 3513 6499 1 1 1 616.3338 1230.6531 2 1230.653 0.0001 0 54.24 7.80E-05 R ICDDELILIK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7030.7030.2.dta 21 1 IPI00290566.1 T-complex protein 1 subunit alpha 439 60819 16 16 15 15 4895 2416 1 1 1 706.338 1410.6614 2 1410.664 -0.0026 0 15.62 0.034 R AFHNEAQVNPER K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2692.2692.2.dta 21 1 IPI00290566.1 T-complex protein 1 subunit alpha 439 60819 16 16 15 15 5389 3361 1 1 1 495.9437 1484.8092 3 1484.81 -0.0008 1 31.04 0.0018 K QKIHPTSVISGYR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3741.3741.3.dta 21 1 IPI00290566.1 T-complex protein 1 subunit alpha 439 60819 16 16 15 15 5507 6404 1 1 1 758.9108 1515.807 2 1515.8079 -0.0009 0 95.32 1.80E-09 R SQNVMAAASIANIVK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6937.6937.2.dta 21 1 IPI00290566.1 T-complex protein 1 subunit alpha 439 60819 16 16 15 15 5614 5577 1 1 1 766.9076 1531.8006 2 1531.8028 -0.0022 0 81.28 2.40E-08 R SQNVMAAASIANIVK S Oxidation (M) 0.000010000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6112.6112.2.dta 21 1 IPI00290566.1 T-complex protein 1 subunit alpha 439 60819 16 16 15 15 5658 2001 1 1 1 513.927 1538.7592 3 1538.759 0.0002 1 36.56 0.00037 R AFHNEAQVNPERK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2240.2240.3.dta 21 1 IPI00290566.1 T-complex protein 1 subunit alpha 439 60819 16 16 15 15 5898 5450 1 1 1 525.6202 1573.8389 3 1573.8385 0.0004 1 22.17 0.0083 R ICDDELILIKNTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5987.5987.3.dta 21 IPI00550591.1 T-complex protein 1 isoform b 211 44200 9 9 9 9 380 4161 1 0 1 358.7133 715.412 2 715.4116 0.0004 0 27.65 0.039 R IDDLIK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4618.4618.2.dta 21 IPI00550591.1 T-complex protein 1 isoform b 211 44200 9 9 9 9 1052 4436 1 0 1 430.7634 859.5122 2 859.5127 -0.0005 0 59.21 1.20E-05 R TSASIILR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4916.4916.2.dta 21 IPI00550591.1 T-complex protein 1 isoform b 211 44200 9 9 9 9 2940 5298 1 0 1 573.8298 1145.6451 2 1145.6444 0.0007 0 32.47 0.0057 R YPVNSVNILK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5831.5831.2.dta 21 IPI00550591.1 T-complex protein 1 isoform b 211 44200 9 9 9 9 2943 6094 1 0 1 574.3076 1146.6006 2 1146.6033 -0.0027 0 57.7 2.40E-05 R EQLAIAEFAR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6629.6629.2.dta 21 IPI00550591.1 T-complex protein 1 isoform b 211 44200 9 9 9 9 3228 6077 1 0 1 597.8127 1193.6109 2 1193.6114 -0.0005 0 69.34 8.00E-07 K IACLDFSLQK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6612.6612.2.dta 21 IPI00550591.1 T-complex protein 1 isoform b 211 44200 9 9 9 9 3513 6499 1 0 1 616.3338 1230.6531 2 1230.653 0.0001 0 54.24 7.80E-05 R ICDDELILIK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7030.7030.2.dta 21 IPI00550591.1 T-complex protein 1 isoform b 211 44200 9 9 9 9 4895 2416 1 0 1 706.338 1410.6614 2 1410.664 -0.0026 0 15.62 0.034 R AFHNEAQVNPER K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2692.2692.2.dta 21 IPI00550591.1 T-complex protein 1 isoform b 211 44200 9 9 9 9 5658 2001 1 0 1 513.927 1538.7592 3 1538.759 0.0002 1 36.56 0.00037 R AFHNEAQVNPERK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2240.2240.3.dta 21 IPI00550591.1 T-complex protein 1 isoform b 211 44200 9 9 9 9 5898 5450 1 0 1 525.6202 1573.8389 3 1573.8385 0.0004 1 22.17 0.0083 R ICDDELILIKNTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5987.5987.3.dta 22 1 IPI00217975.4 Lamin-B1 431 66653 15 15 15 15 1714 2919 1 1 1 485.2473 968.4801 2 968.4815 -0.0014 0 64.21 1.70E-06 K IGDTSVSYK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3241.3241.2.dta 22 1 IPI00217975.4 Lamin-B1 431 66653 15 15 15 15 1918 4211 1 1 1 333.8786 998.6141 3 998.6124 0.0017 1 23.54 0.048 R AKLQIELGK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4672.4672.3.dta 22 1 IPI00217975.4 Lamin-B1 431 66653 15 15 15 15 2446 4257 1 1 1 359.5544 1075.6414 3 1075.639 0.0025 1 24.74 0.012 R LAVYIDKVR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4722.4722.3.dta 22 1 IPI00217975.4 Lamin-B1 431 66653 15 15 15 15 2726 1476 1 1 1 559.2646 1116.5147 2 1116.5159 -0.0012 0 75.62 1.40E-07 K NSQGEEVAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1671.1671.2.dta 22 1 IPI00217975.4 Lamin-B1 431 66653 15 15 15 15 3089 6513 1 1 1 586.3318 1170.6491 2 1170.6496 -0.0004 0 42.6 0.0011 R IQELEDLLAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7044.7044.2.dta 22 1 IPI00217975.4 Lamin-B1 431 66653 15 15 15 15 4035 3224 1 1 1 647.3434 1292.6722 2 1292.6724 -0.0002 1 49.61 0.00025 K LREYEAALNSK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3587.3587.2.dta 22 1 IPI00217975.4 Lamin-B1 431 66653 15 15 15 15 4340 3334 1 1 1 667.8013 1333.588 2 1333.5899 -0.0019 0 46.02 4.80E-05 K NQNSWGTGEDVK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3712.3712.2.dta 22 1 IPI00217975.4 Lamin-B1 431 66653 15 15 15 15 4806 6029 1 1 1 699.3212 1396.6279 2 1396.6293 -0.0014 0 72.34 1.60E-07 R CQSLTEDLEFR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6564.6564.2.dta 22 1 IPI00217975.4 Lamin-B1 431 66653 15 15 15 15 4829 4017 1 1 1 700.8023 1399.5901 2 1399.5925 -0.0024 0 72.97 1.90E-07 K SMYEEEINETR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4462.4462.2.dta 22 1 IPI00217975.4 Lamin-B1 431 66653 15 15 15 15 5007 5865 1 1 1 476.9359 1427.7857 3 1427.7871 -0.0014 1 27.93 0.0082 R IQELEDLLAKEK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6400.6400.3.dta 22 1 IPI00217975.4 Lamin-B1 431 66653 15 15 15 15 5149 5600 1 1 1 723.8924 1445.7702 2 1445.7725 -0.0023 0 71.28 4.40E-07 R IESLSSQLSNLQK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6136.6136.2.dta 22 1 IPI00217975.4 Lamin-B1 431 66653 15 15 15 15 5438 3085 1 1 1 748.8528 1495.691 2 1495.6936 -0.0026 0 31.49 0.01 R LSSEMNTSTVNSAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3420.3420.2.dta 22 1 IPI00217975.4 Lamin-B1 431 66653 15 15 15 15 5580 5025 1 1 1 509.2482 1524.7229 3 1524.7242 -0.0014 1 28.47 0.0021 R CQSLTEDLEFRK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5553.5553.3.dta 22 1 IPI00217975.4 Lamin-B1 431 66653 15 15 15 15 6339 3295 1 1 1 413.7137 1650.8259 4 1650.8253 0.0006 1 14.2 0.047 R LYKEELEQTYHAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3669.3669.4.dta 22 1 IPI00217975.4 Lamin-B1 431 66653 15 15 15 15 6806 5638 1 1 1 578.6445 1732.9116 3 1732.9141 -0.0025 1 55.47 6.30E-06 R MRIESLSSQLSNLQK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6173.6173.3.dta 22 IPI00790831.1 LMNB1 protein 299 44787 12 12 12 12 1918 4211 1 0 1 333.8786 998.6141 3 998.6124 0.0017 1 23.54 0.048 R AKLQIELGK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4672.4672.3.dta 22 IPI00790831.1 LMNB1 protein 299 44787 12 12 12 12 2446 4257 1 0 1 359.5544 1075.6414 3 1075.639 0.0025 1 24.74 0.012 R LAVYIDKVR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4722.4722.3.dta 22 IPI00790831.1 LMNB1 protein 299 44787 12 12 12 12 3089 6513 1 0 1 586.3318 1170.6491 2 1170.6496 -0.0004 0 42.6 0.0011 R IQELEDLLAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7044.7044.2.dta 22 IPI00790831.1 LMNB1 protein 299 44787 12 12 12 12 4035 3224 1 0 1 647.3434 1292.6722 2 1292.6724 -0.0002 1 49.61 0.00025 K LREYEAALNSK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3587.3587.2.dta 22 IPI00790831.1 LMNB1 protein 299 44787 12 12 12 12 4806 6029 1 0 1 699.3212 1396.6279 2 1396.6293 -0.0014 0 72.34 1.60E-07 R CQSLTEDLEFR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6564.6564.2.dta 22 IPI00790831.1 LMNB1 protein 299 44787 12 12 12 12 4829 4017 1 0 1 700.8023 1399.5901 2 1399.5925 -0.0024 0 72.97 1.90E-07 K SMYEEEINETR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4462.4462.2.dta 22 IPI00790831.1 LMNB1 protein 299 44787 12 12 12 12 5007 5865 1 0 1 476.9359 1427.7857 3 1427.7871 -0.0014 1 27.93 0.0082 R IQELEDLLAKEK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6400.6400.3.dta 22 IPI00790831.1 LMNB1 protein 299 44787 12 12 12 12 5149 5600 1 0 1 723.8924 1445.7702 2 1445.7725 -0.0023 0 71.28 4.40E-07 R IESLSSQLSNLQK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6136.6136.2.dta 22 IPI00790831.1 LMNB1 protein 299 44787 12 12 12 12 5438 3085 1 0 1 748.8528 1495.691 2 1495.6936 -0.0026 0 31.49 0.01 R LSSEMNTSTVNSAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3420.3420.2.dta 22 IPI00790831.1 LMNB1 protein 299 44787 12 12 12 12 5580 5025 1 0 1 509.2482 1524.7229 3 1524.7242 -0.0014 1 28.47 0.0021 R CQSLTEDLEFRK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5553.5553.3.dta 22 IPI00790831.1 LMNB1 protein 299 44787 12 12 12 12 6339 3295 1 0 1 413.7137 1650.8259 4 1650.8253 0.0006 1 14.2 0.047 R LYKEELEQTYHAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3669.3669.4.dta 22 IPI00790831.1 LMNB1 protein 299 44787 12 12 12 12 6806 5638 1 0 1 578.6445 1732.9116 3 1732.9141 -0.0025 1 55.47 6.30E-06 R MRIESLSSQLSNLQK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6173.6173.3.dta 23 1 IPI00018009.2 Enhancer of mRNA decapping protein 3 408 56784 17 17 15 15 534 3441 1 1 1 380.2342 758.4538 2 758.4538 0.0001 0 36.37 0.0054 K LLSVAEK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3828.3828.2.dta 23 1 IPI00018009.2 Enhancer of mRNA decapping protein 3 408 56784 17 17 15 15 987 3488 1 1 1 423.7338 845.453 2 845.4494 0.0036 0 60.61 3.50E-05 R AGDITELK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3881.3881.2.dta 23 1 IPI00018009.2 Enhancer of mRNA decapping protein 3 408 56784 17 17 15 15 1193 5837 1 1 1 442.2554 882.4963 2 882.4963 -0.0001 0 25.07 0.017 K FVIPLHSA - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6373.6373.2.dta 23 1 IPI00018009.2 Enhancer of mRNA decapping protein 3 408 56784 17 17 15 15 1971 2891 1 1 1 336.2063 1005.597 3 1005.5971 -0.0001 0 19.73 0.04 R IIVPHNVSK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3209.3209.3.dta 23 1 IPI00018009.2 Enhancer of mRNA decapping protein 3 408 56784 17 17 15 15 2163 1967 1 1 1 520.2851 1038.5556 2 1038.557 -0.0014 0 24.38 0.045 R GIPNERPTR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2203.2203.2.dta 23 1 IPI00018009.2 Enhancer of mRNA decapping protein 3 408 56784 17 17 15 15 2433 2240 1 1 1 538.2909 1074.5672 2 1074.5669 0.0003 0 40.61 0.00023 K TQGQQVSSLK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2502.2502.2.dta 23 1 IPI00018009.2 Enhancer of mRNA decapping protein 3 408 56784 17 17 15 15 2606 3532 1 1 1 550.7824 1099.5503 2 1099.5523 -0.002 0 57.02 1.90E-05 K AAVAWANQNR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3931.3931.2.dta 23 1 IPI00018009.2 Enhancer of mRNA decapping protein 3 408 56784 17 17 15 15 3944 1730 1 1 1 428.2375 1281.6908 3 1281.6902 0.0007 1 26.29 0.022 R SRGIPNERPTR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1946.1946.3.dta 23 1 IPI00018009.2 Enhancer of mRNA decapping protein 3 408 56784 17 17 15 15 4897 2008 1 1 1 471.2559 1410.7457 3 1410.7467 -0.0009 0 31.3 0.003 K KPASSSSAPQNIPK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2247.2247.3.dta 23 1 IPI00018009.2 Enhancer of mRNA decapping protein 3 408 56784 17 17 15 15 4898 2013 1 1 1 706.3802 1410.7459 2 1410.7467 -0.0007 0 52 3.80E-05 K KPASSSSAPQNIPK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2253.2253.2.dta 23 1 IPI00018009.2 Enhancer of mRNA decapping protein 3 408 56784 17 17 15 15 5960 5408 1 1 1 533.5989 1597.7748 3 1597.7736 0.0012 1 19.11 0.016 K AAVFEEIDTYERR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5943.5943.3.dta 23 1 IPI00018009.2 Enhancer of mRNA decapping protein 3 408 56784 17 17 15 15 6025 7900 1 1 1 806.4181 1610.8216 2 1610.8225 -0.0009 0 63.41 1.10E-06 K MLESITNELSLFSK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8530.8530.2.dta 23 1 IPI00018009.2 Enhancer of mRNA decapping protein 3 408 56784 17 17 15 15 6127 7521 1 1 1 814.4151 1626.8156 2 1626.8174 -0.0018 0 90.14 3.50E-09 K MLESITNELSLFSK T Oxidation (M) 0.10000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8119.8119.2.dta 23 1 IPI00018009.2 Enhancer of mRNA decapping protein 3 408 56784 17 17 15 15 6532 2139 1 1 1 561.5985 1681.7735 3 1681.773 0.0006 1 15.2 0.037 K SYVDRHMESLSQSK S Oxidation (M) 0.00000010000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2391.2391.3.dta 23 1 IPI00018009.2 Enhancer of mRNA decapping protein 3 408 56784 17 17 15 15 6560 2184 1 1 1 845.3973 1688.7801 2 1688.7788 0.0013 0 62.04 1.50E-06 K SQDVAVSPQQQQCSK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2441.2441.2.dta 23 1 IPI00018009.2 Enhancer of mRNA decapping protein 3 408 56784 17 17 15 15 7851 5130 1 1 1 678.3401 2031.9986 3 2032.0014 -0.0027 1 59.22 2.80E-06 R YRHDENILESEPIVYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5660.5660.3.dta 23 1 IPI00018009.2 Enhancer of mRNA decapping protein 3 408 56784 17 17 15 15 7956 5927 1 1 1 705.375 2113.1032 3 2113.1055 -0.0024 0 29.38 0.0018 R APVLSIDPPVHEVEQGIDAK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6461.6461.3.dta 24 1 IPI00387144.4 Tubulin alpha-ubiquitous chain 398 50804 14 14 11 11 628 3280 1 1 1 391.2087 780.4029 2 780.4018 0.0012 0 32.2 0.012 R LSVDYGK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3651.3651.2.dta 24 1 IPI00387144.4 Tubulin alpha-ubiquitous chain 398 50804 14 14 11 11 2023 4801 1 1 1 508.2928 1014.5711 2 1014.5709 0.0002 0 65.1 6.40E-06 K DVNAAIATIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5312.5312.2.dta 24 1 IPI00387144.4 Tubulin alpha-ubiquitous chain 398 50804 14 14 11 11 2517 7168 1 1 1 543.3135 1084.6125 2 1084.6128 -0.0003 0 53.03 1.60E-05 K EIIDLVLDR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7717.7717.2.dta 24 1 IPI00387144.4 Tubulin alpha-ubiquitous chain 398 50804 14 14 11 11 3685 5728 1 1 1 625.279 1248.5434 2 1248.5453 -0.0019 0 47.79 3.30E-05 K YMACCLLYR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6263.6263.2.dta 24 1 IPI00387144.4 Tubulin alpha-ubiquitous chain 398 50804 14 14 11 11 5928 7263 1 1 1 792.8798 1583.745 2 1583.7443 0.0007 0 52 1.30E-05 R SIQFVDWCPTGFK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7821.7821.2.dta 24 1 IPI00387144.4 Tubulin alpha-ubiquitous chain 398 50804 14 14 11 11 6670 7328 1 1 1 851.4558 1700.8971 2 1700.8985 -0.0014 0 69.39 3.10E-07 R AVFVDLEPTVIDEVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7900.7900.2.dta 24 1 IPI00387144.4 Tubulin alpha-ubiquitous chain 398 50804 14 14 11 11 6671 7333 1 1 1 567.9733 1700.8982 3 1700.8985 -0.0004 0 43.12 0.00071 R AVFVDLEPTVIDEVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7906.7906.3.dta 24 1 IPI00387144.4 Tubulin alpha-ubiquitous chain 398 50804 14 14 11 11 6761 4579 1 1 1 859.9445 1717.8744 2 1717.8747 -0.0003 0 44.76 0.00029 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5071.5071.2.dta 24 1 IPI00387144.4 Tubulin alpha-ubiquitous chain 398 50804 14 14 11 11 6762 4553 1 1 1 573.6321 1717.8744 3 1717.8747 -0.0003 0 24.68 0.0077 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5043.5043.3.dta 24 1 IPI00387144.4 Tubulin alpha-ubiquitous chain 398 50804 14 14 11 11 7182 5691 1 1 1 912.9945 1823.9745 2 1823.9782 -0.0037 0 56.3 5.30E-06 K VGINYQPPTVVPGGDLAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6226.6226.2.dta 24 1 IPI00387144.4 Tubulin alpha-ubiquitous chain 398 50804 14 14 11 11 7800 6916 1 1 1 1004.4487 2006.8828 2 2006.8858 -0.003 0 80.42 2.90E-08 K TIGGGDDSFNTFFSETGAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7450.7450.2.dta 24 1 IPI00387144.4 Tubulin alpha-ubiquitous chain 398 50804 14 14 11 11 7801 6925 1 1 1 669.9689 2006.8848 3 2006.8858 -0.001 0 16.13 0.031 K TIGGGDDSFNTFFSETGAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7460.7460.3.dta 24 1 IPI00387144.4 Tubulin alpha-ubiquitous chain 398 50804 14 14 11 11 8217 7159 1 1 1 760.733 2279.1773 3 2279.1798 -0.0025 1 17.17 0.025 R AVFVDLEPTVIDEVRTGTYR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7707.7707.3.dta 24 1 IPI00387144.4 Tubulin alpha-ubiquitous chain 398 50804 14 14 11 11 8569 5320 1 1 1 805.7397 2414.1972 3 2414.1978 -0.0006 1 31.32 0.0012 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5853.5853.3.dta 24 IPI00180675.4 Tubulin alpha-3 chain 362 50788 13 13 10 10 628 3280 1 0 1 391.2087 780.4029 2 780.4018 0.0012 0 32.2 0.012 R LSVDYGK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3651.3651.2.dta 24 IPI00180675.4 Tubulin alpha-3 chain 362 50788 13 13 10 10 2023 4801 1 0 1 508.2928 1014.5711 2 1014.5709 0.0002 0 65.1 6.40E-06 K DVNAAIATIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5312.5312.2.dta 24 IPI00180675.4 Tubulin alpha-3 chain 362 50788 13 13 10 10 2517 7168 1 0 1 543.3135 1084.6125 2 1084.6128 -0.0003 0 53.03 1.60E-05 K EIIDLVLDR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7717.7717.2.dta 24 IPI00180675.4 Tubulin alpha-3 chain 362 50788 13 13 10 10 3685 5728 1 0 1 625.279 1248.5434 2 1248.5453 -0.0019 0 47.79 3.30E-05 K YMACCLLYR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6263.6263.2.dta 24 IPI00180675.4 Tubulin alpha-3 chain 362 50788 13 13 10 10 6670 7328 1 0 1 851.4558 1700.8971 2 1700.8985 -0.0014 0 69.39 3.10E-07 R AVFVDLEPTVIDEVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7900.7900.2.dta 24 IPI00180675.4 Tubulin alpha-3 chain 362 50788 13 13 10 10 6671 7333 1 0 1 567.9733 1700.8982 3 1700.8985 -0.0004 0 43.12 0.00071 R AVFVDLEPTVIDEVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7906.7906.3.dta 24 IPI00180675.4 Tubulin alpha-3 chain 362 50788 13 13 10 10 6761 4579 1 0 1 859.9445 1717.8744 2 1717.8747 -0.0003 0 44.76 0.00029 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5071.5071.2.dta 24 IPI00180675.4 Tubulin alpha-3 chain 362 50788 13 13 10 10 6762 4553 1 0 1 573.6321 1717.8744 3 1717.8747 -0.0003 0 24.68 0.0077 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5043.5043.3.dta 24 IPI00180675.4 Tubulin alpha-3 chain 362 50788 13 13 10 10 7182 5691 1 0 1 912.9945 1823.9745 2 1823.9782 -0.0037 0 56.3 5.30E-06 K VGINYQPPTVVPGGDLAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6226.6226.2.dta 24 IPI00180675.4 Tubulin alpha-3 chain 362 50788 13 13 10 10 7800 6916 1 0 1 1004.4487 2006.8828 2 2006.8858 -0.003 0 80.42 2.90E-08 K TIGGGDDSFNTFFSETGAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7450.7450.2.dta 24 IPI00180675.4 Tubulin alpha-3 chain 362 50788 13 13 10 10 7801 6925 1 0 1 669.9689 2006.8848 3 2006.8858 -0.001 0 16.13 0.031 K TIGGGDDSFNTFFSETGAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7460.7460.3.dta 24 IPI00180675.4 Tubulin alpha-3 chain 362 50788 13 13 10 10 8217 7159 1 0 1 760.733 2279.1773 3 2279.1798 -0.0025 1 17.17 0.025 R AVFVDLEPTVIDEVRTGTYR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7707.7707.3.dta 24 IPI00180675.4 Tubulin alpha-3 chain 362 50788 13 13 10 10 8569 5320 1 0 1 805.7397 2414.1972 3 2414.1978 -0.0006 1 31.32 0.0012 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5853.5853.3.dta 24 IPI00166768.2 TUBA6 protein 322 37681 10 10 8 8 2023 4801 1 0 1 508.2928 1014.5711 2 1014.5709 0.0002 0 65.1 6.40E-06 K DVNAAIATIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5312.5312.2.dta 24 IPI00166768.2 TUBA6 protein 322 37681 10 10 8 8 2517 7168 1 0 1 543.3135 1084.6125 2 1084.6128 -0.0003 0 53.03 1.60E-05 K EIIDLVLDR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7717.7717.2.dta 24 IPI00166768.2 TUBA6 protein 322 37681 10 10 8 8 3685 5728 1 0 1 625.279 1248.5434 2 1248.5453 -0.0019 0 47.79 3.30E-05 K YMACCLLYR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6263.6263.2.dta 24 IPI00166768.2 TUBA6 protein 322 37681 10 10 8 8 6670 7328 1 0 1 851.4558 1700.8971 2 1700.8985 -0.0014 0 69.39 3.10E-07 R AVFVDLEPTVIDEVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7900.7900.2.dta 24 IPI00166768.2 TUBA6 protein 322 37681 10 10 8 8 6671 7333 1 0 1 567.9733 1700.8982 3 1700.8985 -0.0004 0 43.12 0.00071 R AVFVDLEPTVIDEVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7906.7906.3.dta 24 IPI00166768.2 TUBA6 protein 322 37681 10 10 8 8 7182 5691 1 0 1 912.9945 1823.9745 2 1823.9782 -0.0037 0 56.3 5.30E-06 K VGINYQPPTVVPGGDLAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6226.6226.2.dta 24 IPI00166768.2 TUBA6 protein 322 37681 10 10 8 8 7800 6916 1 0 1 1004.4487 2006.8828 2 2006.8858 -0.003 0 80.42 2.90E-08 K TIGGGDDSFNTFFSETGAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7450.7450.2.dta 24 IPI00166768.2 TUBA6 protein 322 37681 10 10 8 8 7801 6925 1 0 1 669.9689 2006.8848 3 2006.8858 -0.001 0 16.13 0.031 K TIGGGDDSFNTFFSETGAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7460.7460.3.dta 24 IPI00166768.2 TUBA6 protein 322 37681 10 10 8 8 8217 7159 1 0 1 760.733 2279.1773 3 2279.1798 -0.0025 1 17.17 0.025 R AVFVDLEPTVIDEVRTGTYR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7707.7707.3.dta 24 IPI00166768.2 TUBA6 protein 322 37681 10 10 8 8 8569 5320 1 0 1 805.7397 2414.1972 3 2414.1978 -0.0006 1 31.32 0.0012 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5853.5853.3.dta 24 IPI00793930.1 K-ALPHA-1 protein 322 37707 10 10 8 8 2023 4801 1 0 1 508.2928 1014.5711 2 1014.5709 0.0002 0 65.1 6.40E-06 K DVNAAIATIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5312.5312.2.dta 24 IPI00793930.1 K-ALPHA-1 protein 322 37707 10 10 8 8 3685 5728 1 0 1 625.279 1248.5434 2 1248.5453 -0.0019 0 47.79 3.30E-05 K YMACCLLYR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6263.6263.2.dta 24 IPI00793930.1 K-ALPHA-1 protein 322 37707 10 10 8 8 5928 7263 1 0 1 792.8798 1583.745 2 1583.7443 0.0007 0 52 1.30E-05 R SIQFVDWCPTGFK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7821.7821.2.dta 24 IPI00793930.1 K-ALPHA-1 protein 322 37707 10 10 8 8 6670 7328 1 0 1 851.4558 1700.8971 2 1700.8985 -0.0014 0 69.39 3.10E-07 R AVFVDLEPTVIDEVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7900.7900.2.dta 24 IPI00793930.1 K-ALPHA-1 protein 322 37707 10 10 8 8 6671 7333 1 0 1 567.9733 1700.8982 3 1700.8985 -0.0004 0 43.12 0.00071 R AVFVDLEPTVIDEVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7906.7906.3.dta 24 IPI00793930.1 K-ALPHA-1 protein 322 37707 10 10 8 8 7182 5691 1 0 1 912.9945 1823.9745 2 1823.9782 -0.0037 0 56.3 5.30E-06 K VGINYQPPTVVPGGDLAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6226.6226.2.dta 24 IPI00793930.1 K-ALPHA-1 protein 322 37707 10 10 8 8 7800 6916 1 0 1 1004.4487 2006.8828 2 2006.8858 -0.003 0 80.42 2.90E-08 K TIGGGDDSFNTFFSETGAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7450.7450.2.dta 24 IPI00793930.1 K-ALPHA-1 protein 322 37707 10 10 8 8 7801 6925 1 0 1 669.9689 2006.8848 3 2006.8858 -0.001 0 16.13 0.031 K TIGGGDDSFNTFFSETGAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7460.7460.3.dta 24 IPI00793930.1 K-ALPHA-1 protein 322 37707 10 10 8 8 8217 7159 1 0 1 760.733 2279.1773 3 2279.1798 -0.0025 1 17.17 0.025 R AVFVDLEPTVIDEVRTGTYR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7707.7707.3.dta 24 IPI00793930.1 K-ALPHA-1 protein 322 37707 10 10 8 8 8569 5320 1 0 1 805.7397 2414.1972 3 2414.1978 -0.0006 1 31.32 0.0012 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5853.5853.3.dta 24 IPI00478908.3 29 kDa protein 249 28716 10 10 7 7 628 3280 1 0 1 391.2087 780.4029 2 780.4018 0.0012 0 32.2 0.012 R LSVDYGK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3651.3651.2.dta 24 IPI00478908.3 29 kDa protein 249 28716 10 10 7 7 2517 7168 1 0 1 543.3135 1084.6125 2 1084.6128 -0.0003 0 53.03 1.60E-05 K EIIDLVLDR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7717.7717.2.dta 24 IPI00478908.3 29 kDa protein 249 28716 10 10 7 7 6670 7328 1 0 1 851.4558 1700.8971 2 1700.8985 -0.0014 0 69.39 3.10E-07 R AVFVDLEPTVIDEVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7900.7900.2.dta 24 IPI00478908.3 29 kDa protein 249 28716 10 10 7 7 6671 7333 1 0 1 567.9733 1700.8982 3 1700.8985 -0.0004 0 43.12 0.00071 R AVFVDLEPTVIDEVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7906.7906.3.dta 24 IPI00478908.3 29 kDa protein 249 28716 10 10 7 7 6761 4579 1 0 1 859.9445 1717.8744 2 1717.8747 -0.0003 0 44.76 0.00029 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5071.5071.2.dta 24 IPI00478908.3 29 kDa protein 249 28716 10 10 7 7 6762 4553 1 0 1 573.6321 1717.8744 3 1717.8747 -0.0003 0 24.68 0.0077 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5043.5043.3.dta 24 IPI00478908.3 29 kDa protein 249 28716 10 10 7 7 7800 6916 1 0 1 1004.4487 2006.8828 2 2006.8858 -0.003 0 80.42 2.90E-08 K TIGGGDDSFNTFFSETGAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7450.7450.2.dta 24 IPI00478908.3 29 kDa protein 249 28716 10 10 7 7 7801 6925 1 0 1 669.9689 2006.8848 3 2006.8858 -0.001 0 16.13 0.031 K TIGGGDDSFNTFFSETGAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7460.7460.3.dta 24 IPI00478908.3 29 kDa protein 249 28716 10 10 7 7 8217 7159 1 0 1 760.733 2279.1773 3 2279.1798 -0.0025 1 17.17 0.025 R AVFVDLEPTVIDEVRTGTYR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7707.7707.3.dta 24 IPI00478908.3 29 kDa protein 249 28716 10 10 7 7 8569 5320 1 0 1 805.7397 2414.1972 3 2414.1978 -0.0006 1 31.32 0.0012 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5853.5853.3.dta 24 IPI00179709.4 Isoform 1 of Tubulin alpha-2 chain 219 50612 8 8 6 6 628 3280 1 0 1 391.2087 780.4029 2 780.4018 0.0012 0 32.2 0.012 R LSVDYGK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3651.3651.2.dta 24 IPI00179709.4 Isoform 1 of Tubulin alpha-2 chain 219 50612 8 8 6 6 2023 4801 1 0 1 508.2928 1014.5711 2 1014.5709 0.0002 0 65.1 6.40E-06 K DVNAAIATIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5312.5312.2.dta 24 IPI00179709.4 Isoform 1 of Tubulin alpha-2 chain 219 50612 8 8 6 6 6761 4579 1 0 1 859.9445 1717.8744 2 1717.8747 -0.0003 0 44.76 0.00029 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5071.5071.2.dta 24 IPI00179709.4 Isoform 1 of Tubulin alpha-2 chain 219 50612 8 8 6 6 6762 4553 1 0 1 573.6321 1717.8744 3 1717.8747 -0.0003 0 24.68 0.0077 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5043.5043.3.dta 24 IPI00179709.4 Isoform 1 of Tubulin alpha-2 chain 219 50612 8 8 6 6 7182 5691 1 0 1 912.9945 1823.9745 2 1823.9782 -0.0037 0 56.3 5.30E-06 K VGINYQPPTVVPGGDLAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6226.6226.2.dta 24 IPI00179709.4 Isoform 1 of Tubulin alpha-2 chain 219 50612 8 8 6 6 7800 6916 1 0 1 1004.4487 2006.8828 2 2006.8858 -0.003 0 80.42 2.90E-08 K TIGGGDDSFNTFFSETGAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7450.7450.2.dta 24 IPI00179709.4 Isoform 1 of Tubulin alpha-2 chain 219 50612 8 8 6 6 7801 6925 1 0 1 669.9689 2006.8848 3 2006.8858 -0.001 0 16.13 0.031 K TIGGGDDSFNTFFSETGAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7460.7460.3.dta 24 IPI00179709.4 Isoform 1 of Tubulin alpha-2 chain 219 50612 8 8 6 6 8569 5320 1 0 1 805.7397 2414.1972 3 2414.1978 -0.0006 1 31.32 0.0012 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5853.5853.3.dta 24 IPI00795002.1 19 kDa protein 218 19479 8 8 6 6 628 3280 1 0 1 391.2087 780.4029 2 780.4018 0.0012 0 32.2 0.012 R LSVDYGK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3651.3651.2.dta 24 IPI00795002.1 19 kDa protein 218 19479 8 8 6 6 2517 7168 1 0 1 543.3135 1084.6125 2 1084.6128 -0.0003 0 53.03 1.60E-05 K EIIDLVLDR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7717.7717.2.dta 24 IPI00795002.1 19 kDa protein 218 19479 8 8 6 6 6670 7328 1 0 1 851.4558 1700.8971 2 1700.8985 -0.0014 0 69.39 3.10E-07 R AVFVDLEPTVIDEVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7900.7900.2.dta 24 IPI00795002.1 19 kDa protein 218 19479 8 8 6 6 6671 7333 1 0 1 567.9733 1700.8982 3 1700.8985 -0.0004 0 43.12 0.00071 R AVFVDLEPTVIDEVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7906.7906.3.dta 24 IPI00795002.1 19 kDa protein 218 19479 8 8 6 6 7800 6916 1 0 1 1004.4487 2006.8828 2 2006.8858 -0.003 0 80.42 2.90E-08 K TIGGGDDSFNTFFSETGAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7450.7450.2.dta 24 IPI00795002.1 19 kDa protein 218 19479 8 8 6 6 7801 6925 1 0 1 669.9689 2006.8848 3 2006.8858 -0.001 0 16.13 0.031 K TIGGGDDSFNTFFSETGAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7460.7460.3.dta 24 IPI00795002.1 19 kDa protein 218 19479 8 8 6 6 8217 7159 1 0 1 760.733 2279.1773 3 2279.1798 -0.0025 1 17.17 0.025 R AVFVDLEPTVIDEVRTGTYR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7707.7707.3.dta 24 IPI00795002.1 19 kDa protein 218 19479 8 8 6 6 8569 5320 1 0 1 805.7397 2414.1972 3 2414.1978 -0.0006 1 31.32 0.0012 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5853.5853.3.dta 24 IPI00410402.2 Similar to alpha tubulin 194 50568 6 6 4 4 2023 4801 1 0 1 508.2928 1014.5711 2 1014.5709 0.0002 0 65.1 6.40E-06 K DVNAAIATIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5312.5312.2.dta 24 IPI00410402.2 Similar to alpha tubulin 194 50568 6 6 4 4 6761 4579 1 0 1 859.9445 1717.8744 2 1717.8747 -0.0003 0 44.76 0.00029 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5071.5071.2.dta 24 IPI00410402.2 Similar to alpha tubulin 194 50568 6 6 4 4 6762 4553 1 0 1 573.6321 1717.8744 3 1717.8747 -0.0003 0 24.68 0.0077 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5043.5043.3.dta 24 IPI00410402.2 Similar to alpha tubulin 194 50568 6 6 4 4 7182 5691 1 0 1 912.9945 1823.9745 2 1823.9782 -0.0037 0 56.3 5.30E-06 K VGINYQPPTVVPGGDLAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6226.6226.2.dta 24 IPI00410402.2 Similar to alpha tubulin 194 50568 6 6 4 4 7800 6916 1 0 1 1004.4487 2006.8828 2 2006.8858 -0.003 0 80.42 2.90E-08 K TIGGGDDSFNTFFSETGAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7450.7450.2.dta 24 IPI00410402.2 Similar to alpha tubulin 194 50568 6 6 4 4 7801 6925 1 0 1 669.9689 2006.8848 3 2006.8858 -0.001 0 16.13 0.031 K TIGGGDDSFNTFFSETGAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7460.7460.3.dta 24 IPI00007750.1 Tubulin alpha-1 chain 183 50634 7 7 6 6 628 3280 1 0 1 391.2087 780.4029 2 780.4018 0.0012 0 32.2 0.012 R LSVDYGK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3651.3651.2.dta 24 IPI00007750.1 Tubulin alpha-1 chain 183 50634 7 7 6 6 3685 5728 1 0 1 625.279 1248.5434 2 1248.5453 -0.0019 0 47.79 3.30E-05 K YMACCLLYR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6263.6263.2.dta 24 IPI00007750.1 Tubulin alpha-1 chain 183 50634 7 7 6 6 5928 7263 1 0 1 792.8798 1583.745 2 1583.7443 0.0007 0 52 1.30E-05 R SIQFVDWCPTGFK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7821.7821.2.dta 24 IPI00007750.1 Tubulin alpha-1 chain 183 50634 7 7 6 6 6761 4579 1 0 1 859.9445 1717.8744 2 1717.8747 -0.0003 0 44.76 0.00029 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5071.5071.2.dta 24 IPI00007750.1 Tubulin alpha-1 chain 183 50634 7 7 6 6 6762 4553 1 0 1 573.6321 1717.8744 3 1717.8747 -0.0003 0 24.68 0.0077 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5043.5043.3.dta 24 IPI00007750.1 Tubulin alpha-1 chain 183 50634 7 7 6 6 7182 5691 1 0 1 912.9945 1823.9745 2 1823.9782 -0.0037 0 56.3 5.30E-06 K VGINYQPPTVVPGGDLAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6226.6226.2.dta 24 IPI00007750.1 Tubulin alpha-1 chain 183 50634 7 7 6 6 8569 5320 1 0 1 805.7397 2414.1972 3 2414.1978 -0.0006 1 31.32 0.0012 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5853.5853.3.dta 24 IPI00646909.2 Tubulin alpha-8 chain 106 50746 4 4 3 3 6761 4579 1 0 1 859.9445 1717.8744 2 1717.8747 -0.0003 0 44.76 0.00029 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5071.5071.2.dta 24 IPI00646909.2 Tubulin alpha-8 chain 106 50746 4 4 3 3 6762 4553 1 0 1 573.6321 1717.8744 3 1717.8747 -0.0003 0 24.68 0.0077 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5043.5043.3.dta 24 IPI00646909.2 Tubulin alpha-8 chain 106 50746 4 4 3 3 7182 5691 1 0 1 912.9945 1823.9745 2 1823.9782 -0.0037 0 56.3 5.30E-06 K VGINYQPPTVVPGGDLAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6226.6226.2.dta 24 IPI00646909.2 Tubulin alpha-8 chain 106 50746 4 4 3 3 8569 5320 1 0 1 805.7397 2414.1972 3 2414.1978 -0.0006 1 31.32 0.0012 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5853.5853.3.dta 24 IPI00784332.1 Similar to Tubulin alpha-2 chain 100 17148 2 2 2 2 2023 4801 1 0 1 508.2928 1014.5711 2 1014.5709 0.0002 0 65.1 6.40E-06 K DVNAAIATIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5312.5312.2.dta 24 IPI00784332.1 Similar to Tubulin alpha-2 chain 100 17148 2 2 2 2 7182 5691 1 0 1 912.9945 1823.9745 2 1823.9782 -0.0037 0 56.3 5.30E-06 K VGINYQPPTVVPGGDLAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6226.6226.2.dta 24 IPI00414274.3 similar to Tubulin alpha-3 chain 100 23560 4 4 3 3 628 3280 1 0 1 391.2087 780.4029 2 780.4018 0.0012 0 32.2 0.012 R LSVDYGK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3651.3651.2.dta 24 IPI00414274.3 similar to Tubulin alpha-3 chain 100 23560 4 4 3 3 2023 4801 1 0 1 508.2928 1014.5711 2 1014.5709 0.0002 0 65.1 6.40E-06 K DVNAAIATIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5312.5312.2.dta 24 IPI00414274.3 similar to Tubulin alpha-3 chain 100 23560 4 4 3 3 6761 4579 1 0 1 859.9445 1717.8744 2 1717.8747 -0.0003 0 44.76 0.00029 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5071.5071.2.dta 24 IPI00414274.3 similar to Tubulin alpha-3 chain 100 23560 4 4 3 3 6762 4553 1 0 1 573.6321 1717.8744 3 1717.8747 -0.0003 0 24.68 0.0077 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5043.5043.3.dta 24 IPI00335314.3 30 kDa protein 75 30008 4 4 3 3 628 3280 1 0 1 391.2087 780.4029 2 780.4018 0.0012 0 32.2 0.012 R LSVDYGK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3651.3651.2.dta 24 IPI00335314.3 30 kDa protein 75 30008 4 4 3 3 6761 4579 1 0 1 859.9445 1717.8744 2 1717.8747 -0.0003 0 44.76 0.00029 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5071.5071.2.dta 24 IPI00335314.3 30 kDa protein 75 30008 4 4 3 3 6762 4553 1 0 1 573.6321 1717.8744 3 1717.8747 -0.0003 0 24.68 0.0077 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5043.5043.3.dta 24 IPI00335314.3 30 kDa protein 75 30008 4 4 3 3 8569 5320 1 0 1 805.7397 2414.1972 3 2414.1978 -0.0006 1 31.32 0.0012 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5853.5853.3.dta 24 IPI00017454.3 Tubulin alpha-4 chain 50 27757 2 2 1 1 6761 4579 1 0 1 859.9445 1717.8744 2 1717.8747 -0.0003 0 44.76 0.00029 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5071.5071.2.dta 24 IPI00017454.3 Tubulin alpha-4 chain 50 27757 2 2 1 1 6762 4553 1 0 1 573.6321 1717.8744 3 1717.8747 -0.0003 0 24.68 0.0077 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5043.5043.3.dta 24 IPI00015671.3 "tubulin, alpha-like 3" 48 50675 1 1 1 1 3685 5728 1 0 1 625.279 1248.5434 2 1248.5453 -0.0019 0 47.79 3.30E-05 K YMACCLLYR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6263.6263.2.dta 24 IPI00794009.1 22 kDa protein 44 21949 2 2 2 2 628 3280 1 0 1 391.2087 780.4029 2 780.4018 0.0012 0 32.2 0.012 R LSVDYGK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3651.3651.2.dta 24 IPI00794009.1 22 kDa protein 44 21949 2 2 2 2 8569 5320 1 0 1 805.7397 2414.1972 3 2414.1978 -0.0006 1 31.32 0.0012 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5853.5853.3.dta 24 IPI00062209.5 Alpha tubulin-like 32 16843 1 1 1 1 628 3280 1 0 1 391.2087 780.4029 2 780.4018 0.0012 0 32.2 0.012 R LSVDYGK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3651.3651.2.dta 25 1 IPI00465233.1 DJ1014D13.1 protein 395 71085 11 11 10 10 1055 6954 1 1 1 430.7838 859.5531 2 859.5531 0 0 23.6 0.0044 R IQLLVFK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7489.7489.2.dta 25 1 IPI00465233.1 DJ1014D13.1 protein 395 71085 11 11 10 10 1056 6938 1 1 1 430.7839 859.5533 2 859.5531 0.0001 0 32.13 0.00061 R IQLLVFK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7473.7473.2.dta 25 1 IPI00465233.1 DJ1014D13.1 protein 395 71085 11 11 10 10 1392 6295 1 1 1 459.2297 916.4448 2 916.4443 0.0005 0 46.47 0.00054 R YGDFFIR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6829.6829.2.dta 25 1 IPI00465233.1 DJ1014D13.1 protein 395 71085 11 11 10 10 1835 2729 1 1 1 495.7588 989.503 2 989.5029 0.0001 0 70.62 2.20E-06 R VSSDVIDQK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3033.3033.2.dta 25 1 IPI00465233.1 DJ1014D13.1 protein 395 71085 11 11 10 10 2100 2727 1 1 1 515.2695 1028.5245 2 1028.5251 -0.0006 0 69.23 2.00E-06 K VSGGPSLEQR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3030.3030.2.dta 25 1 IPI00465233.1 DJ1014D13.1 protein 395 71085 11 11 10 10 3272 3799 1 1 1 600.353 1198.6914 2 1198.6921 -0.0007 1 29.26 0.0018 K VLENIELNKK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4226.4226.2.dta 25 1 IPI00465233.1 DJ1014D13.1 protein 395 71085 11 11 10 10 3841 5177 1 1 1 633.3212 1264.6279 2 1264.6299 -0.002 1 51.2 0.00016 K KSEEEIDFLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5708.5708.2.dta 25 1 IPI00465233.1 DJ1014D13.1 protein 395 71085 11 11 10 10 5652 7755 1 1 1 769.8957 1537.7768 2 1537.7776 -0.0008 0 66.07 6.50E-07 K LAGFLDLTEQEFR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8380.8380.2.dta 25 1 IPI00465233.1 DJ1014D13.1 protein 395 71085 11 11 10 10 7287 5121 1 1 1 924.974 1847.9334 2 1847.9377 -0.0043 0 97.02 8.00E-10 K VFSDEVQQQAQLSTIR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5651.5651.2.dta 25 1 IPI00465233.1 DJ1014D13.1 protein 395 71085 11 11 10 10 7606 7016 1 1 1 959.93 1917.8454 2 1917.8455 0 0 58.42 3.30E-06 K GDPQVYEELFSYSCPK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7554.7554.2.dta 25 1 IPI00465233.1 DJ1014D13.1 protein 395 71085 11 11 10 10 7712 6421 1 1 1 655.6815 1964.0227 3 1964.0215 0.0013 1 45.32 0.00014 K TVSDLIDQKVYELQASR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6953.6953.3.dta 25 IPI00787469.1 "similar to eukaryotic translation initiation factor 3, subunit 6 interacting protein" 145 75285 2 2 2 2 5652 7755 1 0 1 769.8957 1537.7768 2 1537.7776 -0.0008 0 66.07 6.50E-07 K LAGFLDLTEQEFR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8380.8380.2.dta 25 IPI00787469.1 "similar to eukaryotic translation initiation factor 3, subunit 6 interacting protein" 145 75285 2 2 2 2 7287 5121 1 0 1 924.974 1847.9334 2 1847.9377 -0.0043 0 97.02 8.00E-10 K VFSDEVQQQAQLSTIR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5651.5651.2.dta 26 1 IPI00013174.2 Isoform 1 of RNA-binding protein 14 380 69620 9 9 9 9 2371 4831 1 1 1 533.7797 1065.5449 2 1065.5455 -0.0006 0 64.15 7.30E-06 R LSESQLSFR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5344.5344.2.dta 26 1 IPI00013174.2 Isoform 1 of RNA-binding protein 14 380 69620 9 9 9 9 2993 2259 1 1 1 578.8189 1155.6233 2 1155.6248 -0.0015 1 63.17 1.20E-06 K KGPGLAVQSGDK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2522.2522.2.dta 26 1 IPI00013174.2 Isoform 1 of RNA-binding protein 14 380 69620 9 9 9 9 3362 3967 1 1 1 603.3153 1204.6161 2 1204.62 -0.004 0 75.88 1.10E-07 R AQPSASLGVGYR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4408.4408.2.dta 26 1 IPI00013174.2 Isoform 1 of RNA-binding protein 14 380 69620 9 9 9 9 3615 4531 1 1 1 619.2772 1236.5399 2 1236.5411 -0.0012 0 69.38 3.50E-07 R YSGSYNDYLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5019.5019.2.dta 26 1 IPI00013174.2 Isoform 1 of RNA-binding protein 14 380 69620 9 9 9 9 3659 4394 1 1 1 623.3314 1244.6483 2 1244.6513 -0.003 0 50.98 3.70E-05 R AQPSVSLGAPYR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4871.4871.2.dta 26 1 IPI00013174.2 Isoform 1 of RNA-binding protein 14 380 69620 9 9 9 9 4069 2255 1 1 1 434.2177 1299.6311 3 1299.632 -0.0008 1 14.64 0.042 R RLPDAHSDYAR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2518.2518.3.dta 26 1 IPI00013174.2 Isoform 1 of RNA-binding protein 14 380 69620 9 9 9 9 4366 2272 1 1 1 670.8161 1339.6177 2 1339.619 -0.0014 0 51.11 3.00E-05 R TQPMTAQAASYR A Oxidation (M) 0.000100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2536.2536.2.dta 26 1 IPI00013174.2 Isoform 1 of RNA-binding protein 14 380 69620 9 9 9 9 6009 4879 1 1 1 804.9235 1607.8324 2 1607.8307 0.0016 0 56.4 1.80E-05 R ASYVAPLTAQPATYR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5396.5396.2.dta 26 1 IPI00013174.2 Isoform 1 of RNA-binding protein 14 380 69620 9 9 9 9 6898 5158 1 1 1 876.4405 1750.8664 2 1750.8672 -0.0008 0 87.45 2.70E-08 K IFVGNVSAACTSQELR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5689.5689.2.dta 26 IPI00556514.1 RNA binding motif protein 14 variant (Fragment) 223 55824 5 5 5 5 2993 2259 1 0 1 578.8189 1155.6233 2 1155.6248 -0.0015 1 63.17 1.20E-06 K KGPGLAVQSGDK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2522.2522.2.dta 26 IPI00556514.1 RNA binding motif protein 14 variant (Fragment) 223 55824 5 5 5 5 3362 3967 1 0 1 603.3153 1204.6161 2 1204.62 -0.004 0 75.88 1.10E-07 R AQPSASLGVGYR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4408.4408.2.dta 26 IPI00556514.1 RNA binding motif protein 14 variant (Fragment) 223 55824 5 5 5 5 3659 4394 1 0 1 623.3314 1244.6483 2 1244.6513 -0.003 0 50.98 3.70E-05 R AQPSVSLGAPYR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4871.4871.2.dta 26 IPI00556514.1 RNA binding motif protein 14 variant (Fragment) 223 55824 5 5 5 5 4366 2272 1 0 1 670.8161 1339.6177 2 1339.619 -0.0014 0 51.11 3.00E-05 R TQPMTAQAASYR A Oxidation (M) 0.000100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2536.2536.2.dta 26 IPI00556514.1 RNA binding motif protein 14 variant (Fragment) 223 55824 5 5 5 5 6009 4879 1 0 1 804.9235 1607.8324 2 1607.8307 0.0016 0 56.4 1.80E-05 R ASYVAPLTAQPATYR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5396.5396.2.dta 26 IPI00644837.1 Isoform 2 of RNA-binding protein 14 87 17277 1 1 1 1 6898 5158 1 0 1 876.4405 1750.8664 2 1750.8672 -0.0008 0 87.45 2.70E-08 K IFVGNVSAACTSQELR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5689.5689.2.dta 27 1 IPI00027626.3 T-complex protein 1 subunit zeta 370 58444 15 15 13 13 58 3892 1 1 0 308.2071 614.3997 2 614.4003 -0.0006 0 27.46 0.018 K IIELK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4327.4327.2.dta 27 1 IPI00027626.3 T-complex protein 1 subunit zeta 370 58444 15 15 13 13 94 1767 1 1 1 315.1848 628.355 2 628.3544 0.0005 0 29.13 0.0094 R TNLGPK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1986.1986.2.dta 27 1 IPI00027626.3 T-complex protein 1 subunit zeta 370 58444 15 15 13 13 485 2763 1 1 1 375.6949 749.3752 2 749.3742 0.0011 1 33.56 0.011 R AGMSSLKG - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3069.3069.2.dta 27 1 IPI00027626.3 T-complex protein 1 subunit zeta 370 58444 15 15 13 13 704 5012 1 1 1 400.735 799.4554 2 799.4552 0.0002 0 40.64 0.0016 R GLQDVLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5539.5539.2.dta 27 1 IPI00027626.3 T-complex protein 1 subunit zeta 370 58444 15 15 13 13 1836 4119 1 1 1 495.7682 989.5219 2 989.5216 0.0003 0 59.31 3.40E-05 K MLVSGAGDIK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4573.4573.2.dta 27 1 IPI00027626.3 T-complex protein 1 subunit zeta 370 58444 15 15 13 13 2442 6370 1 1 1 538.8036 1075.5927 2 1075.5913 0.0014 0 43.71 0.00026 K ALQFLEEVK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6903.6903.2.dta 27 1 IPI00027626.3 T-complex protein 1 subunit zeta 370 58444 15 15 13 13 3209 5368 1 1 1 596.2876 1190.5606 2 1190.5608 -0.0001 0 51.2 7.20E-05 K TEVNSGFFYK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5902.5902.2.dta 27 1 IPI00027626.3 T-complex protein 1 subunit zeta 370 58444 15 15 13 13 3613 2042 1 1 1 412.907 1235.6993 3 1235.6986 0.0007 1 30.7 0.0013 K GPNKHTLTQIK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2285.2285.3.dta 27 1 IPI00027626.3 T-complex protein 1 subunit zeta 370 58444 15 15 13 13 3823 7238 1 1 1 631.8362 1261.6579 2 1261.6554 0.0025 0 55.83 6.50E-05 K GIDPFSLDALSK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7794.7794.2.dta 27 1 IPI00027626.3 T-complex protein 1 subunit zeta 370 58444 15 15 13 13 4345 3803 1 1 1 668.3607 1334.7068 2 1334.7081 -0.0014 1 66.67 1.60E-06 R IITEGFEAAKEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4230.4230.2.dta 27 1 IPI00027626.3 T-complex protein 1 subunit zeta 370 58444 15 15 13 13 4346 3795 1 1 1 445.9102 1334.7087 3 1334.7081 0.0006 1 29.71 0.0029 R IITEGFEAAKEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4222.4222.3.dta 27 1 IPI00027626.3 T-complex protein 1 subunit zeta 370 58444 15 15 13 13 5151 4865 1 1 1 724.3614 1446.7083 2 1446.7137 -0.0053 1 50.61 5.80E-05 R EMDRETLIDVAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5381.5381.2.dta 27 1 IPI00027626.3 T-complex protein 1 subunit zeta 370 58444 15 15 13 13 5152 4857 1 1 1 483.2449 1446.7128 3 1446.7137 -0.0009 1 31.13 0.009 R EMDRETLIDVAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5372.5372.3.dta 27 1 IPI00027626.3 T-complex protein 1 subunit zeta 370 58444 15 15 13 13 5444 4776 1 1 1 500.2604 1497.7594 3 1497.7576 0.0018 0 31.99 0.0012 K QADLYISEGLHPR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5285.5285.3.dta 27 1 IPI00027626.3 T-complex protein 1 subunit zeta 370 58444 15 15 13 13 6942 6343 1 1 1 881.4714 1760.9282 2 1760.9309 -0.0027 0 88.76 9.10E-09 K VLAQNSGFDLQETLVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6876.6876.2.dta 27 IPI00552590.1 "chaperonin containing TCP1, subunit 6A isoform b" 353 53711 14 14 12 12 58 3892 1 0 0 308.2071 614.3997 2 614.4003 -0.0006 0 27.46 0.018 K IIELK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4327.4327.2.dta 27 IPI00552590.1 "chaperonin containing TCP1, subunit 6A isoform b" 353 53711 14 14 12 12 94 1767 1 0 1 315.1848 628.355 2 628.3544 0.0005 0 29.13 0.0094 R TNLGPK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1986.1986.2.dta 27 IPI00552590.1 "chaperonin containing TCP1, subunit 6A isoform b" 353 53711 14 14 12 12 485 2763 1 0 1 375.6949 749.3752 2 749.3742 0.0011 1 33.56 0.011 R AGMSSLKG - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3069.3069.2.dta 27 IPI00552590.1 "chaperonin containing TCP1, subunit 6A isoform b" 353 53711 14 14 12 12 704 5012 1 0 1 400.735 799.4554 2 799.4552 0.0002 0 40.64 0.0016 R GLQDVLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5539.5539.2.dta 27 IPI00552590.1 "chaperonin containing TCP1, subunit 6A isoform b" 353 53711 14 14 12 12 1836 4119 1 0 1 495.7682 989.5219 2 989.5216 0.0003 0 59.31 3.40E-05 K MLVSGAGDIK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4573.4573.2.dta 27 IPI00552590.1 "chaperonin containing TCP1, subunit 6A isoform b" 353 53711 14 14 12 12 2442 6370 1 0 1 538.8036 1075.5927 2 1075.5913 0.0014 0 43.71 0.00026 K ALQFLEEVK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6903.6903.2.dta 27 IPI00552590.1 "chaperonin containing TCP1, subunit 6A isoform b" 353 53711 14 14 12 12 3209 5368 1 0 1 596.2876 1190.5606 2 1190.5608 -0.0001 0 51.2 7.20E-05 K TEVNSGFFYK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5902.5902.2.dta 27 IPI00552590.1 "chaperonin containing TCP1, subunit 6A isoform b" 353 53711 14 14 12 12 3613 2042 1 0 1 412.907 1235.6993 3 1235.6986 0.0007 1 30.7 0.0013 K GPNKHTLTQIK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2285.2285.3.dta 27 IPI00552590.1 "chaperonin containing TCP1, subunit 6A isoform b" 353 53711 14 14 12 12 3823 7238 1 0 1 631.8362 1261.6579 2 1261.6554 0.0025 0 55.83 6.50E-05 K GIDPFSLDALSK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7794.7794.2.dta 27 IPI00552590.1 "chaperonin containing TCP1, subunit 6A isoform b" 353 53711 14 14 12 12 4345 3803 1 0 1 668.3607 1334.7068 2 1334.7081 -0.0014 1 66.67 1.60E-06 R IITEGFEAAKEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4230.4230.2.dta 27 IPI00552590.1 "chaperonin containing TCP1, subunit 6A isoform b" 353 53711 14 14 12 12 4346 3795 1 0 1 445.9102 1334.7087 3 1334.7081 0.0006 1 29.71 0.0029 R IITEGFEAAKEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4222.4222.3.dta 27 IPI00552590.1 "chaperonin containing TCP1, subunit 6A isoform b" 353 53711 14 14 12 12 5151 4865 1 0 1 724.3614 1446.7083 2 1446.7137 -0.0053 1 50.61 5.80E-05 R EMDRETLIDVAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5381.5381.2.dta 27 IPI00552590.1 "chaperonin containing TCP1, subunit 6A isoform b" 353 53711 14 14 12 12 5152 4857 1 0 1 483.2449 1446.7128 3 1446.7137 -0.0009 1 31.13 0.009 R EMDRETLIDVAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5372.5372.3.dta 27 IPI00552590.1 "chaperonin containing TCP1, subunit 6A isoform b" 353 53711 14 14 12 12 6942 6343 1 0 1 881.4714 1760.9282 2 1760.9309 -0.0027 0 88.76 9.10E-09 K VLAQNSGFDLQETLVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6876.6876.2.dta 27 IPI00791107.1 Protein 102 18091 2 2 2 2 3613 2042 1 0 1 412.907 1235.6993 3 1235.6986 0.0007 1 30.7 0.0013 K GPNKHTLTQIK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2285.2285.3.dta 27 IPI00791107.1 Protein 102 18091 2 2 2 2 6942 6343 1 0 1 881.4714 1760.9282 2 1760.9309 -0.0027 0 88.76 9.10E-09 K VLAQNSGFDLQETLVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6876.6876.2.dta 27 IPI00798268.1 12 kDa protein 98 12318 2 2 2 2 485 2763 1 0 1 375.6949 749.3752 2 749.3742 0.0011 1 33.56 0.011 R AGMSSLKG - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3069.3069.2.dta 27 IPI00798268.1 12 kDa protein 98 12318 2 2 2 2 6942 6343 1 0 1 881.4714 1760.9282 2 1760.9309 -0.0027 0 88.76 9.10E-09 K VLAQNSGFDLQETLVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6876.6876.2.dta 27 IPI00220656.4 T-complex protein 1 subunit zeta-2 96 58299 5 5 5 5 94 1767 1 0 1 315.1848 628.355 2 628.3544 0.0005 0 29.13 0.0094 R TNLGPK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1986.1986.2.dta 27 IPI00220656.4 T-complex protein 1 subunit zeta-2 96 58299 5 5 5 5 704 5012 1 0 1 400.735 799.4554 2 799.4552 0.0002 0 40.64 0.0016 R GLQDVLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5539.5539.2.dta 27 IPI00220656.4 T-complex protein 1 subunit zeta-2 96 58299 5 5 5 5 3209 5368 1 0 1 596.2876 1190.5606 2 1190.5608 -0.0001 0 51.2 7.20E-05 K TEVNSGFFYK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5902.5902.2.dta 27 IPI00220656.4 T-complex protein 1 subunit zeta-2 96 58299 5 5 5 5 3823 7238 2 0 1 631.8362 1261.6579 2 1261.6554 0.0025 0 30.29 0.023 K GIDPFSLDSLAK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7794.7794.2.dta 27 IPI00220656.4 T-complex protein 1 subunit zeta-2 96 58299 5 5 5 5 5444 4776 1 0 1 500.2604 1497.7594 3 1497.7576 0.0018 0 31.99 0.0012 K QADLYISEGLHPR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5285.5285.3.dta 27 IPI00797484.1 17 kDa protein 88 17285 3 3 3 3 58 3892 1 0 0 308.2071 614.3997 2 614.4003 -0.0006 0 27.46 0.018 K IIELK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4327.4327.2.dta 27 IPI00797484.1 17 kDa protein 88 17285 3 3 3 3 3209 5368 1 0 1 596.2876 1190.5606 2 1190.5608 -0.0001 0 51.2 7.20E-05 K TEVNSGFFYK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5902.5902.2.dta 27 IPI00797484.1 17 kDa protein 88 17285 3 3 3 3 3823 7238 1 0 1 631.8362 1261.6579 2 1261.6554 0.0025 0 55.83 6.50E-05 K GIDPFSLDALSK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7794.7794.2.dta 27 IPI00744567.1 "Similar to T-complex protein 1, zeta subunit" 32 20938 1 1 1 1 5444 4776 1 0 1 500.2604 1497.7594 3 1497.7576 0.0018 0 31.99 0.0012 K QADLYISEGLHPR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5285.5285.3.dta 28 1 IPI00302927.6 T-complex protein 1 subunit delta 337 58401 14 14 12 12 578 2083 1 1 1 384.6987 767.3829 2 767.3813 0.0016 0 17.84 0.021 R LTEYSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2330.2330.2.dta 28 1 IPI00302927.6 T-complex protein 1 subunit delta 337 58401 14 14 12 12 1491 6367 1 1 1 467.2918 932.569 2 932.5695 -0.0005 0 48.42 3.90E-05 R AYILNLVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6900.6900.2.dta 28 1 IPI00302927.6 T-complex protein 1 subunit delta 337 58401 14 14 12 12 1646 3834 1 1 1 479.7633 957.5121 2 957.5131 -0.001 0 46.73 0.00019 K LVIEEAER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4264.4264.2.dta 28 1 IPI00302927.6 T-complex protein 1 subunit delta 337 58401 14 14 12 12 2928 4888 1 1 1 573.3201 1144.6256 2 1144.6274 -0.0018 0 55.05 7.20E-05 K TGCNVLLIQK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5406.5406.2.dta 28 1 IPI00302927.6 T-complex protein 1 subunit delta 337 58401 14 14 12 12 3167 4839 1 1 1 592.316 1182.6175 2 1182.6179 -0.0004 0 38.17 0.0011 R SIHDALCVIR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5353.5353.2.dta 28 1 IPI00302927.6 T-complex protein 1 subunit delta 337 58401 14 14 12 12 4403 3563 1 1 1 672.8585 1343.7024 2 1343.7045 -0.0021 1 31.07 0.0052 R GSNKLVIEEAER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3965.3965.2.dta 28 1 IPI00302927.6 T-complex protein 1 subunit delta 337 58401 14 14 12 12 4404 3545 1 1 1 448.9086 1343.7039 3 1343.7045 -0.0006 1 52.91 0.00012 R GSNKLVIEEAER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3945.3945.3.dta 28 1 IPI00302927.6 T-complex protein 1 subunit delta 337 58401 14 14 12 12 4493 5013 1 1 1 679.3688 1356.723 2 1356.7249 -0.0019 0 54.44 7.50E-05 K VIDPATATSVDLR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5540.5540.2.dta 28 1 IPI00302927.6 T-complex protein 1 subunit delta 337 58401 14 14 12 12 4598 5260 1 1 1 686.8926 1371.7707 2 1371.7722 -0.0014 1 69.28 1.80E-06 R SILKIDDVVNTR - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5792.5792.2.dta 28 1 IPI00302927.6 T-complex protein 1 subunit delta 337 58401 14 14 12 12 4599 5262 1 1 1 458.2647 1371.7724 3 1371.7722 0.0002 1 44.48 7.70E-05 R SILKIDDVVNTR - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5794.5794.3.dta 28 1 IPI00302927.6 T-complex protein 1 subunit delta 337 58401 14 14 12 12 5212 8169 1 1 1 728.8923 1455.77 2 1455.7722 -0.0022 0 41.48 0.0014 R DALSDLALHFLNK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8798.8798.2.dta 28 1 IPI00302927.6 T-complex protein 1 subunit delta 337 58401 14 14 12 12 5213 4874 1 1 1 486.2645 1455.7718 3 1455.7722 -0.0004 0 39.3 0.0018 K GIHPTIISESFQK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5391.5391.3.dta 28 1 IPI00302927.6 T-complex protein 1 subunit delta 337 58401 14 14 12 12 7922 4966 1 1 1 697.3621 2089.0645 3 2089.0725 -0.008 1 34.39 0.0006 K MIQDGKGDVTITNDGATILK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5491.5491.3.dta 28 1 IPI00302927.6 T-complex protein 1 subunit delta 337 58401 14 14 12 12 8016 6894 1 1 1 730.0562 2187.1468 3 2187.1457 0.0011 1 35.02 0.00052 K KLGGTIDDCELVEGLVLTQK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7428.7428.3.dta 28 2 IPI00010720.1 T-complex protein 1 subunit epsilon 136 60089 6 6 5 5 813 5783 1 0 1 410.258 818.5014 2 818.5014 0 0 32.88 0.0022 R AVTIFIR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6318.6318.2.dta 28 2 IPI00010720.1 T-complex protein 1 subunit epsilon 136 60089 6 6 5 5 2063 4359 1 0 1 510.7641 1019.5137 2 1019.5144 -0.0007 0 40.34 0.0016 K MLVIEQCK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4833.4833.2.dta 28 2 IPI00010720.1 T-complex protein 1 subunit epsilon 136 60089 6 6 5 5 3167 4839 1 0 1 592.316 1182.6175 2 1182.6179 -0.0004 0 38.17 0.0011 R SLHDALCVIR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5353.5353.2.dta 28 2 IPI00010720.1 T-complex protein 1 subunit epsilon 136 60089 6 6 5 5 4762 6092 1 0 1 696.3738 1390.7331 2 1390.7344 -0.0013 1 72.85 4.30E-07 R DVDFELIKVEGK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6627.6627.2.dta 28 2 IPI00010720.1 T-complex protein 1 subunit epsilon 136 60089 6 6 5 5 4763 6091 1 0 1 464.5857 1390.7352 3 1390.7344 0.0008 1 25.39 0.0075 R DVDFELIKVEGK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6626.6626.3.dta 28 2 IPI00010720.1 T-complex protein 1 subunit epsilon 136 60089 6 6 5 5 6022 5944 1 0 1 805.9506 1609.8866 2 1609.8902 -0.0036 0 30.11 0.0051 K IAILTCPFEPPKPK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6478.6478.2.dta 28 IPI00794046.1 20 kDa protein 104 19834 5 5 4 4 578 2083 1 0 1 384.6987 767.3829 2 767.3813 0.0016 0 17.84 0.021 R LTEYSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2330.2330.2.dta 28 IPI00794046.1 20 kDa protein 104 19834 5 5 4 4 1646 3834 1 0 1 479.7633 957.5121 2 957.5131 -0.001 0 46.73 0.00019 K LVIEEAER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4264.4264.2.dta 28 IPI00794046.1 20 kDa protein 104 19834 5 5 4 4 3167 4839 1 0 1 592.316 1182.6175 2 1182.6179 -0.0004 0 38.17 0.0011 R SIHDALCVIR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5353.5353.2.dta 28 IPI00794046.1 20 kDa protein 104 19834 5 5 4 4 4403 3563 1 0 1 672.8585 1343.7024 2 1343.7045 -0.0021 1 31.07 0.0052 R GSNKLVIEEAER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3965.3965.2.dta 28 IPI00794046.1 20 kDa protein 104 19834 5 5 4 4 4404 3545 1 0 1 448.9086 1343.7039 3 1343.7045 -0.0006 1 52.91 0.00012 R GSNKLVIEEAER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3945.3945.3.dta 28 IPI00789017.1 30 kDa protein 89 29695 3 3 2 2 4762 6092 1 0 1 696.3738 1390.7331 2 1390.7344 -0.0013 1 72.85 4.30E-07 R DVDFELIKVEGK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6627.6627.2.dta 28 IPI00789017.1 30 kDa protein 89 29695 3 3 2 2 4763 6091 1 0 1 464.5857 1390.7352 3 1390.7344 0.0008 1 25.39 0.0075 R DVDFELIKVEGK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6626.6626.3.dta 28 IPI00789017.1 30 kDa protein 89 29695 3 3 2 2 6022 5944 1 0 1 805.9506 1609.8866 2 1609.8902 -0.0036 0 30.11 0.0051 K IAILTCPFEPPKPK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6478.6478.2.dta 29 1 IPI00009771.6 Lamin B2 305 70020 9 9 9 9 2335 2487 1 1 1 530.7908 1059.5671 2 1059.5673 -0.0001 1 29.6 0.023 R RLVEVDSSR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2769.2769.2.dta 29 1 IPI00009771.6 Lamin B2 305 70020 9 9 9 9 2531 5245 1 1 1 544.7819 1087.5492 2 1087.5509 -0.0018 0 72.31 1.40E-06 R GLESDVAELR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5777.5777.2.dta 29 1 IPI00009771.6 Lamin B2 305 70020 9 9 9 9 2533 1907 1 1 1 544.788 1087.5615 2 1087.5622 -0.0007 1 34.71 0.0064 R VLDETARER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2138.2138.2.dta 29 1 IPI00009771.6 Lamin B2 305 70020 9 9 9 9 2781 3311 1 1 1 562.8059 1123.5973 2 1123.5986 -0.0013 0 34.76 0.00064 R AGGPATPLSPTR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3687.3687.2.dta 29 1 IPI00009771.6 Lamin B2 305 70020 9 9 9 9 3644 5307 1 1 1 415.2318 1242.6735 3 1242.6721 0.0015 1 28.33 0.003 R VKDLESLFHR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5840.5840.3.dta 29 1 IPI00009771.6 Lamin B2 305 70020 9 9 9 9 3855 2000 1 1 1 634.8073 1267.6001 2 1267.6004 -0.0003 0 110.35 9.40E-11 R ATSSSSGSLSATGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2239.2239.2.dta 29 1 IPI00009771.6 Lamin B2 305 70020 9 9 9 9 4054 4434 1 1 1 649.7911 1297.5677 2 1297.5687 -0.001 0 45.58 5.30E-05 K GQSSWGTGESFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4914.4914.2.dta 29 1 IPI00009771.6 Lamin B2 305 70020 9 9 9 9 5459 4733 1 1 1 752.3766 1502.7386 2 1502.7399 -0.0013 0 83.61 1.40E-08 R TVLVNADGEEVAMR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5238.5238.2.dta 29 1 IPI00009771.6 Lamin B2 305 70020 9 9 9 9 6899 5743 1 1 1 584.6465 1750.9176 3 1750.9141 0.0035 1 23.82 0.0058 R QVLEGEEIAYKFTPK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6278.6278.3.dta 30 1 IPI00376317.3 autoantigen RCD8 300 152992 12 12 11 11 1133 4073 1 1 1 437.2428 872.471 2 872.4716 -0.0006 0 40.92 0.00042 K NLTDAIAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4523.4523.2.dta 30 1 IPI00376317.3 autoantigen RCD8 300 152992 12 12 11 11 1767 2980 1 1 1 489.2663 976.518 2 976.5189 -0.0009 0 34.05 0.0013 R VISVSTSER T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3308.3308.2.dta 30 1 IPI00376317.3 autoantigen RCD8 300 152992 12 12 11 11 2839 4613 1 1 1 567.7987 1133.5829 2 1133.5829 -0.0001 0 27.23 0.0028 R FLITGADQNR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5108.5108.2.dta 30 1 IPI00376317.3 autoantigen RCD8 300 152992 12 12 11 11 2879 2956 1 1 1 570.2932 1138.5718 2 1138.5731 -0.0013 0 48.59 0.00023 R HSQEELLQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3282.3282.2.dta 30 1 IPI00376317.3 autoantigen RCD8 300 152992 12 12 11 11 5251 6983 1 1 1 732.8901 1463.7657 2 1463.766 -0.0003 0 60.33 1.40E-05 R EAFQSVVLPAFEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7518.7518.2.dta 30 1 IPI00376317.3 autoantigen RCD8 300 152992 12 12 11 11 5643 4063 1 1 1 769.3823 1536.75 2 1536.7519 -0.0019 0 52.89 1.10E-05 K EVEIVASSDSSISSK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4512.4512.2.dta 30 1 IPI00376317.3 autoantigen RCD8 300 152992 12 12 11 11 5655 4555 1 1 1 513.6144 1537.8213 3 1537.8212 0.0001 1 23.02 0.017 R EQEAREPVLAQLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5045.5045.3.dta 30 1 IPI00376317.3 autoantigen RCD8 300 152992 12 12 11 11 6797 6362 1 1 1 866.3812 1730.7479 2 1730.7505 -0.0026 0 91.77 2.50E-09 K SCQAMFQQINDSFR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6895.6895.2.dta 30 1 IPI00376317.3 autoantigen RCD8 300 152992 12 12 11 11 7099 6403 1 1 1 602.3016 1803.8829 3 1803.8825 0.0004 0 20.43 0.048 R LGTQEYLQQLESHMK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6936.6936.3.dta 30 1 IPI00376317.3 autoantigen RCD8 300 152992 12 12 11 11 7168 5249 1 1 1 607.6322 1819.8748 3 1819.8774 -0.0027 0 20.69 0.017 R LGTQEYLQQLESHMK S Oxidation (M) 0.000000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5781.5781.3.dta 30 1 IPI00376317.3 autoantigen RCD8 300 152992 12 12 11 11 7293 4564 1 1 1 617.6611 1849.9614 3 1849.9646 -0.0032 1 24.55 0.005 R ELAELRHSQEELLQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5055.5055.3.dta 30 1 IPI00376317.3 autoantigen RCD8 300 152992 12 12 11 11 7845 5426 1 1 1 676.675 2027.0031 3 2027.0106 -0.0075 0 57.42 6.70E-06 R LCTQLEGLQSTVTGHVER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5961.5961.3.dta 30 IPI00641449.1 "CDNA FLJ46741 fis, clone TRACH3021373, highly similar to Homo sapiens autoantigen" 248 123252 10 10 9 9 1133 4073 1 0 1 437.2428 872.471 2 872.4716 -0.0006 0 40.92 0.00042 K NLTDAIAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4523.4523.2.dta 30 IPI00641449.1 "CDNA FLJ46741 fis, clone TRACH3021373, highly similar to Homo sapiens autoantigen" 248 123252 10 10 9 9 2839 4613 1 0 1 567.7987 1133.5829 2 1133.5829 -0.0001 0 27.23 0.0028 R FLITGADQNR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5108.5108.2.dta 30 IPI00641449.1 "CDNA FLJ46741 fis, clone TRACH3021373, highly similar to Homo sapiens autoantigen" 248 123252 10 10 9 9 2879 2956 1 0 1 570.2932 1138.5718 2 1138.5731 -0.0013 0 48.59 0.00023 R HSQEELLQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3282.3282.2.dta 30 IPI00641449.1 "CDNA FLJ46741 fis, clone TRACH3021373, highly similar to Homo sapiens autoantigen" 248 123252 10 10 9 9 5251 6983 1 0 1 732.8901 1463.7657 2 1463.766 -0.0003 0 60.33 1.40E-05 R EAFQSVVLPAFEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7518.7518.2.dta 30 IPI00641449.1 "CDNA FLJ46741 fis, clone TRACH3021373, highly similar to Homo sapiens autoantigen" 248 123252 10 10 9 9 5655 4555 1 0 1 513.6144 1537.8213 3 1537.8212 0.0001 1 23.02 0.017 R EQEAREPVLAQLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5045.5045.3.dta 30 IPI00641449.1 "CDNA FLJ46741 fis, clone TRACH3021373, highly similar to Homo sapiens autoantigen" 248 123252 10 10 9 9 6797 6362 1 0 1 866.3812 1730.7479 2 1730.7505 -0.0026 0 91.77 2.50E-09 K SCQAMFQQINDSFR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6895.6895.2.dta 30 IPI00641449.1 "CDNA FLJ46741 fis, clone TRACH3021373, highly similar to Homo sapiens autoantigen" 248 123252 10 10 9 9 7099 6403 1 0 1 602.3016 1803.8829 3 1803.8825 0.0004 0 20.43 0.048 R LGTQEYLQQLESHMK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6936.6936.3.dta 30 IPI00641449.1 "CDNA FLJ46741 fis, clone TRACH3021373, highly similar to Homo sapiens autoantigen" 248 123252 10 10 9 9 7168 5249 1 0 1 607.6322 1819.8748 3 1819.8774 -0.0027 0 20.69 0.017 R LGTQEYLQQLESHMK S Oxidation (M) 0.000000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5781.5781.3.dta 30 IPI00641449.1 "CDNA FLJ46741 fis, clone TRACH3021373, highly similar to Homo sapiens autoantigen" 248 123252 10 10 9 9 7293 4564 1 0 1 617.6611 1849.9614 3 1849.9646 -0.0032 1 24.55 0.005 R ELAELRHSQEELLQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5055.5055.3.dta 30 IPI00641449.1 "CDNA FLJ46741 fis, clone TRACH3021373, highly similar to Homo sapiens autoantigen" 248 123252 10 10 9 9 7845 5426 1 0 1 676.675 2027.0031 3 2027.0106 -0.0075 0 57.42 6.70E-06 R LCTQLEGLQSTVTGHVER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5961.5961.3.dta 31 1 IPI00472102.3 61 kDa protein 292 61346 8 8 8 8 118 1947 1 1 0 318.6586 635.3026 2 635.3027 -0.0001 0 32.84 0.0084 K FGADAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2181.2181.2.dta 31 1 IPI00472102.3 61 kDa protein 292 61346 8 8 8 8 1657 2830 1 1 1 480.7595 959.5044 2 959.5036 0.0008 0 61.66 2.00E-05 R VTDALNATR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3142.3142.2.dta 31 1 IPI00472102.3 61 kDa protein 292 61346 8 8 8 8 1981 2459 1 1 1 504.7714 1007.5282 2 1007.5287 -0.0006 1 29.52 0.017 R SIAKEGFEK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2739.2739.2.dta 31 1 IPI00472102.3 61 kDa protein 292 61346 8 8 8 8 4405 5250 1 1 1 672.8606 1343.7066 2 1343.7085 -0.0019 0 65.43 2.80E-06 R TVIIEQSWGSPK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5782.5782.2.dta 31 1 IPI00472102.3 61 kDa protein 292 61346 8 8 8 8 4741 6033 1 1 1 695.355 1388.6955 2 1388.6976 -0.0021 0 70.5 2.50E-07 R GYISPYFINTSK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6568.6568.2.dta 31 1 IPI00472102.3 61 kDa protein 292 61346 8 8 8 8 5969 6901 1 1 1 801.3787 1600.7429 2 1600.7443 -0.0014 0 74.59 2.70E-07 K CEFQDAYVLLSEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7436.7436.2.dta 31 1 IPI00472102.3 61 kDa protein 292 61346 8 8 8 8 6791 6125 1 1 1 577.2841 1728.8303 3 1728.8392 -0.0089 1 55.39 6.40E-06 K CEFQDAYVLLSEKK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6659.6659.3.dta 31 1 IPI00472102.3 61 kDa protein 292 61346 8 8 8 8 8701 4562 1 1 1 854.0874 2559.2404 3 2559.2413 -0.0009 0 48.89 2.60E-05 K LVQDVANNTNEEAGDGTTTATVLAR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5053.5053.3.dta 31 IPI00790763.1 Hypothetical protein HSPD1 (Fragment) 164 25138 5 5 5 5 118 1947 1 0 0 318.6586 635.3026 2 635.3027 -0.0001 0 32.84 0.0084 K FGADAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2181.2181.2.dta 31 IPI00790763.1 Hypothetical protein HSPD1 (Fragment) 164 25138 5 5 5 5 1981 2459 1 0 1 504.7714 1007.5282 2 1007.5287 -0.0006 1 29.52 0.017 R SIAKEGFEK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2739.2739.2.dta 31 IPI00790763.1 Hypothetical protein HSPD1 (Fragment) 164 25138 5 5 5 5 4405 5250 1 0 1 672.8606 1343.7066 2 1343.7085 -0.0019 0 65.43 2.80E-06 R TVIIEQSWGSPK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5782.5782.2.dta 31 IPI00790763.1 Hypothetical protein HSPD1 (Fragment) 164 25138 5 5 5 5 4741 6033 1 0 1 695.355 1388.6955 2 1388.6976 -0.0021 0 70.5 2.50E-07 R GYISPYFINTSK - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6568.6568.2.dta 31 IPI00790763.1 Hypothetical protein HSPD1 (Fragment) 164 25138 5 5 5 5 8701 4562 1 0 1 854.0874 2559.2404 3 2559.2413 -0.0009 0 48.89 2.60E-05 K LVQDVANNTNEEAGDGTTTATVLAR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5053.5053.3.dta 31 IPI00795445.1 17 kDa protein 111 17203 4 4 4 4 118 1947 1 0 0 318.6586 635.3026 2 635.3027 -0.0001 0 32.84 0.0084 K FGADAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2181.2181.2.dta 31 IPI00795445.1 17 kDa protein 111 17203 4 4 4 4 1981 2459 1 0 1 504.7714 1007.5282 2 1007.5287 -0.0006 1 29.52 0.017 R SIAKEGFEK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2739.2739.2.dta 31 IPI00795445.1 17 kDa protein 111 17203 4 4 4 4 4405 5250 1 0 1 672.8606 1343.7066 2 1343.7085 -0.0019 0 65.43 2.80E-06 R TVIIEQSWGSPK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5782.5782.2.dta 31 IPI00795445.1 17 kDa protein 111 17203 4 4 4 4 8701 4562 1 0 1 854.0874 2559.2404 3 2559.2413 -0.0009 0 48.89 2.60E-05 K LVQDVANNTNEEAGDGTTTATVLAR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5053.5053.3.dta 31 IPI00076042.2 Short heat shock protein 60 Hsp60s2 62 27136 1 1 1 1 1657 2830 1 0 1 480.7595 959.5044 2 959.5036 0.0008 0 61.66 2.00E-05 R VTDALNATR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3142.3142.2.dta 32 1 IPI00020127.1 Replication protein A 70 kDa DNA-binding subunit 286 68723 10 10 9 9 216 5554 1 1 1 335.1892 668.3639 2 668.3646 -0.0007 0 37.29 0.0017 R SFIFR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6089.6089.2.dta 32 1 IPI00020127.1 Replication protein A 70 kDa DNA-binding subunit 286 68723 10 10 9 9 453 2435 1 1 1 369.1829 736.3512 2 736.3504 0.0008 0 25.53 0.044 R VSDFGGR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2713.2713.2.dta 32 1 IPI00020127.1 Replication protein A 70 kDa DNA-binding subunit 286 68723 10 10 9 9 3543 7264 1 1 1 616.8315 1231.6485 2 1231.6482 0.0003 0 60.74 6.00E-06 K DSLVDIIGICK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7822.7822.2.dta 32 1 IPI00020127.1 Replication protein A 70 kDa DNA-binding subunit 286 68723 10 10 9 9 4081 7655 1 1 1 651.3904 1300.7663 2 1300.7676 -0.0013 0 25.92 0.0065 R VVILMELEVLK S Oxidation (M) 0.00001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8270.8270.2.dta 32 1 IPI00020127.1 Replication protein A 70 kDa DNA-binding subunit 286 68723 10 10 9 9 4363 2294 1 1 1 447.2211 1338.6416 3 1338.6415 0 1 65.79 2.70E-06 R VKVETYNDESR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2560.2560.3.dta 32 1 IPI00020127.1 Replication protein A 70 kDa DNA-binding subunit 286 68723 10 10 9 9 4364 2299 1 1 1 670.3288 1338.643 2 1338.6415 0.0015 1 57.98 1.00E-05 R VKVETYNDESR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2566.2566.2.dta 32 1 IPI00020127.1 Replication protein A 70 kDa DNA-binding subunit 286 68723 10 10 9 9 4847 5672 1 1 1 701.9007 1401.7868 2 1401.7868 0.0001 0 48.34 2.90E-05 K VVPIASLTPYQSK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6208.6208.2.dta 32 1 IPI00020127.1 Replication protein A 70 kDa DNA-binding subunit 286 68723 10 10 9 9 5156 6319 1 1 1 483.2657 1446.7751 3 1446.7752 -0.0001 1 40.98 0.00019 K SKDSLVDIIGICK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6852.6852.3.dta 32 1 IPI00020127.1 Replication protein A 70 kDa DNA-binding subunit 286 68723 10 10 9 9 5385 1800 1 1 1 743.368 1484.7215 2 1484.7219 -0.0004 0 58.14 3.50E-06 K AAGPSLSHTSGGTQSK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2022.2022.2.dta 32 1 IPI00020127.1 Replication protein A 70 kDa DNA-binding subunit 286 68723 10 10 9 9 7916 6821 1 1 1 695.9912 2084.9516 3 2084.9552 -0.0035 1 39.84 0.00046 K DKNEQAFEEVFQNANFR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7356.7356.3.dta 33 1 IPI00004860.2 "Isoform Complexed of Arginyl-tRNA synthetase, cytoplasmic" 279 76129 10 10 10 10 2803 3613 1 1 1 565.3083 1128.6021 2 1128.6026 -0.0005 0 49.63 0.00023 R LLQQEEEIK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4021.4021.2.dta 33 1 IPI00004860.2 "Isoform Complexed of Arginyl-tRNA synthetase, cytoplasmic" 279 76129 10 10 10 10 3654 6074 1 1 1 415.5726 1243.6959 3 1243.6958 0.0001 1 25.94 0.019 R LMDLLGEGLKR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6609.6609.3.dta 33 1 IPI00004860.2 "Isoform Complexed of Arginyl-tRNA synthetase, cytoplasmic" 279 76129 10 10 10 10 3809 7038 1 1 1 631.3085 1260.6025 2 1260.6026 -0.0001 0 46.38 8.50E-05 R LNDYIFSFDK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7579.7579.2.dta 33 1 IPI00004860.2 "Isoform Complexed of Arginyl-tRNA synthetase, cytoplasmic" 279 76129 10 10 10 10 4006 5559 1 1 1 645.3574 1288.7003 2 1288.7027 -0.0024 0 46.89 0.00017 K VIVDFSSPNIAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6094.6094.2.dta 33 1 IPI00004860.2 "Isoform Complexed of Arginyl-tRNA synthetase, cytoplasmic" 279 76129 10 10 10 10 4114 5135 1 1 1 652.3314 1302.6482 2 1302.6489 -0.0007 0 52.58 4.00E-05 R LANIDEEMLQK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5666.5666.2.dta 33 1 IPI00004860.2 "Isoform Complexed of Arginyl-tRNA synthetase, cytoplasmic" 279 76129 10 10 10 10 4391 6356 1 1 1 671.8946 1341.7746 2 1341.7769 -0.0022 0 49.37 2.70E-05 K GFDILGIKPVQR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6889.6889.2.dta 33 1 IPI00004860.2 "Isoform Complexed of Arginyl-tRNA synthetase, cytoplasmic" 279 76129 10 10 10 10 4865 8092 1 1 1 703.863 1405.7115 2 1405.7131 -0.0016 0 67.51 9.50E-07 R MLLCEAVAAVMAK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8721.8721.2.dta 33 1 IPI00004860.2 "Isoform Complexed of Arginyl-tRNA synthetase, cytoplasmic" 279 76129 10 10 10 10 6283 7458 1 1 1 821.9834 1641.9522 2 1641.9528 -0.0006 0 37.75 0.00063 K IVFVPGCSIPLTIVK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8044.8044.2.dta 33 1 IPI00004860.2 "Isoform Complexed of Arginyl-tRNA synthetase, cytoplasmic" 279 76129 10 10 10 10 7704 4638 1 1 1 654.3119 1959.9138 3 1959.9174 -0.0035 1 19.3 0.015 K SDGGYTYDTSDLAAIKQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5135.5135.3.dta 33 1 IPI00004860.2 "Isoform Complexed of Arginyl-tRNA synthetase, cytoplasmic" 279 76129 10 10 10 10 7983 6468 1 1 1 1076.5675 2151.1205 2 2151.1212 -0.0007 0 56.68 5.20E-06 K AAYPDLENPPLLVTPSQQAK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6999.6999.2.dta 33 IPI00759723.1 "Isoform Monomeric of Arginyl-tRNA synthetase, cytoplasmic" 255 67725 9 9 9 9 3654 6074 1 0 1 415.5726 1243.6959 3 1243.6958 0.0001 1 25.94 0.019 R LMDLLGEGLKR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6609.6609.3.dta 33 IPI00759723.1 "Isoform Monomeric of Arginyl-tRNA synthetase, cytoplasmic" 255 67725 9 9 9 9 3809 7038 1 0 1 631.3085 1260.6025 2 1260.6026 -0.0001 0 46.38 8.50E-05 R LNDYIFSFDK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7579.7579.2.dta 33 IPI00759723.1 "Isoform Monomeric of Arginyl-tRNA synthetase, cytoplasmic" 255 67725 9 9 9 9 4006 5559 1 0 1 645.3574 1288.7003 2 1288.7027 -0.0024 0 46.89 0.00017 K VIVDFSSPNIAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6094.6094.2.dta 33 IPI00759723.1 "Isoform Monomeric of Arginyl-tRNA synthetase, cytoplasmic" 255 67725 9 9 9 9 4114 5135 1 0 1 652.3314 1302.6482 2 1302.6489 -0.0007 0 52.58 4.00E-05 R LANIDEEMLQK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5666.5666.2.dta 33 IPI00759723.1 "Isoform Monomeric of Arginyl-tRNA synthetase, cytoplasmic" 255 67725 9 9 9 9 4391 6356 1 0 1 671.8946 1341.7746 2 1341.7769 -0.0022 0 49.37 2.70E-05 K GFDILGIKPVQR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6889.6889.2.dta 33 IPI00759723.1 "Isoform Monomeric of Arginyl-tRNA synthetase, cytoplasmic" 255 67725 9 9 9 9 4865 8092 1 0 1 703.863 1405.7115 2 1405.7131 -0.0016 0 67.51 9.50E-07 R MLLCEAVAAVMAK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8721.8721.2.dta 33 IPI00759723.1 "Isoform Monomeric of Arginyl-tRNA synthetase, cytoplasmic" 255 67725 9 9 9 9 6283 7458 1 0 1 821.9834 1641.9522 2 1641.9528 -0.0006 0 37.75 0.00063 K IVFVPGCSIPLTIVK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8044.8044.2.dta 33 IPI00759723.1 "Isoform Monomeric of Arginyl-tRNA synthetase, cytoplasmic" 255 67725 9 9 9 9 7704 4638 1 0 1 654.3119 1959.9138 3 1959.9174 -0.0035 1 19.3 0.015 K SDGGYTYDTSDLAAIKQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5135.5135.3.dta 33 IPI00759723.1 "Isoform Monomeric of Arginyl-tRNA synthetase, cytoplasmic" 255 67725 9 9 9 9 7983 6468 1 0 1 1076.5675 2151.1205 2 2151.1212 -0.0007 0 56.68 5.20E-06 K AAYPDLENPPLLVTPSQQAK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6999.6999.2.dta 34 1 IPI00257508.4 Dihydropyrimidinase-related protein 2 279 62711 7 7 7 7 1343 5548 1 1 1 454.753 907.4915 2 907.4916 -0.0001 0 29.18 0.0079 K VFNLYPR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6083.6083.2.dta 34 1 IPI00257508.4 Dihydropyrimidinase-related protein 2 279 62711 7 7 7 7 2114 2907 1 1 1 516.2771 1030.5396 2 1030.5407 -0.0011 0 75.52 8.60E-07 K SSAEVIAQAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3228.3228.2.dta 34 1 IPI00257508.4 Dihydropyrimidinase-related protein 2 279 62711 7 7 7 7 4280 5601 1 1 1 662.3859 1322.7573 2 1322.7558 0.0015 0 31.97 0.001 K QIGENLIVPGGVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6137.6137.2.dta 34 1 IPI00257508.4 Dihydropyrimidinase-related protein 2 279 62711 7 7 7 7 6065 5263 1 1 1 810.8997 1619.7848 2 1619.7865 -0.0018 0 87.47 7.20E-09 R GLYDGPVCEVSVTPK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5795.5795.2.dta 34 1 IPI00257508.4 Dihydropyrimidinase-related protein 2 279 62711 7 7 7 7 6782 4886 1 1 0 863.4069 1724.7992 2 1724.8039 -0.0048 0 47.12 3.80E-05 K MDENQFVAVTSTNAAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5404.5404.2.dta 34 1 IPI00257508.4 Dihydropyrimidinase-related protein 2 279 62711 7 7 7 7 7170 5521 1 1 1 910.9802 1819.9459 2 1819.9502 -0.0043 0 78.45 4.40E-08 R AITIANQTNCPLYITK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6057.6057.2.dta 34 1 IPI00257508.4 Dihydropyrimidinase-related protein 2 279 62711 7 7 7 7 8000 5561 1 1 1 723.6935 2168.0586 3 2168.061 -0.0024 0 40.53 0.00024 R NLHQSGFSLSGAQIDDNIPR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6096.6096.3.dta 34 2 IPI00029111.2 DPYSL3 protein 214 74320 5 5 5 5 2116 4262 1 0 1 516.2777 1030.5409 2 1030.5407 0.0002 0 71.66 1.50E-06 K SAADLISQAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4728.4728.2.dta 34 2 IPI00029111.2 DPYSL3 protein 214 74320 5 5 5 5 2899 4821 1 0 1 571.3235 1140.6325 2 1140.6325 0 0 52.16 5.90E-05 R GAPLVVICQGK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5333.5333.2.dta 34 2 IPI00029111.2 DPYSL3 protein 214 74320 5 5 5 5 6782 4886 1 0 0 863.4069 1724.7992 2 1724.8039 -0.0048 0 47.12 3.80E-05 K MDENQFVAVTSTNAAK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5404.5404.2.dta 34 2 IPI00029111.2 DPYSL3 protein 214 74320 5 5 5 5 7012 5256 1 0 1 890.4681 1778.9216 2 1778.9237 -0.0021 0 89.95 9.10E-09 R AITIASQTNCPLYVTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5788.5788.2.dta 34 2 IPI00029111.2 DPYSL3 protein 214 74320 5 5 5 5 7847 4753 1 0 1 677.6669 2029.979 3 2029.9818 -0.0028 0 33.49 0.00072 R NLHQSGFSLSGTQVDEGVR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5260.5260.3.dta 34 IPI00106642.4 Dihydropyrimidinase-like 2 178 67545 4 4 4 4 2114 2907 1 0 1 516.2771 1030.5396 2 1030.5407 -0.0011 0 75.52 8.60E-07 K SSAEVIAQAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3228.3228.2.dta 34 IPI00106642.4 Dihydropyrimidinase-like 2 178 67545 4 4 4 4 4280 5601 1 0 1 662.3859 1322.7573 2 1322.7558 0.0015 0 31.97 0.001 K QIGENLIVPGGVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6137.6137.2.dta 34 IPI00106642.4 Dihydropyrimidinase-like 2 178 67545 4 4 4 4 6782 4886 1 0 0 863.4069 1724.7992 2 1724.8039 -0.0048 0 47.12 3.80E-05 K MDENQFVAVTSTNAAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5404.5404.2.dta 34 IPI00106642.4 Dihydropyrimidinase-like 2 178 67545 4 4 4 4 7170 5521 1 0 1 910.9802 1819.9459 2 1819.9502 -0.0043 0 78.45 4.40E-08 R AITIANQTNCPLYITK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6057.6057.2.dta 34 IPI00414123.4 Dihydropyrimidinase-related protein 1 65 62487 2 2 2 2 4280 5601 1 0 1 662.3859 1322.7573 2 1322.7558 0.0015 0 31.97 0.001 K QIGENLIVPGGVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6137.6137.2.dta 34 IPI00414123.4 Dihydropyrimidinase-related protein 1 65 62487 2 2 2 2 6782 4886 1 0 0 863.4069 1724.7992 2 1724.8039 -0.0048 0 47.12 3.80E-05 K MDENQFVAVTSTNAAK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5404.5404.2.dta 34 IPI00790378.1 6 kDa protein 32 6114 1 1 1 1 4280 5601 1 0 1 662.3859 1322.7573 2 1322.7558 0.0015 0 31.97 0.001 K QIGENLIVPGGVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6137.6137.2.dta 35 1 IPI00011603.2 26S proteasome non-ATPase regulatory subunit 3 271 61054 10 10 9 9 3364 3258 1 1 1 402.5648 1204.6726 3 1204.6716 0.001 1 29.93 0.013 R RLNHYVLYK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3625.3625.3.dta 35 1 IPI00011603.2 26S proteasome non-ATPase regulatory subunit 3 271 61054 10 10 9 9 4904 5062 1 1 1 706.8489 1411.6833 2 1411.6844 -0.0011 0 67.12 5.10E-07 K AVQGFFTSNNATR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5592.5592.2.dta 35 1 IPI00011603.2 26S proteasome non-ATPase regulatory subunit 3 271 61054 10 10 9 9 5437 6722 1 1 1 499.2766 1494.8078 3 1494.8082 -0.0004 1 46.84 5.10E-05 R VYEFLDKLDVVR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7258.7258.3.dta 35 1 IPI00011603.2 26S proteasome non-ATPase regulatory subunit 3 271 61054 10 10 9 9 5746 7686 1 1 1 777.92 1553.8254 2 1553.8276 -0.0022 0 30.25 0.0015 R SLMPYFLLTQAVR T Oxidation (M) 0.0010000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8306.8306.2.dta 35 1 IPI00011603.2 26S proteasome non-ATPase regulatory subunit 3 271 61054 10 10 9 9 6284 4827 1 1 1 548.5948 1642.7625 3 1642.7627 -0.0002 0 25.68 0.0039 R NYLHYSLYDQAEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5340.5340.3.dta 35 1 IPI00011603.2 26S proteasome non-ATPase regulatory subunit 3 271 61054 10 10 9 9 6325 8085 1 1 1 825.4514 1648.8883 2 1648.8896 -0.0014 0 41.02 0.00017 R HDADGQATLLNLLLR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8714.8714.2.dta 35 1 IPI00011603.2 26S proteasome non-ATPase regulatory subunit 3 271 61054 10 10 9 9 6326 8075 1 1 1 550.6367 1648.8883 3 1648.8896 -0.0013 0 20.19 0.016 R HDADGQATLLNLLLR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8705.8705.3.dta 35 1 IPI00011603.2 26S proteasome non-ATPase regulatory subunit 3 271 61054 10 10 9 9 6341 3719 1 1 1 551.2935 1650.8587 3 1650.8689 -0.0102 1 22.77 0.0073 K AIRDGVIEASINHEK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4138.4138.3.dta 35 1 IPI00011603.2 26S proteasome non-ATPase regulatory subunit 3 271 61054 10 10 9 9 6382 5187 1 1 1 831.3857 1660.7569 2 1660.7594 -0.0024 0 65.46 7.30E-07 K SVFPEQANNNEWAR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5719.5719.2.dta 35 1 IPI00011603.2 26S proteasome non-ATPase regulatory subunit 3 271 61054 10 10 9 9 6486 6422 1 1 1 837.932 1673.8495 2 1673.8512 -0.0017 0 76.25 4.40E-07 K LQLDSPEDAEFIVAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6954.6954.2.dta 35 IPI00383659.1 Proteasome subunit p58 23 13463 1 1 1 1 6341 3719 1 0 1 551.2935 1650.8587 3 1650.8689 -0.0102 1 22.77 0.0073 K AIRDGVIEASINHEK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4138.4138.3.dta 36 1 IPI00012074.3 Heterogeneous nuclear ribonucleoprotein R 263 71184 11 11 10 10 110 4790 1 1 0 317.208 632.4015 2 632.401 0.0005 0 20.73 0.015 K VLFVR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5300.5300.2.dta 36 1 IPI00012074.3 Heterogeneous nuclear ribonucleoprotein R 263 71184 11 11 10 10 1054 5145 1 1 0 430.7657 859.5168 2 859.5167 0.0001 0 35.96 0.0022 R LFVGSIPK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5676.5676.2.dta 36 1 IPI00012074.3 Heterogeneous nuclear ribonucleoprotein R 263 71184 11 11 10 10 1999 5730 1 1 0 506.7512 1011.4878 2 1011.4882 -0.0004 0 55.06 3.00E-05 K SAFLCGVMK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6265.6265.2.dta 36 1 IPI00012074.3 Heterogeneous nuclear ribonucleoprotein R 263 71184 11 11 10 10 2657 6720 1 1 1 554.7794 1107.5443 2 1107.5448 -0.0005 0 32.96 0.0038 K ENILEEFSK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7256.7256.2.dta 36 1 IPI00012074.3 Heterogeneous nuclear ribonucleoprotein R 263 71184 11 11 10 10 3265 4667 1 1 1 600.3063 1198.598 2 1198.5982 -0.0002 1 28.8 0.0054 K SFSEFGKLER V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5166.5166.2.dta 36 1 IPI00012074.3 Heterogeneous nuclear ribonucleoprotein R 263 71184 11 11 10 10 5103 3773 1 1 0 720.3759 1438.7372 2 1438.7416 -0.0045 1 45.44 7.00E-05 R TGYTLDVTTGQRK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4198.4198.2.dta 36 1 IPI00012074.3 Heterogeneous nuclear ribonucleoprotein R 263 71184 11 11 10 10 5228 7576 1 1 1 487.5995 1459.7768 3 1459.777 -0.0001 0 45.14 0.00014 R NLATTVTEEILEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8177.8177.3.dta 36 1 IPI00012074.3 Heterogeneous nuclear ribonucleoprotein R 263 71184 11 11 10 10 5229 7570 1 1 1 730.8959 1459.7773 2 1459.777 0.0004 0 96.07 1.00E-09 R NLATTVTEEILEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8171.8171.2.dta 36 1 IPI00012074.3 Heterogeneous nuclear ribonucleoprotein R 263 71184 11 11 10 10 5657 5063 1 1 1 513.924 1538.7502 3 1538.7518 -0.0016 1 26.75 0.0031 K LKDYAFVHFEDR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5593.5593.3.dta 36 1 IPI00012074.3 Heterogeneous nuclear ribonucleoprotein R 263 71184 11 11 10 10 6015 7970 1 1 1 805.4025 1608.7904 2 1608.7923 -0.0019 0 33.92 0.0021 R DLYEDELVPLFEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8600.8600.2.dta 36 1 IPI00012074.3 Heterogeneous nuclear ribonucleoprotein R 263 71184 11 11 10 10 6926 4208 1 1 1 586.9296 1757.7671 3 1757.7685 -0.0015 0 24.48 0.0051 R STAYEDYYYHPPPR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4669.4669.3.dta 36 2 IPI00402183.2 Isoform 3 of Heterogeneous nuclear ribonucleoprotein Q 260 62845 11 11 11 11 110 4790 1 0 0 317.208 632.4015 2 632.401 0.0005 0 20.73 0.015 K VLFVR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5300.5300.2.dta 36 2 IPI00402183.2 Isoform 3 of Heterogeneous nuclear ribonucleoprotein Q 260 62845 11 11 11 11 1054 5145 1 0 0 430.7657 859.5168 2 859.5167 0.0001 0 35.96 0.0022 R LFVGSIPK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5676.5676.2.dta 36 2 IPI00402183.2 Isoform 3 of Heterogeneous nuclear ribonucleoprotein Q 260 62845 11 11 11 11 1906 5791 1 0 1 499.7613 997.508 2 997.508 -0.0001 0 75.25 3.60E-07 K GVEAGPDLLQ - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6326.6326.2.dta 36 2 IPI00402183.2 Isoform 3 of Heterogeneous nuclear ribonucleoprotein Q 260 62845 11 11 11 11 1999 5730 1 0 0 506.7512 1011.4878 2 1011.4882 -0.0004 0 55.06 3.00E-05 K SAFLCGVMK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6265.6265.2.dta 36 2 IPI00402183.2 Isoform 3 of Heterogeneous nuclear ribonucleoprotein Q 260 62845 11 11 11 11 2314 2256 1 0 1 529.7721 1057.5296 2 1057.5305 -0.0008 0 45.72 0.00029 K LYNNHEIR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2519.2519.2.dta 36 2 IPI00402183.2 Isoform 3 of Heterogeneous nuclear ribonucleoprotein Q 260 62845 11 11 11 11 3804 6742 1 0 1 630.8256 1259.6366 2 1259.6366 0 0 64.76 2.10E-06 R LMMDPLTGLNR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7278.7278.2.dta 36 2 IPI00402183.2 Isoform 3 of Heterogeneous nuclear ribonucleoprotein Q 260 62845 11 11 11 11 5103 3773 1 0 0 720.3759 1438.7372 2 1438.7416 -0.0045 1 45.44 7.00E-05 R TGYTLDVTTGQRK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4198.4198.2.dta 36 2 IPI00402183.2 Isoform 3 of Heterogeneous nuclear ribonucleoprotein Q 260 62845 11 11 11 11 5947 8707 1 0 1 797.406 1592.7975 2 1592.7974 0.0001 0 25.14 0.0044 R DLFEDELVPLFEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.9333.9333.2.dta 36 2 IPI00402183.2 Isoform 3 of Heterogeneous nuclear ribonucleoprotein Q 260 62845 11 11 11 11 7670 5962 1 0 1 648.3299 1941.9679 3 1941.9684 -0.0005 0 24.25 0.0053 K VTEGLTDVILYHQPDDK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6497.6497.3.dta 36 2 IPI00402183.2 Isoform 3 of Heterogeneous nuclear ribonucleoprotein Q 260 62845 11 11 11 11 7868 5270 1 0 1 681.6506 2041.9301 3 2041.9316 -0.0015 1 24.69 0.015 R GFCFLEYEDHKTAAQAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5802.5802.3.dta 36 2 IPI00402183.2 Isoform 3 of Heterogeneous nuclear ribonucleoprotein Q 260 62845 11 11 11 11 8847 5579 1 0 1 898.7829 2693.3269 3 2693.3337 -0.0069 1 27.85 0.0028 R KYGGPPPDSVYSGQQPSVGTEIFVGK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6114.6114.3.dta 36 IPI00402184.4 Isoform 4 of Heterogeneous nuclear ribonucleoprotein Q 255 58927 10 10 10 10 110 4790 1 0 0 317.208 632.4015 2 632.401 0.0005 0 20.73 0.015 K VLFVR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5300.5300.2.dta 36 IPI00402184.4 Isoform 4 of Heterogeneous nuclear ribonucleoprotein Q 255 58927 10 10 10 10 1054 5145 1 0 0 430.7657 859.5168 2 859.5167 0.0001 0 35.96 0.0022 R LFVGSIPK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5676.5676.2.dta 36 IPI00402184.4 Isoform 4 of Heterogeneous nuclear ribonucleoprotein Q 255 58927 10 10 10 10 1906 5791 1 0 1 499.7613 997.508 2 997.508 -0.0001 0 75.25 3.60E-07 K GVEAGPDLLQ - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6326.6326.2.dta 36 IPI00402184.4 Isoform 4 of Heterogeneous nuclear ribonucleoprotein Q 255 58927 10 10 10 10 1999 5730 1 0 0 506.7512 1011.4878 2 1011.4882 -0.0004 0 55.06 3.00E-05 K SAFLCGVMK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6265.6265.2.dta 36 IPI00402184.4 Isoform 4 of Heterogeneous nuclear ribonucleoprotein Q 255 58927 10 10 10 10 2314 2256 1 0 1 529.7721 1057.5296 2 1057.5305 -0.0008 0 45.72 0.00029 K LYNNHEIR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2519.2519.2.dta 36 IPI00402184.4 Isoform 4 of Heterogeneous nuclear ribonucleoprotein Q 255 58927 10 10 10 10 3804 6742 1 0 1 630.8256 1259.6366 2 1259.6366 0 0 64.76 2.10E-06 R LMMDPLTGLNR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7278.7278.2.dta 36 IPI00402184.4 Isoform 4 of Heterogeneous nuclear ribonucleoprotein Q 255 58927 10 10 10 10 5103 3773 1 0 0 720.3759 1438.7372 2 1438.7416 -0.0045 1 45.44 7.00E-05 R TGYTLDVTTGQRK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4198.4198.2.dta 36 IPI00402184.4 Isoform 4 of Heterogeneous nuclear ribonucleoprotein Q 255 58927 10 10 10 10 5947 8707 1 0 1 797.406 1592.7975 2 1592.7974 0.0001 0 25.14 0.0044 R DLFEDELVPLFEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.9333.9333.2.dta 36 IPI00402184.4 Isoform 4 of Heterogeneous nuclear ribonucleoprotein Q 255 58927 10 10 10 10 7670 5962 1 0 1 648.3299 1941.9679 3 1941.9684 -0.0005 0 24.25 0.0053 K VTEGLTDVILYHQPDDK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6497.6497.3.dta 36 IPI00402184.4 Isoform 4 of Heterogeneous nuclear ribonucleoprotein Q 255 58927 10 10 10 10 8847 5579 1 0 1 898.7829 2693.3269 3 2693.3337 -0.0069 1 27.85 0.0028 R KYGGPPPDSVYSGQQPSVGTEIFVGK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6114.6114.3.dta 36 IPI00018140.3 Isoform 1 of Heterogeneous nuclear ribonucleoprotein Q 208 69788 10 10 10 10 110 4790 1 0 0 317.208 632.4015 2 632.401 0.0005 0 20.73 0.015 K VLFVR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5300.5300.2.dta 36 IPI00018140.3 Isoform 1 of Heterogeneous nuclear ribonucleoprotein Q 208 69788 10 10 10 10 1054 5145 1 0 0 430.7657 859.5168 2 859.5167 0.0001 0 35.96 0.0022 R LFVGSIPK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5676.5676.2.dta 36 IPI00018140.3 Isoform 1 of Heterogeneous nuclear ribonucleoprotein Q 208 69788 10 10 10 10 1999 5730 1 0 0 506.7512 1011.4878 2 1011.4882 -0.0004 0 55.06 3.00E-05 K SAFLCGVMK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6265.6265.2.dta 36 IPI00018140.3 Isoform 1 of Heterogeneous nuclear ribonucleoprotein Q 208 69788 10 10 10 10 2314 2256 1 0 1 529.7721 1057.5296 2 1057.5305 -0.0008 0 45.72 0.00029 K LYNNHEIR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2519.2519.2.dta 36 IPI00018140.3 Isoform 1 of Heterogeneous nuclear ribonucleoprotein Q 208 69788 10 10 10 10 3804 6742 1 0 1 630.8256 1259.6366 2 1259.6366 0 0 64.76 2.10E-06 R LMMDPLTGLNR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7278.7278.2.dta 36 IPI00018140.3 Isoform 1 of Heterogeneous nuclear ribonucleoprotein Q 208 69788 10 10 10 10 5103 3773 1 0 0 720.3759 1438.7372 2 1438.7416 -0.0045 1 45.44 7.00E-05 R TGYTLDVTTGQRK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4198.4198.2.dta 36 IPI00018140.3 Isoform 1 of Heterogeneous nuclear ribonucleoprotein Q 208 69788 10 10 10 10 5947 8707 1 0 1 797.406 1592.7975 2 1592.7974 0.0001 0 25.14 0.0044 R DLFEDELVPLFEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.9333.9333.2.dta 36 IPI00018140.3 Isoform 1 of Heterogeneous nuclear ribonucleoprotein Q 208 69788 10 10 10 10 7670 5962 1 0 1 648.3299 1941.9679 3 1941.9684 -0.0005 0 24.25 0.0053 K VTEGLTDVILYHQPDDK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6497.6497.3.dta 36 IPI00018140.3 Isoform 1 of Heterogeneous nuclear ribonucleoprotein Q 208 69788 10 10 10 10 7868 5270 1 0 1 681.6506 2041.9301 3 2041.9316 -0.0015 1 24.69 0.015 R GFCFLEYEDHKTAAQAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5802.5802.3.dta 36 IPI00018140.3 Isoform 1 of Heterogeneous nuclear ribonucleoprotein Q 208 69788 10 10 10 10 8847 5579 1 0 1 898.7829 2693.3269 3 2693.3337 -0.0069 1 27.85 0.0028 R KYGGPPPDSVYSGQQPSVGTEIFVGK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6114.6114.3.dta 36 IPI00402182.2 Isoform 2 of Heterogeneous nuclear ribonucleoprotein Q 202 65870 9 9 9 9 110 4790 1 0 0 317.208 632.4015 2 632.401 0.0005 0 20.73 0.015 K VLFVR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5300.5300.2.dta 36 IPI00402182.2 Isoform 2 of Heterogeneous nuclear ribonucleoprotein Q 202 65870 9 9 9 9 1054 5145 1 0 0 430.7657 859.5168 2 859.5167 0.0001 0 35.96 0.0022 R LFVGSIPK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5676.5676.2.dta 36 IPI00402182.2 Isoform 2 of Heterogeneous nuclear ribonucleoprotein Q 202 65870 9 9 9 9 1999 5730 1 0 0 506.7512 1011.4878 2 1011.4882 -0.0004 0 55.06 3.00E-05 K SAFLCGVMK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6265.6265.2.dta 36 IPI00402182.2 Isoform 2 of Heterogeneous nuclear ribonucleoprotein Q 202 65870 9 9 9 9 2314 2256 1 0 1 529.7721 1057.5296 2 1057.5305 -0.0008 0 45.72 0.00029 K LYNNHEIR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2519.2519.2.dta 36 IPI00402182.2 Isoform 2 of Heterogeneous nuclear ribonucleoprotein Q 202 65870 9 9 9 9 3804 6742 1 0 1 630.8256 1259.6366 2 1259.6366 0 0 64.76 2.10E-06 R LMMDPLTGLNR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7278.7278.2.dta 36 IPI00402182.2 Isoform 2 of Heterogeneous nuclear ribonucleoprotein Q 202 65870 9 9 9 9 5103 3773 1 0 0 720.3759 1438.7372 2 1438.7416 -0.0045 1 45.44 7.00E-05 R TGYTLDVTTGQRK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4198.4198.2.dta 36 IPI00402182.2 Isoform 2 of Heterogeneous nuclear ribonucleoprotein Q 202 65870 9 9 9 9 5947 8707 1 0 1 797.406 1592.7975 2 1592.7974 0.0001 0 25.14 0.0044 R DLFEDELVPLFEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.9333.9333.2.dta 36 IPI00402182.2 Isoform 2 of Heterogeneous nuclear ribonucleoprotein Q 202 65870 9 9 9 9 7670 5962 1 0 1 648.3299 1941.9679 3 1941.9684 -0.0005 0 24.25 0.0053 K VTEGLTDVILYHQPDDK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6497.6497.3.dta 36 IPI00402182.2 Isoform 2 of Heterogeneous nuclear ribonucleoprotein Q 202 65870 9 9 9 9 8847 5579 1 0 1 898.7829 2693.3269 3 2693.3337 -0.0069 1 27.85 0.0028 R KYGGPPPDSVYSGQQPSVGTEIFVGK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6114.6114.3.dta 36 IPI00402185.4 Isoform 5 of Heterogeneous nuclear ribonucleoprotein Q 185 46470 8 8 8 8 110 4790 1 0 0 317.208 632.4015 2 632.401 0.0005 0 20.73 0.015 K VLFVR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5300.5300.2.dta 36 IPI00402185.4 Isoform 5 of Heterogeneous nuclear ribonucleoprotein Q 185 46470 8 8 8 8 1054 5145 1 0 0 430.7657 859.5168 2 859.5167 0.0001 0 35.96 0.0022 R LFVGSIPK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5676.5676.2.dta 36 IPI00402185.4 Isoform 5 of Heterogeneous nuclear ribonucleoprotein Q 185 46470 8 8 8 8 1906 5791 1 0 1 499.7613 997.508 2 997.508 -0.0001 0 75.25 3.60E-07 K GVEAGPDLLQ - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6326.6326.2.dta 36 IPI00402185.4 Isoform 5 of Heterogeneous nuclear ribonucleoprotein Q 185 46470 8 8 8 8 2314 2256 1 0 1 529.7721 1057.5296 2 1057.5305 -0.0008 0 45.72 0.00029 K LYNNHEIR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2519.2519.2.dta 36 IPI00402185.4 Isoform 5 of Heterogeneous nuclear ribonucleoprotein Q 185 46470 8 8 8 8 3804 6742 1 0 1 630.8256 1259.6366 2 1259.6366 0 0 64.76 2.10E-06 R LMMDPLTGLNR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7278.7278.2.dta 36 IPI00402185.4 Isoform 5 of Heterogeneous nuclear ribonucleoprotein Q 185 46470 8 8 8 8 5947 8707 1 0 1 797.406 1592.7975 2 1592.7974 0.0001 0 25.14 0.0044 R DLFEDELVPLFEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.9333.9333.2.dta 36 IPI00402185.4 Isoform 5 of Heterogeneous nuclear ribonucleoprotein Q 185 46470 8 8 8 8 7670 5962 1 0 1 648.3299 1941.9679 3 1941.9684 -0.0005 0 24.25 0.0053 K VTEGLTDVILYHQPDDK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6497.6497.3.dta 36 IPI00402185.4 Isoform 5 of Heterogeneous nuclear ribonucleoprotein Q 185 46470 8 8 8 8 7868 5270 1 0 1 681.6506 2041.9301 3 2041.9316 -0.0015 1 24.69 0.015 R GFCFLEYEDHKTAAQAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5802.5802.3.dta 36 IPI00746866.1 OTTHUMP00000016817 103 20301 4 4 4 4 1999 5730 1 0 0 506.7512 1011.4878 2 1011.4882 -0.0004 0 55.06 3.00E-05 K SAFLCGVMK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6265.6265.2.dta 36 IPI00746866.1 OTTHUMP00000016817 103 20301 4 4 4 4 5103 3773 1 0 0 720.3759 1438.7372 2 1438.7416 -0.0045 1 45.44 7.00E-05 R TGYTLDVTTGQRK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4198.4198.2.dta 36 IPI00746866.1 OTTHUMP00000016817 103 20301 4 4 4 4 5947 8707 1 0 1 797.406 1592.7975 2 1592.7974 0.0001 0 25.14 0.0044 R DLFEDELVPLFEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.9333.9333.2.dta 36 IPI00746866.1 OTTHUMP00000016817 103 20301 4 4 4 4 8847 5579 1 0 1 898.7829 2693.3269 3 2693.3337 -0.0069 1 27.85 0.0028 R KYGGPPPDSVYSGQQPSVGTEIFVGK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6114.6114.3.dta 37 1 IPI00658000.1 insulin-like growth factor 2 mRNA binding protein 3 259 64008 10 10 9 9 1792 2243 1 1 1 491.7636 981.5126 2 981.5131 -0.0005 0 49.85 2.10E-05 K IAPAEAPDAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2505.2505.2.dta 37 1 IPI00658000.1 insulin-like growth factor 2 mRNA binding protein 3 259 64008 10 10 9 9 2167 1894 1 1 1 520.7772 1039.5398 2 1039.541 -0.0013 0 50.03 0.00011 K ALQSGPPQSR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2124.2124.2.dta 37 1 IPI00658000.1 insulin-like growth factor 2 mRNA binding protein 3 259 64008 10 10 9 9 2297 6060 1 1 1 528.8264 1055.6383 2 1055.6379 0.0004 0 34.93 0.00097 K IPVSGPFLVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6595.6595.2.dta 37 1 IPI00658000.1 insulin-like growth factor 2 mRNA binding protein 3 259 64008 10 10 9 9 2400 4722 1 1 1 536.3241 1070.6336 2 1070.6335 0.0001 0 44.66 0.00041 K IQEILTQVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5226.5226.2.dta 37 1 IPI00658000.1 insulin-like growth factor 2 mRNA binding protein 3 259 64008 10 10 9 9 3273 4315 1 1 1 600.3717 1198.7289 2 1198.7285 0.0004 1 65.54 1.30E-06 R KIQEILTQVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4785.4785.2.dta 37 1 IPI00658000.1 insulin-like growth factor 2 mRNA binding protein 3 259 64008 10 10 9 9 5015 5986 1 1 0 715.8889 1429.7633 2 1429.7639 -0.0006 0 42.76 0.00065 R MVIITGPPEAQFK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6520.6520.2.dta 37 1 IPI00658000.1 insulin-like growth factor 2 mRNA binding protein 3 259 64008 10 10 9 9 5148 5303 1 1 0 723.8862 1445.7578 2 1445.7588 -0.0011 0 36.41 0.0027 R MVIITGPPEAQFK A Oxidation (M) 0.1000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5836.5836.2.dta 37 1 IPI00658000.1 insulin-like growth factor 2 mRNA binding protein 3 259 64008 10 10 9 9 6235 5091 1 1 1 818.4194 1634.8243 2 1634.8185 0.0058 0 19.45 0.015 K SITILSTPEGTSAACK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5620.5620.2.dta 37 1 IPI00658000.1 insulin-like growth factor 2 mRNA binding protein 3 259 64008 10 10 9 9 7322 6138 1 1 1 927.9981 1853.9817 2 1853.9847 -0.003 0 66.34 1.00E-06 K TVNELQNLSSAEVVVPR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6672.6672.2.dta 37 1 IPI00658000.1 insulin-like growth factor 2 mRNA binding protein 3 259 64008 10 10 9 9 7339 6750 1 1 1 929.9188 1857.8231 2 1857.8244 -0.0013 0 21.31 0.01 K TGYAFVDCPDESWALK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7285.7285.2.dta 37 2 IPI00008557.4 insulin-like growth factor 2 mRNA binding protein 1 169 63783 5 5 4 4 5015 5986 1 0 0 715.8889 1429.7633 2 1429.7639 -0.0006 0 42.76 0.00065 R MVIITGPPEAQFK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6520.6520.2.dta 37 2 IPI00008557.4 insulin-like growth factor 2 mRNA binding protein 1 169 63783 5 5 4 4 5148 5303 1 0 0 723.8862 1445.7578 2 1445.7588 -0.0011 0 36.41 0.0027 R MVIITGPPEAQFK A Oxidation (M) 0.1000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5836.5836.2.dta 37 2 IPI00008557.4 insulin-like growth factor 2 mRNA binding protein 1 169 63783 5 5 4 4 5289 7529 1 0 1 736.447 1470.8794 2 1470.881 -0.0016 0 37.96 0.00039 R LLVPTQYVGAIIGK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8127.8127.2.dta 37 2 IPI00008557.4 insulin-like growth factor 2 mRNA binding protein 1 169 63783 5 5 4 4 5447 3515 1 0 1 750.8625 1499.7104 2 1499.7104 0.0001 0 69.31 8.40E-07 R DQTPDENDQVIVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3912.3912.2.dta 37 2 IPI00008557.4 insulin-like growth factor 2 mRNA binding protein 1 169 63783 5 5 4 4 7320 6643 1 0 1 927.0098 1852.0051 2 1852.0054 -0.0003 0 62.9 1.50E-06 K TVNELQNLTAAEVVVPR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7179.7179.2.dta 37 3 IPI00179713.6 insulin-like growth factor 2 mRNA binding protein 2 isoform a 76 66195 3 3 2 2 3632 2961 1 0 1 620.8109 1239.6072 2 1239.6095 -0.0024 0 37.55 0.0003 K IAPAEGPDVSER M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3287.3287.2.dta 37 3 IPI00179713.6 insulin-like growth factor 2 mRNA binding protein 2 isoform a 76 66195 3 3 2 2 5015 5986 1 0 0 715.8889 1429.7633 2 1429.7639 -0.0006 0 42.76 0.00065 R MVIITGPPEAQFK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6520.6520.2.dta 37 3 IPI00179713.6 insulin-like growth factor 2 mRNA binding protein 2 isoform a 76 66195 3 3 2 2 5148 5303 1 0 0 723.8862 1445.7578 2 1445.7588 -0.0011 0 36.41 0.0027 R MVIITGPPEAQFK A Oxidation (M) 0.1000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5836.5836.2.dta 37 IPI00165467.7 55 kDa protein 235 55434 8 8 7 7 1792 2243 1 0 1 491.7636 981.5126 2 981.5131 -0.0005 0 49.85 2.10E-05 K IAPAEAPDAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2505.2505.2.dta 37 IPI00165467.7 55 kDa protein 235 55434 8 8 7 7 2167 1894 1 0 1 520.7772 1039.5398 2 1039.541 -0.0013 0 50.03 0.00011 K ALQSGPPQSR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2124.2124.2.dta 37 IPI00165467.7 55 kDa protein 235 55434 8 8 7 7 2400 4722 1 0 1 536.3241 1070.6336 2 1070.6335 0.0001 0 44.66 0.00041 K IQEILTQVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5226.5226.2.dta 37 IPI00165467.7 55 kDa protein 235 55434 8 8 7 7 3273 4315 1 0 1 600.3717 1198.7289 2 1198.7285 0.0004 1 65.54 1.30E-06 R KIQEILTQVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4785.4785.2.dta 37 IPI00165467.7 55 kDa protein 235 55434 8 8 7 7 5015 5986 1 0 0 715.8889 1429.7633 2 1429.7639 -0.0006 0 42.76 0.00065 R MVIITGPPEAQFK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6520.6520.2.dta 37 IPI00165467.7 55 kDa protein 235 55434 8 8 7 7 5148 5303 1 0 0 723.8862 1445.7578 2 1445.7588 -0.0011 0 36.41 0.0027 R MVIITGPPEAQFK A Oxidation (M) 0.1000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5836.5836.2.dta 37 IPI00165467.7 55 kDa protein 235 55434 8 8 7 7 6235 5091 1 0 1 818.4194 1634.8243 2 1634.8185 0.0058 0 19.45 0.015 K SITILSTPEGTSAACK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5620.5620.2.dta 37 IPI00165467.7 55 kDa protein 235 55434 8 8 7 7 7322 6138 1 0 1 927.9981 1853.9817 2 1853.9847 -0.003 0 66.34 1.00E-06 K TVNELQNLSSAEVVVPR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6672.6672.2.dta 37 IPI00746216.1 Insulin-like growth factor 2 mRNA-binding protein 3 212 64462 9 9 8 8 1792 2243 1 0 1 491.7636 981.5126 2 981.5131 -0.0005 0 49.85 2.10E-05 K IAPAEAPDAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2505.2505.2.dta 37 IPI00746216.1 Insulin-like growth factor 2 mRNA-binding protein 3 212 64462 9 9 8 8 2167 1894 1 0 1 520.7772 1039.5398 2 1039.541 -0.0013 0 50.03 0.00011 K ALQSGPPQSR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2124.2124.2.dta 37 IPI00746216.1 Insulin-like growth factor 2 mRNA-binding protein 3 212 64462 9 9 8 8 2297 6060 1 0 1 528.8264 1055.6383 2 1055.6379 0.0004 0 34.93 0.00097 K IPVSGPFLVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6595.6595.2.dta 37 IPI00746216.1 Insulin-like growth factor 2 mRNA-binding protein 3 212 64462 9 9 8 8 2400 4722 1 0 1 536.3241 1070.6336 2 1070.6335 0.0001 0 44.66 0.00041 K IQEILTQVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5226.5226.2.dta 37 IPI00746216.1 Insulin-like growth factor 2 mRNA-binding protein 3 212 64462 9 9 8 8 3273 4315 1 0 1 600.3717 1198.7289 2 1198.7285 0.0004 1 65.54 1.30E-06 R KIQEILTQVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4785.4785.2.dta 37 IPI00746216.1 Insulin-like growth factor 2 mRNA-binding protein 3 212 64462 9 9 8 8 5015 5986 1 0 0 715.8889 1429.7633 2 1429.7639 -0.0006 0 42.76 0.00065 R MVIITGPPEAQFK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6520.6520.2.dta 37 IPI00746216.1 Insulin-like growth factor 2 mRNA-binding protein 3 212 64462 9 9 8 8 5148 5303 1 0 0 723.8862 1445.7578 2 1445.7588 -0.0011 0 36.41 0.0027 R MVIITGPPEAQFK A Oxidation (M) 0.1000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5836.5836.2.dta 37 IPI00746216.1 Insulin-like growth factor 2 mRNA-binding protein 3 212 64462 9 9 8 8 6235 5091 1 0 1 818.4194 1634.8243 2 1634.8185 0.0058 0 19.45 0.015 K SITILSTPEGTSAACK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5620.5620.2.dta 37 IPI00746216.1 Insulin-like growth factor 2 mRNA-binding protein 3 212 64462 9 9 8 8 7339 6750 1 0 1 929.9188 1857.8231 2 1857.8244 -0.0013 0 21.31 0.01 K TGYAFVDCPDESWALK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7285.7285.2.dta 38 1 IPI00005184.1 Isoform Long of Transcription intermediary factor 1-alpha 253 118696 8 8 7 7 1496 1548 1 1 1 467.7328 933.4511 2 933.4516 -0.0005 0 53.2 7.90E-05 R SPSASSVGSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1749.1749.2.dta 38 1 IPI00005184.1 Isoform Long of Transcription intermediary factor 1-alpha 253 118696 8 8 7 7 2025 5924 1 1 1 508.3236 1014.6327 2 1014.6325 0.0002 0 46.33 4.80E-05 K VIIDTLITK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6459.6459.2.dta 38 1 IPI00005184.1 Isoform Long of Transcription intermediary factor 1-alpha 253 118696 8 8 7 7 2451 2402 1 1 1 539.2739 1076.5332 2 1076.5363 -0.0031 0 53.76 7.20E-05 K FTGNQIQNR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2677.2677.2.dta 38 1 IPI00005184.1 Isoform Long of Transcription intermediary factor 1-alpha 253 118696 8 8 7 7 2515 2660 1 1 1 543.2998 1084.5851 2 1084.5876 -0.0026 0 45.61 0.00046 R IIEVNQNQK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2958.2958.2.dta 38 1 IPI00005184.1 Isoform Long of Transcription intermediary factor 1-alpha 253 118696 8 8 7 7 4796 1910 1 1 1 698.2756 1394.5366 2 1394.5377 -0.0011 0 44.4 6.70E-05 R CPVCSQECAER H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2141.2141.2.dta 38 1 IPI00005184.1 Isoform Long of Transcription intermediary factor 1-alpha 253 118696 8 8 7 7 5692 6151 1 1 1 772.8704 1543.7263 2 1543.7307 -0.0044 0 68.71 1.90E-06 R YQFIEEAFQNQK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6686.6686.2.dta 38 1 IPI00005184.1 Isoform Long of Transcription intermediary factor 1-alpha 253 118696 8 8 7 7 5693 6437 1 1 1 772.8723 1543.73 2 1543.7307 -0.0007 0 71.29 1.10E-06 R YQFIEEAFQNQK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6969.6969.2.dta 38 1 IPI00005184.1 Isoform Long of Transcription intermediary factor 1-alpha 253 118696 8 8 7 7 8662 3606 1 1 1 833.728 2498.1621 3 2498.1633 -0.0012 0 15.76 0.033 K AVAAAAAASAAASGGPSAAPSGENEAESR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4013.4013.3.dta 38 2 IPI00010252.3 Isoform Alpha of Transcription intermediary factor 1-gamma 231 124610 6 6 5 5 1458 5658 1 0 1 464.7765 927.5385 2 927.5389 -0.0004 0 49.49 0.00013 K GAIENLLAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6193.6193.2.dta 38 2 IPI00010252.3 Isoform Alpha of Transcription intermediary factor 1-gamma 231 124610 6 6 5 5 2008 1357 1 0 1 507.742 1013.4695 2 1013.4713 -0.0017 0 19.47 0.018 K TCIEAHQR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1543.1543.2.dta 38 2 IPI00010252.3 Isoform Alpha of Transcription intermediary factor 1-gamma 231 124610 6 6 5 5 4467 6839 1 0 1 677.3547 1352.6949 2 1352.6976 -0.0027 0 47.78 3.50E-05 R QIDLVDNYFVK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7373.7373.2.dta 38 2 IPI00010252.3 Isoform Alpha of Transcription intermediary factor 1-gamma 231 124610 6 6 5 5 5388 4567 1 0 1 743.4036 1484.7926 2 1484.7947 -0.0021 0 76.47 1.70E-07 K LLQQQNDITGLSR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5058.5058.2.dta 38 2 IPI00010252.3 Isoform Alpha of Transcription intermediary factor 1-gamma 231 124610 6 6 5 5 5692 6151 1 0 1 772.8704 1543.7263 2 1543.7307 -0.0044 0 68.71 1.90E-06 R YQFLEEAFQNQK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6686.6686.2.dta 38 2 IPI00010252.3 Isoform Alpha of Transcription intermediary factor 1-gamma 231 124610 6 6 5 5 5693 6437 1 0 1 772.8723 1543.73 2 1543.7307 -0.0007 0 71.29 1.10E-06 R YQFLEEAFQNQK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6969.6969.2.dta 38 IPI00444332.1 "CDNA FLJ45687 fis, clone FCBBF3020030, highly similar to Transcription intermediary factor 1-alpha" 223 63509 6 6 5 5 2025 5924 1 0 1 508.3236 1014.6327 2 1014.6325 0.0002 0 46.33 4.80E-05 K VIIDTLITK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6459.6459.2.dta 38 IPI00444332.1 "CDNA FLJ45687 fis, clone FCBBF3020030, highly similar to Transcription intermediary factor 1-alpha" 223 63509 6 6 5 5 2451 2402 1 0 1 539.2739 1076.5332 2 1076.5363 -0.0031 0 53.76 7.20E-05 K FTGNQIQNR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2677.2677.2.dta 38 IPI00444332.1 "CDNA FLJ45687 fis, clone FCBBF3020030, highly similar to Transcription intermediary factor 1-alpha" 223 63509 6 6 5 5 2515 2660 1 0 1 543.2998 1084.5851 2 1084.5876 -0.0026 0 45.61 0.00046 R IIEVNQNQK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2958.2958.2.dta 38 IPI00444332.1 "CDNA FLJ45687 fis, clone FCBBF3020030, highly similar to Transcription intermediary factor 1-alpha" 223 63509 6 6 5 5 4796 1910 1 0 1 698.2756 1394.5366 2 1394.5377 -0.0011 0 44.4 6.70E-05 R CPVCSQECAER H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2141.2141.2.dta 38 IPI00444332.1 "CDNA FLJ45687 fis, clone FCBBF3020030, highly similar to Transcription intermediary factor 1-alpha" 223 63509 6 6 5 5 5692 6151 1 0 1 772.8704 1543.7263 2 1543.7307 -0.0044 0 68.71 1.90E-06 R YQFIEEAFQNQK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6686.6686.2.dta 38 IPI00444332.1 "CDNA FLJ45687 fis, clone FCBBF3020030, highly similar to Transcription intermediary factor 1-alpha" 223 63509 6 6 5 5 5693 6437 1 0 1 772.8723 1543.73 2 1543.7307 -0.0007 0 71.29 1.10E-06 R YQFIEEAFQNQK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6969.6969.2.dta 39 1 IPI00186290.6 Elongation factor 2 251 96246 9 9 9 9 821 5217 1 1 1 411.2222 820.4298 2 820.4299 -0.0001 0 26.65 0.022 R TILMMGR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5748.5748.2.dta 39 1 IPI00186290.6 Elongation factor 2 251 96246 9 9 9 9 1717 3620 1 1 1 485.2768 968.5391 2 968.5403 -0.0012 0 32.12 0.0045 R GGGQIIPTAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4028.4028.2.dta 39 1 IPI00186290.6 Elongation factor 2 251 96246 9 9 9 9 2006 2463 1 1 1 507.2537 1012.4928 2 1012.4938 -0.001 0 59.59 1.10E-05 K GEGQLGPAER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2743.2743.2.dta 39 1 IPI00186290.6 Elongation factor 2 251 96246 9 9 9 9 2450 3569 1 1 1 539.273 1076.5315 2 1076.5325 -0.001 0 19.89 0.014 R IMGPNYTPGK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3973.3973.2.dta 39 1 IPI00186290.6 Elongation factor 2 251 96246 9 9 9 9 2651 5688 1 1 1 554.3243 1106.634 2 1106.6336 0.0004 0 69.18 7.50E-07 R VFSGLVSTGLK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6223.6223.2.dta 39 1 IPI00186290.6 Elongation factor 2 251 96246 9 9 9 9 4461 3210 1 1 1 451.257 1350.7491 3 1350.7507 -0.0016 1 33.88 0.0019 R VAVEAKNPADLPK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3568.3568.3.dta 39 1 IPI00186290.6 Elongation factor 2 251 96246 9 9 9 9 4649 5550 1 1 1 689.8605 1377.7065 2 1377.7075 -0.0009 0 62.96 2.90E-06 R CLYASVLTAQPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6085.6085.2.dta 39 1 IPI00186290.6 Elongation factor 2 251 96246 9 9 9 9 4848 3782 1 1 1 468.2721 1401.7944 3 1401.798 -0.0036 1 31.02 0.0021 K KEDLYLKPIQR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4208.4208.3.dta 39 1 IPI00186290.6 Elongation factor 2 251 96246 9 9 9 9 5948 5136 1 1 1 797.8848 1593.755 2 1593.7556 -0.0006 0 73.78 2.90E-07 R ETVSEESNVLCLSK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5667.5667.2.dta 39 IPI00440662.1 Antigen MLAA-42 (Fragment) 74 17032 1 1 1 1 5948 5136 1 0 1 797.8848 1593.755 2 1593.7556 -0.0006 0 73.78 2.90E-07 R ETVSEESNVLCLSK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5667.5667.2.dta 39 IPI00003519.1 116 kDa U5 small nuclear ribonucleoprotein component 32 110336 1 1 1 1 1717 3620 1 0 1 485.2768 968.5391 2 968.5403 -0.0012 0 32.12 0.0045 R GGGQIIPTAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4028.4028.2.dta 40 1 IPI00011126.6 26S protease regulatory subunit 4 225 49325 5 5 4 4 1739 4003 1 1 1 486.7897 971.5648 2 971.5651 -0.0003 0 53.74 6.70E-05 R VVGSELIQK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4447.4447.2.dta 40 1 IPI00011126.6 26S protease regulatory subunit 4 225 49325 5 5 4 4 3576 5789 1 1 1 617.8186 1233.6227 2 1233.6241 -0.0014 1 39.23 0.00095 K KQEGTPEGLYL - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6323.6323.2.dta 40 1 IPI00011126.6 26S protease regulatory subunit 4 225 49325 5 5 4 4 3926 4533 1 1 1 639.8427 1277.6709 2 1277.6728 -0.0019 0 87.7 8.00E-09 K AVANQTSATFLR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5021.5021.2.dta 40 1 IPI00011126.6 26S protease regulatory subunit 4 225 49325 5 5 4 4 3927 4536 1 1 1 639.843 1277.6714 2 1277.6728 -0.0014 0 76.61 1.30E-07 K AVANQTSATFLR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5025.5025.2.dta 40 1 IPI00011126.6 26S protease regulatory subunit 4 225 49325 5 5 4 4 8136 7538 1 1 1 752.0579 2253.1519 3 2253.1529 -0.0009 0 48.96 2.60E-05 R VAEEHAPSIVFIDEIDAIGTK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8139.8139.3.dta 41 1 IPI00008575.3 "Isoform 1 of KH domain-containing, RNA-binding, signal transduction-associated protein 1" 222 48311 10 10 8 8 62 3790 1 1 1 308.7048 615.3951 2 615.3956 -0.0005 0 35.19 0.0079 K ISVLGK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4216.4216.2.dta 41 1 IPI00008575.3 "Isoform 1 of KH domain-containing, RNA-binding, signal transduction-associated protein 1" 222 48311 10 10 8 8 213 4324 1 1 0 334.7392 667.4638 2 667.4632 0.0006 0 28.21 0.0026 R VLIPVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4795.4795.2.dta 41 1 IPI00008575.3 "Isoform 1 of KH domain-containing, RNA-binding, signal transduction-associated protein 1" 222 48311 10 10 8 8 358 4596 1 1 0 356.1952 710.3759 2 710.3752 0.0007 0 32.2 0.011 K FNFVGK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5090.5090.2.dta 41 1 IPI00008575.3 "Isoform 1 of KH domain-containing, RNA-binding, signal transduction-associated protein 1" 222 48311 10 10 8 8 1407 2165 1 1 1 461.2144 920.4142 2 920.414 0.0001 1 25.96 0.0044 R EHPYGRY - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2421.2421.2.dta 41 1 IPI00008575.3 "Isoform 1 of KH domain-containing, RNA-binding, signal transduction-associated protein 1" 222 48311 10 10 8 8 2115 1259 1 1 1 516.2774 1030.5403 2 1030.5407 -0.0004 1 39.46 0.0025 K RLQEETGAK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1437.1437.2.dta 41 1 IPI00008575.3 "Isoform 1 of KH domain-containing, RNA-binding, signal transduction-associated protein 1" 222 48311 10 10 8 8 3177 3988 1 1 1 592.8731 1183.7317 2 1183.7329 -0.0012 1 44.95 0.00017 R VLIPVKQYPK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4431.4431.2.dta 41 1 IPI00008575.3 "Isoform 1 of KH domain-containing, RNA-binding, signal transduction-associated protein 1" 222 48311 10 10 8 8 3247 2832 1 1 1 598.8608 1195.707 2 1195.7037 0.0033 1 81.72 3.40E-08 K ILGPQGNTIKR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3144.3144.2.dta 41 1 IPI00008575.3 "Isoform 1 of KH domain-containing, RNA-binding, signal transduction-associated protein 1" 222 48311 10 10 8 8 3248 2827 1 1 1 399.5771 1195.7094 3 1195.7037 0.0057 1 22.79 0.024 K ILGPQGNTIKR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3139.3139.3.dta 41 1 IPI00008575.3 "Isoform 1 of KH domain-containing, RNA-binding, signal transduction-associated protein 1" 222 48311 10 10 8 8 4692 2355 1 1 1 692.816 1383.6175 2 1383.6201 -0.0026 0 57.28 1.30E-05 R SGSMDPSGAHPSVR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2626.2626.2.dta 41 1 IPI00008575.3 "Isoform 1 of KH domain-containing, RNA-binding, signal transduction-associated protein 1" 222 48311 10 10 8 8 4830 1669 1 1 1 700.8143 1399.6141 2 1399.615 -0.0009 0 37.12 0.00033 R SGSMDPSGAHPSVR Q Oxidation (M) 0.00010000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1880.1880.2.dta 41 IPI00082310.1 "Isoform 3 of KH domain-containing, RNA-binding, signal transduction-associated protein 1" 125 44114 5 5 4 4 213 4324 1 0 0 334.7392 667.4638 2 667.4632 0.0006 0 28.21 0.0026 R VLIPVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4795.4795.2.dta 41 IPI00082310.1 "Isoform 3 of KH domain-containing, RNA-binding, signal transduction-associated protein 1" 125 44114 5 5 4 4 1407 2165 1 0 1 461.2144 920.4142 2 920.414 0.0001 1 25.96 0.0044 R EHPYGRY - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2421.2421.2.dta 41 IPI00082310.1 "Isoform 3 of KH domain-containing, RNA-binding, signal transduction-associated protein 1" 125 44114 5 5 4 4 3177 3988 1 0 1 592.8731 1183.7317 2 1183.7329 -0.0012 1 44.95 0.00017 R VLIPVKQYPK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4431.4431.2.dta 41 IPI00082310.1 "Isoform 3 of KH domain-containing, RNA-binding, signal transduction-associated protein 1" 125 44114 5 5 4 4 4692 2355 1 0 1 692.816 1383.6175 2 1383.6201 -0.0026 0 57.28 1.30E-05 R SGSMDPSGAHPSVR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2626.2626.2.dta 41 IPI00082310.1 "Isoform 3 of KH domain-containing, RNA-binding, signal transduction-associated protein 1" 125 44114 5 5 4 4 4830 1669 1 0 1 700.8143 1399.6141 2 1399.615 -0.0009 0 37.12 0.00033 R SGSMDPSGAHPSVR Q Oxidation (M) 0.00010000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1880.1880.2.dta 41 IPI00166708.2 "KH domain containing, RNA binding, signal transduction associated 2" 90 38904 5 5 5 5 213 4324 1 0 0 334.7392 667.4638 2 667.4632 0.0006 0 28.21 0.0026 R VLIPVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4795.4795.2.dta 41 IPI00166708.2 "KH domain containing, RNA binding, signal transduction associated 2" 90 38904 5 5 5 5 358 4596 1 0 0 356.1952 710.3759 2 710.3752 0.0007 0 32.2 0.011 K FNFVGK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5090.5090.2.dta 41 IPI00166708.2 "KH domain containing, RNA binding, signal transduction associated 2" 90 38904 5 5 5 5 1407 2165 1 0 1 461.2144 920.4142 2 920.414 0.0001 1 25.96 0.0044 R EHPYGRY - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2421.2421.2.dta 41 IPI00166708.2 "KH domain containing, RNA binding, signal transduction associated 2" 90 38904 5 5 5 5 2115 1259 1 0 1 516.2774 1030.5403 2 1030.5407 -0.0004 1 39.46 0.0025 K RLQEETGAK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1437.1437.2.dta 41 IPI00166708.2 "KH domain containing, RNA binding, signal transduction associated 2" 90 38904 5 5 5 5 3177 3988 1 0 1 592.8731 1183.7317 2 1183.7329 -0.0012 1 44.95 0.00017 R VLIPVKQYPK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4431.4431.2.dta 42 1 IPI00795338.1 Eukaryotic translation initiation factor 2A 222 65606 9 9 9 9 731 5772 1 1 1 403.742 805.4695 2 805.4698 -0.0003 0 30.91 0.0077 K ATIFNLK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6307.6307.2.dta 42 1 IPI00795338.1 Eukaryotic translation initiation factor 2A 222 65606 9 9 9 9 2241 5146 1 1 1 525.7682 1049.5218 2 1049.5216 0.0003 0 40.74 0.0012 K AVCLEFSPK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5677.5677.2.dta 42 1 IPI00795338.1 Eukaryotic translation initiation factor 2A 222 65606 9 9 9 9 2277 5111 1 1 1 527.8163 1053.6181 2 1053.6182 -0.0001 0 47.47 7.00E-05 M APSTPLLTVR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5641.5641.2.dta 42 1 IPI00795338.1 Eukaryotic translation initiation factor 2A 222 65606 9 9 9 9 4563 6209 1 1 1 684.3044 1366.5943 2 1366.5976 -0.0033 0 58.73 4.30E-06 K CDPVFDFGTGPR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6744.6744.2.dta 42 1 IPI00795338.1 Eukaryotic translation initiation factor 2A 222 65606 9 9 9 9 4716 2773 1 1 1 693.8824 1385.7502 2 1385.7514 -0.0012 1 55.91 1.10E-05 K AIEQLKEQAATGK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3080.3080.2.dta 42 1 IPI00795338.1 Eukaryotic translation initiation factor 2A 222 65606 9 9 9 9 5897 5872 1 1 1 787.913 1573.8114 2 1573.814 -0.0027 0 40.42 0.0017 K INDFVLSPGPQPYK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6408.6408.2.dta 42 1 IPI00795338.1 Eukaryotic translation initiation factor 2A 222 65606 9 9 9 9 5982 6550 1 1 1 802.4225 1602.8305 2 1602.8253 0.0052 0 46.22 0.00011 K DGTAGIPNLQLYDVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7085.7085.2.dta 42 1 IPI00795338.1 Eukaryotic translation initiation factor 2A 222 65606 9 9 9 9 6759 3333 1 1 1 573.2906 1716.8499 3 1716.853 -0.0031 1 28.46 0.0021 R NTVSQSISGDPEIDKK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3711.3711.3.dta 42 1 IPI00795338.1 Eukaryotic translation initiation factor 2A 222 65606 9 9 9 9 7425 5101 1 1 1 625.6545 1873.9416 3 1873.9475 -0.0059 0 27.5 0.0028 R LYQYPNFAGPHAALANK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5631.5631.3.dta 42 IPI00012462.1 Eukaryotic translation initiation factor 2A 65 kDa 192 68436 8 8 8 8 731 5772 1 0 1 403.742 805.4695 2 805.4698 -0.0003 0 30.91 0.0077 K ATIFNLK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6307.6307.2.dta 42 IPI00012462.1 Eukaryotic translation initiation factor 2A 65 kDa 192 68436 8 8 8 8 2241 5146 1 0 1 525.7682 1049.5218 2 1049.5216 0.0003 0 40.74 0.0012 K AVCLEFSPK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5677.5677.2.dta 42 IPI00012462.1 Eukaryotic translation initiation factor 2A 65 kDa 192 68436 8 8 8 8 4563 6209 1 0 1 684.3044 1366.5943 2 1366.5976 -0.0033 0 58.73 4.30E-06 K CDPVFDFGTGPR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6744.6744.2.dta 42 IPI00012462.1 Eukaryotic translation initiation factor 2A 65 kDa 192 68436 8 8 8 8 4716 2773 1 0 1 693.8824 1385.7502 2 1385.7514 -0.0012 1 55.91 1.10E-05 K AIEQLKEQAATGK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3080.3080.2.dta 42 IPI00012462.1 Eukaryotic translation initiation factor 2A 65 kDa 192 68436 8 8 8 8 5897 5872 1 0 1 787.913 1573.8114 2 1573.814 -0.0027 0 40.42 0.0017 K INDFVLSPGPQPYK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6408.6408.2.dta 42 IPI00012462.1 Eukaryotic translation initiation factor 2A 65 kDa 192 68436 8 8 8 8 5982 6550 1 0 1 802.4225 1602.8305 2 1602.8253 0.0052 0 46.22 0.00011 K DGTAGIPNLQLYDVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7085.7085.2.dta 42 IPI00012462.1 Eukaryotic translation initiation factor 2A 65 kDa 192 68436 8 8 8 8 6759 3333 1 0 1 573.2906 1716.8499 3 1716.853 -0.0031 1 28.46 0.0021 R NTVSQSISGDPEIDKK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3711.3711.3.dta 42 IPI00012462.1 Eukaryotic translation initiation factor 2A 65 kDa 192 68436 8 8 8 8 7425 5101 1 0 1 625.6545 1873.9416 3 1873.9475 -0.0059 0 27.5 0.0028 R LYQYPNFAGPHAALANK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5631.5631.3.dta 42 IPI00513831.1 MSTP004 70 35680 2 2 2 2 731 5772 1 0 1 403.742 805.4695 2 805.4698 -0.0003 0 30.91 0.0077 K ATIFNLK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6307.6307.2.dta 42 IPI00513831.1 MSTP004 70 35680 2 2 2 2 4563 6209 1 0 1 684.3044 1366.5943 2 1366.5976 -0.0033 0 58.73 4.30E-06 K CDPVFDFGTGPR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6744.6744.2.dta 42 IPI00792500.1 13 kDa protein 68 12869 2 2 2 2 4716 2773 1 0 1 693.8824 1385.7502 2 1385.7514 -0.0012 1 55.91 1.10E-05 K AIEQLKEQAATGK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3080.3080.2.dta 42 IPI00792500.1 13 kDa protein 68 12869 2 2 2 2 6759 3333 1 0 1 573.2906 1716.8499 3 1716.853 -0.0031 1 28.46 0.0021 R NTVSQSISGDPEIDKK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3711.3711.3.dta 43 1 IPI00006167.1 Protein phosphatase 2C isoform gamma 221 59919 4 4 3 3 2913 3596 1 1 1 572.3088 1142.6031 2 1142.6044 -0.0012 0 61.32 9.60E-06 K QLIVANAGDSR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4002.4002.2.dta 43 1 IPI00006167.1 Protein phosphatase 2C isoform gamma 221 59919 4 4 3 3 3914 6963 1 1 1 638.8427 1275.6708 2 1275.671 -0.0003 0 102.37 1.30E-09 K ALEDAFLAIDAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7499.7499.2.dta 43 1 IPI00006167.1 Protein phosphatase 2C isoform gamma 221 59919 4 4 3 3 3915 6987 1 1 1 638.8428 1275.6711 2 1275.671 0.0001 0 81.08 9.70E-08 K ALEDAFLAIDAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7522.7522.2.dta 43 1 IPI00006167.1 Protein phosphatase 2C isoform gamma 221 59919 4 4 3 3 4316 1960 1 1 1 665.3401 1328.6657 2 1328.6684 -0.0027 1 49.28 0.00022 R NTAELQPESGKR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2195.2195.2.dta 43 IPI00746326.1 Protein phosphatase 1G variant (Fragment) 86 38757 2 2 2 2 2913 3596 1 0 1 572.3088 1142.6031 2 1142.6044 -0.0012 0 61.32 9.60E-06 K QLIVANAGDSR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4002.4002.2.dta 43 IPI00746326.1 Protein phosphatase 1G variant (Fragment) 86 38757 2 2 2 2 4316 1960 1 0 1 665.3401 1328.6657 2 1328.6684 -0.0027 1 49.28 0.00022 R NTAELQPESGKR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2195.2195.2.dta 44 1 IPI00013894.1 Stress-induced-phosphoprotein 1 219 63227 11 11 10 10 84 1662 1 1 0 314.6747 627.3349 2 627.334 0.0009 0 26.82 0.037 K LQDPR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1872.1872.2.dta 44 1 IPI00013894.1 Stress-induced-phosphoprotein 1 219 63227 11 11 10 10 1026 2810 1 1 1 427.7077 853.4009 2 853.4004 0.0005 0 26.37 0.0042 K AMDVYQK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3120.3120.2.dta 44 1 IPI00013894.1 Stress-induced-phosphoprotein 1 219 63227 11 11 10 10 2037 1514 1 1 1 339.8544 1016.5415 3 1016.5403 0.0012 1 48.46 0.00041 K HYTEAIKR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1712.1712.3.dta 44 1 IPI00013894.1 Stress-induced-phosphoprotein 1 219 63227 11 11 10 10 2364 4545 1 1 1 533.2817 1064.5489 2 1064.5502 -0.0013 0 20.48 0.021 R TLLSDPTYR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5034.5034.2.dta 44 1 IPI00013894.1 Stress-induced-phosphoprotein 1 219 63227 11 11 10 10 2608 7131 1 1 1 550.8289 1099.6432 2 1099.6423 0.0008 0 63.95 5.60E-06 K LMDVGLIAIR - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7678.7678.2.dta 44 1 IPI00013894.1 Stress-induced-phosphoprotein 1 219 63227 11 11 10 10 2722 6236 1 1 1 558.8251 1115.6357 2 1115.6373 -0.0015 0 60.84 1.10E-05 K LMDVGLIAIR - Oxidation (M) 0.0100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6771.6771.2.dta 44 1 IPI00013894.1 Stress-induced-phosphoprotein 1 219 63227 11 11 10 10 2775 1464 1 1 1 562.7609 1123.5072 2 1123.508 -0.0009 1 41.65 0.00015 K NKGNECFQK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1658.1658.2.dta 44 1 IPI00013894.1 Stress-induced-phosphoprotein 1 219 63227 11 11 10 10 4057 3597 1 1 1 433.5562 1297.6468 3 1297.6455 0.0013 1 30.48 0.014 K YKDAIHFYNK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4003.4003.3.dta 44 1 IPI00013894.1 Stress-induced-phosphoprotein 1 219 63227 11 11 10 10 5405 6207 1 1 1 744.8988 1487.7831 2 1487.7871 -0.0041 0 49.96 0.00014 R LAYINPDLALEEK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6742.6742.2.dta 44 1 IPI00013894.1 Stress-induced-phosphoprotein 1 219 63227 11 11 10 10 7498 3881 1 1 1 633.6213 1897.8422 3 1897.8476 -0.0054 1 32.51 0.00089 K ALDLDSSCKEAADGYQR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4315.4315.3.dta 44 1 IPI00013894.1 Stress-induced-phosphoprotein 1 219 63227 11 11 10 10 7681 7274 1 1 1 649.6898 1946.0474 3 1946.0473 0.0002 1 23.69 0.011 R TLLSDPTYRELIEQLR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7835.7835.3.dta 45 1 IPI00179964.5 Isoform 1 of Polypyrimidine tract-binding protein 1 215 57357 12 12 11 11 125 2389 1 1 1 319.2111 636.4076 2 636.4071 0.0004 0 22.83 0.021 R VIHIR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2663.2663.2.dta 45 1 IPI00179964.5 Isoform 1 of Polypyrimidine tract-binding protein 1 215 57357 12 12 11 11 197 3859 1 1 0 332.705 663.3954 2 663.3956 -0.0001 0 41.35 0.00096 K FGTVLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4291.4291.2.dta 45 1 IPI00179964.5 Isoform 1 of Polypyrimidine tract-binding protein 1 215 57357 12 12 11 11 818 1078 1 1 1 410.7614 819.5083 2 819.5079 0.0004 0 21.22 0.0091 K LHGKPIR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1241.1241.2.dta 45 1 IPI00179964.5 Isoform 1 of Polypyrimidine tract-binding protein 1 215 57357 12 12 11 11 1574 5733 1 1 1 474.283 946.5514 2 946.5521 -0.0007 0 43.64 0.00026 K VTNLLMLK G Oxidation (M) 0.00000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6268.6268.2.dta 45 1 IPI00179964.5 Isoform 1 of Polypyrimidine tract-binding protein 1 215 57357 12 12 11 11 1849 2670 1 1 1 331.1859 990.536 3 990.5359 0.0001 0 26.12 0.038 K HQNVQLPR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2969.2969.3.dta 45 1 IPI00179964.5 Isoform 1 of Polypyrimidine tract-binding protein 1 215 57357 12 12 11 11 2306 2713 1 1 1 529.7533 1057.492 2 1057.4941 -0.0021 0 47.08 0.00012 K DYGNSPLHR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3015.3015.2.dta 45 1 IPI00179964.5 Isoform 1 of Polypyrimidine tract-binding protein 1 215 57357 12 12 11 11 2307 2710 1 1 1 353.5057 1057.4952 3 1057.4941 0.0011 0 18.88 0.026 K DYGNSPLHR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3012.3012.3.dta 45 1 IPI00179964.5 Isoform 1 of Polypyrimidine tract-binding protein 1 215 57357 12 12 11 11 4412 1498 1 1 1 673.3387 1344.6629 2 1344.6633 -0.0004 1 22.8 0.012 K ELKTDSSPNQAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1695.1695.2.dta 45 1 IPI00179964.5 Isoform 1 of Polypyrimidine tract-binding protein 1 215 57357 12 12 11 11 5019 4870 1 1 1 716.371 1430.7274 2 1430.7306 -0.0032 0 29.7 0.0019 R GQPIYIQFSNHK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5386.5386.2.dta 45 1 IPI00179964.5 Isoform 1 of Polypyrimidine tract-binding protein 1 215 57357 12 12 11 11 7495 5803 1 1 1 949.4476 1896.8806 2 1896.8822 -0.0016 0 62.43 1.40E-06 K LSLDGQNIYNACCTLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6338.6338.2.dta 45 1 IPI00179964.5 Isoform 1 of Polypyrimidine tract-binding protein 1 215 57357 12 12 11 11 7979 3536 1 1 1 715.3362 2142.9869 3 2142.993 -0.0061 1 29.48 0.0017 R EGQEDQGLTKDYGNSPLHR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3935.3935.3.dta 45 1 IPI00179964.5 Isoform 1 of Polypyrimidine tract-binding protein 1 215 57357 12 12 11 11 8126 7050 1 1 1 748.3788 2242.1145 3 2242.1131 0.0015 0 44.18 7.20E-05 K NNQFQALLQYADPVSAQHAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7591.7591.3.dta 45 IPI00556157.1 Polypyrimidine tract-binding protein 1 isoform c variant (Fragment) 160 35812 7 7 7 7 125 2389 1 0 1 319.2111 636.4076 2 636.4071 0.0004 0 22.83 0.021 R VIHIR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2663.2663.2.dta 45 IPI00556157.1 Polypyrimidine tract-binding protein 1 isoform c variant (Fragment) 160 35812 7 7 7 7 197 3859 1 0 0 332.705 663.3954 2 663.3956 -0.0001 0 41.35 0.00096 K FGTVLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4291.4291.2.dta 45 IPI00556157.1 Polypyrimidine tract-binding protein 1 isoform c variant (Fragment) 160 35812 7 7 7 7 1574 5733 1 0 1 474.283 946.5514 2 946.5521 -0.0007 0 43.64 0.00026 K VTNLLMLK G Oxidation (M) 0.00000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6268.6268.2.dta 45 IPI00556157.1 Polypyrimidine tract-binding protein 1 isoform c variant (Fragment) 160 35812 7 7 7 7 4412 1498 1 0 1 673.3387 1344.6629 2 1344.6633 -0.0004 1 22.8 0.012 K ELKTDSSPNQAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1695.1695.2.dta 45 IPI00556157.1 Polypyrimidine tract-binding protein 1 isoform c variant (Fragment) 160 35812 7 7 7 7 5019 4870 1 0 1 716.371 1430.7274 2 1430.7306 -0.0032 0 29.7 0.0019 R GQPIYIQFSNHK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5386.5386.2.dta 45 IPI00556157.1 Polypyrimidine tract-binding protein 1 isoform c variant (Fragment) 160 35812 7 7 7 7 7495 5803 1 0 1 949.4476 1896.8806 2 1896.8822 -0.0016 0 62.43 1.40E-06 K LSLDGQNIYNACCTLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6338.6338.2.dta 45 IPI00556157.1 Polypyrimidine tract-binding protein 1 isoform c variant (Fragment) 160 35812 7 7 7 7 8126 7050 1 0 1 748.3788 2242.1145 3 2242.1131 0.0015 0 44.18 7.20E-05 K NNQFQALLQYADPVSAQHAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7591.7591.3.dta 45 IPI00413691.2 polypyrimidine tract-binding protein 1 isoform d 73 21899 5 5 4 4 818 1078 1 0 1 410.7614 819.5083 2 819.5079 0.0004 0 21.22 0.0091 K LHGKPIR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1241.1241.2.dta 45 IPI00413691.2 polypyrimidine tract-binding protein 1 isoform d 73 21899 5 5 4 4 1849 2670 1 0 1 331.1859 990.536 3 990.5359 0.0001 0 26.12 0.038 K HQNVQLPR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2969.2969.3.dta 45 IPI00413691.2 polypyrimidine tract-binding protein 1 isoform d 73 21899 5 5 4 4 2306 2713 1 0 1 529.7533 1057.492 2 1057.4941 -0.0021 0 47.08 0.00012 K DYGNSPLHR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3015.3015.2.dta 45 IPI00413691.2 polypyrimidine tract-binding protein 1 isoform d 73 21899 5 5 4 4 2307 2710 1 0 1 353.5057 1057.4952 3 1057.4941 0.0011 0 18.88 0.026 K DYGNSPLHR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3012.3012.3.dta 45 IPI00413691.2 polypyrimidine tract-binding protein 1 isoform d 73 21899 5 5 4 4 7979 3536 1 0 1 715.3362 2142.9869 3 2142.993 -0.0061 1 29.48 0.0017 R EGQEDQGLTKDYGNSPLHR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3935.3935.3.dta 45 IPI00159072.3 ROD1 regulator of differentiation 1 66 57071 3 3 3 3 125 2389 1 0 1 319.2111 636.4076 2 636.4071 0.0004 0 22.83 0.021 R VLHLR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2663.2663.2.dta 45 IPI00159072.3 ROD1 regulator of differentiation 1 66 57071 3 3 3 3 197 3859 1 0 0 332.705 663.3954 2 663.3956 -0.0001 0 41.35 0.00096 K FGTVLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4291.4291.2.dta 45 IPI00159072.3 ROD1 regulator of differentiation 1 66 57071 3 3 3 3 1574 5733 1 0 1 474.283 946.5514 2 946.5521 -0.0007 0 43.64 0.00026 K VTNLLMLK G Oxidation (M) 0.00000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6268.6268.2.dta 46 1 IPI00410693.3 Isoform 1 of Plasminogen activator inhibitor 1 RNA-binding protein 215 44995 8 8 7 7 618 4676 1 1 1 389.2165 776.4185 2 776.4181 0.0004 0 33.01 0.011 K VEFNIR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5176.5176.2.dta 46 1 IPI00410693.3 Isoform 1 of Plasminogen activator inhibitor 1 RNA-binding protein 215 44995 8 8 7 7 3738 1641 1 1 1 628.3223 1254.63 2 1254.6317 -0.0017 0 41.23 0.0013 R RPDQQLQGEGK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1850.1850.2.dta 46 1 IPI00410693.3 Isoform 1 of Plasminogen activator inhibitor 1 RNA-binding protein 215 44995 8 8 7 7 3739 1646 1 1 1 419.2175 1254.6308 3 1254.6317 -0.0009 0 38.49 0.0021 R RPDQQLQGEGK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1855.1855.3.dta 46 1 IPI00410693.3 Isoform 1 of Plasminogen activator inhibitor 1 RNA-binding protein 215 44995 8 8 7 7 5225 1426 1 1 1 730.8576 1459.7007 2 1459.7015 -0.0008 0 98.01 1.20E-09 K SAAQAAAQTNSNAAGK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1618.1618.2.dta 46 1 IPI00410693.3 Isoform 1 of Plasminogen activator inhibitor 1 RNA-binding protein 215 44995 8 8 7 7 5806 1837 1 1 1 784.4198 1566.825 2 1566.8226 0.0024 1 23.38 0.0064 R VGRRPDQQLQGEGK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2062.2062.2.dta 46 1 IPI00410693.3 Isoform 1 of Plasminogen activator inhibitor 1 RNA-binding protein 215 44995 8 8 7 7 6934 6840 1 1 1 880.4025 1758.7905 2 1758.7948 -0.0043 0 43.44 8.40E-05 K SSASAPDVDDPEAFPALA - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7374.7374.2.dta 46 1 IPI00410693.3 Isoform 1 of Plasminogen activator inhibitor 1 RNA-binding protein 215 44995 8 8 7 7 7676 7989 1 1 1 972.4484 1942.8823 2 1942.8837 -0.0014 0 30.33 0.0014 R FDQLFDDESDPFEVLK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8619.8619.2.dta 46 1 IPI00410693.3 Isoform 1 of Plasminogen activator inhibitor 1 RNA-binding protein 215 44995 8 8 7 7 7945 6241 1 1 1 1052.4889 2102.9632 2 2102.9644 -0.0012 1 42.13 0.00011 R TDKSSASAPDVDDPEAFPALA - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6776.6776.2.dta 47 1 IPI00604620.3 Isoform 1 of Nucleolin 212 76625 9 9 9 9 473 9006 1 1 1 373.7258 745.4371 2 745.4334 0.0037 1 24.5 0.023 R LVSKDGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.966.966.2.dta 47 1 IPI00604620.3 Isoform 1 of Nucleolin 212 76625 9 9 9 9 1517 5433 1 1 1 469.2523 936.4901 2 936.4917 -0.0015 0 51.91 9.80E-05 K TGISDVFAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5968.5968.2.dta 47 1 IPI00604620.3 Isoform 1 of Nucleolin 212 76625 9 9 9 9 2758 999 1 1 1 561.7673 1121.5201 2 1121.5214 -0.0013 1 17.79 0.021 K GQNQDYRGGK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1155.1155.2.dta 47 1 IPI00604620.3 Isoform 1 of Nucleolin 212 76625 9 9 9 9 2969 4600 1 1 1 384.8999 1151.6779 3 1151.6775 0.0004 1 29.21 0.0052 R AIRLELQGPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5094.5094.3.dta 47 1 IPI00604620.3 Isoform 1 of Nucleolin 212 76625 9 9 9 9 3022 5011 1 1 1 580.7958 1159.5771 2 1159.5761 0.001 0 27.49 0.01 R SISLYYTGEK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5538.5538.2.dta 47 1 IPI00604620.3 Isoform 1 of Nucleolin 212 76625 9 9 9 9 3212 1336 1 1 1 596.8113 1191.6081 2 1191.6095 -0.0014 1 68.88 1.30E-06 R IVTDRETGSSK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1520.1520.2.dta 47 1 IPI00604620.3 Isoform 1 of Nucleolin 212 76625 9 9 9 9 5770 6731 1 1 1 781.3428 1560.6711 2 1560.6733 -0.0022 0 61.78 2.00E-06 K GFGFVDFNSEEDAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7267.7267.2.dta 47 1 IPI00604620.3 Isoform 1 of Nucleolin 212 76625 9 9 9 9 7609 6687 1 1 1 640.3463 1918.0171 3 1918.016 0.0011 1 40.53 0.00069 K TGISDVFAKNDLAVVDVR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7223.7223.3.dta 47 1 IPI00604620.3 Isoform 1 of Nucleolin 212 76625 9 9 9 9 8027 5721 1 1 1 734.012 2199.0142 3 2199.0179 -0.0037 1 44.49 6.70E-05 K GLSEDTTEETLKESFDGSVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6256.6256.3.dta 47 IPI00444262.3 "CDNA FLJ45706 fis, clone FEBRA2028457, highly similar to Nucleolin" 208 65979 8 8 8 8 1517 5433 1 0 1 469.2523 936.4901 2 936.4917 -0.0015 0 51.91 9.80E-05 K TGISDVFAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5968.5968.2.dta 47 IPI00444262.3 "CDNA FLJ45706 fis, clone FEBRA2028457, highly similar to Nucleolin" 208 65979 8 8 8 8 2758 999 1 0 1 561.7673 1121.5201 2 1121.5214 -0.0013 1 17.79 0.021 K GQNQDYRGGK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1155.1155.2.dta 47 IPI00444262.3 "CDNA FLJ45706 fis, clone FEBRA2028457, highly similar to Nucleolin" 208 65979 8 8 8 8 2969 4600 1 0 1 384.8999 1151.6779 3 1151.6775 0.0004 1 29.21 0.0052 R AIRLELQGPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5094.5094.3.dta 47 IPI00444262.3 "CDNA FLJ45706 fis, clone FEBRA2028457, highly similar to Nucleolin" 208 65979 8 8 8 8 3022 5011 1 0 1 580.7958 1159.5771 2 1159.5761 0.001 0 27.49 0.01 R SISLYYTGEK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5538.5538.2.dta 47 IPI00444262.3 "CDNA FLJ45706 fis, clone FEBRA2028457, highly similar to Nucleolin" 208 65979 8 8 8 8 3212 1336 1 0 1 596.8113 1191.6081 2 1191.6095 -0.0014 1 68.88 1.30E-06 R IVTDRETGSSK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1520.1520.2.dta 47 IPI00444262.3 "CDNA FLJ45706 fis, clone FEBRA2028457, highly similar to Nucleolin" 208 65979 8 8 8 8 5770 6731 1 0 1 781.3428 1560.6711 2 1560.6733 -0.0022 0 61.78 2.00E-06 K GFGFVDFNSEEDAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7267.7267.2.dta 47 IPI00444262.3 "CDNA FLJ45706 fis, clone FEBRA2028457, highly similar to Nucleolin" 208 65979 8 8 8 8 7609 6687 1 0 1 640.3463 1918.0171 3 1918.016 0.0011 1 40.53 0.00069 K TGISDVFAKNDLAVVDVR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7223.7223.3.dta 47 IPI00444262.3 "CDNA FLJ45706 fis, clone FEBRA2028457, highly similar to Nucleolin" 208 65979 8 8 8 8 8027 5721 1 0 1 734.012 2199.0142 3 2199.0179 -0.0037 1 44.49 6.70E-05 K GLSEDTTEETLKESFDGSVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6256.6256.3.dta 47 IPI00183526.5 NCL protein 160 51667 6 6 6 6 2758 999 1 0 1 561.7673 1121.5201 2 1121.5214 -0.0013 1 17.79 0.021 K GQNQDYRGGK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1155.1155.2.dta 47 IPI00183526.5 NCL protein 160 51667 6 6 6 6 2969 4600 1 0 1 384.8999 1151.6779 3 1151.6775 0.0004 1 29.21 0.0052 R AIRLELQGPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5094.5094.3.dta 47 IPI00183526.5 NCL protein 160 51667 6 6 6 6 3022 5011 1 0 1 580.7958 1159.5771 2 1159.5761 0.001 0 27.49 0.01 R SISLYYTGEK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5538.5538.2.dta 47 IPI00183526.5 NCL protein 160 51667 6 6 6 6 3212 1336 1 0 1 596.8113 1191.6081 2 1191.6095 -0.0014 1 68.88 1.30E-06 R IVTDRETGSSK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1520.1520.2.dta 47 IPI00183526.5 NCL protein 160 51667 6 6 6 6 5770 6731 1 0 1 781.3428 1560.6711 2 1560.6733 -0.0022 0 61.78 2.00E-06 K GFGFVDFNSEEDAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7267.7267.2.dta 47 IPI00183526.5 NCL protein 160 51667 6 6 6 6 8027 5721 1 0 1 734.012 2199.0142 3 2199.0179 -0.0037 1 44.49 6.70E-05 K GLSEDTTEETLKESFDGSVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6256.6256.3.dta 48 1 IPI00069750.2 fuse-binding protein-interacting repressor isoform a 211 60009 8 8 8 8 2435 6288 1 1 1 538.3013 1074.588 2 1074.5862 0.0018 0 24.33 0.012 R QAFAPFGPIK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6822.6822.2.dta 48 1 IPI00069750.2 fuse-binding protein-interacting repressor isoform a 211 60009 8 8 8 8 2635 5417 1 1 1 553.2633 1104.5121 2 1104.5128 -0.0007 0 45 6.00E-05 K GYGFIEYEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5952.5952.2.dta 48 1 IPI00069750.2 fuse-binding protein-interacting repressor isoform a 211 60009 8 8 8 8 3203 3741 1 1 1 595.8309 1189.6472 2 1189.6489 -0.0017 1 44.88 0.00032 R KQESTVMVLR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4163.4163.2.dta 48 1 IPI00069750.2 fuse-binding protein-interacting repressor isoform a 211 60009 8 8 8 8 4816 6454 1 1 1 700.3141 1398.6136 2 1398.6159 -0.0023 0 51.92 1.40E-05 K SIDMSWDSVTMK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6985.6985.2.dta 48 1 IPI00069750.2 fuse-binding protein-interacting repressor isoform a 211 60009 8 8 8 8 6943 5897 1 1 1 881.4896 1760.9647 2 1760.9672 -0.0025 0 49.58 2.20E-05 K LGLPPLTPEQQEALQK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6432.6432.2.dta 48 1 IPI00069750.2 fuse-binding protein-interacting repressor isoform a 211 60009 8 8 8 8 7428 7256 1 1 1 938.9695 1875.9244 2 1875.9254 -0.001 0 26.25 0.0035 R VYVGSIYYELGEDTIR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7812.7812.2.dta 48 1 IPI00069750.2 fuse-binding protein-interacting repressor isoform a 211 60009 8 8 8 8 8316 6411 1 1 1 788.0861 2361.2364 3 2361.24 -0.0037 0 50.45 1.90E-05 K VGRPSNIGQAQPIIDQLAEEAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6943.6943.3.dta 48 1 IPI00069750.2 fuse-binding protein-interacting repressor isoform a 211 60009 8 8 8 8 8984 7291 1 1 1 937.5203 2809.5391 3 2809.5412 -0.002 0 36.51 0.00078 K AVTPPMPLLTPATPGGLPPAAAVAAAAATAK I Oxidation (M) 0.0000010000000000000000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7853.7853.3.dta 49 1 IPI00789324.1 JUP protein 210 82416 7 7 7 7 457 4773 1 1 1 372.2426 742.4707 2 742.4701 0.0006 0 36.31 0.0043 K ATIGLIR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5281.5281.2.dta 49 1 IPI00789324.1 JUP protein 210 82416 7 7 7 7 1351 1127 1 1 1 456.238 910.4615 2 910.4621 -0.0006 0 22.05 0.0085 K HLTSNSPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1294.1294.2.dta 49 1 IPI00789324.1 JUP protein 210 82416 7 7 7 7 4384 4686 1 1 1 671.3658 1340.7171 2 1340.7188 -0.0016 0 63.39 5.70E-06 K LLNDEDPVVVTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5187.5187.2.dta 49 1 IPI00789324.1 JUP protein 210 82416 7 7 7 7 5381 6810 1 1 1 742.379 1482.7435 2 1482.7467 -0.0032 0 85.55 4.90E-08 R NEGTATYAAAVLFR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7345.7345.2.dta 49 1 IPI00789324.1 JUP protein 210 82416 7 7 7 7 7196 5586 1 1 1 610.998 1829.9721 3 1829.9734 -0.0013 1 34.62 0.001 R NLSDVATKQEGLESVLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6121.6121.3.dta 49 1 IPI00789324.1 JUP protein 210 82416 7 7 7 7 7846 5761 1 1 1 677.0157 2028.0254 3 2028.0276 -0.0022 0 27.64 0.0026 K SAIVHLINYQDDAELATR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6296.6296.3.dta 49 1 IPI00789324.1 JUP protein 210 82416 7 7 7 7 7989 5566 1 1 1 719.0513 2154.132 3 2154.1367 -0.0048 0 55.12 6.80E-06 R NLALCPANHAPLQEAAVIPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6100.6100.3.dta 49 IPI00554711.2 Junction plakoglobin 197 82376 6 6 6 6 457 4773 1 0 1 372.2426 742.4707 2 742.4701 0.0006 0 36.31 0.0043 K ATIGLIR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5281.5281.2.dta 49 IPI00554711.2 Junction plakoglobin 197 82376 6 6 6 6 1351 1127 1 0 1 456.238 910.4615 2 910.4621 -0.0006 0 22.05 0.0085 K HLTSNSPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1294.1294.2.dta 49 IPI00554711.2 Junction plakoglobin 197 82376 6 6 6 6 4384 4686 1 0 1 671.3658 1340.7171 2 1340.7188 -0.0016 0 63.39 5.70E-06 K LLNDEDPVVVTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5187.5187.2.dta 49 IPI00554711.2 Junction plakoglobin 197 82376 6 6 6 6 5381 6810 1 0 1 742.379 1482.7435 2 1482.7467 -0.0032 0 85.55 4.90E-08 R NEGTATYAAAVLFR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7345.7345.2.dta 49 IPI00554711.2 Junction plakoglobin 197 82376 6 6 6 6 7196 5586 1 0 1 610.998 1829.9721 3 1829.9734 -0.0013 1 34.62 0.001 R NLSDVATKQEGLESVLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6121.6121.3.dta 49 IPI00554711.2 Junction plakoglobin 197 82376 6 6 6 6 7989 5566 1 0 1 719.0513 2154.132 3 2154.1367 -0.0048 0 55.12 6.80E-06 R NLALCPANHAPLQEAAVIPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6100.6100.3.dta 49 IPI00793164.1 55 kDa protein 156 55868 5 5 5 5 457 4773 1 0 1 372.2426 742.4707 2 742.4701 0.0006 0 36.31 0.0043 K ATIGLIR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5281.5281.2.dta 49 IPI00793164.1 55 kDa protein 156 55868 5 5 5 5 1351 1127 1 0 1 456.238 910.4615 2 910.4621 -0.0006 0 22.05 0.0085 K HLTSNSPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1294.1294.2.dta 49 IPI00793164.1 55 kDa protein 156 55868 5 5 5 5 5381 6810 1 0 1 742.379 1482.7435 2 1482.7467 -0.0032 0 85.55 4.90E-08 R NEGTATYAAAVLFR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7345.7345.2.dta 49 IPI00793164.1 55 kDa protein 156 55868 5 5 5 5 7196 5586 1 0 1 610.998 1829.9721 3 1829.9734 -0.0013 1 34.62 0.001 R NLSDVATKQEGLESVLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6121.6121.3.dta 49 IPI00793164.1 55 kDa protein 156 55868 5 5 5 5 7989 5566 1 0 1 719.0513 2154.132 3 2154.1367 -0.0048 0 55.12 6.80E-06 R NLALCPANHAPLQEAAVIPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6100.6100.3.dta 49 IPI00788705.1 30 kDa protein 73 30528 2 2 2 2 4384 4686 1 0 1 671.3658 1340.7171 2 1340.7188 -0.0016 0 63.39 5.70E-06 K LLNDEDPVVVTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5187.5187.2.dta 49 IPI00788705.1 30 kDa protein 73 30528 2 2 2 2 7846 5761 1 0 1 677.0157 2028.0254 3 2028.0276 -0.0022 0 27.64 0.0026 K SAIVHLINYQDDAELATR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6296.6296.3.dta 50 1 IPI00550821.2 Isoform 1 of Cleavage and polyadenylation specificity factor 7 209 52189 5 5 5 5 2920 2122 1 1 1 572.7653 1143.5161 2 1143.5156 0.0005 0 67.53 4.70E-07 K SYSVGASGSSSR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2373.2373.2.dta 50 1 IPI00550821.2 Isoform 1 of Cleavage and polyadenylation specificity factor 7 209 52189 5 5 5 5 3450 6449 1 1 1 611.3395 1220.6644 2 1220.6653 -0.0008 0 43.28 0.00063 R SIGVYDVVELK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6980.6980.2.dta 50 1 IPI00550821.2 Isoform 1 of Cleavage and polyadenylation specificity factor 7 209 52189 5 5 5 5 4019 4134 1 1 1 646.3224 1290.6303 2 1290.6316 -0.0013 0 61.76 3.80E-06 R QNLSQFEAQAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4589.4589.2.dta 50 1 IPI00550821.2 Isoform 1 of Cleavage and polyadenylation specificity factor 7 209 52189 5 5 5 5 4309 3767 1 1 1 664.8409 1327.6672 2 1327.6732 -0.006 0 59.48 1.90E-05 R ATPSENLVPSSAR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4191.4191.2.dta 50 1 IPI00550821.2 Isoform 1 of Cleavage and polyadenylation specificity factor 7 209 52189 5 5 5 5 4474 6279 1 1 1 677.8717 1353.7289 2 1353.7292 -0.0004 0 65.86 4.60E-06 K TPAILYTYSGLR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6813.6813.2.dta 51 1 IPI00026781.2 Fatty acid synthase 208 275850 10 10 10 10 989 4990 1 1 1 423.7455 845.4764 2 845.4759 0.0005 0 30.17 0.019 K AGLYGLPR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5517.5517.2.dta 51 1 IPI00026781.2 Fatty acid synthase 208 275850 10 10 10 10 1335 2021 1 1 1 454.2299 906.4453 2 906.4447 0.0007 0 70.96 1.70E-06 R AAEQYTPK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2262.2262.2.dta 51 1 IPI00026781.2 Fatty acid synthase 208 275850 10 10 10 10 2516 4844 1 1 1 543.3135 1084.6124 2 1084.6128 -0.0004 0 25.28 0.0043 R QEPLLIGSTK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5358.5358.2.dta 51 1 IPI00026781.2 Fatty acid synthase 208 275850 10 10 10 10 2714 6704 1 1 1 558.3369 1114.6592 2 1114.6598 -0.0006 0 57.5 6.50E-06 R SEGVVAVLLTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7240.7240.2.dta 51 1 IPI00026781.2 Fatty acid synthase 208 275850 10 10 10 10 3646 5826 1 1 1 415.2589 1242.755 3 1242.7547 0.0003 1 18.75 0.032 R SEGVVAVLLTKK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6362.6362.3.dta 51 1 IPI00026781.2 Fatty acid synthase 208 275850 10 10 10 10 3700 6057 1 1 1 417.8768 1250.6086 3 1250.6084 0.0001 0 30.54 0.01 R FDASFFGVHPK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6592.6592.3.dta 51 1 IPI00026781.2 Fatty acid synthase 208 275850 10 10 10 10 3830 5131 1 1 1 632.374 1262.7335 2 1262.7347 -0.0012 0 50.54 3.70E-05 R LQVVDQPLPVR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5662.5662.2.dta 51 1 IPI00026781.2 Fatty acid synthase 208 275850 10 10 10 10 4458 8214 1 1 1 676.3533 1350.6921 2 1350.6932 -0.0011 0 26.33 0.0067 R DNLEFFLAGIGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8841.8841.2.dta 51 1 IPI00026781.2 Fatty acid synthase 208 275850 10 10 10 10 4877 5786 1 1 1 704.8659 1407.7173 2 1407.718 -0.0008 0 34.43 0.00059 R LSIPTYGLQCTR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6320.6320.2.dta 51 1 IPI00026781.2 Fatty acid synthase 208 275850 10 10 10 10 8689 6018 1 1 1 848.0717 2541.1933 3 2541.2023 -0.009 0 31.48 0.0011 R SLYQSAGVAPESFEYIEAHGTGTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6552.6552.3.dta 51 IPI00793768.1 Protein 85 133622 2 2 2 2 1335 2021 1 0 1 454.2299 906.4453 2 906.4447 0.0007 0 70.96 1.70E-06 R AAEQYTPK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2262.2262.2.dta 51 IPI00793768.1 Protein 85 133622 2 2 2 2 4877 5786 1 0 1 704.8659 1407.7173 2 1407.718 -0.0008 0 34.43 0.00059 R LSIPTYGLQCTR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6320.6320.2.dta 51 IPI00795588.1 Protein 71 25373 1 1 1 1 1335 2021 1 0 1 454.2299 906.4453 2 906.4447 0.0007 0 70.96 1.70E-06 R AAEQYTPK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2262.2262.2.dta 52 1 IPI00398625.5 Hornerin 205 283140 9 9 8 8 3630 9254 1 1 1 620.7864 1239.5582 2 1239.5592 -0.001 0 42.81 9.70E-05 R HGSGSGQSPSPSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.995.995.2.dta 52 1 IPI00398625.5 Hornerin 205 283140 9 9 8 8 3693 1013 1 1 1 417.5377 1249.5911 3 1249.5912 -0.0001 0 30.38 0.0077 R HGAGSGQSLSHGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1170.1170.3.dta 52 1 IPI00398625.5 Hornerin 205 283140 9 9 8 8 4438 5925 1 1 1 674.8078 1347.601 2 1347.6028 -0.0018 0 65.91 7.30E-07 R HGSGSGQSPGHGQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.646.646.2.dta 52 1 IPI00398625.5 Hornerin 205 283140 9 9 8 8 4797 1294 1 1 1 698.3158 1394.617 2 1394.6175 -0.0004 0 65.77 6.80E-07 R YGQQGSGSGQSPSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1475.1475.2.dta 52 1 IPI00398625.5 Hornerin 205 283140 9 9 8 8 5777 6154 1 1 1 521.9047 1562.6923 3 1562.6935 -0.0011 0 25.41 0.0041 R GQHSSGSGQSPGHGQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.669.669.3.dta 52 1 IPI00398625.5 Hornerin 205 283140 9 9 8 8 5778 6174 1 1 1 782.3537 1562.6928 2 1562.6935 -0.0006 0 34.22 0.00062 R GQHSSGSGQSPGHGQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.671.671.2.dta 52 1 IPI00398625.5 Hornerin 205 283140 9 9 8 8 7115 279 1 1 1 603.5894 1807.7462 3 1807.747 -0.0008 0 26.55 0.0095 R HGSSSGSSSSYGQHGSGSR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1035.1035.3.dta 52 1 IPI00398625.5 Hornerin 205 283140 9 9 8 8 7682 1227 1 1 1 649.9718 1946.8936 3 1946.8943 -0.0008 0 31.7 0.002 R QSLGHGQHGSGSGQSPSPSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1402.1402.3.dta 52 1 IPI00398625.5 Hornerin 205 283140 9 9 8 8 7965 925 1 1 1 708.2969 2121.8688 3 2121.8696 -0.0008 0 14.67 0.041 R GEQHGSSSGSSSSYGQHGSGSR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1130.1130.3.dta 52 IPI00787362.1 similar to Hornerin 197 188565 8 8 7 7 3630 9254 1 0 1 620.7864 1239.5582 2 1239.5592 -0.001 0 42.81 9.70E-05 R HGSGSGQSPSPSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.995.995.2.dta 52 IPI00787362.1 similar to Hornerin 197 188565 8 8 7 7 3693 1013 1 0 1 417.5377 1249.5911 3 1249.5912 -0.0001 0 30.38 0.0077 R HGAGSGQSLSHGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1170.1170.3.dta 52 IPI00787362.1 similar to Hornerin 197 188565 8 8 7 7 4438 5925 1 0 1 674.8078 1347.601 2 1347.6028 -0.0018 0 65.91 7.30E-07 R HGSGSGQSPGHGQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.646.646.2.dta 52 IPI00787362.1 similar to Hornerin 197 188565 8 8 7 7 4797 1294 1 0 1 698.3158 1394.617 2 1394.6175 -0.0004 0 65.77 6.80E-07 R YGQQGSGSGQSPSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1475.1475.2.dta 52 IPI00787362.1 similar to Hornerin 197 188565 8 8 7 7 5777 6154 1 0 1 521.9047 1562.6923 3 1562.6935 -0.0011 0 25.41 0.0041 R GQHSSGSGQSPGHGQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.669.669.3.dta 52 IPI00787362.1 similar to Hornerin 197 188565 8 8 7 7 5778 6174 1 0 1 782.3537 1562.6928 2 1562.6935 -0.0006 0 34.22 0.00062 R GQHSSGSGQSPGHGQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.671.671.2.dta 52 IPI00787362.1 similar to Hornerin 197 188565 8 8 7 7 7682 1227 1 0 1 649.9718 1946.8936 3 1946.8943 -0.0008 0 31.7 0.002 R QSLGHGQHGSGSGQSPSPSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1402.1402.3.dta 52 IPI00787362.1 similar to Hornerin 197 188565 8 8 7 7 7965 925 1 0 1 708.2969 2121.8688 3 2121.8696 -0.0008 0 14.67 0.041 R GEQHGSSSGSSSSYGQHGSGSR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1130.1130.3.dta 53 1 IPI00384938.1 Hypothetical protein DKFZp686N02209 201 53503 9 9 3 3 887 4225 1 1 1 418.2218 834.429 2 834.4269 0.0021 0 40.12 0.0026 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4688.4688.2.dta 53 1 IPI00384938.1 Hypothetical protein DKFZp686N02209 201 53503 9 9 3 3 890 2941 1 1 1 418.7408 835.4671 2 835.4664 0.0006 1 37.42 0.0026 K GRFTISR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3266.3266.2.dta 53 1 IPI00384938.1 Hypothetical protein DKFZp686N02209 201 53503 9 9 3 3 1006 3661 1 1 1 426.2169 850.4193 2 850.4218 -0.0025 0 59.76 2.00E-05 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4073.4073.2.dta 53 1 IPI00384938.1 Hypothetical protein DKFZp686N02209 201 53503 9 9 3 3 1008 4005 1 1 1 426.2178 850.4211 2 850.4218 -0.0007 0 38.06 0.0028 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4449.4449.2.dta 53 1 IPI00384938.1 Hypothetical protein DKFZp686N02209 201 53503 9 9 3 3 1011 4171 1 1 1 426.2182 850.4218 2 850.4218 0 0 43.24 0.0013 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4629.4629.2.dta 53 1 IPI00384938.1 Hypothetical protein DKFZp686N02209 201 53503 9 9 3 3 1016 3590 1 1 1 426.2187 850.4228 2 850.4218 0.001 0 36.5 0.0059 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3996.3996.2.dta 53 1 IPI00384938.1 Hypothetical protein DKFZp686N02209 201 53503 9 9 3 3 1017 4203 1 1 1 426.2189 850.4233 2 850.4218 0.0015 0 33.44 0.012 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4664.4664.2.dta 53 1 IPI00384938.1 Hypothetical protein DKFZp686N02209 201 53503 9 9 3 3 3851 4768 1 1 1 634.3835 1266.7524 2 1266.7547 -0.0023 1 51.82 2.80E-05 K ALPAPIEKTISK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5276.5276.2.dta 53 1 IPI00384938.1 Hypothetical protein DKFZp686N02209 201 53503 9 9 3 3 3852 4304 1 1 1 634.3838 1266.7531 2 1266.7547 -0.0016 1 56.61 9.20E-06 K ALPAPIEKTISK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4773.4773.2.dta 53 IPI00168728.1 FLJ00385 protein (Fragment) 188 57272 8 8 2 2 887 4225 1 0 1 418.2218 834.429 2 834.4269 0.0021 0 40.12 0.0026 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4688.4688.2.dta 53 IPI00168728.1 FLJ00385 protein (Fragment) 188 57272 8 8 2 2 1006 3661 1 0 1 426.2169 850.4193 2 850.4218 -0.0025 0 59.76 2.00E-05 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4073.4073.2.dta 53 IPI00168728.1 FLJ00385 protein (Fragment) 188 57272 8 8 2 2 1008 4005 1 0 1 426.2178 850.4211 2 850.4218 -0.0007 0 38.06 0.0028 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4449.4449.2.dta 53 IPI00168728.1 FLJ00385 protein (Fragment) 188 57272 8 8 2 2 1011 4171 1 0 1 426.2182 850.4218 2 850.4218 0 0 43.24 0.0013 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4629.4629.2.dta 53 IPI00168728.1 FLJ00385 protein (Fragment) 188 57272 8 8 2 2 1016 3590 1 0 1 426.2187 850.4228 2 850.4218 0.001 0 36.5 0.0059 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3996.3996.2.dta 53 IPI00168728.1 FLJ00385 protein (Fragment) 188 57272 8 8 2 2 1017 4203 1 0 1 426.2189 850.4233 2 850.4218 0.0015 0 33.44 0.012 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4664.4664.2.dta 53 IPI00168728.1 FLJ00385 protein (Fragment) 188 57272 8 8 2 2 3851 4768 1 0 1 634.3835 1266.7524 2 1266.7547 -0.0023 1 51.82 2.80E-05 K ALPAPIEKTISK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5276.5276.2.dta 53 IPI00168728.1 FLJ00385 protein (Fragment) 188 57272 8 8 2 2 3852 4304 1 0 1 634.3838 1266.7531 2 1266.7547 -0.0016 1 56.61 9.20E-06 K ALPAPIEKTISK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4773.4773.2.dta 53 IPI00426051.3 Hypothetical protein DKFZp686C15213 133 51864 7 7 2 2 887 4225 1 0 1 418.2218 834.429 2 834.4269 0.0021 0 40.12 0.0026 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4688.4688.2.dta 53 IPI00426051.3 Hypothetical protein DKFZp686C15213 133 51864 7 7 2 2 890 2941 1 0 1 418.7408 835.4671 2 835.4664 0.0006 1 37.42 0.0026 K GRFTISR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3266.3266.2.dta 53 IPI00426051.3 Hypothetical protein DKFZp686C15213 133 51864 7 7 2 2 1006 3661 1 0 1 426.2169 850.4193 2 850.4218 -0.0025 0 59.76 2.00E-05 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4073.4073.2.dta 53 IPI00426051.3 Hypothetical protein DKFZp686C15213 133 51864 7 7 2 2 1008 4005 1 0 1 426.2178 850.4211 2 850.4218 -0.0007 0 38.06 0.0028 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4449.4449.2.dta 53 IPI00426051.3 Hypothetical protein DKFZp686C15213 133 51864 7 7 2 2 1011 4171 1 0 1 426.2182 850.4218 2 850.4218 0 0 43.24 0.0013 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4629.4629.2.dta 53 IPI00426051.3 Hypothetical protein DKFZp686C15213 133 51864 7 7 2 2 1016 3590 1 0 1 426.2187 850.4228 2 850.4218 0.001 0 36.5 0.0059 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3996.3996.2.dta 53 IPI00426051.3 Hypothetical protein DKFZp686C15213 133 51864 7 7 2 2 1017 4203 1 0 1 426.2189 850.4233 2 850.4218 0.0015 0 33.44 0.012 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4664.4664.2.dta 53 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 119 46716 6 6 1 1 887 4225 1 0 1 418.2218 834.429 2 834.4269 0.0021 0 40.12 0.0026 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4688.4688.2.dta 53 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 119 46716 6 6 1 1 1006 3661 1 0 1 426.2169 850.4193 2 850.4218 -0.0025 0 59.76 2.00E-05 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4073.4073.2.dta 53 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 119 46716 6 6 1 1 1008 4005 1 0 1 426.2178 850.4211 2 850.4218 -0.0007 0 38.06 0.0028 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4449.4449.2.dta 53 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 119 46716 6 6 1 1 1011 4171 1 0 1 426.2182 850.4218 2 850.4218 0 0 43.24 0.0013 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4629.4629.2.dta 53 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 119 46716 6 6 1 1 1016 3590 1 0 1 426.2187 850.4228 2 850.4218 0.001 0 36.5 0.0059 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3996.3996.2.dta 53 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 119 46716 6 6 1 1 1017 4203 1 0 1 426.2189 850.4233 2 850.4218 0.0015 0 33.44 0.012 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4664.4664.2.dta 53 IPI00007899.2 Single chain Fv (Fragment) 37 12349 1 1 1 1 890 2941 1 0 1 418.7408 835.4671 2 835.4664 0.0006 1 37.42 0.0026 K GRFTISR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3266.3266.2.dta 54 1 IPI00479217.1 Isoform Short of Heterogeneous nuclear ribonucleoprotein U 199 89665 7 7 7 7 446 3188 1 1 1 368.2053 734.396 2 734.3963 -0.0003 0 24.03 0.033 K TTWVTK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3540.3540.2.dta 54 1 IPI00479217.1 Isoform Short of Heterogeneous nuclear ribonucleoprotein U 199 89665 7 7 7 7 811 4616 1 1 1 410.24 818.4655 2 818.465 0.0005 0 28.44 0.015 K FIEIAAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5111.5111.2.dta 54 1 IPI00479217.1 Isoform Short of Heterogeneous nuclear ribonucleoprotein U 199 89665 7 7 7 7 1542 2579 1 1 1 314.5309 940.5707 3 940.5706 0.0002 1 23.73 0.027 K VTEKIPVR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2869.2869.3.dta 54 1 IPI00479217.1 Isoform Short of Heterogeneous nuclear ribonucleoprotein U 199 89665 7 7 7 7 1886 3652 1 1 1 498.7586 995.5027 2 995.5036 -0.0009 0 43.87 0.00055 K DIDIHEVR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4063.4063.2.dta 54 1 IPI00479217.1 Isoform Short of Heterogeneous nuclear ribonucleoprotein U 199 89665 7 7 7 7 2234 4648 1 1 1 524.7742 1047.5339 2 1047.5349 -0.001 0 46.54 5.50E-05 K NGQDLGVAFK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5146.5146.2.dta 54 1 IPI00479217.1 Isoform Short of Heterogeneous nuclear ribonucleoprotein U 199 89665 7 7 7 7 6303 5560 1 1 1 824.4244 1646.8342 2 1646.8376 -0.0034 0 101.93 1.70E-09 R NFILDQTNVSAAAQR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6095.6095.2.dta 54 1 IPI00479217.1 Isoform Short of Heterogeneous nuclear ribonucleoprotein U 199 89665 7 7 7 7 6735 6707 1 1 1 857.9581 1713.9017 2 1713.905 -0.0033 0 59.16 3.20E-06 K SSGPTSLFAVTVAPPGAR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7243.7243.2.dta 54 IPI00644224.1 Heterogeneous nuclear ribonucleoprotein U 158 62395 6 6 6 6 446 3188 1 0 1 368.2053 734.396 2 734.3963 -0.0003 0 24.03 0.033 K TTWVTK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3540.3540.2.dta 54 IPI00644224.1 Heterogeneous nuclear ribonucleoprotein U 158 62395 6 6 6 6 811 4616 1 0 1 410.24 818.4655 2 818.465 0.0005 0 28.44 0.015 K FIEIAAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5111.5111.2.dta 54 IPI00644224.1 Heterogeneous nuclear ribonucleoprotein U 158 62395 6 6 6 6 1542 2579 1 0 1 314.5309 940.5707 3 940.5706 0.0002 1 23.73 0.027 K VTEKIPVR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2869.2869.3.dta 54 IPI00644224.1 Heterogeneous nuclear ribonucleoprotein U 158 62395 6 6 6 6 1886 3652 1 0 1 498.7586 995.5027 2 995.5036 -0.0009 0 43.87 0.00055 K DIDIHEVR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4063.4063.2.dta 54 IPI00644224.1 Heterogeneous nuclear ribonucleoprotein U 158 62395 6 6 6 6 2234 4648 1 0 1 524.7742 1047.5339 2 1047.5349 -0.001 0 46.54 5.50E-05 K NGQDLGVAFK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5146.5146.2.dta 54 IPI00644224.1 Heterogeneous nuclear ribonucleoprotein U 158 62395 6 6 6 6 6303 5560 1 0 1 824.4244 1646.8342 2 1646.8376 -0.0034 0 101.93 1.70E-09 R NFILDQTNVSAAAQR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6095.6095.2.dta 54 IPI00640106.1 Heterogeneous nuclear ribonucleoprotein U 73 27900 3 3 3 3 1542 2579 1 0 1 314.5309 940.5707 3 940.5706 0.0002 1 23.73 0.027 K VTEKIPVR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2869.2869.3.dta 54 IPI00640106.1 Heterogeneous nuclear ribonucleoprotein U 73 27900 3 3 3 3 1886 3652 1 0 1 498.7586 995.5027 2 995.5036 -0.0009 0 43.87 0.00055 K DIDIHEVR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4063.4063.2.dta 54 IPI00640106.1 Heterogeneous nuclear ribonucleoprotein U 73 27900 3 3 3 3 2234 4648 1 0 1 524.7742 1047.5339 2 1047.5349 -0.001 0 46.54 5.50E-05 K NGQDLGVAFK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5146.5146.2.dta 55 1 IPI00030131.3 "Isoform Beta of Lamina-associated polypeptide 2, isoforms beta/gamma" 192 50696 5 5 5 5 1356 5104 1 1 1 456.7666 911.5186 2 911.5189 -0.0003 0 38.43 0.001 K GGPLQALTR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5634.5634.2.dta 55 1 IPI00030131.3 "Isoform Beta of Lamina-associated polypeptide 2, isoforms beta/gamma" 192 50696 5 5 5 5 4323 4502 1 1 1 665.8584 1329.7022 2 1329.7041 -0.0019 0 52.93 1.20E-05 K YGVNPGPIVGTTR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4988.4988.2.dta 55 1 IPI00030131.3 "Isoform Beta of Lamina-associated polypeptide 2, isoforms beta/gamma" 192 50696 5 5 5 5 4614 6190 1 1 1 687.8625 1373.7104 2 1373.7078 0.0026 0 56.8 2.20E-05 M PEFLEDPSVLTK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6725.6725.2.dta 55 1 IPI00030131.3 "Isoform Beta of Lamina-associated polypeptide 2, isoforms beta/gamma" 192 50696 5 5 5 5 7069 6898 1 1 1 598.3246 1791.9521 3 1791.9519 0.0002 0 58.34 9.30E-06 K HASPILPITEFSDIPR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7433.7433.3.dta 55 1 IPI00030131.3 "Isoform Beta of Lamina-associated polypeptide 2, isoforms beta/gamma" 192 50696 5 5 5 5 8712 4700 1 1 1 857.407 2569.1993 3 2569.2045 -0.0052 1 64.31 1.00E-06 K GPPDFSSDEEREPTPVLGSGAAAAGR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5202.5202.3.dta 55 IPI00791301.1 46 kDa protein 175 46335 4 4 4 4 4323 4502 1 0 1 665.8584 1329.7022 2 1329.7041 -0.0019 0 52.93 1.20E-05 K YGVNPGPIVGTTR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4988.4988.2.dta 55 IPI00791301.1 46 kDa protein 175 46335 4 4 4 4 4614 6190 1 0 1 687.8625 1373.7104 2 1373.7078 0.0026 0 56.8 2.20E-05 M PEFLEDPSVLTK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6725.6725.2.dta 55 IPI00791301.1 46 kDa protein 175 46335 4 4 4 4 7069 6898 1 0 1 598.3246 1791.9521 3 1791.9519 0.0002 0 58.34 9.30E-06 K HASPILPITEFSDIPR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7433.7433.3.dta 55 IPI00791301.1 46 kDa protein 175 46335 4 4 4 4 8712 4700 1 0 1 857.407 2569.1993 3 2569.2045 -0.0052 1 64.31 1.00E-06 K GPPDFSSDEEREPTPVLGSGAAAAGR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5202.5202.3.dta 55 IPI00181409.6 "Isoform Gamma of Lamina-associated polypeptide 2, isoforms beta/gamma" 137 38771 3 3 3 3 4323 4502 1 0 1 665.8584 1329.7022 2 1329.7041 -0.0019 0 52.93 1.20E-05 K YGVNPGPIVGTTR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4988.4988.2.dta 55 IPI00181409.6 "Isoform Gamma of Lamina-associated polypeptide 2, isoforms beta/gamma" 137 38771 3 3 3 3 4614 6190 1 0 1 687.8625 1373.7104 2 1373.7078 0.0026 0 56.8 2.20E-05 M PEFLEDPSVLTK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6725.6725.2.dta 55 IPI00181409.6 "Isoform Gamma of Lamina-associated polypeptide 2, isoforms beta/gamma" 137 38771 3 3 3 3 8712 4700 1 0 1 857.407 2569.1993 3 2569.2045 -0.0052 1 64.31 1.00E-06 K GPPDFSSDEEREPTPVLGSGAAAAGR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5202.5202.3.dta 55 IPI00795693.1 19 kDa protein 58 19187 1 1 1 1 7069 6898 1 0 1 598.3246 1791.9521 3 1791.9519 0.0002 0 58.34 9.30E-06 K HASPILPITEFSDIPR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7433.7433.3.dta 56 1 IPI00012442.1 Ras GTPase-activating protein-binding protein 1 190 52189 7 7 6 6 3387 5347 1 1 1 404.2051 1209.5935 3 1209.5931 0.0004 0 27.57 0.017 K FYVHNDIFR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5880.5880.3.dta 56 1 IPI00012442.1 Ras GTPase-activating protein-binding protein 1 190 52189 7 7 6 6 4291 4383 1 1 0 442.5922 1324.7547 3 1324.7537 0.001 0 23.61 0.0061 M VMEKPSPLLVGR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4859.4859.3.dta 56 1 IPI00012442.1 Ras GTPase-activating protein-binding protein 1 190 52189 7 7 6 6 5842 7247 1 1 1 787.387 1572.7595 2 1572.7573 0.0022 0 81.52 1.10E-07 K DFFQSYGNVVELR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7802.7802.2.dta 56 1 IPI00012442.1 Ras GTPase-activating protein-binding protein 1 190 52189 7 7 6 6 6829 6547 1 1 1 869.949 1737.8835 2 1737.876 0.0075 0 66.52 6.50E-07 R FMQTFVLAPEGSVANK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7081.7081.2.dta 56 1 IPI00012442.1 Ras GTPase-activating protein-binding protein 1 190 52189 7 7 6 6 7356 6246 1 1 1 621.645 1861.913 3 1861.9145 -0.0014 0 33.08 0.0013 R QYYTLLNQAPDMLHR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6781.6781.3.dta 56 1 IPI00012442.1 Ras GTPase-activating protein-binding protein 1 190 52189 7 7 6 6 7441 5431 1 1 1 626.9748 1877.9025 3 1877.9094 -0.0068 0 22.08 0.0087 R QYYTLLNQAPDMLHR F Oxidation (M) 0.000000000001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5966.5966.3.dta 56 1 IPI00012442.1 Ras GTPase-activating protein-binding protein 1 190 52189 7 7 6 6 7657 7963 1 1 1 969.4852 1936.9558 2 1936.9571 -0.0013 0 41.97 0.00012 K LPNFGFVVFDDSEPVQK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8593.8593.2.dta 56 2 IPI00009057.2 Isoform A of Ras GTPase-activating protein-binding protein 2 89 54145 4 4 3 3 1439 981 1 0 1 463.2331 924.4517 2 924.4526 -0.0009 1 22.35 0.0096 R NDRGPGGPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1140.1140.2.dta 56 2 IPI00009057.2 Isoform A of Ras GTPase-activating protein-binding protein 2 89 54145 4 4 3 3 4291 4383 1 0 0 442.5922 1324.7547 3 1324.7537 0.001 0 23.61 0.0061 M VMEKPSPLLVGR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4859.4859.3.dta 56 2 IPI00009057.2 Isoform A of Ras GTPase-activating protein-binding protein 2 89 54145 4 4 3 3 5252 2066 1 0 1 732.8933 1463.7721 2 1463.7732 -0.0012 0 45.95 0.0002 R VEAKPEVQSQPPR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2311.2311.2.dta 56 2 IPI00009057.2 Isoform A of Ras GTPase-activating protein-binding protein 2 89 54145 4 4 3 3 5253 2050 1 0 1 488.9317 1463.7732 3 1463.7732 0 0 52.5 5.80E-05 R VEAKPEVQSQPPR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2294.2294.3.dta 56 IPI00442863.1 "CDNA FLJ26493 fis, clone KDN06317, highly similar to Ras-GTPase- activating protein binding protein 1" 134 34554 5 5 4 4 4291 4383 1 0 0 442.5922 1324.7547 3 1324.7537 0.001 0 23.61 0.0061 M VMEKPSPLLVGR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4859.4859.3.dta 56 IPI00442863.1 "CDNA FLJ26493 fis, clone KDN06317, highly similar to Ras-GTPase- activating protein binding protein 1" 134 34554 5 5 4 4 5842 7247 1 0 1 787.387 1572.7595 2 1572.7573 0.0022 0 81.52 1.10E-07 K DFFQSYGNVVELR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7802.7802.2.dta 56 IPI00442863.1 "CDNA FLJ26493 fis, clone KDN06317, highly similar to Ras-GTPase- activating protein binding protein 1" 134 34554 5 5 4 4 7356 6246 1 0 1 621.645 1861.913 3 1861.9145 -0.0014 0 33.08 0.0013 R QYYTLLNQAPDMLHR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6781.6781.3.dta 56 IPI00442863.1 "CDNA FLJ26493 fis, clone KDN06317, highly similar to Ras-GTPase- activating protein binding protein 1" 134 34554 5 5 4 4 7441 5431 1 0 1 626.9748 1877.9025 3 1877.9094 -0.0068 0 22.08 0.0087 R QYYTLLNQAPDMLHR F Oxidation (M) 0.000000000001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5966.5966.3.dta 56 IPI00442863.1 "CDNA FLJ26493 fis, clone KDN06317, highly similar to Ras-GTPase- activating protein binding protein 1" 134 34554 5 5 4 4 7657 7963 1 0 1 969.4852 1936.9558 2 1936.9571 -0.0013 0 41.97 0.00012 K LPNFGFVVFDDSEPVQK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8593.8593.2.dta 57 1 IPI00306960.3 "Asparaginyl-tRNA synthetase, cytoplasmic" 190 63758 8 8 7 7 472 4266 1 1 1 373.7139 745.4132 2 745.4123 0.001 0 30.52 0.042 R WNVISK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4732.4732.2.dta 57 1 IPI00306960.3 "Asparaginyl-tRNA synthetase, cytoplasmic" 190 63758 8 8 7 7 1170 4059 1 1 1 439.7397 877.4649 2 877.4657 -0.0009 0 28.78 0.02 K IGALEGYR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4508.4508.2.dta 57 1 IPI00306960.3 "Asparaginyl-tRNA synthetase, cytoplasmic" 190 63758 8 8 7 7 2069 7161 1 1 1 511.2974 1020.5802 2 1020.579 0.0012 0 39.77 0.00083 K NLMFLVLR D Oxidation (M) 0.00100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7709.7709.2.dta 57 1 IPI00306960.3 "Asparaginyl-tRNA synthetase, cytoplasmic" 190 63758 8 8 7 7 6238 4301 1 1 1 546.2559 1635.7457 3 1635.7464 -0.0006 0 49.97 3.20E-05 K YGTCPHGGYGLGLER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4770.4770.3.dta 57 1 IPI00306960.3 "Asparaginyl-tRNA synthetase, cytoplasmic" 190 63758 8 8 7 7 6557 6710 1 1 1 844.9376 1687.8606 2 1687.8637 -0.0031 0 80.09 1.60E-07 R LMTDTINEPILLCR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7246.7246.2.dta 57 1 IPI00306960.3 "Asparaginyl-tRNA synthetase, cytoplasmic" 190 63758 8 8 7 7 7511 6603 1 1 1 952.4289 1902.8432 2 1902.8424 0.0008 0 50.87 1.70E-05 R EGIDPTPYYWYTDQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7137.7137.2.dta 57 1 IPI00306960.3 "Asparaginyl-tRNA synthetase, cytoplasmic" 190 63758 8 8 7 7 7645 5697 1 1 1 644.6691 1930.9856 3 1930.9901 -0.0045 0 26.23 0.0035 K SPAGSIVHELNPNFQPPK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6232.6232.3.dta 57 1 IPI00306960.3 "Asparaginyl-tRNA synthetase, cytoplasmic" 190 63758 8 8 7 7 7646 5656 1 1 1 644.6703 1930.9892 3 1930.9901 -0.0009 0 24.53 0.005 K SPAGSIVHELNPNFQPPK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6191.6191.3.dta 57 IPI00647678.1 10 kDa protein 84 9903 2 2 2 2 6238 4301 1 0 1 546.2559 1635.7457 3 1635.7464 -0.0006 0 49.97 3.20E-05 K YGTCPHGGYGLGLER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4770.4770.3.dta 57 IPI00647678.1 10 kDa protein 84 9903 2 2 2 2 7511 6603 1 0 1 952.4289 1902.8432 2 1902.8424 0.0008 0 50.87 1.70E-05 R EGIDPTPYYWYTDQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7137.7137.2.dta 57 IPI00643900.1 33 kDa protein 50 32931 3 3 3 3 472 4266 1 0 1 373.7139 745.4132 2 745.4123 0.001 0 30.52 0.042 R WNVISK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4732.4732.2.dta 57 IPI00643900.1 33 kDa protein 50 32931 3 3 3 3 1170 4059 1 0 1 439.7397 877.4649 2 877.4657 -0.0009 0 28.78 0.02 K IGALEGYR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4508.4508.2.dta 57 IPI00643900.1 33 kDa protein 50 32931 3 3 3 3 2069 7161 1 0 1 511.2974 1020.5802 2 1020.579 0.0012 0 39.77 0.00083 K NLMFLVLR D Oxidation (M) 0.00100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7709.7709.2.dta 58 1 IPI00031420.3 UDP-glucose 6-dehydrogenase 189 55674 6 6 6 6 717 1251 1 1 1 401.7302 801.4459 2 801.4457 0.0002 1 28.66 0.033 R AAESIRR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1428.1428.2.dta 58 1 IPI00031420.3 UDP-glucose 6-dehydrogenase 189 55674 6 6 6 6 1779 8026 1 1 1 490.3022 978.5898 2 978.5902 -0.0004 0 32.47 0.0021 K IAILGFAFK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8656.8656.2.dta 58 1 IPI00031420.3 UDP-glucose 6-dehydrogenase 189 55674 6 6 6 6 2730 3478 1 1 1 559.2958 1116.577 2 1116.5775 -0.0005 0 62.62 2.50E-06 R VTVVDVNESR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3869.3869.2.dta 58 1 IPI00031420.3 UDP-glucose 6-dehydrogenase 189 55674 6 6 6 6 4577 3835 1 1 1 685.8477 1369.6809 2 1369.6838 -0.0029 0 48.75 3.90E-05 R VLIGGDETPEGQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4265.4265.2.dta 58 1 IPI00031420.3 UDP-glucose 6-dehydrogenase 189 55674 6 6 6 6 5362 5648 1 1 1 740.3872 1478.7599 2 1478.7617 -0.0018 0 68.99 3.40E-07 K ILTTNTWSSELSK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6183.6183.2.dta 58 1 IPI00031420.3 UDP-glucose 6-dehydrogenase 189 55674 6 6 6 6 7537 7090 1 1 1 957.0121 1912.0096 2 1912.0094 0.0002 0 40.96 0.00014 R INAWNSPTLPIYEPGLK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7634.7634.2.dta 58 IPI00182164.7 Isoform 1 of FCH domain only protein 1 29 97428 1 1 1 1 717 1251 1 0 1 401.7302 801.4459 2 801.4457 0.0002 1 28.66 0.033 K AAESLRR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1428.1428.2.dta 59 1 IPI00465044.2 Protein RCC2 187 56790 8 8 7 7 2629 4884 1 1 1 552.7657 1103.5168 2 1103.5182 -0.0014 0 45.51 6.50E-05 K AVQDLCGWR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5402.5402.2.dta 59 1 IPI00465044.2 Protein RCC2 187 56790 8 8 7 7 3198 1733 1 1 1 595.3195 1188.6244 2 1188.6251 -0.0007 1 17.38 0.026 K EVPKQQAAYR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1949.1949.2.dta 59 1 IPI00465044.2 Protein RCC2 187 56790 8 8 7 7 3519 7106 1 1 1 616.7958 1231.577 2 1231.5775 -0.0005 0 66.9 7.00E-07 R VFSWGFGGYGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7652.7652.2.dta 59 1 IPI00465044.2 Protein RCC2 187 56790 8 8 7 7 6306 4566 1 1 1 550.2751 1647.8034 3 1647.8039 -0.0004 1 32.6 0.00091 R AQRIEYDCELVPR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5057.5057.3.dta 59 1 IPI00465044.2 Protein RCC2 187 56790 8 8 7 7 6954 2940 1 1 1 588.978 1763.9123 3 1763.9166 -0.0043 1 38.06 0.00083 K AGGAAVVITEPEHTKER V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3264.3264.3.dta 59 1 IPI00465044.2 Protein RCC2 187 56790 8 8 7 7 6955 2943 1 1 1 441.9865 1763.9169 4 1763.9166 0.0003 1 35.03 0.00078 K AGGAAVVITEPEHTKER V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3268.3268.4.dta 59 1 IPI00465044.2 Protein RCC2 187 56790 8 8 7 7 7124 5481 1 1 1 604.3206 1809.94 3 1809.9407 -0.0007 0 35.86 0.00097 R LIEGLSHEVIVSAACGR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6017.6017.3.dta 59 1 IPI00465044.2 Protein RCC2 187 56790 8 8 7 7 7456 3464 1 1 1 628.6501 1882.9286 3 1882.9319 -0.0033 1 38.19 0.0018 R DVACGANHTLVLDSQKR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3853.3853.3.dta 59 IPI00786996.1 similar to RCC1-like 95 37703 2 2 2 2 2629 4884 1 0 1 552.7657 1103.5168 2 1103.5182 -0.0014 0 45.51 6.50E-05 K AVQDLCGWR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5402.5402.2.dta 59 IPI00786996.1 similar to RCC1-like 95 37703 2 2 2 2 3519 7106 1 0 1 616.7958 1231.577 2 1231.5775 -0.0005 0 66.9 7.00E-07 R VFSWGFGGYGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7652.7652.2.dta 60 1 IPI00300074.3 Phenylalanyl-tRNA synthetase beta chain 182 66715 6 6 6 6 1631 6719 1 1 1 478.3131 954.6117 2 954.6114 0.0004 0 32.99 0.0005 R TTLLPGLLK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7255.7255.2.dta 60 1 IPI00300074.3 Phenylalanyl-tRNA synthetase beta chain 182 66715 6 6 6 6 2041 4056 1 1 1 509.2947 1016.5749 2 1016.5753 -0.0005 0 45.39 0.00054 K LIITEETAK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4505.4505.2.dta 60 1 IPI00300074.3 Phenylalanyl-tRNA synthetase beta chain 182 66715 6 6 6 6 2569 4210 1 1 1 547.2972 1092.5799 2 1092.5815 -0.0016 0 59.22 1.60E-05 K AAGASDVVLYK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4671.4671.2.dta 60 1 IPI00300074.3 Phenylalanyl-tRNA synthetase beta chain 182 66715 6 6 6 6 2845 5246 1 1 1 568.2805 1134.5464 2 1134.5458 0.0006 0 55.15 4.30E-05 K ASEGPAFFPGR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5779.5779.2.dta 60 1 IPI00300074.3 Phenylalanyl-tRNA synthetase beta chain 182 66715 6 6 6 6 3125 7515 1 1 1 588.848 1175.6814 2 1175.6802 0.0012 0 48.78 9.30E-05 K LFEISDIVIK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8111.8111.2.dta 60 1 IPI00300074.3 Phenylalanyl-tRNA synthetase beta chain 182 66715 6 6 6 6 5697 6114 1 1 1 773.3655 1544.7165 2 1544.7181 -0.0016 0 44.16 0.00011 R NIFIECTGTDFTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6648.6648.2.dta 61 1 IPI00011654.2 Tubulin beta chain 182 50095 6 6 6 6 2919 6475 1 1 0 572.3207 1142.6268 2 1142.627 -0.0002 0 53.32 4.40E-05 K LAVNMVPFPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7006.7006.2.dta 61 1 IPI00011654.2 Tubulin beta chain 182 50095 6 6 6 6 4077 4095 1 1 1 651.3225 1300.6305 2 1300.6299 0.0006 0 39.71 0.00019 R ISVYYNEATGGK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4547.4547.2.dta 61 1 IPI00011654.2 Tubulin beta chain 182 50095 6 6 6 6 6041 6662 1 1 1 808.422 1614.8294 2 1614.8287 0.0007 0 40.35 0.00022 R AILVDLEPGTMDSVR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7198.7198.2.dta 61 1 IPI00011654.2 Tubulin beta chain 182 50095 6 6 6 6 6375 7364 1 1 1 830.4489 1658.8833 2 1658.8879 -0.0047 0 51.58 1.50E-05 R ALTVPELTQQVFDAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7941.7941.2.dta 61 1 IPI00011654.2 Tubulin beta chain 182 50095 6 6 6 6 6648 7150 1 1 0 848.9192 1695.8238 2 1695.8257 -0.0018 0 50.36 0.00012 K NSSYFVEWIPNNVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7698.7698.2.dta 61 1 IPI00011654.2 Tubulin beta chain 182 50095 6 6 6 6 7626 5360 1 1 0 641.9693 1922.8861 3 1922.89 -0.0039 1 36.29 0.0004 R MSMKEVDEQMLNVQNK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5893.5893.3.dta 61 2 IPI00007752.1 Tubulin beta-2C chain 126 50255 4 4 4 4 2919 6475 1 0 0 572.3207 1142.6268 2 1142.627 -0.0002 0 53.32 4.40E-05 K LAVNMVPFPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7006.7006.2.dta 61 2 IPI00007752.1 Tubulin beta-2C chain 126 50255 4 4 4 4 4307 4097 1 0 1 664.828 1327.6415 2 1327.6408 0.0006 0 44.99 0.00011 R INVYYNEATGGK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4549.4549.2.dta 61 2 IPI00007752.1 Tubulin beta-2C chain 126 50255 4 4 4 4 6648 7150 1 0 0 848.9192 1695.8238 2 1695.8257 -0.0018 0 50.36 0.00012 K NSSYFVEWIPNNVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7698.7698.2.dta 61 2 IPI00007752.1 Tubulin beta-2C chain 126 50255 4 4 4 4 7626 5360 1 0 0 641.9693 1922.8861 3 1922.89 -0.0039 1 36.29 0.0004 R MSMKEVDEQMLNVQNK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5893.5893.3.dta 61 IPI00647896.1 "Tubulin, beta" 134 42114 4 4 4 4 2919 6475 1 0 0 572.3207 1142.6268 2 1142.627 -0.0002 0 53.32 4.40E-05 K LAVNMVPFPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7006.7006.2.dta 61 IPI00647896.1 "Tubulin, beta" 134 42114 4 4 4 4 6375 7364 1 0 1 830.4489 1658.8833 2 1658.8879 -0.0047 0 51.58 1.50E-05 R ALTVPELTQQVFDAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7941.7941.2.dta 61 IPI00647896.1 "Tubulin, beta" 134 42114 4 4 4 4 6648 7150 1 0 0 848.9192 1695.8238 2 1695.8257 -0.0018 0 50.36 0.00012 K NSSYFVEWIPNNVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7698.7698.2.dta 61 IPI00647896.1 "Tubulin, beta" 134 42114 4 4 4 4 7626 5360 1 0 0 641.9693 1922.8861 3 1922.89 -0.0039 1 36.29 0.0004 R MSMKEVDEQMLNVQNK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5893.5893.3.dta 61 IPI00013475.1 Tubulin beta-2A chain 123 50274 4 4 4 4 2919 6475 1 0 0 572.3207 1142.6268 2 1142.627 -0.0002 0 53.32 4.40E-05 K LAVNMVPFPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7006.7006.2.dta 61 IPI00013475.1 Tubulin beta-2A chain 123 50274 4 4 4 4 6041 6662 1 0 1 808.422 1614.8294 2 1614.8287 0.0007 0 40.35 0.00022 R AILVDLEPGTMDSVR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7198.7198.2.dta 61 IPI00013475.1 Tubulin beta-2A chain 123 50274 4 4 4 4 6648 7150 1 0 0 848.9192 1695.8238 2 1695.8257 -0.0018 0 50.36 0.00012 K NSSYFVEWIPNNVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7698.7698.2.dta 61 IPI00013475.1 Tubulin beta-2A chain 123 50274 4 4 4 4 7626 5360 1 0 0 641.9693 1922.8861 3 1922.89 -0.0039 1 36.29 0.0004 R MSMKEVDEQMLNVQNK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5893.5893.3.dta 61 IPI00013683.2 Tubulin beta-3 chain 103 50856 3 3 3 3 2919 6475 1 0 0 572.3207 1142.6268 2 1142.627 -0.0002 0 53.32 4.40E-05 K LAVNMVPFPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7006.7006.2.dta 61 IPI00013683.2 Tubulin beta-3 chain 103 50856 3 3 3 3 6041 6662 1 0 1 808.422 1614.8294 2 1614.8287 0.0007 0 40.35 0.00022 R AILVDLEPGTMDSVR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7198.7198.2.dta 61 IPI00013683.2 Tubulin beta-3 chain 103 50856 3 3 3 3 6648 7150 1 0 0 848.9192 1695.8238 2 1695.8257 -0.0018 0 50.36 0.00012 K NSSYFVEWIPNNVK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7698.7698.2.dta 61 IPI00023598.2 Tubulin beta-4 chain 81 50010 2 2 2 2 2919 6475 1 0 0 572.3207 1142.6268 2 1142.627 -0.0002 0 53.32 4.40E-05 K LAVNMVPFPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7006.7006.2.dta 61 IPI00023598.2 Tubulin beta-4 chain 81 50010 2 2 2 2 6648 7150 1 0 0 848.9192 1695.8238 2 1695.8257 -0.0018 0 50.36 0.00012 K NSSYFVEWIPNNVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7698.7698.2.dta 61 IPI00006510.1 Tubulin beta-1 chain 53 50865 1 1 1 1 2919 6475 1 0 0 572.3207 1142.6268 2 1142.627 -0.0002 0 53.32 4.40E-05 K LAVNMVPFPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7006.7006.2.dta 61 IPI00398982.1 "similar to tubulin, beta 5" 50 12210 1 1 1 1 6648 7150 1 0 0 848.9192 1695.8238 2 1695.8257 -0.0018 0 50.36 0.00012 K NSSYFVEWIPNNVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7698.7698.2.dta 62 1 IPI00742905.1 ATP-dependent RNA helicase A 180 147921 6 6 6 6 1952 6302 1 1 1 502.301 1002.5875 2 1002.5862 0.0013 0 59.32 8.40E-06 R LGGIGQFLAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6836.6836.2.dta 62 1 IPI00742905.1 ATP-dependent RNA helicase A 180 147921 6 6 6 6 3005 6617 1 1 1 579.7736 1157.5327 2 1157.5328 -0.0001 0 36.84 0.0028 K NFLYAWCGK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7150.7150.2.dta 62 1 IPI00742905.1 ATP-dependent RNA helicase A 180 147921 6 6 6 6 3996 5391 1 1 1 644.8553 1287.696 2 1287.6969 -0.0009 0 71.65 1.20E-06 K LAAQSCALSLVR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5926.5926.2.dta 62 1 IPI00742905.1 ATP-dependent RNA helicase A 180 147921 6 6 6 6 4241 7727 1 1 1 659.3288 1316.643 2 1316.6441 -0.0011 0 20.28 0.013 K YPSPFFVFGEK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8351.8351.2.dta 62 1 IPI00742905.1 ATP-dependent RNA helicase A 180 147921 6 6 6 6 4489 3633 1 1 1 679.3463 1356.6781 2 1356.682 -0.0039 0 72.57 1.20E-06 R AAECNIVVTQPR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4042.4042.2.dta 62 1 IPI00742905.1 ATP-dependent RNA helicase A 180 147921 6 6 6 6 7005 6034 1 1 1 593.3196 1776.9369 3 1776.941 -0.0041 0 22.23 0.0082 R QLYHLGVVEAYSGLTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6569.6569.3.dta 63 1 IPI00025874.2 Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 67 kDa subunit precursor 177 72847 8 8 8 8 71 3870 1 1 1 311.1896 620.3647 2 620.3646 0.0001 0 30.99 0.011 R IGLYR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4303.4303.2.dta 63 1 IPI00025874.2 Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 67 kDa subunit precursor 177 72847 8 8 8 8 405 1478 1 1 1 363.2194 724.4242 2 724.4232 0.001 0 25.95 0.024 K HTGAVLK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1673.1673.2.dta 63 1 IPI00025874.2 Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 67 kDa subunit precursor 177 72847 8 8 8 8 1782 4713 1 1 1 490.7923 979.57 2 979.5702 -0.0002 0 30.62 0.0048 K LPVALDPGAK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5216.5216.2.dta 63 1 IPI00025874.2 Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 67 kDa subunit precursor 177 72847 8 8 8 8 3496 3703 1 1 1 615.3456 1228.6767 2 1228.6775 -0.0008 1 66.32 4.90E-06 K SAVEAERLVAGK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4121.4121.2.dta 63 1 IPI00025874.2 Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 67 kDa subunit precursor 177 72847 8 8 8 8 5042 5471 1 1 1 718.3561 1434.6976 2 1434.699 -0.0014 0 55.61 5.90E-05 K NIEIDSPYEISR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6007.6007.2.dta 63 1 IPI00025874.2 Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 67 kDa subunit precursor 177 72847 8 8 8 8 5974 7084 1 1 1 534.9799 1601.9177 3 1601.9181 -0.0004 1 31.5 0.0029 R FFTVKLPVALDPGAK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7629.7629.3.dta 63 1 IPI00025874.2 Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 67 kDa subunit precursor 177 72847 8 8 8 8 6377 8087 1 1 1 830.4504 1658.8862 2 1658.8879 -0.0017 0 49.41 7.50E-05 R ATSFLLALEPELEAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8717.8717.2.dta 63 1 IPI00025874.2 Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 67 kDa subunit precursor 177 72847 8 8 8 8 7021 3879 1 1 1 595.6218 1783.8437 3 1783.8489 -0.0053 1 38.47 0.00031 R YDYQRQPDSGISSIR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4313.4313.3.dta 63 IPI00793589.1 5 kDa protein 56 4586 1 1 1 1 5042 5471 1 0 1 718.3561 1434.6976 2 1434.699 -0.0014 0 55.61 5.90E-05 K NIEIDSPYEISR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6007.6007.2.dta 64 1 IPI00514053.1 Coatomer subunit delta 172 57630 10 10 10 10 816 3235 1 1 1 410.7211 819.4276 2 819.4273 0.0003 0 21.67 0.033 K ITLTCGR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3599.3599.2.dta 64 1 IPI00514053.1 Coatomer subunit delta 172 57630 10 10 10 10 1550 1190 1 1 1 472.2691 942.5237 2 942.5246 -0.0009 1 38.63 0.0028 K AKELQQAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1362.1362.2.dta 64 1 IPI00514053.1 Coatomer subunit delta 172 57630 10 10 10 10 1618 1585 1 1 1 318.4948 952.4626 3 952.4614 0.0012 1 17.85 0.047 R ISDDKYGR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1789.1789.3.dta 64 1 IPI00514053.1 Coatomer subunit delta 172 57630 10 10 10 10 2217 4774 1 1 1 523.3071 1044.5996 2 1044.6001 -0.0006 0 46.02 4.80E-05 M VLLAAAVCTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5282.5282.2.dta 64 1 IPI00514053.1 Coatomer subunit delta 172 57630 10 10 10 10 2319 7042 1 1 1 529.8162 1057.6178 2 1057.6172 0.0006 0 48.11 0.00017 R IEGLLAAFPK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7582.7582.2.dta 64 1 IPI00514053.1 Coatomer subunit delta 172 57630 10 10 10 10 3585 1660 1 1 1 617.8483 1233.6821 2 1233.683 -0.0008 0 24.08 0.045 K VAPAPARPSGPSK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1870.1870.2.dta 64 1 IPI00514053.1 Coatomer subunit delta 172 57630 10 10 10 10 3815 5522 1 1 1 631.3423 1260.6701 2 1260.6714 -0.0013 0 19.69 0.04 K SFPVNSDVGVLK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6058.6058.2.dta 64 1 IPI00514053.1 Coatomer subunit delta 172 57630 10 10 10 10 4221 6607 1 1 1 439.2624 1314.7653 3 1314.7659 -0.0006 1 29.91 0.0061 R TRIEGLLAAFPK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7140.7140.3.dta 64 1 IPI00514053.1 Coatomer subunit delta 172 57630 10 10 10 10 4927 7794 1 1 1 708.8687 1415.7229 2 1415.7256 -0.0027 0 66.95 3.50E-06 K NSNILEDLETLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8419.8419.2.dta 64 1 IPI00514053.1 Coatomer subunit delta 172 57630 10 10 10 10 5765 7430 1 1 1 779.9007 1557.7868 2 1557.7861 0.0007 0 44.93 0.00018 R NTLEWCLPVIDAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8015.8015.2.dta 64 IPI00298520.3 Hypothetical protein DKFZp686M09245 142 62129 9 9 9 9 816 3235 1 0 1 410.7211 819.4276 2 819.4273 0.0003 0 21.67 0.033 K ITLTCGR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3599.3599.2.dta 64 IPI00298520.3 Hypothetical protein DKFZp686M09245 142 62129 9 9 9 9 1550 1190 1 0 1 472.2691 942.5237 2 942.5246 -0.0009 1 38.63 0.0028 K AKELQQAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1362.1362.2.dta 64 IPI00298520.3 Hypothetical protein DKFZp686M09245 142 62129 9 9 9 9 1618 1585 1 0 1 318.4948 952.4626 3 952.4614 0.0012 1 17.85 0.047 R ISDDKYGR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1789.1789.3.dta 64 IPI00298520.3 Hypothetical protein DKFZp686M09245 142 62129 9 9 9 9 2319 7042 1 0 1 529.8162 1057.6178 2 1057.6172 0.0006 0 48.11 0.00017 R IEGLLAAFPK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7582.7582.2.dta 64 IPI00298520.3 Hypothetical protein DKFZp686M09245 142 62129 9 9 9 9 3585 1660 1 0 1 617.8483 1233.6821 2 1233.683 -0.0008 0 24.08 0.045 K VAPAPARPSGPSK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1870.1870.2.dta 64 IPI00298520.3 Hypothetical protein DKFZp686M09245 142 62129 9 9 9 9 3815 5522 1 0 1 631.3423 1260.6701 2 1260.6714 -0.0013 0 19.69 0.04 K SFPVNSDVGVLK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6058.6058.2.dta 64 IPI00298520.3 Hypothetical protein DKFZp686M09245 142 62129 9 9 9 9 4221 6607 1 0 1 439.2624 1314.7653 3 1314.7659 -0.0006 1 29.91 0.0061 R TRIEGLLAAFPK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7140.7140.3.dta 64 IPI00298520.3 Hypothetical protein DKFZp686M09245 142 62129 9 9 9 9 4927 7794 1 0 1 708.8687 1415.7229 2 1415.7256 -0.0027 0 66.95 3.50E-06 K NSNILEDLETLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8419.8419.2.dta 64 IPI00298520.3 Hypothetical protein DKFZp686M09245 142 62129 9 9 9 9 5765 7430 1 0 1 779.9007 1557.7868 2 1557.7861 0.0007 0 44.93 0.00018 R NTLEWCLPVIDAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8015.8015.2.dta 64 IPI00439944.1 ARCN1 protein 129 22011 4 4 4 4 2217 4774 1 0 1 523.3071 1044.5996 2 1044.6001 -0.0006 0 46.02 4.80E-05 M VLLAAAVCTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5282.5282.2.dta 64 IPI00439944.1 ARCN1 protein 129 22011 4 4 4 4 2319 7042 1 0 1 529.8162 1057.6178 2 1057.6172 0.0006 0 48.11 0.00017 R IEGLLAAFPK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7582.7582.2.dta 64 IPI00439944.1 ARCN1 protein 129 22011 4 4 4 4 4221 6607 1 0 1 439.2624 1314.7653 3 1314.7659 -0.0006 1 29.91 0.0061 R TRIEGLLAAFPK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7140.7140.3.dta 64 IPI00439944.1 ARCN1 protein 129 22011 4 4 4 4 4927 7794 1 0 1 708.8687 1415.7229 2 1415.7256 -0.0027 0 66.95 3.50E-06 K NSNILEDLETLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8419.8419.2.dta 65 1 IPI00604707.4 Dihydrolipoamide S-acetyltransferase (E2 component of pyruvate dehydrogenase complex) variant 172 69466 6 6 6 6 1042 3182 1 1 1 429.7554 857.4962 2 857.4971 -0.0009 0 25.35 0.013 K ILVAEGTR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3533.3533.2.dta 65 1 IPI00604707.4 Dihydrolipoamide S-acetyltransferase (E2 component of pyruvate dehydrogenase complex) variant 172 69466 6 6 6 6 1053 4940 1 1 1 430.7655 859.5165 2 859.5167 -0.0002 0 23.51 0.018 R VFVSPLAK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5463.5463.2.dta 65 1 IPI00604707.4 Dihydrolipoamide S-acetyltransferase (E2 component of pyruvate dehydrogenase complex) variant 172 69466 6 6 6 6 1198 3664 1 1 1 442.7633 883.5121 2 883.5127 -0.0006 0 36.38 0.0019 K ILVPEGTR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4076.4076.2.dta 65 1 IPI00604707.4 Dihydrolipoamide S-acetyltransferase (E2 component of pyruvate dehydrogenase complex) variant 172 69466 6 6 6 6 3445 7606 1 1 1 610.8514 1219.6883 2 1219.6886 -0.0003 0 38.39 0.00096 K YLEKPITMLL - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8211.8211.2.dta 65 1 IPI00604707.4 Dihydrolipoamide S-acetyltransferase (E2 component of pyruvate dehydrogenase complex) variant 172 69466 6 6 6 6 5508 7488 1 1 1 758.9138 1515.8131 2 1515.8144 -0.0014 0 91.11 9.20E-09 K GVETIANDVVSLATK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8083.8083.2.dta 65 1 IPI00604707.4 Dihydrolipoamide S-acetyltransferase (E2 component of pyruvate dehydrogenase complex) variant 172 69466 6 6 6 6 5741 7442 1 1 1 777.4341 1552.8537 2 1552.8535 0.0003 0 57.24 4.30E-06 R DVPLGTPLCIIVEK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8029.8029.2.dta 65 IPI00021338.1 "Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial precursor" 168 66195 5 5 5 5 1042 3182 1 0 1 429.7554 857.4962 2 857.4971 -0.0009 0 25.35 0.013 K ILVAEGTR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3533.3533.2.dta 65 IPI00021338.1 "Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial precursor" 168 66195 5 5 5 5 1198 3664 1 0 1 442.7633 883.5121 2 883.5127 -0.0006 0 36.38 0.0019 K ILVPEGTR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4076.4076.2.dta 65 IPI00021338.1 "Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial precursor" 168 66195 5 5 5 5 3445 7606 1 0 1 610.8514 1219.6883 2 1219.6886 -0.0003 0 38.39 0.00096 K YLEKPITMLL - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8211.8211.2.dta 65 IPI00021338.1 "Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial precursor" 168 66195 5 5 5 5 5508 7488 1 0 1 758.9138 1515.8131 2 1515.8144 -0.0014 0 91.11 9.20E-09 K GVETIANDVVSLATK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8083.8083.2.dta 65 IPI00021338.1 "Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial precursor" 168 66195 5 5 5 5 5741 7442 1 0 1 777.4341 1552.8537 2 1552.8535 0.0003 0 57.24 4.30E-06 R DVPLGTPLCIIVEK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8029.8029.2.dta 65 IPI00788836.1 Pyruvate dehydrogenase complex component E2 117 58006 4 4 4 4 1042 3182 1 0 1 429.7554 857.4962 2 857.4971 -0.0009 0 25.35 0.013 K ILVAEGTR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3533.3533.2.dta 65 IPI00788836.1 Pyruvate dehydrogenase complex component E2 117 58006 4 4 4 4 1053 4940 1 0 1 430.7655 859.5165 2 859.5167 -0.0002 0 23.51 0.018 R VFVSPLAK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5463.5463.2.dta 65 IPI00788836.1 Pyruvate dehydrogenase complex component E2 117 58006 4 4 4 4 3445 7606 1 0 1 610.8514 1219.6883 2 1219.6886 -0.0003 0 38.39 0.00096 K YLEKPITMLL - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8211.8211.2.dta 65 IPI00788836.1 Pyruvate dehydrogenase complex component E2 117 58006 4 4 4 4 5508 7488 1 0 1 758.9138 1515.8131 2 1515.8144 -0.0014 0 91.11 9.20E-09 K GVETIANDVVSLATK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8083.8083.2.dta 66 1 IPI00784614.1 Isoform 1 of Septin-9 166 65646 6 6 6 6 56 1917 1 0 0 307.7087 613.4029 2 613.4024 0.0006 1 29.96 0.02 K RILGR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2149.2149.2.dta 66 1 IPI00784614.1 Isoform 1 of Septin-9 166 65646 6 6 6 6 2147 7082 1 1 1 518.8055 1035.5965 2 1035.5964 0.0001 0 50.96 5.50E-05 K STLINTLFK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7627.7627.2.dta 66 1 IPI00784614.1 Isoform 1 of Septin-9 166 65646 6 6 6 6 2231 4082 1 1 1 524.2701 1046.5256 2 1046.5244 0.0012 0 86.95 5.60E-08 K ADTLTLEER V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4533.4533.2.dta 66 1 IPI00784614.1 Isoform 1 of Septin-9 166 65646 6 6 6 6 2247 5830 1 1 1 526.3479 1050.6812 2 1050.6801 0.0011 0 24.88 0.0042 K VVNIVPVIAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6367.6367.2.dta 66 1 IPI00784614.1 Isoform 1 of Septin-9 166 65646 6 6 6 6 3260 2687 1 1 1 599.8115 1197.6085 2 1197.6102 -0.0017 0 49.7 0.00018 K QVENAGAIGPSR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2987.2987.2.dta 66 1 IPI00784614.1 Isoform 1 of Septin-9 166 65646 6 6 6 6 6140 3096 1 1 1 543.9714 1628.8925 3 1628.8886 0.0039 0 29.79 0.0018 R LEPKPQPPVAEATPR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3432.3432.3.dta 66 IPI00455033.5 Isoform 3 of Septin-9 141 47756 5 5 5 5 56 1917 1 0 0 307.7087 613.4029 2 613.4024 0.0006 1 29.96 0.02 K RILGR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2149.2149.2.dta 66 IPI00455033.5 Isoform 3 of Septin-9 141 47756 5 5 5 5 2147 7082 1 0 1 518.8055 1035.5965 2 1035.5964 0.0001 0 50.96 5.50E-05 K STLINTLFK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7627.7627.2.dta 66 IPI00455033.5 Isoform 3 of Septin-9 141 47756 5 5 5 5 2231 4082 1 0 1 524.2701 1046.5256 2 1046.5244 0.0012 0 86.95 5.60E-08 K ADTLTLEER V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4533.4533.2.dta 66 IPI00455033.5 Isoform 3 of Septin-9 141 47756 5 5 5 5 2247 5830 1 0 1 526.3479 1050.6812 2 1050.6801 0.0011 0 24.88 0.0042 K VVNIVPVIAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6367.6367.2.dta 66 IPI00455033.5 Isoform 3 of Septin-9 141 47756 5 5 5 5 6140 3096 1 0 1 543.9714 1628.8925 3 1628.8886 0.0039 0 29.79 0.0018 R LEPKPQPPVAEATPR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3432.3432.3.dta 66 IPI00790814.1 53 kDa protein 130 53621 5 5 5 5 56 1917 1 0 0 307.7087 613.4029 2 613.4024 0.0006 1 29.96 0.02 K RILGR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2149.2149.2.dta 66 IPI00790814.1 53 kDa protein 130 53621 5 5 5 5 379 1064 1 0 1 358.7119 715.4093 2 715.4089 0.0004 1 26.45 0.045 R QGSLRR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1226.1226.2.dta 66 IPI00790814.1 53 kDa protein 130 53621 5 5 5 5 2147 7082 1 0 1 518.8055 1035.5965 2 1035.5964 0.0001 0 50.96 5.50E-05 K STLINTLFK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7627.7627.2.dta 66 IPI00790814.1 53 kDa protein 130 53621 5 5 5 5 2231 4082 1 0 1 524.2701 1046.5256 2 1046.5244 0.0012 0 86.95 5.60E-08 K ADTLTLEER V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4533.4533.2.dta 66 IPI00790814.1 53 kDa protein 130 53621 5 5 5 5 2247 5830 1 0 1 526.3479 1050.6812 2 1050.6801 0.0011 0 24.88 0.0042 K VVNIVPVIAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6367.6367.2.dta 66 IPI00748715.2 SEPT9 protein (Fragment) 59 36717 2 2 2 2 3260 2687 1 0 1 599.8115 1197.6085 2 1197.6102 -0.0017 0 49.7 0.00018 K QVENAGAIGPSR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2987.2987.2.dta 66 IPI00748715.2 SEPT9 protein (Fragment) 59 36717 2 2 2 2 6140 3096 1 0 1 543.9714 1628.8925 3 1628.8886 0.0039 0 29.79 0.0018 R LEPKPQPPVAEATPR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3432.3432.3.dta 66 IPI00784926.1 Isoform 6 of Septin-9 51 22506 1 1 1 1 2147 7082 1 0 1 518.8055 1035.5965 2 1035.5964 0.0001 0 50.96 5.50E-05 K STLINTLFK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7627.7627.2.dta 67 1 IPI00554777.2 Asparagine synthetase 166 64899 5 5 4 4 2813 4015 1 1 1 565.7828 1129.551 2 1129.5516 -0.0006 0 32.61 0.0013 K WINATDPSAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4460.4460.2.dta 67 1 IPI00554777.2 Asparagine synthetase 166 64899 5 5 4 4 3059 8400 1 1 1 584.3248 1166.635 2 1166.6335 0.0014 0 45.92 0.00014 R ELYLFDVLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.9025.9025.2.dta 67 1 IPI00554777.2 Asparagine synthetase 166 64899 5 5 4 4 5755 7807 1 1 1 778.4366 1554.8586 2 1554.8592 -0.0006 0 55.56 6.20E-06 R LAVVDPLFGMQPIR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8432.8432.2.dta 67 1 IPI00554777.2 Asparagine synthetase 166 64899 5 5 4 4 5825 7056 1 1 1 786.4341 1570.8536 2 1570.8541 -0.0005 0 52.67 2.40E-05 R LAVVDPLFGMQPIR V Oxidation (M) 0.00000000010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7597.7597.2.dta 67 1 IPI00554777.2 Asparagine synthetase 166 64899 5 5 4 4 6133 5852 1 1 1 814.8669 1627.7192 2 1627.7222 -0.003 0 49.13 2.50E-05 K AMTEDGFLAVCSEAK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6388.6388.2.dta 68 1 IPI00021439.1 "Actin, cytoplasmic 1" 164 42052 5 5 5 5 1759 2924 1 1 1 488.7272 975.4398 2 975.441 -0.0012 0 63.77 4.00E-06 K AGFAGDDAPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3247.3247.2.dta 68 1 IPI00021439.1 "Actin, cytoplasmic 1" 164 42052 5 5 5 5 3030 4631 1 1 1 581.3123 1160.61 2 1160.6111 -0.0011 0 24.06 0.0055 K EITALAPSTMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5127.5127.2.dta 68 1 IPI00021439.1 "Actin, cytoplasmic 1" 164 42052 5 5 5 5 4469 2141 1 1 1 677.8146 1353.6146 2 1353.6161 -0.0015 1 39.04 0.00022 K DSYVGDEAQSKR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2393.2393.2.dta 68 1 IPI00021439.1 "Actin, cytoplasmic 1" 164 42052 5 5 5 5 7036 6432 1 1 0 895.9489 1789.8833 2 1789.8846 -0.0014 0 71.99 5.50E-07 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6964.6964.2.dta 68 1 IPI00021439.1 "Actin, cytoplasmic 1" 164 42052 5 5 5 5 7693 5340 2 1 1 652.0255 1953.0545 3 1953.0571 -0.0026 0 40.68 0.00072 R VAPEEHPVLLTEAPLNPK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5874.5874.3.dta 68 2 IPI00003269.1 hypothetical protein LOC345651 94 42318 2 2 2 2 7036 6432 1 0 0 895.9489 1789.8833 2 1789.8846 -0.0014 0 71.99 5.50E-07 R SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6964.6964.2.dta 68 2 IPI00003269.1 hypothetical protein LOC345651 94 42318 2 2 2 2 7693 5340 1 0 1 652.0255 1953.0545 3 1953.0571 -0.0026 0 44.05 0.00033 R VAPDEHPILLTEAPLNPK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5874.5874.3.dta 68 IPI00816229.1 ACTA2 protein (Fragment) 121 37125 3 3 3 3 1759 2924 1 0 1 488.7272 975.4398 2 975.441 -0.0012 0 63.77 4.00E-06 K AGFAGDDAPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3247.3247.2.dta 68 IPI00816229.1 ACTA2 protein (Fragment) 121 37125 3 3 3 3 3030 4631 1 0 1 581.3123 1160.61 2 1160.6111 -0.0011 0 24.06 0.0055 K EITALAPSTMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5127.5127.2.dta 68 IPI00816229.1 ACTA2 protein (Fragment) 121 37125 3 3 3 3 7036 6432 1 0 0 895.9489 1789.8833 2 1789.8846 -0.0014 0 71.99 5.50E-07 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6964.6964.2.dta 68 IPI00739539.2 "similar to Prostate, ovary, testis expressed protein on chromosome 2" 114 123020 2 2 2 2 1759 2924 1 0 1 488.7272 975.4398 2 975.441 -0.0012 0 63.77 4.00E-06 K AGFAGDDAPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3247.3247.2.dta 68 IPI00739539.2 "similar to Prostate, ovary, testis expressed protein on chromosome 2" 114 123020 2 2 2 2 7036 6432 1 0 0 895.9489 1789.8833 2 1789.8846 -0.0014 0 71.99 5.50E-07 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6964.6964.2.dta 68 IPI00790339.1 22 kDa protein 104 22189 3 3 3 3 1759 2924 1 0 1 488.7272 975.4398 2 975.441 -0.0012 0 63.77 4.00E-06 K AGFAGDDAPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3247.3247.2.dta 68 IPI00790339.1 22 kDa protein 104 22189 3 3 3 3 4469 2141 1 0 1 677.8146 1353.6146 2 1353.6161 -0.0015 1 39.04 0.00022 K DSYVGDEAQSKR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2393.2393.2.dta 68 IPI00790339.1 22 kDa protein 104 22189 3 3 3 3 7693 5340 2 0 1 652.0255 1953.0545 3 1953.0571 -0.0026 0 40.68 0.00072 R VAPEEHPVLLTEAPLNPK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5874.5874.3.dta 68 IPI00414057.2 Actin alpha 1 skeletal muscle protein 93 28454 3 3 3 3 1759 2924 1 0 1 488.7272 975.4398 2 975.441 -0.0012 0 63.77 4.00E-06 K AGFAGDDAPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3247.3247.2.dta 68 IPI00414057.2 Actin alpha 1 skeletal muscle protein 93 28454 3 3 3 3 3030 4631 1 0 1 581.3123 1160.61 2 1160.6111 -0.0011 0 24.06 0.0055 K EITALAPSTMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5127.5127.2.dta 68 IPI00414057.2 Actin alpha 1 skeletal muscle protein 93 28454 3 3 3 3 4469 2141 1 0 1 677.8146 1353.6146 2 1353.6161 -0.0015 1 39.04 0.00022 K DSYVGDEAQSKR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2393.2393.2.dta 68 IPI00794523.2 ACTG1 protein 78 28478 2 2 2 2 3030 4631 1 0 1 581.3123 1160.61 2 1160.6111 -0.0011 0 24.06 0.0055 K EITALAPSTMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5127.5127.2.dta 68 IPI00794523.2 ACTG1 protein 78 28478 2 2 2 2 7036 6432 1 0 0 895.9489 1789.8833 2 1789.8846 -0.0014 0 71.99 5.50E-07 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6964.6964.2.dta 68 IPI00555900.1 FKSG30 72 42331 1 1 1 1 7036 6432 1 0 0 895.9489 1789.8833 2 1789.8846 -0.0014 0 71.99 5.50E-07 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6964.6964.2.dta 68 IPI00738655.2 "similar to Prostate, ovary, testis expressed protein on chromosome 2" 64 118740 1 1 1 1 1759 2924 1 0 1 488.7272 975.4398 2 975.441 -0.0012 0 63.77 4.00E-06 K AGFAGDDAPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3247.3247.2.dta 68 IPI00444605.1 "CDNA FLJ45296 fis, clone BRHIP3003340, moderately similar to Actin, alpha skeletal muscle 2" 24 23821 1 1 1 1 3030 4631 1 0 1 581.3123 1160.61 2 1160.6111 -0.0011 0 24.06 0.0055 K EITALAPSTMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5127.5127.2.dta 69 1 IPI00328550.3 Thrombospondin-4 precursor 162 108482 5 5 5 5 985 2252 1 1 1 423.727 845.4395 2 845.4395 0 1 31.73 0.016 R NVGWKDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2515.2515.2.dta 69 1 IPI00328550.3 Thrombospondin-4 precursor 162 108482 5 5 5 5 2278 2666 1 1 1 528.2036 1054.3927 2 1054.3961 -0.0034 0 44.43 3.60E-05 R CDSNPCFR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2964.2964.2.dta 69 1 IPI00328550.3 Thrombospondin-4 precursor 162 108482 5 5 5 5 6040 3955 1 1 1 808.3758 1614.737 2 1614.7387 -0.0016 0 71.43 3.00E-07 R NSLWHTGDTSDQVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4395.4395.2.dta 69 1 IPI00328550.3 Thrombospondin-4 precursor 162 108482 5 5 5 5 6363 6013 1 1 1 828.3922 1654.7699 2 1654.774 -0.0041 0 68.26 1.70E-06 K QTEQTYWQATPFR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6548.6548.2.dta 69 1 IPI00328550.3 Thrombospondin-4 precursor 162 108482 5 5 5 5 7438 6683 1 1 1 939.9461 1877.8777 2 1877.8829 -0.0053 0 25.28 0.012 R IDVCPENAEVTLTDFR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7219.7219.2.dta 69 IPI00329535.2 Thrombospondin-3 precursor 68 106872 1 1 1 1 6363 6013 1 0 1 828.3922 1654.7699 2 1654.774 -0.0041 0 68.26 1.70E-06 K QTEQTYWQATPFR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6548.6548.2.dta 69 IPI00028030.3 Cartilage oligomeric matrix protein precursor 35 85402 2 2 2 2 985 2252 1 0 1 423.727 845.4395 2 845.4395 0 1 31.73 0.016 R NVGWKDK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2515.2515.2.dta 69 IPI00028030.3 Cartilage oligomeric matrix protein precursor 35 85402 2 2 2 2 7438 6683 1 0 1 939.9461 1877.8777 2 1877.8829 -0.0053 0 25.28 0.012 K IDVCPENAEVTLTDFR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7219.7219.2.dta 70 1 IPI00007682.2 "Vacuolar ATP synthase catalytic subunit A, ubiquitous isoform" 159 68660 4 4 3 3 1280 3855 1 1 1 451.7563 901.498 2 901.4981 -0.0001 0 53.48 5.00E-05 R GVNVSALSR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4287.4287.2.dta 70 1 IPI00007682.2 "Vacuolar ATP synthase catalytic subunit A, ubiquitous isoform" 159 68660 4 4 3 3 4174 5836 1 1 1 655.315 1308.6155 2 1308.6173 -0.0018 1 34.97 0.001 R DIKWDFTPCK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6372.6372.2.dta 70 1 IPI00007682.2 "Vacuolar ATP synthase catalytic subunit A, ubiquitous isoform" 159 68660 4 4 3 3 5503 4355 1 1 1 758.4005 1514.7865 2 1514.7875 -0.001 0 55.35 6.50E-06 R TALVANTSNMPVAAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4828.4828.2.dta 70 1 IPI00007682.2 "Vacuolar ATP synthase catalytic subunit A, ubiquitous isoform" 159 68660 4 4 3 3 5604 3276 1 1 1 766.3976 1530.7807 2 1530.7824 -0.0017 0 77.45 4.10E-07 R TALVANTSNMPVAAR E Oxidation (M) 0.000000000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3646.3646.2.dta 70 IPI00386819.1 "Vacuolar ATP synthase catalytic subunit A, osteoclast isoform" 112 68420 2 2 1 1 5503 4355 1 0 1 758.4005 1514.7865 2 1514.7875 -0.001 0 55.35 6.50E-06 R TALVANTSNMPVAAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4828.4828.2.dta 70 IPI00386819.1 "Vacuolar ATP synthase catalytic subunit A, osteoclast isoform" 112 68420 2 2 1 1 5604 3276 1 0 1 766.3976 1530.7807 2 1530.7824 -0.0017 0 77.45 4.10E-07 R TALVANTSNMPVAAR E Oxidation (M) 0.000000000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3646.3646.2.dta 71 1 IPI00103554.1 Transcriptional repressor p66 beta 157 65562 4 4 4 4 4583 3016 1 1 0 686.3456 1370.6767 2 1370.679 -0.0022 0 47.53 0.00027 K ALQQEQEIEQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3347.3347.2.dta 71 1 IPI00103554.1 Transcriptional repressor p66 beta 157 65562 4 4 4 4 4765 4091 1 1 1 696.3895 1390.7645 2 1390.7681 -0.0036 0 58.04 3.60E-06 R VIAPNPAQLQGQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4542.4542.2.dta 71 1 IPI00103554.1 Transcriptional repressor p66 beta 157 65562 4 4 4 4 6763 3486 1 1 1 573.6478 1717.9217 3 1717.9223 -0.0007 0 38.9 0.00026 K LPSRPGAQGVEPQNLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3879.3879.3.dta 71 1 IPI00103554.1 Transcriptional repressor p66 beta 157 65562 4 4 4 4 8683 4601 1 1 1 838.4519 2512.3339 3 2512.3398 -0.0059 0 66.89 5.30E-07 K TPVVQNAASIVQPSPAHVGQQGLSK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5095.5095.3.dta 71 2 IPI00410330.3 Isoform 1 of Transcriptional repressor p66 alpha 152 68363 4 4 4 4 1536 4319 1 0 1 470.8005 939.5865 2 939.5865 0 0 24.79 0.015 R IIQQGLIR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4789.4789.2.dta 71 2 IPI00410330.3 Isoform 1 of Transcriptional repressor p66 alpha 152 68363 4 4 4 4 3474 2519 1 0 1 613.3479 1224.6812 2 1224.6826 -0.0014 0 71.34 2.00E-07 R LLQQGTAPAQAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2804.2804.2.dta 71 2 IPI00410330.3 Isoform 1 of Transcriptional repressor p66 alpha 152 68363 4 4 4 4 4244 3815 1 0 1 659.3583 1316.702 2 1316.7048 -0.0028 0 66.49 5.80E-07 K LQNSASATALVSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4243.4243.2.dta 71 2 IPI00410330.3 Isoform 1 of Transcriptional repressor p66 alpha 152 68363 4 4 4 4 4583 3016 1 0 0 686.3456 1370.6767 2 1370.679 -0.0022 0 47.53 0.00027 K ALQQEQEIEQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3347.3347.2.dta 72 1 IPI00216694.3 plastin 3 155 71279 6 6 6 6 2117 4538 1 1 1 516.2811 1030.5477 2 1030.5481 -0.0004 0 32 0.008 K AVGDGIVLCK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5027.5027.2.dta 72 1 IPI00216694.3 plastin 3 155 71279 6 6 6 6 2398 4769 1 1 1 357.8785 1070.6136 3 1070.6124 0.0012 1 33.41 0.0088 R IKVPVDWSK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5277.5277.3.dta 72 1 IPI00216694.3 plastin 3 155 71279 6 6 6 6 5003 6691 1 1 1 714.8645 1427.7145 2 1427.7157 -0.0013 0 70.26 6.60E-07 K ANDDIIVNWVNR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7227.7227.2.dta 72 1 IPI00216694.3 plastin 3 155 71279 6 6 6 6 5218 5259 1 1 1 729.8821 1457.7496 2 1457.7515 -0.0019 0 56.98 1.20E-05 R QFVTPADVVSGNPK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5790.5790.2.dta 72 1 IPI00216694.3 plastin 3 155 71279 6 6 6 6 5454 6176 1 1 1 751.8796 1501.7446 2 1501.7446 0 0 40.31 0.00025 K MINLSVPDTIDER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6711.6711.2.dta 72 1 IPI00216694.3 plastin 3 155 71279 6 6 6 6 5966 5889 1 1 1 533.9716 1598.893 3 1598.8919 0.0011 0 24.95 0.0083 R VYALPEDLVEVKPK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6424.6424.3.dta 72 IPI00032304.1 Plastin-1 57 70707 1 1 1 1 5218 5259 1 0 1 729.8821 1457.7496 2 1457.7515 -0.0019 0 56.98 1.20E-05 K QFVTPADVVSGNPK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5790.5790.2.dta 72 IPI00010471.5 Plastin-2 40 70815 1 1 1 1 5454 6176 1 0 1 751.8796 1501.7446 2 1501.7446 0 0 40.31 0.00025 K MINLSVPDTIDER T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6711.6711.2.dta 73 1 IPI00001676.9 Isoform 2 of Nuclear protein localization protein 4 homolog 152 70215 6 6 6 6 271 4925 1 1 1 344.2235 686.4324 2 686.4326 -0.0002 0 38.55 0.0028 K SLNLLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5447.5447.2.dta 73 1 IPI00001676.9 Isoform 2 of Nuclear protein localization protein 4 homolog 152 70215 6 6 6 6 1192 7550 1 1 1 442.2266 882.4386 2 882.4388 -0.0003 0 30.64 0.01 R FLDFWR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8150.8150.2.dta 73 1 IPI00001676.9 Isoform 2 of Nuclear protein localization protein 4 homolog 152 70215 6 6 6 6 1806 1481 1 1 1 493.2743 984.534 2 984.5352 -0.0012 1 28.31 0.0064 R VQSPDGVKR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1676.1676.2.dta 73 1 IPI00001676.9 Isoform 2 of Nuclear protein localization protein 4 homolog 152 70215 6 6 6 6 3157 5201 1 1 1 590.8049 1179.5953 2 1179.5958 -0.0005 0 46.33 0.00023 K FVALENISCK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5732.5732.2.dta 73 1 IPI00001676.9 Isoform 2 of Nuclear protein localization protein 4 homolog 152 70215 6 6 6 6 3690 1345 1 1 1 625.3223 1248.6301 2 1248.631 -0.0009 1 64.02 9.90E-07 R NKTGEITASSNK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1530.1530.2.dta 73 1 IPI00001676.9 Isoform 2 of Nuclear protein localization protein 4 homolog 152 70215 6 6 6 6 4903 4390 1 1 1 471.5613 1411.6622 3 1411.6633 -0.0011 0 47.02 4.20E-05 K TGNQHFGYLYGR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4866.4866.3.dta 74 1 IPI00022434.2 ALB protein 152 73881 5 5 5 5 1152 2430 1 1 1 438.2582 874.5019 2 874.5025 -0.0005 1 33.51 0.004 R LSQRFPK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2708.2708.2.dta 74 1 IPI00022434.2 ALB protein 152 73881 5 5 5 5 1448 4878 1 1 1 464.2502 926.4858 2 926.4861 -0.0004 0 36.9 0.0031 K YLYEIAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5395.5395.2.dta 74 1 IPI00022434.2 ALB protein 152 73881 5 5 5 5 2801 4573 1 1 1 564.8531 1127.6917 2 1127.6914 0.0004 1 58.23 3.50E-06 K KQTALVELVK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5065.5065.2.dta 74 1 IPI00022434.2 ALB protein 152 73881 5 5 5 5 5124 2995 1 1 1 722.3231 1442.6316 2 1442.6347 -0.0032 0 22.75 0.037 K YICENQDSISSK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3324.3324.2.dta 74 1 IPI00022434.2 ALB protein 152 73881 5 5 5 5 6275 4775 1 1 1 820.4708 1638.927 2 1638.9305 -0.0035 1 82.38 2.50E-08 K KVPQVSTPTLVEVSR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5283.5283.2.dta 74 IPI00384697.2 Isoform 2 of Serum albumin precursor 138 48641 4 4 4 4 1152 2430 1 0 1 438.2582 874.5019 2 874.5025 -0.0005 1 33.51 0.004 R LSQRFPK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2708.2708.2.dta 74 IPI00384697.2 Isoform 2 of Serum albumin precursor 138 48641 4 4 4 4 2801 4573 1 0 1 564.8531 1127.6917 2 1127.6914 0.0004 1 58.23 3.50E-06 K KQTALVELVK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5065.5065.2.dta 74 IPI00384697.2 Isoform 2 of Serum albumin precursor 138 48641 4 4 4 4 5124 2995 1 0 1 722.3231 1442.6316 2 1442.6347 -0.0032 0 22.75 0.037 K YICENQDSISSK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3324.3324.2.dta 74 IPI00384697.2 Isoform 2 of Serum albumin precursor 138 48641 4 4 4 4 6275 4775 1 0 1 820.4708 1638.927 2 1638.9305 -0.0035 1 82.38 2.50E-08 K KVPQVSTPTLVEVSR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5283.5283.2.dta 74 IPI00216773.4 ALB protein 123 46442 2 2 2 2 2801 4573 1 0 1 564.8531 1127.6917 2 1127.6914 0.0004 1 58.23 3.50E-06 K KQTALVELVK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5065.5065.2.dta 74 IPI00216773.4 ALB protein 123 46442 2 2 2 2 6275 4775 1 0 1 820.4708 1638.927 2 1638.9305 -0.0035 1 82.38 2.50E-08 K KVPQVSTPTLVEVSR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5283.5283.2.dta 75 1 IPI00221354.1 Isoform Short of RNA-binding protein FUS 150 53551 6 6 5 5 221 4130 3 1 1 336.2264 670.4383 2 670.4377 0.0005 0 26.69 0.025 K QIGIIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4585.4585.2.dta 75 1 IPI00221354.1 Isoform Short of RNA-binding protein FUS 150 53551 6 6 5 5 250 3053 1 1 1 340.6898 679.3651 2 679.3653 -0.0002 0 23.52 0.017 K VSFATR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3387.3387.2.dta 75 1 IPI00221354.1 Isoform Short of RNA-binding protein FUS 150 53551 6 6 5 5 4951 4118 1 1 1 710.8331 1419.6517 2 1419.6518 -0.0001 0 67.69 1.40E-06 K GEATVSFDDPPSAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4572.4572.2.dta 75 1 IPI00221354.1 Isoform Short of RNA-binding protein FUS 150 53551 6 6 5 5 6384 3918 1 1 1 554.617 1660.8292 3 1660.8308 -0.0016 1 39.22 0.00053 K LKGEATVSFDDPPSAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4355.4355.3.dta 75 1 IPI00221354.1 Isoform Short of RNA-binding protein FUS 150 53551 6 6 5 5 7485 6904 1 1 1 947.9689 1893.9233 2 1893.9261 -0.0028 1 44.52 6.70E-05 K AAIDWFDGKEFSGNPIK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7439.7439.2.dta 75 1 IPI00221354.1 Isoform Short of RNA-binding protein FUS 150 53551 6 6 5 5 7486 6887 1 1 1 632.3162 1893.9268 3 1893.9261 0.0007 1 42.05 0.00014 K AAIDWFDGKEFSGNPIK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7421.7421.3.dta 75 IPI00020194.1 Isoform Short of TATA-binding protein-associated factor 2N 76 61749 3 3 3 3 221 4130 3 0 1 336.2264 670.4383 2 670.4377 0.0005 0 26.69 0.025 K QIGIIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4585.4585.2.dta 75 IPI00020194.1 Isoform Short of TATA-binding protein-associated factor 2N 76 61749 3 3 3 3 250 3053 1 0 1 340.6898 679.3651 2 679.3653 -0.0002 0 23.52 0.017 K VSFATR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3387.3387.2.dta 75 IPI00020194.1 Isoform Short of TATA-binding protein-associated factor 2N 76 61749 3 3 3 3 4951 4118 1 0 1 710.8331 1419.6517 2 1419.6518 -0.0001 0 67.69 1.40E-06 K GEATVSFDDPPSAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4572.4572.2.dta 76 1 IPI00216256.3 Isoform 2 of WD repeat protein 1 146 58593 6 6 6 6 703 3008 1 1 1 400.7335 799.4524 2 799.4552 -0.0028 0 51.73 0.00012 R IAVVGEGR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3338.3338.2.dta 76 1 IPI00216256.3 Isoform 2 of WD repeat protein 1 146 58593 6 6 6 6 1252 7860 1 1 1 449.7282 897.4419 2 897.4417 0.0003 0 22.44 0.0079 K GHTNQVSR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.849.849.2.dta 76 1 IPI00216256.3 Isoform 2 of WD repeat protein 1 146 58593 6 6 6 6 2304 2372 1 1 1 353.2058 1056.5956 3 1056.5927 0.0029 1 17.92 0.048 R IAVVGEGREK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2645.2645.3.dta 76 1 IPI00216256.3 Isoform 2 of WD repeat protein 1 146 58593 6 6 6 6 2612 4599 1 1 1 551.7637 1101.5128 2 1101.5131 -0.0003 0 35.48 0.0019 K YEYQPFAGK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5093.5093.2.dta 76 1 IPI00216256.3 Isoform 2 of WD repeat protein 1 146 58593 6 6 6 6 6053 5603 1 1 1 809.89 1617.7655 2 1617.7675 -0.002 0 84.65 1.20E-08 K YAPSGFYIASGDVSGK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6139.6139.2.dta 76 1 IPI00216256.3 Isoform 2 of WD repeat protein 1 146 58593 6 6 6 6 8215 5679 1 1 1 760.6906 2279.0498 3 2279.0529 -0.003 0 24.67 0.005 K GPVTDVAYSHDGAFLAVCDASK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6214.6214.3.dta 76 IPI00796208.1 25 kDa protein 129 24726 4 4 4 4 703 3008 1 0 1 400.7335 799.4524 2 799.4552 -0.0028 0 51.73 0.00012 R IAVVGEGR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3338.3338.2.dta 76 IPI00796208.1 25 kDa protein 129 24726 4 4 4 4 2304 2372 1 0 1 353.2058 1056.5956 3 1056.5927 0.0029 1 17.92 0.048 R IAVVGEGREK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2645.2645.3.dta 76 IPI00796208.1 25 kDa protein 129 24726 4 4 4 4 2612 4599 1 0 1 551.7637 1101.5128 2 1101.5131 -0.0003 0 35.48 0.0019 K YEYQPFAGK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5093.5093.2.dta 76 IPI00796208.1 25 kDa protein 129 24726 4 4 4 4 6053 5603 1 0 1 809.89 1617.7655 2 1617.7675 -0.002 0 84.65 1.20E-08 K YAPSGFYIASGDVSGK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6139.6139.2.dta 76 IPI00747624.1 Isoform 3 of WD repeat protein 1 33 51264 2 2 2 2 1252 7860 1 0 1 449.7282 897.4419 2 897.4417 0.0003 0 22.44 0.0079 K GHTNQVSR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.849.849.2.dta 76 IPI00747624.1 Isoform 3 of WD repeat protein 1 33 51264 2 2 2 2 8215 5679 1 0 1 760.6906 2279.0498 3 2279.0529 -0.003 0 24.67 0.005 K GPVTDVAYSHDGAFLAVCDASK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6214.6214.3.dta 77 1 IPI00014898.1 Isoform 1 of Plectin-1 144 533408 5 5 5 5 1277 6608 1 1 1 451.2895 900.5644 2 900.5644 0 0 30.54 0.0042 R SSIAGLLLK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7141.7141.2.dta 77 1 IPI00014898.1 Isoform 1 of Plectin-1 144 533408 5 5 5 5 3205 6318 1 1 1 595.843 1189.6715 2 1189.6707 0.0008 0 55.7 3.50E-05 R LLFNDVQTLK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6851.6851.2.dta 77 1 IPI00014898.1 Isoform 1 of Plectin-1 144 533408 5 5 5 5 3955 6688 1 1 1 642.8614 1283.7083 2 1283.7085 -0.0001 0 33.53 0.0017 R SLVPAAELLESR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7224.7224.2.dta 77 1 IPI00014898.1 Isoform 1 of Plectin-1 144 533408 5 5 5 5 5761 5692 1 1 1 778.9163 1555.8181 2 1555.8205 -0.0025 0 79.45 3.60E-08 R LQEAGILSAEELQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6227.6227.2.dta 77 1 IPI00014898.1 Isoform 1 of Plectin-1 144 533408 5 5 5 5 7631 6903 1 1 1 643.0151 1926.0236 3 1926.0244 -0.0008 0 18.38 0.019 R CRPDQLTGLSLLPLSEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7438.7438.3.dta 77 IPI00740690.1 similar to Plectin-1 56 144727 1 1 1 1 3205 6318 1 0 1 595.843 1189.6715 2 1189.6707 0.0008 0 55.7 3.50E-05 R LLFNDVQTLK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6851.6851.2.dta 78 1 IPI00302592.2 "filamin A, alpha" 142 282581 4 4 4 4 3477 5393 1 1 1 613.8293 1225.6441 2 1225.6455 -0.0014 0 80.43 1.40E-07 R AWGPGLEGGVVGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5928.5928.2.dta 78 1 IPI00302592.2 "filamin A, alpha" 142 282581 4 4 4 4 3963 6666 1 1 1 643.3657 1284.7169 2 1284.719 -0.0021 0 25.58 0.004 K LPQLPITNFSR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7201.7201.2.dta 78 1 IPI00302592.2 "filamin A, alpha" 142 282581 4 4 4 4 6345 3711 1 1 1 826.9336 1651.8526 2 1651.8529 -0.0003 0 74.94 6.50E-07 K VTAQGPGLEPSGNIANK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4130.4130.2.dta 78 1 IPI00302592.2 "filamin A, alpha" 142 282581 4 4 4 4 7034 1862 1 1 1 597.2805 1788.8197 3 1788.8213 -0.0016 0 19.45 0.017 K ATCAPQHGAPGPGPADASK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2089.2089.3.dta 79 1 IPI00178431.11 ATP-dependent DNA helicase Q1 141 74435 5 5 5 5 925 1933 1 1 1 420.2039 838.3933 2 838.3933 0 0 37.71 0.00065 K STQNSFR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2166.2166.2.dta 79 1 IPI00178431.11 ATP-dependent DNA helicase Q1 141 74435 5 5 5 5 1674 4293 1 1 1 481.7816 961.5486 2 961.5484 0.0001 0 31.47 0.0066 K LIYVTPEK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4761.4761.2.dta 79 1 IPI00178431.11 ATP-dependent DNA helicase Q1 141 74435 5 5 5 5 3578 6252 1 1 1 617.8278 1233.6411 2 1233.6428 -0.0017 0 46.42 0.0002 K EVFLVMPTGGGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6787.6787.2.dta 79 1 IPI00178431.11 ATP-dependent DNA helicase Q1 141 74435 5 5 5 5 4534 3573 1 1 1 682.2814 1362.5483 2 1362.551 -0.0027 0 64.34 9.20E-07 K SMENYYQESGR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3977.3977.2.dta 79 1 IPI00178431.11 ATP-dependent DNA helicase Q1 141 74435 5 5 5 5 6945 6548 1 1 1 588.3025 1761.8856 3 1761.8785 0.0072 0 40.09 0.00065 R QKPSNTEDFIEDIVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7083.7083.3.dta 79 IPI00792775.1 24 kDa protein 56 23928 2 2 2 2 1674 4293 1 0 1 481.7816 961.5486 2 961.5484 0.0001 0 31.47 0.0066 K LIYVTPEK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4761.4761.2.dta 79 IPI00792775.1 24 kDa protein 56 23928 2 2 2 2 3578 6252 1 0 1 617.8278 1233.6411 2 1233.6428 -0.0017 0 46.42 0.0002 K EVFLVMPTGGGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6787.6787.2.dta 79 IPI00004859.1 Bloom syndrome protein 31 160611 1 1 1 1 1674 4293 1 0 1 481.7816 961.5486 2 961.5484 0.0001 0 31.47 0.0066 K LLYVTPEK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4761.4761.2.dta 80 1 IPI00179330.6 ubiquitin and ribosomal protein S27a precursor 140 18296 6 6 5 5 160 4417 1 1 0 324.7075 647.4004 2 647.4006 -0.0003 0 25.72 0.049 R LIFAGK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4896.4896.2.dta 80 1 IPI00179330.6 ubiquitin and ribosomal protein S27a precursor 140 18296 6 6 5 5 563 4941 1 1 0 383.2202 764.4258 2 764.4255 0.0003 0 29.55 0.015 - MQIFVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5464.5464.2.dta 80 1 IPI00179330.6 ubiquitin and ribosomal protein S27a precursor 140 18296 6 6 5 5 5559 2124 1 1 1 508.5984 1522.7734 3 1522.774 -0.0005 1 24.53 0.0071 K IQDKEGIPPDQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2375.2375.3.dta 80 1 IPI00179330.6 ubiquitin and ribosomal protein S27a precursor 140 18296 6 6 5 5 5560 2152 1 1 1 762.3948 1522.7751 2 1522.774 0.0012 1 54.7 7.40E-06 K IQDKEGIPPDQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2405.2405.2.dta 80 1 IPI00179330.6 ubiquitin and ribosomal protein S27a precursor 140 18296 6 6 5 5 7024 5841 1 1 1 894.4662 1786.9178 2 1786.92 -0.0022 0 62.66 1.80E-06 K TITLEVEPSDTIENVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6378.6378.2.dta 80 1 IPI00179330.6 ubiquitin and ribosomal protein S27a precursor 140 18296 6 6 5 5 7766 5238 1 1 1 663.0234 1986.0485 3 1986.0521 -0.0036 1 37.59 0.0003 K TITLEVEPSDTIENVKAK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5770.5770.3.dta 80 IPI00397808.3 similar to ubiquitin and ribosomal protein S27a precursor 74 18355 4 4 3 3 160 4417 1 0 0 324.7075 647.4004 2 647.4006 -0.0003 0 25.72 0.049 R LIFAGK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4896.4896.2.dta 80 IPI00397808.3 similar to ubiquitin and ribosomal protein S27a precursor 74 18355 4 4 3 3 563 4941 1 0 0 383.2202 764.4258 2 764.4255 0.0003 0 29.55 0.015 - MQIFVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5464.5464.2.dta 80 IPI00397808.3 similar to ubiquitin and ribosomal protein S27a precursor 74 18355 4 4 3 3 5559 2124 1 0 1 508.5984 1522.7734 3 1522.774 -0.0005 1 24.53 0.0071 K IQDKEGIPPDQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2375.2375.3.dta 80 IPI00397808.3 similar to ubiquitin and ribosomal protein S27a precursor 74 18355 4 4 3 3 5560 2152 1 0 1 762.3948 1522.7751 2 1522.774 0.0012 1 54.7 7.40E-06 K IQDKEGIPPDQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2405.2405.2.dta 81 1 IPI00219005.3 FK506-binding protein 4 139 52057 4 4 4 4 2095 2948 1 1 1 514.7742 1027.5338 2 1027.5338 -0.0001 1 40.91 0.00047 R GTVYFKEGK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3273.3273.2.dta 81 1 IPI00219005.3 FK506-binding protein 4 139 52057 4 4 4 4 2537 4614 1 1 1 544.8082 1087.6019 2 1087.6026 -0.0007 0 50.1 0.00021 K VLQLYPNNK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5109.5109.2.dta 81 1 IPI00219005.3 FK506-binding protein 4 139 52057 4 4 4 4 2824 3353 1 1 1 566.7773 1131.54 2 1131.5407 -0.0007 0 31.4 0.011 K ALELDSNNEK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3732.3732.2.dta 81 1 IPI00219005.3 FK506-binding protein 4 139 52057 4 4 4 4 5096 4961 1 1 1 719.8521 1437.6897 2 1437.6922 -0.0025 0 82.75 1.70E-08 K LQAFSAAIESCNK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5486.5486.2.dta 82 1 IPI00024143.4 Aladin 137 60392 5 5 5 5 3123 5509 1 1 1 588.3419 1174.6692 2 1174.671 -0.0018 0 40.73 0.0002 K ILATTPSAVFR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6045.6045.2.dta 82 1 IPI00024143.4 Aladin 137 60392 5 5 5 5 3363 6733 1 1 1 603.3297 1204.6449 2 1204.6452 -0.0003 0 46.94 0.0003 K FAVALLDDSVR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7269.7269.2.dta 82 1 IPI00024143.4 Aladin 137 60392 5 5 5 5 3399 5127 1 1 1 606.8501 1211.6856 2 1211.6874 -0.0017 0 30.2 0.0015 R LLSASPVDAAIR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5657.5657.2.dta 82 1 IPI00024143.4 Aladin 137 60392 5 5 5 5 4700 6426 1 1 1 462.2818 1383.8237 3 1383.8238 -0.0002 0 41.53 0.00019 R VQDGKPVILLFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6958.6958.3.dta 82 1 IPI00024143.4 Aladin 137 60392 5 5 5 5 5395 6466 1 1 1 744.3762 1486.7378 2 1486.7416 -0.0039 0 46.89 4.00E-05 R GGGVTNLLWSPDGSK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6997.6997.2.dta 82 IPI00747361.1 Achalasia variant 113 56577 4 4 4 4 3123 5509 1 0 1 588.3419 1174.6692 2 1174.671 -0.0018 0 40.73 0.0002 K ILATTPSAVFR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6045.6045.2.dta 82 IPI00747361.1 Achalasia variant 113 56577 4 4 4 4 3399 5127 1 0 1 606.8501 1211.6856 2 1211.6874 -0.0017 0 30.2 0.0015 R LLSASPVDAAIR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5657.5657.2.dta 82 IPI00747361.1 Achalasia variant 113 56577 4 4 4 4 4700 6426 1 0 1 462.2818 1383.8237 3 1383.8238 -0.0002 0 41.53 0.00019 R VQDGKPVILLFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6958.6958.3.dta 82 IPI00747361.1 Achalasia variant 113 56577 4 4 4 4 5395 6466 1 0 1 744.3762 1486.7378 2 1486.7416 -0.0039 0 46.89 4.00E-05 R GGGVTNLLWSPDGSK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6997.6997.2.dta 82 IPI00792670.1 14 kDa protein 42 14228 1 1 1 1 4700 6426 1 0 1 462.2818 1383.8237 3 1383.8238 -0.0002 0 41.53 0.00019 R VQDGKPVILLFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6958.6958.3.dta 83 1 IPI00073096.3 Isoform Alpha of Tripartite motif-containing protein 29 137 66478 5 5 4 4 1077 4504 1 1 1 433.7219 865.4293 2 865.4294 -0.0001 0 52.56 0.00012 R ADTGLFSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4990.4990.2.dta 83 1 IPI00073096.3 Isoform Alpha of Tripartite motif-containing protein 29 137 66478 5 5 4 4 1838 4582 1 1 1 495.7719 989.5292 2 989.5294 -0.0002 0 22.69 0.0091 K AILEQNFR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5074.5074.2.dta 83 1 IPI00073096.3 Isoform Alpha of Tripartite motif-containing protein 29 137 66478 5 5 4 4 2787 786 1 1 1 563.3038 1124.593 2 1124.5938 -0.0008 1 43.33 0.00032 K VLHEDKQTR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1111.1111.2.dta 83 1 IPI00073096.3 Isoform Alpha of Tripartite motif-containing protein 29 137 66478 5 5 4 4 2788 778 1 1 1 375.872 1124.5942 3 1124.5938 0.0004 1 40.01 0.00018 K VLHEDKQTR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1110.1110.3.dta 83 1 IPI00073096.3 Isoform Alpha of Tripartite motif-containing protein 29 137 66478 5 5 4 4 3122 4889 1 1 1 588.3236 1174.6327 2 1174.6346 -0.0019 0 55.66 1.40E-05 R SPYAGLQLGAAK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5407.5407.2.dta 84 1 IPI00291510.3 Inosine-5~-monophosphate dehydrogenase 2 136 56226 3 3 3 3 979 4583 1 1 1 422.7665 843.5185 2 843.5178 0.0007 0 55.95 3.30E-05 R LVGIISSR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5075.5075.2.dta 84 1 IPI00291510.3 Inosine-5~-monophosphate dehydrogenase 2 136 56226 3 3 3 3 2994 6433 1 1 1 578.8199 1155.6253 2 1155.6248 0.0006 0 56.08 4.90E-05 K NLIDAGVDALR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6965.6965.2.dta 84 1 IPI00291510.3 Inosine-5~-monophosphate dehydrogenase 2 136 56226 3 3 3 3 3011 2303 1 1 1 579.809 1157.6035 2 1157.6041 -0.0006 0 69.61 5.10E-07 K VAQGVSGAVQDK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2570.2570.2.dta 84 IPI00795143.1 10 kDa protein 70 10505 1 1 1 1 3011 2303 1 0 1 579.809 1157.6035 2 1157.6041 -0.0006 0 69.61 5.10E-07 K VAQGVSGAVQDK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2570.2570.2.dta 84 IPI00791628.1 Inosine monophosphate dehydrogenase type II 56 21434 1 1 1 1 2994 6433 1 0 1 578.8199 1155.6253 2 1155.6248 0.0006 0 56.08 4.90E-05 K NLIDAGVDALR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6965.6965.2.dta 84 IPI00795859.1 IMP dehydrogenase 2 56 27289 1 1 1 1 979 4583 1 0 1 422.7665 843.5185 2 843.5178 0.0007 0 55.95 3.30E-05 R LVGIISSR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5075.5075.2.dta 85 1 IPI00011200.5 D-3-phosphoglycerate dehydrogenase 134 57356 4 4 4 4 1264 6658 1 1 1 450.2873 898.56 2 898.56 0 0 54.73 3.00E-05 K TLGILGLGR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7193.7193.2.dta 85 1 IPI00011200.5 D-3-phosphoglycerate dehydrogenase 134 57356 4 4 4 4 4416 5048 1 1 1 673.3871 1344.7596 2 1344.7613 -0.0017 0 35.64 0.00045 K GTIQVITQGTSLK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5577.5577.2.dta 85 1 IPI00011200.5 D-3-phosphoglycerate dehydrogenase 134 57356 4 4 4 4 5404 4457 1 1 1 744.8676 1487.7207 2 1487.7216 -0.0009 0 70.85 5.10E-07 R AGTGVDNVDLEAATR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4939.4939.2.dta 85 1 IPI00011200.5 D-3-phosphoglycerate dehydrogenase 134 57356 4 4 4 4 6119 7967 1 1 1 813.4547 1624.8948 2 1624.897 -0.0023 0 26.2 0.0035 K NAGNCLSPAVIVGLLK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8597.8597.2.dta 86 1 IPI00215965.2 Isoform A1-B of Heterogeneous nuclear ribonucleoprotein A1 133 38936 2 2 2 2 411 1155 1 1 0 364.2269 726.4392 2 726.4388 0.0004 1 30.23 0.01 R VVEPKR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1324.1324.2.dta 86 1 IPI00215965.2 Isoform A1-B of Heterogeneous nuclear ribonucleoprotein A1 133 38936 2 2 2 2 6627 2077 1 1 1 847.8539 1693.6933 2 1693.6928 0.0005 0 122.54 1.10E-12 R NQGGYGGSSSSSSYGSGR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2323.2323.2.dta 87 1 IPI00013808.1 Alpha-actinin-4 132 105245 4 4 4 4 3116 6992 1 1 1 587.8057 1173.5969 2 1173.5965 0.0004 0 48.85 0.00031 K EGLLLWCQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7527.7527.2.dta 87 1 IPI00013808.1 Alpha-actinin-4 132 105245 4 4 4 4 4717 8388 1 1 1 693.8895 1385.7644 2 1385.7667 -0.0023 0 44.15 0.00017 R VGWEQLLTTIAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.9013.9013.2.dta 87 1 IPI00013808.1 Alpha-actinin-4 132 105245 4 4 4 4 5009 5482 1 1 1 715.3847 1428.7549 2 1428.7572 -0.0024 0 77.67 2.70E-07 R TINEVENQILTR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6018.6018.2.dta 87 1 IPI00013808.1 Alpha-actinin-4 132 105245 4 4 4 4 5713 3684 1 1 1 516.9268 1547.7586 3 1547.758 0.0007 1 29.88 0.0069 K HRDYETATLSDIK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4099.4099.3.dta 87 IPI00013508.5 Alpha-actinin-1 124 103563 3 3 3 3 3116 6992 1 0 1 587.8057 1173.5969 2 1173.5965 0.0004 0 48.85 0.00031 K EGLLLWCQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7527.7527.2.dta 87 IPI00013508.5 Alpha-actinin-1 124 103563 3 3 3 3 4717 8388 1 0 1 693.8895 1385.7644 2 1385.7667 -0.0023 0 44.15 0.00017 R VGWEQLLTTIAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.9013.9013.2.dta 87 IPI00013508.5 Alpha-actinin-1 124 103563 3 3 3 3 5009 5482 1 0 1 715.3847 1428.7549 2 1428.7572 -0.0024 0 77.67 2.70E-07 R TINEVENQILTR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6018.6018.2.dta 87 IPI00793285.1 39 kDa protein 100 39035 2 2 2 2 4717 8388 1 0 1 693.8895 1385.7644 2 1385.7667 -0.0023 0 44.15 0.00017 R VGWEQLLTTIAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.9013.9013.2.dta 87 IPI00793285.1 39 kDa protein 100 39035 2 2 2 2 5009 5482 1 0 1 715.3847 1428.7549 2 1428.7572 -0.0024 0 77.67 2.70E-07 R TINEVENQILTR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6018.6018.2.dta 87 IPI00019884.1 Alpha-actinin-2 49 104358 1 1 1 1 3116 6992 1 0 1 587.8057 1173.5969 2 1173.5965 0.0004 0 48.85 0.00031 K EGLLLWCQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7527.7527.2.dta 88 1 IPI00441473.3 Protein arginine N-methyltransferase 5 132 73322 6 6 6 6 1441 1045 1 1 1 463.2515 924.4885 2 924.489 -0.0004 0 23.84 0.033 K NRPGPQTR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1205.1205.2.dta 88 1 IPI00441473.3 Protein arginine N-methyltransferase 5 132 73322 6 6 6 6 1668 2850 1 1 1 481.7417 961.4688 2 961.4651 0.0037 0 20.36 0.049 R EGQTICVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3164.3164.2.dta 88 1 IPI00441473.3 Protein arginine N-methyltransferase 5 132 73322 6 6 6 6 2180 2210 1 1 1 521.7531 1041.4916 2 1041.4913 0.0002 1 23.76 0.014 R TLCDYSKR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2469.2469.2.dta 88 1 IPI00441473.3 Protein arginine N-methyltransferase 5 132 73322 6 6 6 6 4016 3775 1 1 1 646.3175 1290.6205 2 1290.6244 -0.004 0 58.42 3.30E-06 K YSQYQQAIYK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4200.4200.2.dta 88 1 IPI00441473.3 Protein arginine N-methyltransferase 5 132 73322 6 6 6 6 4737 7396 1 1 1 694.9103 1387.8061 2 1387.8075 -0.0014 0 39.79 0.00019 K AAILPTSIFLTNK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7978.7978.2.dta 88 1 IPI00441473.3 Protein arginine N-methyltransferase 5 132 73322 6 6 6 6 7023 7361 1 1 1 893.4552 1784.8958 2 1784.8978 -0.002 0 57.6 8.10E-06 R DLNCVPEIADTLGAVAK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7939.7939.2.dta 88 IPI00064328.3 protein arginine methyltransferase 5 isoform b 93 71902 5 5 5 5 1441 1045 1 0 1 463.2515 924.4885 2 924.489 -0.0004 0 23.84 0.033 K NRPGPQTR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1205.1205.2.dta 88 IPI00064328.3 protein arginine methyltransferase 5 isoform b 93 71902 5 5 5 5 1668 2850 1 0 1 481.7417 961.4688 2 961.4651 0.0037 0 20.36 0.049 R EGQTICVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3164.3164.2.dta 88 IPI00064328.3 protein arginine methyltransferase 5 isoform b 93 71902 5 5 5 5 2180 2210 1 0 1 521.7531 1041.4916 2 1041.4913 0.0002 1 23.76 0.014 R TLCDYSKR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2469.2469.2.dta 88 IPI00064328.3 protein arginine methyltransferase 5 isoform b 93 71902 5 5 5 5 4016 3775 1 0 1 646.3175 1290.6205 2 1290.6244 -0.004 0 58.42 3.30E-06 K YSQYQQAIYK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4200.4200.2.dta 88 IPI00064328.3 protein arginine methyltransferase 5 isoform b 93 71902 5 5 5 5 4737 7396 1 0 1 694.9103 1387.8061 2 1387.8075 -0.0014 0 39.79 0.00019 K AAILPTSIFLTNK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7978.7978.2.dta 88 IPI00793983.1 54 kDa protein 64 54116 3 3 3 3 1441 1045 1 0 1 463.2515 924.4885 2 924.489 -0.0004 0 23.84 0.033 K NRPGPQTR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1205.1205.2.dta 88 IPI00793983.1 54 kDa protein 64 54116 3 3 3 3 1668 2850 1 0 1 481.7417 961.4688 2 961.4651 0.0037 0 20.36 0.049 R EGQTICVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3164.3164.2.dta 88 IPI00793983.1 54 kDa protein 64 54116 3 3 3 3 4016 3775 1 0 1 646.3175 1290.6205 2 1290.6244 -0.004 0 58.42 3.30E-06 K YSQYQQAIYK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4200.4200.2.dta 88 IPI00743148.1 "CDNA FLJ14831 fis, clone OVARC1001107, highly similar to Homo sapiens protein methyltransferase (JBP1) mRNA" 58 18181 1 1 1 1 4016 3775 1 0 1 646.3175 1290.6205 2 1290.6244 -0.004 0 58.42 3.30E-06 K YSQYQQAIYK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4200.4200.2.dta 88 IPI00794580.1 16 kDa protein 28 16520 2 2 2 2 1441 1045 1 0 1 463.2515 924.4885 2 924.489 -0.0004 0 23.84 0.033 K NRPGPQTR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1205.1205.2.dta 88 IPI00794580.1 16 kDa protein 28 16520 2 2 2 2 2180 2210 1 0 1 521.7531 1041.4916 2 1041.4913 0.0002 1 23.76 0.014 R TLCDYSKR - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2469.2469.2.dta 88 IPI00792693.1 Protein 20 18184 1 1 1 1 1668 2850 1 0 1 481.7417 961.4688 2 961.4651 0.0037 0 20.36 0.049 R EGQTICVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3164.3164.2.dta 89 1 IPI00007941.4 hexamethylene bis-acetamide inducible 1 131 40884 5 5 4 4 210 2354 1 1 1 334.6851 667.3557 2 667.3541 0.0016 0 16.51 0.049 K TGLYSK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2625.2625.2.dta 89 1 IPI00007941.4 hexamethylene bis-acetamide inducible 1 131 40884 5 5 4 4 1693 3609 1 1 1 483.2648 964.5151 2 964.5164 -0.0013 1 38.29 0.0027 R IRAEMFAK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4016.4016.2.dta 89 1 IPI00007941.4 hexamethylene bis-acetamide inducible 1 131 40884 5 5 4 4 1695 3618 1 1 1 322.5133 964.5181 3 964.5164 0.0017 1 32.21 0.0036 R IRAEMFAK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4026.4026.3.dta 89 1 IPI00007941.4 hexamethylene bis-acetamide inducible 1 131 40884 5 5 4 4 2218 3617 1 1 1 523.7244 1045.4342 2 1045.4352 -0.0011 0 35.54 0.0007 R DFSETYER Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4025.4025.2.dta 89 1 IPI00007941.4 hexamethylene bis-acetamide inducible 1 131 40884 5 5 4 4 7020 4159 1 1 1 892.4207 1782.8268 2 1782.8285 -0.0018 0 84.55 1.20E-08 K LGAPAAGGEEEWGQQQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4616.4616.2.dta 89 IPI00180465.4 "CDNA FLJ32384 fis, clone SKMUS1000104, weakly similar to Homo sapiens HEXIM1 protein" 36 32741 1 1 1 1 2218 3617 1 0 1 523.7244 1045.4342 2 1045.4352 -0.0011 0 35.54 0.0007 K DFSETYER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4025.4025.2.dta 90 1 IPI00014238.2 Lysyl-tRNA synthetase 128 68461 7 7 6 6 1438 1788 1 1 1 463.2316 924.4487 2 924.4487 0 0 26.27 0.0034 K AVECPPPR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2009.2009.2.dta 90 1 IPI00014238.2 Lysyl-tRNA synthetase 128 68461 7 7 6 6 1530 6728 1 1 1 470.2689 938.5232 2 938.5225 0.0006 0 34.64 0.0034 K LIFYDLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7264.7264.2.dta 90 1 IPI00014238.2 Lysyl-tRNA synthetase 128 68461 7 7 6 6 1855 3800 1 1 1 496.7553 991.4961 2 991.4974 -0.0014 0 38.46 0.0032 R QLFEEQAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4227.4227.2.dta 90 1 IPI00014238.2 Lysyl-tRNA synthetase 128 68461 7 7 6 6 4183 3103 1 1 1 655.8613 1309.7081 2 1309.7103 -0.0021 1 62.53 7.20E-06 R RGDIIGVQGNPGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3440.3440.2.dta 90 1 IPI00014238.2 Lysyl-tRNA synthetase 128 68461 7 7 6 6 4184 3116 1 1 1 437.5774 1309.7104 3 1309.7103 0.0002 1 25.97 0.0042 R RGDIIGVQGNPGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3454.3454.3.dta 90 1 IPI00014238.2 Lysyl-tRNA synthetase 128 68461 7 7 6 6 4661 8327 1 1 1 690.8798 1379.745 2 1379.7449 0.0001 0 33.54 0.0015 R YLDLILNDFVR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8953.8953.2.dta 90 1 IPI00014238.2 Lysyl-tRNA synthetase 128 68461 7 7 6 6 7246 4707 1 1 1 613.3184 1836.9334 3 1836.937 -0.0036 0 28.62 0.015 K YSHLQPGDHLTDITLK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5210.5210.3.dta 90 IPI00445108.2 "CDNA FLJ44621 fis, clone BRACE2016896, highly similar to Lysyl-tRNA synthetase" 60 48704 3 3 3 3 1438 1788 1 0 1 463.2316 924.4487 2 924.4487 0 0 26.27 0.0034 K AVECPPPR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2009.2009.2.dta 90 IPI00445108.2 "CDNA FLJ44621 fis, clone BRACE2016896, highly similar to Lysyl-tRNA synthetase" 60 48704 3 3 3 3 1855 3800 1 0 1 496.7553 991.4961 2 991.4974 -0.0014 0 38.46 0.0032 R QLFEEQAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4227.4227.2.dta 90 IPI00445108.2 "CDNA FLJ44621 fis, clone BRACE2016896, highly similar to Lysyl-tRNA synthetase" 60 48704 3 3 3 3 4661 8327 1 0 1 690.8798 1379.745 2 1379.7449 0.0001 0 33.54 0.0015 R YLDLILNDFVR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8953.8953.2.dta 91 1 IPI00031556.7 Splicing factor U2AF 65 kDa subunit 127 53809 4 4 4 4 282 4542 1 1 1 346.2103 690.406 2 690.4064 -0.0004 0 47.39 0.00016 K AFNLVK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5031.5031.2.dta 91 1 IPI00031556.7 Splicing factor U2AF 65 kDa subunit 127 53809 4 4 4 4 2192 7581 1 1 1 522.2695 1042.5244 2 1042.5236 0.0008 0 39.37 0.00051 K NFAFLEFR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8181.8181.2.dta 91 1 IPI00031556.7 Splicing factor U2AF 65 kDa subunit 127 53809 4 4 4 4 7105 7331 1 1 1 903.4738 1804.9331 2 1804.9359 -0.0029 0 49.11 0.00014 K LFIGGLPNYLNDDQVK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7904.7904.2.dta 91 1 IPI00031556.7 Splicing factor U2AF 65 kDa subunit 127 53809 4 4 4 4 7526 5309 1 1 1 636.999 1907.9751 3 1907.9775 -0.0025 0 52.22 2.30E-05 K SIEIPRPVDGVEVPGCGK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5842.5842.3.dta 92 1 IPI00216008.4 Isoform Long of Glucose-6-phosphate 1-dehydrogenase 122 64299 5 5 4 4 1065 3102 1 1 1 432.2169 862.4192 2 862.4185 0.0008 0 33.45 0.013 K LPDAYER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3439.3439.2.dta 92 1 IPI00216008.4 Isoform Long of Glucose-6-phosphate 1-dehydrogenase 122 64299 5 5 4 4 2875 6895 1 1 1 380.2133 1137.6179 3 1137.6182 -0.0003 1 32.62 0.007 K LKLEDFFAR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7430.7430.3.dta 92 1 IPI00216008.4 Isoform Long of Glucose-6-phosphate 1-dehydrogenase 122 64299 5 5 4 4 2876 6897 1 1 1 569.8163 1137.618 2 1137.6182 -0.0002 1 35.04 0.00055 K LKLEDFFAR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7432.7432.2.dta 92 1 IPI00216008.4 Isoform Long of Glucose-6-phosphate 1-dehydrogenase 122 64299 5 5 4 4 3208 4532 1 1 1 596.2874 1190.5602 2 1190.5608 -0.0006 0 29.18 0.0073 R VGFQYEGTYK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5020.5020.2.dta 92 1 IPI00216008.4 Isoform Long of Glucose-6-phosphate 1-dehydrogenase 122 64299 5 5 4 4 6407 7421 1 1 1 832.9352 1663.8558 2 1663.857 -0.0012 0 75.64 1.20E-07 R DGLLPENTFIVGYAR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8004.8004.2.dta 92 IPI00642620.1 Glucose-6-phosphate dehydrogenase 105 29655 3 3 2 2 2875 6895 1 0 1 380.2133 1137.6179 3 1137.6182 -0.0003 1 32.62 0.007 K LKLEDFFAR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7430.7430.3.dta 92 IPI00642620.1 Glucose-6-phosphate dehydrogenase 105 29655 3 3 2 2 2876 6897 1 0 1 569.8163 1137.618 2 1137.6182 -0.0002 1 35.04 0.00055 K LKLEDFFAR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7432.7432.2.dta 92 IPI00642620.1 Glucose-6-phosphate dehydrogenase 105 29655 3 3 2 2 6407 7421 1 0 1 832.9352 1663.8558 2 1663.857 -0.0012 0 75.64 1.20E-07 R DGLLPENTFIVGYAR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8004.8004.2.dta 93 1 IPI00184821.1 Bifunctional coenzyme A synthase 122 62632 6 6 5 5 968 5232 1 1 1 421.777 841.5395 2 841.5385 0.001 0 30.8 0.0082 R ILLTNIR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5764.5764.2.dta 93 1 IPI00184821.1 Bifunctional coenzyme A synthase 122 62632 6 6 5 5 4912 8360 1 1 1 707.4124 1412.8102 2 1412.8101 0 0 30.65 0.0013 K ILTDIMWPIIAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8985.8985.2.dta 93 1 IPI00184821.1 Bifunctional coenzyme A synthase 122 62632 6 6 5 5 5972 3032 1 1 1 534.6132 1600.8178 3 1600.8169 0.001 1 30.07 0.0019 R IVERDGLSEAAAQSR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3364.3364.3.dta 93 1 IPI00184821.1 Bifunctional coenzyme A synthase 122 62632 6 6 5 5 6012 8189 1 1 1 804.9855 1607.9564 2 1607.961 -0.0046 0 18.54 0.018 R SGLLVLTTPLASLAPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8817.8817.2.dta 93 1 IPI00184821.1 Bifunctional coenzyme A synthase 122 62632 6 6 5 5 6013 8208 1 1 1 804.9875 1607.9604 2 1607.961 -0.0006 0 56.16 2.50E-06 R SGLLVLTTPLASLAPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8836.8836.2.dta 93 1 IPI00184821.1 Bifunctional coenzyme A synthase 122 62632 6 6 5 5 6894 2525 1 1 1 584.5987 1750.7743 3 1750.7758 -0.0015 1 32.94 0.00081 R HTENEEDKVSSSSFR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2811.2811.3.dta 93 IPI00783178.2 coenzyme A synthase isoform b 64 30318 3 3 3 3 4912 8360 1 0 1 707.4124 1412.8102 2 1412.8101 0 0 30.65 0.0013 K ILTDIMWPIIAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8985.8985.2.dta 93 IPI00783178.2 coenzyme A synthase isoform b 64 30318 3 3 3 3 5972 3032 1 0 1 534.6132 1600.8178 3 1600.8169 0.001 1 30.07 0.0019 R IVERDGLSEAAAQSR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3364.3364.3.dta 93 IPI00783178.2 coenzyme A synthase isoform b 64 30318 3 3 3 3 6894 2525 1 0 1 584.5987 1750.7743 3 1750.7758 -0.0015 1 32.94 0.00081 R HTENEEDKVSSSSFR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2811.2811.3.dta 94 1 IPI00018452.1 Copine-1 121 59649 6 6 6 6 2132 3813 1 1 1 517.2701 1032.5256 2 1032.5274 -0.0018 0 39.3 0.00057 R VVTMEVEAR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4241.4241.2.dta 94 1 IPI00018452.1 Copine-1 121 59649 6 6 6 6 2279 2483 1 1 1 528.2267 1054.4388 2 1054.439 -0.0001 0 45.24 9.90E-05 R NCSSPEFSK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2765.2765.2.dta 94 1 IPI00018452.1 Copine-1 121 59649 6 6 6 6 2509 5812 1 1 1 542.7689 1083.5232 2 1083.5237 -0.0005 0 50.86 2.40E-05 R FGIYDIDNK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6346.6346.2.dta 94 1 IPI00018452.1 Copine-1 121 59649 6 6 6 6 2860 6349 1 1 1 568.8081 1135.6017 2 1135.6026 -0.0009 0 29.34 0.011 R DIVQFVPYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6881.6881.2.dta 94 1 IPI00018452.1 Copine-1 121 59649 6 6 6 6 4028 5504 1 1 1 646.8577 1291.7009 2 1291.7037 -0.0028 1 24.6 0.0049 R DIVQFVPYRR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6040.6040.2.dta 94 1 IPI00018452.1 Copine-1 121 59649 6 6 6 6 5605 3796 1 1 1 511.2736 1530.7989 3 1530.8002 -0.0012 1 26.46 0.031 R GTITVSAQELKDNR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4223.4223.3.dta 94 IPI00642168.1 Copine I 103 17071 4 4 4 4 2132 3813 1 0 1 517.2701 1032.5256 2 1032.5274 -0.0018 0 39.3 0.00057 R VVTMEVEAR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4241.4241.2.dta 94 IPI00642168.1 Copine I 103 17071 4 4 4 4 2279 2483 1 0 1 528.2267 1054.4388 2 1054.439 -0.0001 0 45.24 9.90E-05 R NCSSPEFSK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2765.2765.2.dta 94 IPI00642168.1 Copine I 103 17071 4 4 4 4 2509 5812 1 0 1 542.7689 1083.5232 2 1083.5237 -0.0005 0 50.86 2.40E-05 R FGIYDIDNK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6346.6346.2.dta 94 IPI00642168.1 Copine I 103 17071 4 4 4 4 5605 3796 1 0 1 511.2736 1530.7989 3 1530.8002 -0.0012 1 26.46 0.031 R GTITVSAQELKDNR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4223.4223.3.dta 94 IPI00640313.1 Copine I 79 15437 2 2 2 2 2279 2483 1 0 1 528.2267 1054.4388 2 1054.439 -0.0001 0 45.24 9.90E-05 R NCSSPEFSK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2765.2765.2.dta 94 IPI00640313.1 Copine I 79 15437 2 2 2 2 2509 5812 1 0 1 542.7689 1083.5232 2 1083.5237 -0.0005 0 50.86 2.40E-05 R FGIYDIDNK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6346.6346.2.dta 94 IPI00645385.1 Copine I 45 7631 1 1 1 1 2279 2483 1 0 1 528.2267 1054.4388 2 1054.439 -0.0001 0 45.24 9.90E-05 R NCSSPEFSK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2765.2765.2.dta 94 IPI00552982.2 Copine I 36 21729 2 2 2 2 2860 6349 1 0 1 568.8081 1135.6017 2 1135.6026 -0.0009 0 29.34 0.011 R DIVQFVPYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6881.6881.2.dta 94 IPI00552982.2 Copine I 36 21729 2 2 2 2 4028 5504 1 0 1 646.8577 1291.7009 2 1291.7037 -0.0028 1 24.6 0.0049 R DIVQFVPYRR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6040.6040.2.dta 95 1 IPI00009315.6 Golgi resident protein GCP60 120 60841 2 2 2 2 4841 4339 1 1 1 701.3701 1400.7257 2 1400.726 -0.0003 0 55.05 1.40E-05 K IQQDADSVITVGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4811.4811.2.dta 95 1 IPI00009315.6 Golgi resident protein GCP60 120 60841 2 2 2 2 6047 4040 1 1 1 808.9264 1615.8382 2 1615.8417 -0.0035 0 83.33 1.50E-08 K QQEVVVAGSSLPTSSK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4487.4487.2.dta 96 1 IPI00449049.5 Poly [ADP-ribose] polymerase 1 118 113811 2 2 2 2 4640 7061 1 1 1 689.3779 1376.7413 2 1376.7412 0.0001 0 85.36 3.40E-08 R TTNFAGILSQGLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7604.7604.2.dta 96 1 IPI00449049.5 Poly [ADP-ribose] polymerase 1 118 113811 2 2 2 2 6114 6308 1 1 1 812.9057 1623.7968 2 1623.7992 -0.0024 0 51.86 1.40E-05 R VVSEDFLQDVSASTK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6841.6841.2.dta 97 1 IPI00289601.10 histone deacetylase 2 117 66294 6 6 4 4 2245 5695 1 1 1 526.2841 1050.5536 2 1050.5532 0.0004 0 52.86 3.30E-05 R LGCFNLTVK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6230.6230.2.dta 97 1 IPI00289601.10 histone deacetylase 2 117 66294 6 6 4 4 2273 2512 1 1 1 527.745 1053.4754 2 1053.4767 -0.0013 0 36.11 0.00091 K YHSDEYIK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2796.2796.2.dta 97 1 IPI00289601.10 histone deacetylase 2 117 66294 6 6 4 4 2274 2514 1 1 1 352.1664 1053.4772 3 1053.4767 0.0005 0 29.35 0.011 K YHSDEYIK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2799.2799.3.dta 97 1 IPI00289601.10 histone deacetylase 2 117 66294 6 6 4 4 4611 5622 1 1 1 687.819 1373.6235 2 1373.6252 -0.0017 0 39.35 0.00053 K YGEYFPGTGDLR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6158.6158.2.dta 97 1 IPI00289601.10 histone deacetylase 2 117 66294 6 6 4 4 5117 2029 1 1 1 721.8318 1441.649 2 1441.6507 -0.0017 0 30.08 0.0015 R SIRPDNMSEYSK Q Oxidation (M) 0.000000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2271.2271.2.dta 97 1 IPI00289601.10 histone deacetylase 2 117 66294 6 6 4 4 5118 2027 1 1 1 481.5572 1441.6497 3 1441.6507 -0.001 0 19.1 0.016 R SIRPDNMSEYSK Q Oxidation (M) 0.000000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2269.2269.3.dta 97 IPI00644760.1 18 kDa protein 64 18530 4 4 2 2 2273 2512 1 0 1 527.745 1053.4754 2 1053.4767 -0.0013 0 36.11 0.00091 K YHSDEYIK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2796.2796.2.dta 97 IPI00644760.1 18 kDa protein 64 18530 4 4 2 2 2274 2514 1 0 1 352.1664 1053.4772 3 1053.4767 0.0005 0 29.35 0.011 K YHSDEYIK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2799.2799.3.dta 97 IPI00644760.1 18 kDa protein 64 18530 4 4 2 2 5117 2029 1 0 1 721.8318 1441.649 2 1441.6507 -0.0017 0 30.08 0.0015 R SIRPDNMSEYSK Q Oxidation (M) 0.000000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2271.2271.2.dta 97 IPI00644760.1 18 kDa protein 64 18530 4 4 2 2 5118 2027 1 0 1 481.5572 1441.6497 3 1441.6507 -0.001 0 19.1 0.016 R SIRPDNMSEYSK Q Oxidation (M) 0.000000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2269.2269.3.dta 97 IPI00013774.1 Histone deacetylase 1 57 55638 3 3 2 2 4611 5622 1 0 1 687.819 1373.6235 2 1373.6252 -0.0017 0 39.35 0.00053 K YGEYFPGTGDLR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6158.6158.2.dta 97 IPI00013774.1 Histone deacetylase 1 57 55638 3 3 2 2 5117 2029 1 0 1 721.8318 1441.649 2 1441.6507 -0.0017 0 30.08 0.0015 R SIRPDNMSEYSK Q Oxidation (M) 0.000000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2271.2271.2.dta 97 IPI00013774.1 Histone deacetylase 1 57 55638 3 3 2 2 5118 2027 1 0 1 481.5572 1441.6497 3 1441.6507 -0.001 0 19.1 0.016 R SIRPDNMSEYSK Q Oxidation (M) 0.000000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2269.2269.3.dta 98 1 IPI00013830.1 SNW domain-containing protein 1 113 61514 4 4 3 3 4230 4182 1 1 1 439.5822 1315.7247 3 1315.7248 -0.0001 1 42.24 0.00017 R AADKLAPAQYIR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4641.4641.3.dta 98 1 IPI00013830.1 SNW domain-containing protein 1 113 61514 4 4 3 3 4231 4180 1 1 1 658.8705 1315.7264 2 1315.7248 0.0016 1 21.61 0.0094 R AADKLAPAQYIR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4639.4639.2.dta 98 1 IPI00013830.1 SNW domain-containing protein 1 113 61514 4 4 3 3 5285 4529 1 1 1 490.9289 1469.7649 3 1469.7627 0.0022 0 30.25 0.0019 R GLQTVHINENFAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5017.5017.3.dta 98 1 IPI00013830.1 SNW domain-containing protein 1 113 61514 4 4 3 3 5744 3628 1 1 1 777.8791 1553.7437 2 1553.7474 -0.0037 0 68.71 7.50E-07 R YTPSQQGVAFNSGAK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4037.4037.2.dta 99 1 IPI00465436.4 Catalase 112 59947 2 2 2 2 486 1451 1 1 1 375.6987 749.3828 2 749.382 0.0008 0 32.9 0.0071 R VANYQR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1645.1645.2.dta 99 1 IPI00465436.4 Catalase 112 59947 2 2 2 2 5422 3444 1 1 1 747.3513 1492.688 2 1492.6906 -0.0027 0 103.3 7.20E-10 R FNTANDDNVTQVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3831.3831.2.dta 100 1 IPI00414458.3 Isoform 1 of Uncharacterized protein C10orf119 111 73789 3 3 3 3 2844 2351 1 1 1 568.2768 1134.539 2 1134.5417 -0.0027 0 42.91 0.00024 K EAYVNANQAR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2622.2622.2.dta 100 1 IPI00414458.3 Isoform 1 of Uncharacterized protein C10orf119 111 73789 3 3 3 3 3161 2570 1 1 1 591.2972 1180.5798 2 1180.5724 0.0074 0 17.7 0.022 R VSPSTSYTPSR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2859.2859.2.dta 100 1 IPI00414458.3 Isoform 1 of Uncharacterized protein C10orf119 111 73789 3 3 3 3 4777 4651 1 1 1 697.3576 1392.7007 2 1392.7031 -0.0025 0 85.93 1.30E-08 R CLSLSAGQTTLSR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5149.5149.2.dta 100 IPI00478758.1 74 kDa protein 87 74389 2 2 2 2 3161 2570 1 0 1 591.2972 1180.5798 2 1180.5724 0.0074 0 17.7 0.022 R VSPSTSYTPSR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2859.2859.2.dta 100 IPI00478758.1 74 kDa protein 87 74389 2 2 2 2 4777 4651 1 0 1 697.3576 1392.7007 2 1392.7031 -0.0025 0 85.93 1.30E-08 R CLSLSAGQTTLSR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5149.5149.2.dta 101 1 IPI00002214.1 Importin alpha-2 subunit 110 58168 4 4 4 4 4275 4551 1 1 1 441.586 1321.7363 3 1321.7354 0.0009 1 27.26 0.0028 R EKQPPIDNIIR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5041.5041.3.dta 101 1 IPI00002214.1 Importin alpha-2 subunit 110 58168 4 4 4 4 4638 6827 1 1 1 689.3501 1376.6856 2 1376.6871 -0.0014 0 56.37 1.50E-05 R NLTWTLSNLCR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7361.7361.2.dta 101 1 IPI00002214.1 Importin alpha-2 subunit 110 58168 4 4 4 4 5727 7191 1 1 1 775.4687 1548.9229 2 1548.9239 -0.001 0 54.75 5.70E-06 K LLGASELPIVTPALR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7744.7744.2.dta 101 1 IPI00002214.1 Importin alpha-2 subunit 110 58168 4 4 4 4 8013 7933 1 1 1 729.0823 2184.2252 3 2184.2266 -0.0014 1 21.8 0.019 R NKNPAPPIDAVEQILPTLVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8563.8563.3.dta 101 IPI00374362.5 54 kDa protein 56 54140 1 1 1 1 4638 6827 1 0 1 689.3501 1376.6856 2 1376.6871 -0.0014 0 56.37 1.50E-05 R NITWTLSNLCR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7361.7361.2.dta 102 1 IPI00550689.3 UPF0027 protein C22orf28 110 55688 4 4 4 4 3443 4099 1 1 1 610.8117 1219.6089 2 1219.6084 0.0004 0 34.8 0.00097 R IASPEGQDYLK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4551.4551.2.dta 102 1 IPI00550689.3 UPF0027 protein C22orf28 110 55688 4 4 4 4 4701 6274 1 1 1 693.3325 1384.6505 2 1384.651 -0.0005 0 77.35 1.90E-07 R SYNDELQFLEK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6809.6809.2.dta 102 1 IPI00550689.3 UPF0027 protein C22orf28 110 55688 4 4 4 4 5139 5292 1 1 1 482.2845 1443.8317 3 1443.831 0.0007 0 31.11 0.0033 K QIGNVAALPGIVHR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5825.5825.3.dta 102 1 IPI00550689.3 UPF0027 protein C22orf28 110 55688 4 4 4 4 6271 5526 1 1 1 547.287 1638.8391 3 1638.8399 -0.0008 0 21.17 0.01 R GLGHQVATDALVAMEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6061.6061.3.dta 103 1 IPI00171542.3 "CDNA FLJ12549 fis, clone NT2RM4000689" 109 75810 2 2 2 2 3372 6257 1 1 1 604.3189 1206.6233 2 1206.6245 -0.0012 0 70.63 7.20E-07 K DVDVYSQILR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6791.6791.2.dta 103 1 IPI00171542.3 "CDNA FLJ12549 fis, clone NT2RM4000689" 109 75810 2 2 2 2 4130 2855 1 1 1 652.801 1303.5875 2 1303.5826 0.0049 0 58.26 3.80E-06 K EADASPASAGICR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3169.3169.2.dta 104 1 IPI00009505.1 Isoform 1 of Beta-2-syntrophin 106 58369 2 2 2 2 1797 7910 1 1 1 492.3161 982.6177 2 982.6175 0.0002 0 63.17 1.30E-06 K AGLVELLLR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8540.8540.2.dta 104 1 IPI00009505.1 Isoform 1 of Beta-2-syntrophin 106 58369 2 2 2 2 4457 5888 1 1 1 676.3459 1350.6772 2 1350.6779 -0.0007 0 62.56 5.40E-06 R SPSLGSDLTFATR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6423.6423.2.dta 104 IPI00216631.1 Isoform 2 of Beta-2-syntrophin 63 27717 1 1 1 1 1797 7910 1 0 1 492.3161 982.6177 2 982.6175 0.0002 0 63.17 1.30E-06 K AGLVELLLR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8540.8540.2.dta 105 1 IPI00004968.1 Pre-mRNA-processing factor 19 106 55603 5 5 5 5 1142 1584 1 1 1 437.7407 873.4669 2 873.4668 0.0001 0 20.75 0.036 R QQLQTTR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1788.1788.2.dta 105 1 IPI00004968.1 Pre-mRNA-processing factor 19 106 55603 5 5 5 5 1215 2890 1 1 1 445.7508 889.487 2 889.4869 0.0001 0 43.11 0.00075 K ATVLTTER K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3208.3208.2.dta 105 1 IPI00004968.1 Pre-mRNA-processing factor 19 106 55603 5 5 5 5 1823 1659 1 1 1 494.7927 987.5709 2 987.5713 -0.0004 1 35.97 0.00043 R LTKEVTAAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1869.1869.2.dta 105 1 IPI00004968.1 Pre-mRNA-processing factor 19 106 55603 5 5 5 5 4266 5532 1 1 1 660.8428 1319.671 2 1319.6721 -0.0011 0 66.77 4.80E-06 K TLQLDNNFEVK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6068.6068.2.dta 105 1 IPI00004968.1 Pre-mRNA-processing factor 19 106 55603 5 5 5 5 5901 4720 1 1 1 525.9629 1574.8668 3 1574.8668 0 1 17.64 0.022 K ILTGGADKNVVVFDK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5224.5224.3.dta 106 1 IPI00012998.2 Isoform 1 of Cleavage and polyadenylation specificity factor 6 106 59344 2 2 2 2 641 1034 1 1 1 393.1989 784.3833 2 784.3828 0.0006 0 33.01 0.0025 K AGPPGGSSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1193.1193.2.dta 106 1 IPI00012998.2 Isoform 1 of Cleavage and polyadenylation specificity factor 6 106 59344 2 2 2 2 4170 5569 1 1 1 654.8436 1307.6726 2 1307.6721 0.0004 0 92.14 2.70E-09 K GFALVGVGSEASSK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6104.6104.2.dta 106 IPI00647126.1 Isoform 3 of Cleavage and polyadenylation specificity factor 6 92 52465 1 1 1 1 4170 5569 1 0 1 654.8436 1307.6726 2 1307.6721 0.0004 0 92.14 2.70E-09 K GFALVGVGSEASSK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6104.6104.2.dta 107 1 IPI00300659.4 Parafibromin 105 60653 3 3 3 3 2504 5178 1 1 1 542.3118 1082.6091 2 1082.6084 0.0007 0 61.12 4.00E-06 R SAPLEIGLQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5709.5709.2.dta 107 1 IPI00300659.4 Parafibromin 105 60653 3 3 3 3 2825 8023 1 1 1 566.8397 1131.6648 2 1131.6652 -0.0004 0 44.96 6.10E-05 K NIFAILQSVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8653.8653.2.dta 107 1 IPI00300659.4 Parafibromin 105 60653 3 3 3 3 6822 2963 1 1 1 579.647 1735.9191 3 1735.9217 -0.0026 1 32.02 0.00099 R LEGHKEGIVQTEQIR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3289.3289.3.dta 108 1 IPI00032258.4 Complement C4-A precursor 99 194247 3 3 3 3 281 2636 1 1 1 346.198 690.3814 2 690.3813 0.0001 0 28.83 0.028 R IQQFR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2931.2931.2.dta 108 1 IPI00032258.4 Complement C4-A precursor 99 194247 3 3 3 3 4564 8524 1 1 1 684.364 1366.7134 2 1366.7133 0.0001 0 54.02 4.00E-05 R DSSTWLTAFVLK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.9149.9149.2.dta 108 1 IPI00032258.4 Complement C4-A precursor 99 194247 3 3 3 3 5680 4412 1 1 1 771.4109 1540.8072 2 1540.8097 -0.0025 0 63.85 3.80E-06 K VLSLAQEQVGGSPEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4890.4890.2.dta 108 IPI00418163.3 complement component 4B preproprotein 69 194170 2 2 2 2 281 2636 1 0 1 346.198 690.3814 2 690.3813 0.0001 0 28.83 0.028 R IQQFR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2931.2931.2.dta 108 IPI00418163.3 complement component 4B preproprotein 69 194170 2 2 2 2 5680 4412 1 0 1 771.4109 1540.8072 2 1540.8097 -0.0025 0 63.85 3.80E-06 K VLSLAQEQVGGSPEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4890.4890.2.dta 109 1 IPI00029764.1 Splicing factor 3A subunit 3 98 59154 4 4 4 4 980 3630 1 1 1 423.2055 844.3965 2 844.398 -0.0016 0 31.72 0.01 R HFAEWR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4039.4039.2.dta 109 1 IPI00029764.1 Splicing factor 3A subunit 3 98 59154 4 4 4 4 1428 2133 1 1 1 462.7428 923.4711 2 923.4712 -0.0001 1 25.06 0.015 K TYEDLKR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2385.2385.2.dta 109 1 IPI00029764.1 Splicing factor 3A subunit 3 98 59154 4 4 4 4 2832 1173 1 1 1 567.2933 1132.572 2 1132.5737 -0.0018 0 39.07 0.00084 R HLTHENVQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1344.1344.2.dta 109 1 IPI00029764.1 Splicing factor 3A subunit 3 98 59154 4 4 4 4 4182 6791 1 1 1 655.8459 1309.6773 2 1309.6765 0.0008 0 62.9 1.50E-06 K SLESLDTSLFAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7327.7327.2.dta 110 1 IPI00300053.3 Keratin type II cuticular Hb2 95 58015 2 2 2 2 2156 3117 1 1 1 519.7462 1037.4778 2 1037.4778 0 0 63.48 4.30E-06 K AQYDDIASR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3455.3455.2.dta 110 1 IPI00300053.3 Keratin type II cuticular Hb2 95 58015 2 2 2 2 2396 5235 1 1 1 536.3048 1070.5951 2 1070.5971 -0.0021 0 55.11 5.00E-05 K LAGLEEALQK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5768.5768.2.dta 111 1 IPI00554786.3 Thioredoxin reductase 1 95 71497 5 5 5 5 2199 4062 1 1 1 522.3263 1042.638 2 1042.6386 -0.0006 1 31.17 0.0029 R KIGLETVGVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4511.4511.2.dta 111 1 IPI00554786.3 Thioredoxin reductase 1 95 71497 5 5 5 5 3820 1416 1 1 1 631.8106 1261.6067 2 1261.6085 -0.0018 1 43.62 8.10E-05 K IICNTKDNER V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1607.1607.2.dta 111 1 IPI00554786.3 Thioredoxin reductase 1 95 71497 5 5 5 5 6290 7703 1 1 1 823.4532 1644.8919 2 1644.8909 0.001 0 37.16 0.00033 K VMVLDFVTPTPLGTR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8324.8324.2.dta 111 1 IPI00554786.3 Thioredoxin reductase 1 95 71497 5 5 5 5 6884 5124 1 1 1 583.9613 1748.8621 3 1748.8634 -0.0014 0 15.72 0.039 K VVYENAYGQFIGPHR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5654.5654.3.dta 111 1 IPI00554786.3 Thioredoxin reductase 1 95 71497 5 5 5 5 7413 5452 1 1 1 623.6783 1868.013 3 1868.0156 -0.0026 1 28.84 0.0025 R QFVPIKVEQIEAGTPGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5989.5989.3.dta 111 IPI00816299.1 "CDNA FLJ46672 fis, clone TRACH3009008, highly similar to Thioredoxin reductase" 73 64722 4 4 4 4 2199 4062 1 0 1 522.3263 1042.638 2 1042.6386 -0.0006 1 31.17 0.0029 R KIGLETVGVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4511.4511.2.dta 111 IPI00816299.1 "CDNA FLJ46672 fis, clone TRACH3009008, highly similar to Thioredoxin reductase" 73 64722 4 4 4 4 3820 1416 1 0 1 631.8106 1261.6067 2 1261.6085 -0.0018 1 43.62 8.10E-05 K IICNTKDNER V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1607.1607.2.dta 111 IPI00816299.1 "CDNA FLJ46672 fis, clone TRACH3009008, highly similar to Thioredoxin reductase" 73 64722 4 4 4 4 6884 5124 1 0 1 583.9613 1748.8621 3 1748.8634 -0.0014 0 15.72 0.039 K VVYENAYGQFIGPHR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5654.5654.3.dta 111 IPI00816299.1 "CDNA FLJ46672 fis, clone TRACH3009008, highly similar to Thioredoxin reductase" 73 64722 4 4 4 4 7413 5452 1 0 1 623.6783 1868.013 3 1868.0156 -0.0026 1 28.84 0.0025 R QFVPIKVEQIEAGTPGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5989.5989.3.dta 111 IPI00793928.1 20 kDa protein 38 20174 2 2 2 2 6290 7703 1 0 1 823.4532 1644.8919 2 1644.8909 0.001 0 37.16 0.00033 K VMVLDFVTPTPLGTR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8324.8324.2.dta 111 IPI00793928.1 20 kDa protein 38 20174 2 2 2 2 6884 5124 1 0 1 583.9613 1748.8621 3 1748.8634 -0.0014 0 15.72 0.039 K VVYENAYGQFIGPHR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5654.5654.3.dta 112 1 IPI00029697.2 exosome component 9 isoform 1 92 51398 2 2 2 2 3624 5512 1 1 1 620.3073 1238.6 2 1238.6044 -0.0044 0 65.56 4.80E-06 K FGFAESIANQR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6048.6048.2.dta 112 1 IPI00029697.2 exosome component 9 isoform 1 92 51398 2 2 2 2 4922 5001 1 1 1 708.3799 1414.7453 2 1414.749 -0.0037 0 46.7 4.20E-05 R VLGQVSCELVSPK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5528.5528.2.dta 112 IPI00607722.1 Hypothetical protein PMSCL1 66 39609 1 1 1 1 3624 5512 1 0 1 620.3073 1238.6 2 1238.6044 -0.0044 0 65.56 4.80E-06 K FGFAESIANQR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6048.6048.2.dta 113 1 IPI00013256.1 Isoform 1 of Cleavage stimulation factor 64 kDa subunit 92 61035 3 3 3 3 1894 5214 1 1 1 499.3 996.5855 2 996.5855 0 0 23.05 0.0098 R IVDPEIALK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5745.5745.2.dta 113 1 IPI00013256.1 Isoform 1 of Cleavage stimulation factor 64 kDa subunit 92 61035 3 3 3 3 4076 2580 1 1 1 651.3162 1300.6179 2 1300.6194 -0.0015 0 53.38 6.40E-05 K LCVQNSPQEAR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2870.2870.2.dta 113 1 IPI00013256.1 Isoform 1 of Cleavage stimulation factor 64 kDa subunit 92 61035 3 3 3 3 4918 5678 1 1 1 707.8799 1413.7452 2 1413.7464 -0.0012 0 57.15 2.00E-05 R GGTLLSVTGEVEPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6213.6213.2.dta 113 IPI00550906.6 "Cleavage stimulation factor 64 kDa subunit, tau variant" 57 64624 1 1 1 1 4918 5678 1 0 1 707.8799 1413.7452 2 1413.7464 -0.0012 0 57.15 2.00E-05 R GGTLLSVTGEVEPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6213.6213.2.dta 114 1 IPI00045207.2 BTB/POZ domain-containing protein 14B 92 57906 2 2 2 2 1710 6851 1 1 1 484.7637 967.5129 2 967.5127 0.0001 0 48.16 0.00027 R LLASFFDR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7385.7385.2.dta 114 1 IPI00045207.2 BTB/POZ domain-containing protein 14B 92 57906 2 2 2 2 3828 3009 1 1 1 632.3099 1262.6053 2 1262.6037 0.0016 0 65.07 9.80E-07 R NTLANSCGTGIR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3339.3339.2.dta 114 IPI00059930.1 BTB/POZ domain-containing protein 14A 65 63538 1 1 1 1 3828 3009 1 0 1 632.3099 1262.6053 2 1262.6037 0.0016 0 65.07 9.80E-07 R NTLANSCGTGIR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3339.3339.2.dta 115 1 IPI00248395.7 similar to PR domain zinc finger protein 6 92 68087 3 3 3 3 2873 3693 1 1 1 569.7992 1137.5838 2 1137.5778 0.006 0 56.11 5.20E-05 R SFTQATQLSR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4109.4109.2.dta 115 1 IPI00248395.7 similar to PR domain zinc finger protein 6 92 68087 3 3 3 3 3918 4515 1 1 1 639.3182 1276.6218 2 1276.6234 -0.0016 0 22.43 0.015 R SVVFPQTPCSR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5002.5002.2.dta 115 1 IPI00248395.7 similar to PR domain zinc finger protein 6 92 68087 3 3 3 3 4703 4602 1 1 1 693.356 1384.6975 2 1384.7021 -0.0046 0 54.95 1.30E-05 K ELCLGATSGPGPVK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5096.5096.2.dta 115 IPI00218376.1 Isoform B of PR domain zinc finger protein 6 (Fragment) 55 33474 1 1 1 1 4703 4602 1 0 1 693.356 1384.6975 2 1384.7021 -0.0046 0 54.95 1.30E-05 K ELCLGATSGPGPVK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5096.5096.2.dta 116 1 IPI00029629.3 Tripartite motif-containing protein 25 92 72597 3 3 3 3 1405 5564 1 1 1 460.7761 919.5377 2 919.5379 -0.0002 0 30.38 0.0026 K VLETFLAK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6099.6099.2.dta 116 1 IPI00029629.3 Tripartite motif-containing protein 25 92 72597 3 3 3 3 3715 8116 1 1 1 627.3599 1252.7053 2 1252.7067 -0.0014 0 20.42 0.012 K FDTIYQILLK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8745.8745.2.dta 116 1 IPI00029629.3 Tripartite motif-containing protein 25 92 72597 3 3 3 3 5592 7071 1 1 1 764.424 1526.8335 2 1526.8344 -0.001 0 77.81 2.30E-07 K LPTFGAPEQLVDLK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7615.7615.2.dta 117 1 IPI00413895.2 "Golgi autoantigen, golgin subfamily A member 2" 92 113644 2 2 2 2 2123 2342 1 1 1 516.7876 1031.5606 2 1031.5611 -0.0005 0 51.75 0.00019 R ALSAVSTQQK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2612.2612.2.dta 117 1 IPI00413895.2 "Golgi autoantigen, golgin subfamily A member 2" 92 113644 2 2 2 2 3475 7769 1 1 1 613.3786 1224.7427 2 1224.7441 -0.0015 0 61.62 1.40E-06 K LLELQELVLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8394.8394.2.dta 117 IPI00470416.2 "Isoform 2 of Poly(A) RNA polymerase, mitochondrial precursor" 62 79639 1 1 1 1 3475 7769 1 0 1 613.3786 1224.7427 2 1224.7441 -0.0015 0 61.62 1.40E-06 K LLELQELVLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8394.8394.2.dta 118 1 IPI00025244.1 Zinc-finger protein ZPR1 92 51463 1 1 1 1 3508 6889 1 1 1 615.8562 1229.6979 2 1229.698 -0.0001 0 91.64 9.80E-09 K GALTTVEGLITR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7423.7423.2.dta 119 1 IPI00299095.2 Sorting nexin-2 91 58549 1 1 1 1 4580 5459 1 1 1 685.8899 1369.7652 2 1369.7677 -0.0025 0 91.49 7.60E-09 R AVNTQALSGAGILR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5995.5995.2.dta 120 1 IPI00303292.1 Importin alpha-1 subunit 90 60952 3 3 3 3 634 5875 1 1 0 391.7262 781.4379 2 781.4374 0.0005 0 24.4 0.048 R FVEFLK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6410.6410.2.dta 120 1 IPI00303292.1 Importin alpha-1 subunit 90 60952 3 3 3 3 4115 6586 1 1 1 652.3322 1302.6498 2 1302.6503 -0.0005 0 55.95 5.70E-06 R NAVWALSNLCR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7120.7120.2.dta 120 1 IPI00303292.1 Importin alpha-1 subunit 90 60952 3 3 3 3 5943 5932 1 1 1 796.8771 1591.7396 2 1591.7413 -0.0017 0 46.2 4.70E-05 K EACWTISNITAGNR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6466.6466.2.dta 120 IPI00413214.3 karyopherin alpha 5 56 61369 1 1 1 1 4115 6586 1 0 1 652.3322 1302.6498 2 1302.6503 -0.0005 0 55.95 5.70E-06 R NAVWALSNLCR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7120.7120.2.dta 121 1 IPI00013881.6 Heterogeneous nuclear ribonucleoprotein H 88 49484 2 2 2 2 6542 3153 1 1 1 562.2611 1683.7615 3 1683.7601 0.0014 0 34.01 0.00079 K HTGPNSPDTANDGFVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3494.3494.3.dta 121 1 IPI00013881.6 Heterogeneous nuclear ribonucleoprotein H 88 49484 2 2 2 2 7256 7005 1 1 1 921.4478 1840.8811 2 1840.8843 -0.0032 0 72.98 3.80E-07 R STGEAFVQFASQEIAEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7541.7541.2.dta 122 1 IPI00006181.1 Eukaryotic translation initiation factor 3 subunit 7 87 64560 5 5 4 4 292 2818 1 1 1 347.6988 693.383 2 693.381 0.002 0 27.92 0.027 K LGYVSR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3129.3129.2.dta 122 1 IPI00006181.1 Eukaryotic translation initiation factor 3 subunit 7 87 64560 5 5 4 4 293 2828 1 1 1 347.6995 693.3844 2 693.381 0.0035 0 26.17 0.04 K LGYVSR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3140.3140.2.dta 122 1 IPI00006181.1 Eukaryotic translation initiation factor 3 subunit 7 87 64560 5 5 4 4 2060 4018 1 1 1 510.7403 1019.466 2 1019.4672 -0.0012 0 33.32 0.0017 K TLNEWDSR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4463.4463.2.dta 122 1 IPI00006181.1 Eukaryotic translation initiation factor 3 subunit 7 87 64560 5 5 4 4 5476 3895 1 1 1 754.4061 1506.7976 2 1506.8042 -0.0066 1 52.61 4.90E-05 R GAVIATELKNNSYK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4330.4330.2.dta 122 1 IPI00006181.1 Eukaryotic translation initiation factor 3 subunit 7 87 64560 5 5 4 4 5487 3656 1 1 1 755.8679 1509.7213 2 1509.7212 0.0001 1 33.84 0.0016 K VADWTGATYQDKR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4067.4067.2.dta 122 IPI00789582.1 20 kDa protein 73 20111 4 4 3 3 292 2818 1 0 1 347.6988 693.383 2 693.381 0.002 0 27.92 0.027 K LGYVSR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3129.3129.2.dta 122 IPI00789582.1 20 kDa protein 73 20111 4 4 3 3 293 2828 1 0 1 347.6995 693.3844 2 693.381 0.0035 0 26.17 0.04 K LGYVSR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3140.3140.2.dta 122 IPI00789582.1 20 kDa protein 73 20111 4 4 3 3 2060 4018 1 0 1 510.7403 1019.466 2 1019.4672 -0.0012 0 33.32 0.0017 K TLNEWDSR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4463.4463.2.dta 122 IPI00789582.1 20 kDa protein 73 20111 4 4 3 3 5476 3895 1 0 1 754.4061 1506.7976 2 1506.8042 -0.0066 1 52.61 4.90E-05 R GAVIATELKNNSYK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4330.4330.2.dta 122 IPI00790420.1 18 kDa protein 34 18079 1 1 1 1 5487 3656 1 0 1 755.8679 1509.7213 2 1509.7212 0.0001 1 33.84 0.0016 K VADWTGATYQDKR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4067.4067.2.dta 122 IPI00788906.1 18 kDa protein 33 18131 1 1 1 1 2060 4018 1 0 1 510.7403 1019.466 2 1019.4672 -0.0012 0 33.32 0.0017 K TLNEWDSR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4463.4463.2.dta 123 1 IPI00037599.3 Isoform 1 of Alpha-globin transcription factor CP2 86 57676 1 1 1 1 4290 7105 1 1 1 663.3586 1324.7026 2 1324.7027 -0.0001 0 85.93 3.80E-08 R LFTNFSGADLLK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7651.7651.2.dta 124 1 IPI00024403.1 Copine-3 84 60947 2 2 2 2 2742 7301 1 1 0 560.811 1119.6074 2 1119.6077 -0.0003 0 40.43 0.00032 R DIVQFVPFR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7865.7865.2.dta 124 1 IPI00024403.1 Copine-3 84 60947 2 2 2 2 5094 4819 1 1 1 719.8283 1437.6421 2 1437.6446 -0.0025 0 63.07 4.20E-06 R SSPVEFECINEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5331.5331.2.dta 124 2 IPI00030532.1 Copine-5 54 66319 2 2 2 2 2742 7301 1 0 0 560.811 1119.6074 2 1119.6077 -0.0003 0 40.43 0.00032 R DIVQFVPFR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7865.7865.2.dta 124 2 IPI00030532.1 Copine-5 54 66319 2 2 2 2 2911 7505 1 0 1 572.2951 1142.5757 2 1142.576 -0.0004 0 34.48 0.0036 K SDPFLVFYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8100.8100.2.dta 124 IPI00002657.1 Isoform 1 of Copine-7 40 71390 1 1 1 1 2742 7301 1 0 0 560.811 1119.6074 2 1119.6077 -0.0003 0 40.43 0.00032 R DIVQFVPFR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7865.7865.2.dta 124 IPI00180176.7 Copine-9 34 56569 1 1 1 1 2911 7505 1 0 1 572.2951 1142.5757 2 1142.576 -0.0004 0 34.48 0.0036 K SDPFLVFYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8100.8100.2.dta 125 1 IPI00000634.1 Coiled-coil domain-containing protein 6 83 66274 2 2 2 2 1994 1069 1 1 1 506.264 1010.5135 2 1010.5145 -0.001 0 24.49 0.005 R AAQLQHSEK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1231.1231.2.dta 125 1 IPI00000634.1 Coiled-coil domain-containing protein 6 83 66274 2 2 2 2 6543 7060 1 1 1 842.9064 1683.7982 2 1683.7991 -0.001 0 75.4 1.40E-07 R AEQEEEFISNTLFK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7603.7603.2.dta 126 1 IPI00306043.1 Isoform 1 of YTH domain family protein 2 83 62467 1 1 1 1 3283 3308 1 1 1 601.324 1200.6334 2 1200.635 -0.0016 0 83.11 6.00E-08 K LGSTEVASNVPK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3683.3683.2.dta 127 1 IPI00306398.6 NudC domain containing 1 83 67546 2 2 2 2 824 5541 1 1 1 411.26 820.5055 2 820.5058 -0.0004 0 21.33 0.015 R LFVLTTK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6076.6076.2.dta 127 1 IPI00306398.6 NudC domain containing 1 83 67546 2 2 2 2 3207 2699 1 1 1 596.274 1190.5334 2 1190.535 -0.0015 0 80.26 7.10E-08 R DSAQCAAIAER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3000.3000.2.dta 128 1 IPI00394676.1 Isoform 1 of Negative elongation factor A 82 59722 2 2 2 2 3031 1600 1 1 1 581.3143 1160.614 2 1160.6149 -0.0009 1 55.31 2.90E-05 K STETAQQLKR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1805.1805.2.dta 128 1 IPI00394676.1 Isoform 1 of Negative elongation factor A 82 59722 2 2 2 2 4931 4568 1 1 1 709.3557 1416.6969 2 1416.6998 -0.0029 0 49.3 0.00014 R SPTAPSVFSPTGNR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5059.5059.2.dta 129 1 IPI00219913.10 Ubiquitin carboxyl-terminal hydrolase 14 82 56489 1 1 1 1 4587 6348 1 1 1 686.3893 1370.7641 2 1370.767 -0.0029 0 81.88 1.10E-07 K AQLFALTGVQPAR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6880.6880.2.dta 130 1 IPI00290142.5 CTP synthase 1 80 67332 3 3 3 3 1996 4702 1 1 1 506.3006 1010.5866 2 1010.5872 -0.0006 1 34.6 0.0027 R RLDLPIER Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5204.5204.2.dta 130 1 IPI00290142.5 CTP synthase 1 80 67332 3 3 3 3 2717 4893 1 1 1 558.7813 1115.5481 2 1115.5499 -0.0018 0 50.49 0.00017 K FSDSYASVIK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5411.5411.2.dta 130 1 IPI00290142.5 CTP synthase 1 80 67332 3 3 3 3 3962 6224 1 1 1 643.3499 1284.6853 2 1284.686 -0.0007 0 39.4 0.00088 R GLGLSPDLVVCR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6759.6759.2.dta 131 1 IPI00017375.1 Protein transport protein Sec23A 79 87004 3 3 3 3 35 3921 1 1 0 304.1942 606.3738 2 606.3741 -0.0003 0 24.93 0.036 R FLLSK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4358.4358.2.dta 131 1 IPI00017375.1 Protein transport protein Sec23A 79 87004 3 3 3 3 4134 1867 1 1 1 652.8396 1303.6646 2 1303.6633 0.0013 0 50.33 1.90E-05 R GPQVQQPPPSNR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2094.2094.2.dta 131 1 IPI00017375.1 Protein transport protein Sec23A 79 87004 3 3 3 3 5154 6017 1 1 1 724.3712 1446.7279 2 1446.7289 -0.001 0 42.17 0.00026 R AVLNPLCQVDYR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6551.6551.2.dta 131 IPI00792194.1 63 kDa protein 56 63574 2 2 2 2 35 3921 1 0 0 304.1942 606.3738 2 606.3741 -0.0003 0 24.93 0.036 R FLLSK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4358.4358.2.dta 131 IPI00792194.1 63 kDa protein 56 63574 2 2 2 2 4134 1867 1 0 1 652.8396 1303.6646 2 1303.6633 0.0013 0 50.33 1.90E-05 R GPQVQQPPPSNR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2094.2094.2.dta 131 IPI00017376.2 Protein transport protein Sec23B 46 87393 2 2 2 2 35 3921 1 0 0 304.1942 606.3738 2 606.3741 -0.0003 0 24.93 0.036 R FLLSK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4358.4358.2.dta 131 IPI00017376.2 Protein transport protein Sec23B 46 87393 2 2 2 2 5154 6017 1 0 1 724.3712 1446.7279 2 1446.7289 -0.001 0 42.17 0.00026 K AVLNPLCQVDYR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6551.6551.2.dta 132 1 IPI00019380.1 Nuclear cap-binding protein subunit 1 79 92864 1 1 1 1 3696 7198 1 1 1 625.8347 1249.6549 2 1249.6554 -0.0005 0 78.74 2.20E-07 K ATNDEIFSILK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7750.7750.2.dta 133 1 IPI00184330.5 DNA replication licensing factor MCM2 79 102516 1 1 1 1 4331 8803 1 1 1 666.3811 1330.7477 2 1330.7496 -0.002 0 78.7 1.70E-07 R DNNELLLFILK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.9435.9435.2.dta 134 1 IPI00303207.3 ATP-binding cassette sub-family E member 1 77 68240 3 3 3 3 2447 7647 1 1 1 539.2303 1076.446 2 1076.4451 0.0009 0 29.49 0.0017 K SGNYFFLDD - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8260.8260.2.dta 134 1 IPI00303207.3 ATP-binding cassette sub-family E member 1 77 68240 3 3 3 3 3356 6829 1 1 1 603.2764 1204.5382 2 1204.5401 -0.0019 1 24.29 0.0053 K KSGNYFFLDD - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7363.7363.2.dta 134 1 IPI00303207.3 ATP-binding cassette sub-family E member 1 77 68240 3 3 3 3 4222 4083 1 1 1 658.8254 1315.6362 2 1315.6368 -0.0006 0 56.84 1.80E-05 R NVEDLSGGELQR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4534.4534.2.dta 135 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 77 193260 4 4 4 4 846 5667 1 1 1 413.247 824.4794 2 824.4796 -0.0002 0 35.42 0.0036 R IAAYLFK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6202.6202.2.dta 135 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 77 193260 4 4 4 4 2677 8206 1 1 1 555.8364 1109.6583 2 1109.6597 -0.0014 0 24.75 0.017 K LLLPWLEAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8834.8834.2.dta 135 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 77 193260 4 4 4 4 4047 5371 1 1 1 648.838 1295.6614 2 1295.6622 -0.0009 0 45.08 5.90E-05 K LLYNNVSNFGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5905.5905.2.dta 135 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 77 193260 4 4 4 4 7724 5673 1 1 1 657.6813 1970.0222 3 1970.0221 0 0 26.71 0.0033 R LASTLVHLGEYQAAVDGAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6209.6209.3.dta 136 1 IPI00019502.3 Myosin-9 76 227646 2 2 2 2 4141 6310 1 1 1 653.3352 1304.6559 2 1304.6612 -0.0053 0 46.47 0.00053 K EQADFAIEALAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6843.6843.2.dta 136 1 IPI00019502.3 Myosin-9 76 227646 2 2 2 2 6783 7865 1 1 1 863.977 1725.9395 2 1725.9413 -0.0018 0 50.34 1.90E-05 R QLLQANPILEAFGNAK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8496.8496.2.dta 136 IPI00020501.1 Myosin-11 50 228054 1 1 1 1 6783 7865 1 0 1 863.977 1725.9395 2 1725.9413 -0.0018 0 50.34 1.90E-05 K QLLQANPILEAFGNAK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8496.8496.2.dta 137 1 IPI00101600.5 "CWF19-like 1, cell cycle control" 75 61322 3 3 3 3 3889 5486 1 1 1 636.8495 1271.6845 2 1271.6874 -0.0028 0 54.97 6.30E-05 R FIALANVGNPEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6021.6021.2.dta 137 1 IPI00101600.5 "CWF19-like 1, cell cycle control" 75 61322 3 3 3 3 4330 7629 1 1 1 666.3563 1330.6981 2 1330.6995 -0.0014 0 21.09 0.029 K YLYAFSIVPMK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8240.8240.2.dta 137 1 IPI00101600.5 "CWF19-like 1, cell cycle control" 75 61322 3 3 3 3 6286 2547 1 1 1 548.9564 1643.8473 3 1643.8492 -0.0019 0 38.04 0.00027 R NHIILQENAQHATR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2834.2834.3.dta 138 1 IPI00329629.6 DnaJ homolog subfamily C member 7 74 57203 2 2 2 2 4858 6473 1 1 1 703.3642 1404.7138 2 1404.7137 0.0002 0 42.62 0.0001 K EVGEAFTILSDPK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7004.7004.2.dta 138 1 IPI00329629.6 DnaJ homolog subfamily C member 7 74 57203 2 2 2 2 5346 3337 1 1 1 492.9228 1475.7465 3 1475.7481 -0.0015 1 51.85 0.0001 R FREALGDAQQSVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3715.3715.3.dta 138 IPI00794610.1 18 kDa protein 43 18026 1 1 1 1 4858 6473 1 0 1 703.3642 1404.7138 2 1404.7137 0.0002 0 42.62 0.0001 K EVGEAFTILSDPK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7004.7004.2.dta 139 1 IPI00294879.1 Ran GTPase-activating protein 1 73 63958 3 3 3 3 159 2784 1 1 1 324.6951 647.3757 2 647.3755 0.0002 0 24.48 0.044 K VFVAGR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3092.3092.2.dta 139 1 IPI00294879.1 Ran GTPase-activating protein 1 73 63958 3 3 3 3 2858 4413 1 1 1 568.3089 1134.6032 2 1134.6033 -0.0001 0 24.18 0.0092 K TQVAGGQLSFK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4891.4891.2.dta 139 1 IPI00294879.1 Ran GTPase-activating protein 1 73 63958 3 3 3 3 4871 5128 1 1 1 704.3579 1406.7013 2 1406.7041 -0.0029 0 63.53 2.20E-06 R VINLNDNTFTEK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5658.5658.2.dta 140 1 IPI00470649.3 Isoform 1 of Nicalin precursor 72 63106 1 1 1 1 5031 6035 1 1 1 717.3506 1432.6867 2 1432.6874 -0.0007 0 71.72 1.00E-06 R LLDFSYEQYQK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6570.6570.2.dta 141 1 IPI00016249.2 Isoform 1 of Fragile X mental retardation syndrome-related protein 1 71 69991 2 2 2 2 2011 4503 1 1 1 507.7825 1013.5505 2 1013.5505 -0.0001 0 42.9 0.00096 R LQIDEQLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4989.4989.2.dta 141 1 IPI00016249.2 Isoform 1 of Fragile X mental retardation syndrome-related protein 1 71 69991 2 2 2 2 7683 5719 1 1 1 650.0048 1946.9925 3 1946.9949 -0.0025 1 48.35 2.90E-05 R KVPGVTAIELDEDTGTFR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6254.6254.3.dta 141 IPI00016250.6 Fragile X mental retardation syndrome-related protein 2 43 77424 1 1 1 1 2011 4503 1 0 1 507.7825 1013.5505 2 1013.5505 -0.0001 0 42.9 0.00096 R LQIDEQLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4989.4989.2.dta 142 1 IPI00024642.2 Isoform 1 of Coiled-coil domain-containing protein 47 precursor 71 56123 3 3 3 3 506 1156 1 1 1 377.222 752.4294 2 752.4293 0.0001 0 42.89 0.00072 K LTHVQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1325.1325.2.dta 142 1 IPI00024642.2 Isoform 1 of Coiled-coil domain-containing protein 47 precursor 71 56123 3 3 3 3 2178 6695 1 1 1 521.3062 1040.5978 2 1040.5978 -0.0001 0 51.46 6.90E-05 R QDLLNVLAR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7231.7231.2.dta 142 1 IPI00024642.2 Isoform 1 of Coiled-coil domain-containing protein 47 precursor 71 56123 3 3 3 3 5566 1201 1 1 1 508.6057 1522.7953 3 1522.7964 -0.0011 1 15.49 0.035 K LTHVQRQEAAQSR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1374.1374.3.dta 142 IPI00385944.2 23 kDa protein 40 22702 2 2 2 2 506 1156 1 0 1 377.222 752.4294 2 752.4293 0.0001 0 42.89 0.00072 K LTHVQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1325.1325.2.dta 142 IPI00385944.2 23 kDa protein 40 22702 2 2 2 2 5566 1201 1 0 1 508.6057 1522.7953 3 1522.7964 -0.0011 1 15.49 0.035 K LTHVQRQEAAQSR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1374.1374.3.dta 143 1 IPI00046057.1 Isoform 2 of Syntaxin-binding protein 1 70 69091 1 1 1 1 3459 3665 1 1 1 612.814 1223.6134 2 1223.6146 -0.0012 0 70.32 1.50E-06 R ISEQTYQLSR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4077.4077.2.dta 144 1 IPI00179953.2 Isoform 1 of Nuclear autoantigenic sperm protein 70 85471 2 2 2 2 711 5653 1 1 1 401.245 800.4754 2 800.4756 -0.0002 0 37.08 0.0044 K SLLELAR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6188.6188.2.dta 144 1 IPI00179953.2 Isoform 1 of Nuclear autoantigenic sperm protein 70 85471 2 2 2 2 1933 4698 1 1 1 501.2846 1000.5546 2 1000.5553 -0.0007 0 58.09 2.20E-05 R SGNVAELALK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5200.5200.2.dta 144 IPI00646459.1 Nuclear autoantigenic sperm protein 58 45936 1 1 1 1 1933 4698 1 0 1 501.2846 1000.5546 2 1000.5553 -0.0007 0 58.09 2.20E-05 R SGNVAELALK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5200.5200.2.dta 144 IPI00514504.1 Nuclear autoantigenic sperm protein 37 29322 1 1 1 1 711 5653 1 0 1 401.245 800.4754 2 800.4756 -0.0002 0 37.08 0.0044 K SLLELAR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6188.6188.2.dta 145 1 IPI00239815.9 Isoform 1 of Cirhin 70 77526 3 3 3 3 468 6043 1 1 1 373.205 744.3955 2 744.3959 -0.0003 0 24.9 0.017 R FFLYR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6579.6579.2.dta 145 1 IPI00239815.9 Isoform 1 of Cirhin 70 77526 3 3 3 3 3461 1779 2 1 1 613.2736 1224.5327 2 1224.5305 0.0021 0 21.66 0.023 R CVAYNNQSNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1999.1999.2.dta 145 1 IPI00239815.9 Isoform 1 of Cirhin 70 77526 3 3 3 3 5098 7181 1 1 1 719.8739 1437.7333 2 1437.7351 -0.0019 0 64.86 4.70E-06 R SALQILFSEDSTK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7730.7730.2.dta 146 1 IPI00164672.6 mRNA decapping enzyme 1A 70 63568 4 4 4 4 5153 4484 1 1 1 483.2453 1446.7141 3 1446.7137 0.0004 1 19.39 0.019 K LMADVVEEETRR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4968.4968.3.dta 146 1 IPI00164672.6 mRNA decapping enzyme 1A 70 63568 4 4 4 4 5165 4664 1 1 1 483.5811 1447.7214 3 1447.7208 0.0006 0 38.54 0.00029 R SASPYHGFTIVNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5163.5163.3.dta 146 1 IPI00164672.6 mRNA decapping enzyme 1A 70 63568 4 4 4 4 5819 6907 1 1 1 524.2866 1569.838 3 1569.8403 -0.0022 0 39.94 0.00028 K HLTVEELFGTSLPK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7441.7441.3.dta 146 1 IPI00164672.6 mRNA decapping enzyme 1A 70 63568 4 4 4 4 6679 3222 1 1 1 568.64 1702.898 3 1702.9002 -0.0022 0 20.13 0.02 R LTPQHDQIQTQPLGK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3585.3585.3.dta 146 IPI00795655.1 9 kDa protein 40 9171 1 1 1 1 5819 6907 1 0 1 524.2866 1569.838 3 1569.8403 -0.0022 0 39.94 0.00028 K HLTVEELFGTSLPK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7441.7441.3.dta 147 1 IPI00644766.2 Torsin A interacting protein 1 70 47720 4 4 4 4 133 1717 2 1 1 319.7093 637.404 2 637.4024 0.0017 0 18.41 0.05 R RPPLR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1932.1932.2.dta 147 1 IPI00644766.2 Torsin A interacting protein 1 70 47720 4 4 4 4 2263 1871 1 1 1 527.2639 1052.5132 2 1052.5138 -0.0007 0 38.56 0.00024 R YEATSVQQK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2099.2099.2.dta 147 1 IPI00644766.2 Torsin A interacting protein 1 70 47720 4 4 4 4 3716 6990 1 1 1 627.3824 1252.7503 2 1252.7503 0.0001 0 39.15 0.00021 R SQPAILLLTAAR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7525.7525.2.dta 147 1 IPI00644766.2 Torsin A interacting protein 1 70 47720 4 4 4 4 3950 3751 1 1 1 642.8182 1283.6218 2 1283.6258 -0.004 0 20.08 0.013 K TPQEWAPQTAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4174.4174.2.dta 147 IPI00012280.3 Isoform 2 of Torsin-1A-interacting protein 1 40 43194 2 2 2 2 133 1717 2 0 1 319.7093 637.404 2 637.4024 0.0017 0 18.41 0.05 R RPPLR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1932.1932.2.dta 147 IPI00012280.3 Isoform 2 of Torsin-1A-interacting protein 1 40 43194 2 2 2 2 2263 1871 1 0 1 527.2639 1052.5132 2 1052.5138 -0.0007 0 38.56 0.00024 R YEATSVQQK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2099.2099.2.dta 148 1 IPI00007074.5 "Tyrosyl-tRNA synthetase, cytoplasmic" 70 59448 2 2 2 2 3361 4193 1 1 1 603.2975 1204.5804 2 1204.5837 -0.0032 0 38.82 0.0032 K VDAQFGGIDQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4653.4653.2.dta 148 1 IPI00007074.5 "Tyrosyl-tRNA synthetase, cytoplasmic" 70 59448 2 2 2 2 7906 4954 1 1 1 692.0234 2073.0485 3 2073.0531 -0.0046 0 51.85 1.40E-05 R QVEPLDPPAGSAPGEHVFVK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5478.5478.3.dta 149 1 IPI00031820.3 Phenylalanyl-tRNA synthetase alpha chain 69 57585 2 2 2 2 5413 3226 1 1 1 746.3753 1490.7361 2 1490.7365 -0.0004 0 41.96 0.00083 R LDAEPRPPPTQEAA - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3589.3589.2.dta 149 1 IPI00031820.3 Phenylalanyl-tRNA synthetase alpha chain 69 57585 2 2 2 2 5590 8405 1 1 1 764.4222 1526.8299 2 1526.8304 -0.0004 0 50.92 0.00011 K SLQALGEVIEAELR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.9030.9030.2.dta 150 1 IPI00411937.4 Nucleolar protein Nop56 67 66408 1 1 1 1 4632 5194 1 1 1 688.8731 1375.7317 2 1375.7347 -0.003 0 66.71 3.80E-06 K YPASTVQILGAEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5725.5725.2.dta 151 1 IPI00010948.2 Tripartite motif-containing protein 26 66 62925 1 1 1 1 3091 6966 1 1 1 586.3501 1170.6856 2 1170.686 -0.0003 0 66.5 2.10E-06 R LALVISELEGK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7501.7501.2.dta 152 1 IPI00011857.1 Chromatin assembly factor 1 subunit B 66 61910 1 1 1 1 3546 7639 1 1 1 616.8532 1231.6919 2 1231.6924 -0.0006 0 66.36 3.10E-06 K AIVEFLSNLAR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8253.8253.2.dta 153 1 IPI00021248.1 Serine/threonine-protein kinase PLK1 65 68953 2 2 2 2 6946 5820 1 1 1 881.9553 1761.8961 2 1761.8971 -0.001 0 42.48 0.00011 K TLCGTPNYIAPEVLSK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6355.6355.2.dta 153 1 IPI00021248.1 Serine/threonine-protein kinase PLK1 65 68953 2 2 2 2 7827 7763 1 1 1 1009.9796 2017.9447 2 2017.9455 -0.0008 0 37.83 0.00028 R QEEAEDPACIPIFWVSK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8388.8388.2.dta 154 1 IPI00412880.2 Isoform 1 of Histone-arginine methyltransferase CARM1 65 63989 5 5 5 5 808 1794 1 1 1 410.2014 818.3882 2 818.3882 0 0 36.37 0.0023 K SNNLTDR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2015.2015.2.dta 154 1 IPI00412880.2 Isoform 1 of Histone-arginine methyltransferase CARM1 65 63989 5 5 5 5 3389 7034 1 1 1 605.8188 1209.623 2 1209.6216 0.0014 0 33.31 0.0073 R CLFQSPLFAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7574.7574.2.dta 154 1 IPI00412880.2 Isoform 1 of Histone-arginine methyltransferase CARM1 65 63989 5 5 5 5 5731 7218 1 1 1 517.6154 1549.8244 3 1549.8253 -0.0008 1 22.45 0.048 K SSNLLDLKNPFFR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7773.7773.3.dta 154 1 IPI00412880.2 Isoform 1 of Histone-arginine methyltransferase CARM1 65 63989 5 5 5 5 6563 5087 1 1 1 563.9711 1688.8916 3 1688.8879 0.0036 1 28.42 0.016 K AGDTLSGTCLLIANKR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5617.5617.3.dta 154 1 IPI00412880.2 Isoform 1 of Histone-arginine methyltransferase CARM1 65 63989 5 5 5 5 8025 6854 1 1 1 733.3672 2197.0797 3 2197.0804 -0.0007 1 28.83 0.002 R GAAVDEYFRQPVVDTFDIR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7388.7388.3.dta 154 IPI00514607.1 Isoform 2 of Histone-arginine methyltransferase CARM1 47 45458 2 2 2 2 808 1794 1 0 1 410.2014 818.3882 2 818.3882 0 0 36.37 0.0023 K SNNLTDR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2015.2015.2.dta 154 IPI00514607.1 Isoform 2 of Histone-arginine methyltransferase CARM1 47 45458 2 2 2 2 8025 6854 1 0 1 733.3672 2197.0797 3 2197.0804 -0.0007 1 28.83 0.002 R GAAVDEYFRQPVVDTFDIR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7388.7388.3.dta 155 1 IPI00101645.3 Putative adenosylhomocysteinase 3 65 67705 2 2 2 2 2384 1505 1 1 1 535.3036 1068.5926 2 1068.5927 -0.0001 0 21.92 0.0088 R AQGEKPLAGAK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1702.1702.2.dta 155 1 IPI00101645.3 Putative adenosylhomocysteinase 3 65 67705 2 2 2 2 3943 3715 1 1 1 641.841 1281.6675 2 1281.6677 -0.0003 0 61.61 1.10E-05 K GIVEESVTGVHR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4134.4134.2.dta 155 IPI00441992.1 "CDNA FLJ16815 fis, clone THYMU3044175, highly similar to Adenosylhomocysteinase" 62 36248 1 1 1 1 3943 3715 1 0 1 641.841 1281.6675 2 1281.6677 -0.0003 0 61.61 1.10E-05 R GIVEESVTGVHR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4134.4134.2.dta 156 1 IPI00293655.3 ATP-dependent RNA helicase DDX1 64 83349 1 1 1 1 4702 988 1 1 1 693.3416 1384.6686 2 1384.6695 -0.001 0 63.7 1.10E-06 K SQHSGNAQVTQTK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1144.1144.2.dta 157 1 IPI00418169.3 annexin A2 isoform 1 63 40671 1 1 1 1 5688 7809 1 1 1 771.9268 1541.8391 2 1541.8413 -0.0022 0 63.14 7.00E-06 K GVDEVTIVNILTNR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8434.8434.2.dta 158 1 IPI00017367.5 Radixin 63 68635 2 2 2 2 1233 7234 1 1 1 447.7761 893.5376 2 893.5375 0.0001 0 30.66 0.0058 R LFFLQVK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7789.7789.2.dta 158 1 IPI00017367.5 Radixin 63 68635 2 2 2 2 2631 7360 1 1 1 552.7949 1103.5753 2 1103.5764 -0.0011 0 56.3 6.70E-05 K IGFPWSEIR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7938.7938.2.dta 158 IPI00384282.1 Cytovillin 2 (Fragment) 56 16294 1 1 1 1 2631 7360 1 0 1 552.7949 1103.5753 2 1103.5764 -0.0011 0 56.3 6.70E-05 K IGFPWSEIR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7938.7938.2.dta 159 1 IPI00027497.5 Glucose-6-phosphate isomerase 63 63335 4 4 3 3 668 5100 1 1 1 395.2303 788.4461 2 788.4466 -0.0004 0 28.7 0.031 R MLVDLAK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5630.5630.2.dta 159 1 IPI00027497.5 Glucose-6-phosphate isomerase 63 63335 4 4 3 3 5973 5382 1 1 1 534.9479 1601.822 3 1601.8202 0.0018 0 20.89 0.011 R VWYVSNIDGTHIAK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5917.5917.3.dta 159 1 IPI00027497.5 Glucose-6-phosphate isomerase 63 63335 4 4 3 3 7200 7707 1 1 1 611.3427 1831.0063 3 1831.0091 -0.0028 0 25.02 0.0045 K TLAQLNPESSLFIIASK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8329.8329.3.dta 159 1 IPI00027497.5 Glucose-6-phosphate isomerase 63 63335 4 4 3 3 7201 7695 1 1 1 916.5109 1831.0072 2 1831.0091 -0.0019 0 39.79 0.00019 K TLAQLNPESSLFIIASK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8317.8317.2.dta 159 IPI00556013.1 Glucose phosphate isomerase variant (Fragment) 29 56563 1 1 1 1 668 5100 1 0 1 395.2303 788.4461 2 788.4466 -0.0004 0 28.7 0.031 R MLVDLAK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5630.5630.2.dta 160 1 IPI00396370.5 Isoform 1 of Eukaryotic translation initiation factor 3 subunit 9 62 92833 1 1 1 1 5267 6913 1 1 1 734.3828 1466.751 2 1466.7518 -0.0008 0 62.14 1.50E-06 K GTQGVVTNFEIFR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7448.7448.2.dta 161 1 IPI00218830.1 Isoform Short of Glycylpeptide N-tetradecanoyltransferase 1 62 48338 1 1 1 1 4228 6297 1 1 1 658.8638 1315.713 2 1315.7136 -0.0006 0 61.96 9.00E-06 K AIELFSVGQGPAK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6830.6830.2.dta 162 1 IPI00017341.3 SF3A2 protein (Fragment) 62 51557 2 2 2 2 1706 631 1 1 1 323.1861 966.5366 3 966.5359 0.0007 1 30.41 0.0089 K KHQTNLAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1084.1084.3.dta 162 1 IPI00017341.3 SF3A2 protein (Fragment) 62 51557 2 2 2 2 4040 1252 1 1 1 648.2943 1294.5741 2 1294.5749 -0.0009 0 53.83 4.40E-05 K TGSGGVASSSESNR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1429.1429.2.dta 163 1 IPI00005578.1 EH domain-containing protein 4 59 61365 2 2 2 2 2174 4697 1 1 1 520.8085 1039.6024 2 1039.6026 -0.0002 0 17.47 0.026 K VINTPEVLR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5199.5199.2.dta 163 1 IPI00005578.1 EH domain-containing protein 4 59 61365 2 2 2 2 4595 4868 1 1 1 686.8608 1371.707 2 1371.7107 -0.0037 0 57 4.50E-06 R AGGADAVQTVTGGLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5384.5384.2.dta 163 IPI00384032.1 "CDNA FLJ90140 fis, clone HEMBB1001048, weakly similar to Human Hpast (HPAST) mRNA" 57 21201 1 1 1 1 4595 4868 1 0 1 686.8608 1371.707 2 1371.7107 -0.0037 0 57 4.50E-06 R AGGADAVQTVTGGLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5384.5384.2.dta 163 IPI00021458.1 EH domain-containing protein 3 17 61971 1 1 1 1 2174 4697 1 0 1 520.8085 1039.6024 2 1039.6026 -0.0002 0 17.47 0.026 K IVNTPEVIR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5199.5199.2.dta 164 1 IPI00006612.2 Isoform 1 of Clathrin coat assembly protein AP180 59 92672 1 1 1 1 4984 8076 1 1 1 713.3716 1424.7287 2 1424.73 -0.0012 0 58.82 2.70E-05 R NTLFNLSNFLDK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8706.8706.2.dta 165 1 IPI00102936.3 Isoform 2 of Signal recognition particle 68 kDa protein 59 67775 2 2 2 2 5583 7713 1 1 1 763.4135 1524.8125 2 1524.8148 -0.0023 0 33.03 0.0031 K DLPDVQELITQVR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8336.8336.2.dta 165 1 IPI00102936.3 Isoform 2 of Signal recognition particle 68 kDa protein 59 67775 2 2 2 2 5758 7035 1 1 1 778.8865 1555.7584 2 1555.7592 -0.0009 0 47.17 0.00021 R FETFCLDPSLVTK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7575.7575.2.dta 165 IPI00386885.1 "CDNA FLJ14414 fis, clone HEMBA1004847, highly similar to SIGNAL RECOGNITION PARTICLE 68 KD PROTEIN" 33 37365 1 1 1 1 5583 7713 1 0 1 763.4135 1524.8125 2 1524.8148 -0.0023 0 33.03 0.0031 K DLPDVQELITQVR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8336.8336.2.dta 166 1 IPI00219919.1 53 kDa protein 59 53600 1 1 1 1 4004 3135 1 1 1 645.3378 1288.661 2 1288.6623 -0.0013 0 58.58 1.20E-05 K LITAADTTAEQR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3475.3475.2.dta 167 1 IPI00164949.3 Isoform NELF-C of Negative elongation factor C/D 58 66832 1 1 1 1 6561 6953 1 1 1 845.4293 1688.8441 2 1688.8468 -0.0027 0 58.48 2.10E-05 R TSLATILDGGEENLEK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7488.7488.2.dta 168 1 IPI00007935.4 PDZ and LIM domain protein 5 58 65129 1 1 1 1 1276 6413 1 1 1 451.2788 900.5431 2 900.5433 -0.0002 0 57.74 1.30E-05 R GPFLVALGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6945.6945.2.dta 169 1 IPI00292000.6 Isoform 1 of U4/U6 small nuclear ribonucleoprotein Prp31 57 55649 4 4 4 4 1465 3718 1 1 1 310.531 928.5711 3 928.5705 0.0006 1 28.54 0.011 R LGLTEIRK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4137.4137.3.dta 169 1 IPI00292000.6 Isoform 1 of U4/U6 small nuclear ribonucleoprotein Prp31 57 55649 4 4 4 4 3451 7112 1 1 1 611.7943 1221.5741 2 1221.574 0.0001 0 27.63 0.0026 K YFSSMAEFLK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7658.7658.2.dta 169 1 IPI00292000.6 Isoform 1 of U4/U6 small nuclear ribonucleoprotein Prp31 57 55649 4 4 4 4 3898 1332 1 1 1 637.3463 1272.678 2 1272.6786 -0.0006 1 33.5 0.00072 R VRQTQVNEATK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1516.1516.2.dta 169 1 IPI00292000.6 Isoform 1 of U4/U6 small nuclear ribonucleoprotein Prp31 57 55649 4 4 4 4 8806 7559 1 1 1 868.1165 2601.3275 3 2601.3286 -0.0011 0 14.28 0.046 R SSGTASSVAFTPLQGLEIVNPQAAEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8160.8160.3.dta 170 1 IPI00029079.5 GMP synthase 56 77408 3 3 3 3 1858 2186 1 1 1 331.5392 991.5959 3 991.5927 0.0032 0 20.57 0.026 K KPHTLLQR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2443.2443.3.dta 170 1 IPI00029079.5 GMP synthase 56 77408 3 3 3 3 3635 6355 1 1 1 621.3389 1240.6632 2 1240.6663 -0.0031 0 48.24 0.00022 R ELGLPEELVSR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6888.6888.2.dta 170 1 IPI00029079.5 GMP synthase 56 77408 3 3 3 3 8694 6277 1 1 1 851.7493 2552.2262 3 2552.2291 -0.0029 1 24.02 0.0056 R VICAEEPYICKDFPETNNILK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6811.6811.3.dta 171 1 IPI00220637.5 "Seryl-tRNA synthetase, cytoplasmic" 56 59253 2 2 2 2 1840 7517 1 1 1 495.7845 989.5544 2 989.5546 -0.0002 0 52.15 8.00E-05 M VLDLDLFR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8113.8113.2.dta 171 1 IPI00220637.5 "Seryl-tRNA synthetase, cytoplasmic" 56 59253 2 2 2 2 2088 6802 1 1 1 514.3238 1026.633 2 1026.6325 0.0006 0 23.95 0.0081 R LLIDEAILK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7337.7337.2.dta 172 1 IPI00411531.3 Isoform 2 of General transcription factor 3C polypeptide 5 56 58686 1 1 1 1 7640 6217 1 1 1 965.4836 1928.9526 2 1928.9592 -0.0066 0 55.6 6.10E-06 R EGYNNPPISGENLIGLSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6751.6751.2.dta 173 1 IPI00179326.7 Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 1 55 57189 1 1 1 1 5984 2582 1 1 1 802.8785 1603.7424 2 1603.7438 -0.0014 0 54.9 1.40E-05 R VNNSTGTSEDPSLQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2872.2872.2.dta 174 1 IPI00220834.8 ATP-dependent DNA helicase 2 subunit 2 55 83222 3 3 3 3 789 1637 1 1 1 408.2061 814.3976 2 814.3973 0.0002 1 24.75 0.0077 R YAYDKR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1845.1845.2.dta 174 1 IPI00220834.8 ATP-dependent DNA helicase 2 subunit 2 55 83222 3 3 3 3 2120 7107 1 1 1 516.3106 1030.6067 2 1030.6063 0.0004 0 30.56 0.0052 K TLFPLIEAK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7653.7653.2.dta 174 1 IPI00220834.8 ATP-dependent DNA helicase 2 subunit 2 55 83222 3 3 3 3 2725 6589 1 1 1 559.2618 1116.5091 2 1116.5096 -0.0005 0 33.48 0.00072 K CFSVLGFCK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7123.7123.2.dta 174 IPI00792121.1 Protein 43 20578 2 2 2 2 789 1637 1 0 1 408.2061 814.3976 2 814.3973 0.0002 1 24.75 0.0077 R YAYDKR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1845.1845.2.dta 174 IPI00792121.1 Protein 43 20578 2 2 2 2 2725 6589 1 0 1 559.2618 1116.5091 2 1116.5096 -0.0005 0 33.48 0.00072 K CFSVLGFCK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7123.7123.2.dta 175 1 IPI00003421.3 T-brain-1 protein 54 74520 1 1 1 1 3954 8065 1 1 1 642.8613 1283.7081 2 1283.7085 -0.0004 0 54.28 5.70E-05 K LSPVLDGVSELR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8695.8695.2.dta 176 1 IPI00168235.4 "CDNA FLJ33352 fis, clone BRACE2005087, weakly similar to PRE-MRNA SPLICING HELICASE BRR2" 54 71883 1 1 1 1 3035 7446 1 1 1 582.2959 1162.5772 2 1162.5771 0.0001 0 54.1 8.50E-05 R DIDAFWLQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8032.8032.2.dta 177 1 IPI00743683.2 Rheumatoid factor RF-ET11 (Fragment) 53 10316 1 1 1 1 3961 3852 1 1 1 643.34 1284.6654 2 1284.6674 -0.002 0 53.41 1.70E-05 - ESGGGLVQPGGSLK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4284.4284.2.dta 178 1 IPI00074604.1 Isoform 1 of Glomulin 53 68906 1 1 1 1 3749 7593 1 1 1 628.864 1255.7135 2 1255.7136 -0.0001 0 53.32 6.40E-05 K GLELLENSLLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8195.8195.2.dta 179 1 IPI00171475.1 "nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 interacting protein" 53 45960 1 1 1 1 6913 6809 1 1 1 877.4882 1752.9618 2 1752.9662 -0.0044 0 53.24 1.00E-05 R LVLDPGEAPLVPVYSGK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7344.7344.2.dta 180 1 IPI00177938.2 Isoform 2 of Transducin-like enhancer protein 3 53 82969 1 1 1 1 5382 3278 1 1 1 742.8692 1483.7239 2 1483.7267 -0.0028 0 53.09 2.80E-05 R NDAPTPGTSTTPGLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3648.3648.2.dta 181 1 IPI00296635.5 "1,4-alpha-glucan branching enzyme" 53 80865 1 1 1 1 4171 7445 1 1 1 654.8801 1307.7456 2 1307.7449 0.0007 0 53 1.10E-05 R VALILQNVDLPN - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8031.8031.2.dta 182 1 IPI00007955.5 Isoform 1 of Tripartite motif-containing protein 16 53 64926 1 1 1 1 1385 2630 1 1 1 458.7453 915.4761 2 915.4774 -0.0013 0 52.94 0.00013 K LNENAISR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2924.2924.2.dta 183 1 IPI00022371.1 Histidine-rich glycoprotein precursor 52 60510 1 1 1 1 2782 8074 1 1 1 562.8083 1123.6021 2 1123.6026 -0.0004 0 52.3 0.00012 R DGYLFQLLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8704.8704.2.dta 184 1 IPI00163505.2 Isoform 1 of RNA-binding protein 39 51 59628 1 1 1 1 3882 7705 1 1 1 636.3112 1270.6079 2 1270.6081 -0.0003 0 51.05 0.0001 R DLEEFFSTVGK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8327.8327.2.dta 185 1 IPI00376199.2 interferon regulatory factor 2 binding protein 2 isoform A 51 61728 1 1 1 1 7992 4605 1 1 1 719.3794 2155.1164 3 2155.1134 0.003 0 51.03 1.60E-05 K DILLQQQQQLGHGGPEAAPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5099.5099.3.dta 186 1 IPI00297779.7 T-complex protein 1 subunit beta 51 57794 1 1 1 1 4321 4666 1 1 1 665.8327 1329.6509 2 1329.6524 -0.0016 0 50.85 3.70E-05 R GATQQILDEAER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5165.5165.2.dta 187 1 IPI00396378.3 Isoform B1 of Heterogeneous nuclear ribonucleoproteins A2/B1 50 37464 2 2 2 2 411 1155 1 0 0 364.2269 726.4392 2 726.4388 0.0004 1 30.23 0.01 R VVEPKR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1324.1324.2.dta 187 1 IPI00396378.3 Isoform B1 of Heterogeneous nuclear ribonucleoproteins A2/B1 50 37464 2 2 2 2 4634 4109 1 1 1 689.3181 1376.6216 2 1376.6222 -0.0006 0 38.98 0.00022 R GGGGNFGPGPGSNFR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4562.4562.2.dta 188 1 IPI00472981.3 Isoform 2 of Beta-catenin-like protein 1 50 43820 2 2 2 2 1399 8813 1 1 1 459.7683 917.5221 2 917.5222 -0.0001 0 17.36 0.043 R ILGLLENF - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.9445.9445.2.dta 188 1 IPI00472981.3 Isoform 2 of Beta-catenin-like protein 1 50 43820 2 2 2 2 4615 8013 1 1 1 687.8649 1373.7152 2 1373.7159 -0.0007 0 53.64 9.10E-05 K GEGLQLMNLMLR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8643.8643.2.dta 188 IPI00552222.3 13 kDa protein 17 13264 1 1 1 1 1399 8813 1 0 1 459.7683 917.5221 2 917.5222 -0.0001 0 17.36 0.043 R ILGLLENF - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.9445.9445.2.dta 189 1 IPI00005223.1 Isoform A of Mothers against decapentaplegic homolog 9 49 53429 1 1 1 1 4923 7006 1 1 1 708.4345 1414.8545 2 1414.8548 -0.0003 0 49.09 3.70E-05 R VETPVLPPVLVPR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7542.7542.2.dta 190 1 IPI00169383.3 Phosphoglycerate kinase 1 49 44985 2 2 2 2 2590 7503 1 1 1 549.3138 1096.6131 2 1096.6128 0.0003 0 37.4 0.00031 K VLPGVDALSNI - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8099.8099.2.dta 190 1 IPI00169383.3 Phosphoglycerate kinase 1 49 44985 2 2 2 2 6980 7267 1 1 1 590.3366 1767.988 3 1767.9883 -0.0003 0 26.16 0.0035 K ALESPERPFLAILGGAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7827.7827.3.dta 191 1 IPI00103483.1 Negative elongation factor B 48 66283 1 1 1 1 2984 8302 1 1 1 577.8423 1153.6701 2 1153.6707 -0.0005 0 47.97 0.00011 R DSPDLLLLLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8929.8929.2.dta 192 1 IPI00170935.1 Leucine-rich repeat-containing protein 47 47 64004 1 1 1 1 6989 7251 1 1 1 886.5048 1770.9951 2 1770.9992 -0.0041 0 46.69 4.20E-05 R NALGPGLSPELGPLPALR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7808.7808.2.dta 193 1 IPI00170786.1 WW domain-binding protein 11 45 69954 1 1 1 1 4089 7601 1 1 1 651.8493 1301.6841 2 1301.6835 0.0005 0 45.2 7.60E-05 K ELTPLQAMMLR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8203.8203.2.dta 194 1 IPI00021035.3 Retinoblastoma-binding protein 5 45 59729 1 1 1 1 3218 2205 1 1 1 597.3217 1192.6288 2 1192.6299 -0.0012 0 44.74 0.00052 R VTTGTSNTTAIK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2464.2464.2.dta 195 1 IPI00000279.2 erythropoietin 4 immediate early response 44 48972 2 2 2 2 983 1723 1 1 1 423.715 845.4155 2 845.4144 0.0011 0 30.59 0.012 K FGQQNPR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1938.1938.2.dta 195 1 IPI00000279.2 erythropoietin 4 immediate early response 44 48972 2 2 2 2 7698 6961 1 1 1 652.6981 1955.0725 3 1955.0727 -0.0002 0 32.95 0.00081 K ELQELNELFKPVVAAQK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7497.7497.3.dta 196 1 IPI00394926.1 DNA polymerase subunit delta 3 43 51653 1 1 1 1 4012 4799 1 1 1 645.8345 1289.6545 2 1289.655 -0.0005 0 43.22 0.00098 K FSAIQCAAAVPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5309.5309.2.dta 197 1 IPI00000656.2 Isoform 1 of Uncharacterized protein KIAA0892 precursor 43 70121 1 1 1 1 2315 7925 1 1 1 529.7747 1057.5349 2 1057.5345 0.0004 0 43.19 0.00038 R GLFSFFQGR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8555.8555.2.dta 198 1 IPI00217862.5 U3 small nucleolar RNA-interacting protein 2 43 52436 1 1 1 1 2992 8535 1 1 1 578.8062 1155.5979 2 1155.5996 -0.0018 0 42.7 9.90E-05 R GKPASGAGAGAGAGK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.916.916.2.dta 199 1 IPI00011619.4 Bifunctional 3~-phosphoadenosine 5~-phosphosulfate synthetase 1 43 71586 1 1 1 1 3897 6749 1 1 1 637.327 1272.6395 2 1272.639 0.0005 0 42.52 0.0013 K AWTVLTEYYK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7284.7284.2.dta 200 1 IPI00003515.1 Thyroid receptor-interacting protein 11 42 228184 1 1 1 1 2126 7200 1 1 1 516.8079 1031.6013 2 1031.6015 -0.0002 0 42.35 0.00033 K ALAFEQLLK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7752.7752.2.dta 201 1 IPI00018350.3 DNA replication licensing factor MCM5 42 83031 1 1 1 1 4929 7111 1 1 1 708.9078 1415.8011 2 1415.8024 -0.0013 0 42.17 0.00011 R LAALPNVYEVISK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7657.7657.2.dta 202 1 IPI00216654.1 Isoform Beta of Nucleolar phosphoprotein p130 42 74819 1 1 1 1 2938 1094 1 1 1 573.8093 1145.6041 2 1145.604 0.0001 0 41.78 0.00021 K NSSNKPAVTTK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1258.1258.2.dta 203 1 IPI00165261.6 Sec1 family domain-containing protein 1 42 72676 1 1 1 1 5391 6982 1 1 1 743.922 1485.8294 2 1485.829 0.0004 0 41.75 0.00091 K LTSAVSSLPELLEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7517.7517.2.dta 204 1 IPI00009790.1 6-phosphofructokinase type C 41 86454 1 1 1 1 4085 7750 1 1 1 651.8383 1301.662 2 1301.6615 0.0004 0 40.84 0.0017 K EWSGLLEELAR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8375.8375.2.dta 205 1 IPI00150269.1 Isoform 1 of U4/U6 small nuclear ribonucleoprotein Prp4 40 59097 2 2 2 2 3544 6795 1 1 1 616.8432 1231.6718 2 1231.6713 0.0005 0 41.51 0.00066 R LWIANYSLPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7330.7330.2.dta 205 1 IPI00150269.1 Isoform 1 of U4/U6 small nuclear ribonucleoprotein Prp4 40 59097 2 2 2 2 7131 6395 1 1 1 604.9914 1811.9524 3 1811.953 -0.0006 1 16.18 0.03 R ALGEPITLFGEGPAERR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6928.6928.3.dta 206 1 IPI00176903.2 Isoform 1 of Polymerase I and transcript release factor 39 43450 1 1 1 1 2719 189 1 1 1 558.7855 1115.5565 2 1115.5571 -0.0006 0 39.36 0.0002 K AHATTSNTVSK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1023.1023.2.dta 207 1 IPI00008531.1 REST corepressor 1 38 53110 2 2 2 2 4151 6409 1 1 1 653.8357 1305.6568 2 1305.6565 0.0004 0 37.08 0.0028 R DFQAISDVIGNK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6941.6941.2.dta 207 1 IPI00008531.1 REST corepressor 1 38 53110 2 2 2 2 7186 5940 1 1 1 609.6713 1825.992 3 1825.9938 -0.0018 1 22.98 0.032 K LDGGIEPYRLPEVIQK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6474.6474.3.dta 208 1 IPI00016639.7 "Protein kinase C, iota type" 38 69188 1 1 1 1 5538 7589 1 1 1 761.3979 1520.7813 2 1520.7835 -0.0021 0 38.02 0.00074 K ASSSLGLQDFDLLR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8190.8190.2.dta 209 1 IPI00003935.6 Histone H2B type 2-E 38 13912 2 2 2 2 1271 1000 1 1 1 451.2538 900.493 2 900.493 0 1 29.09 0.021 R LAHYNKR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1156.1156.2.dta 209 1 IPI00003935.6 Histone H2B type 2-E 38 13912 2 2 2 2 1619 5957 1 1 1 477.3049 952.5952 2 952.5957 -0.0005 0 29.22 0.0028 R LLLPGELAK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6491.6491.2.dta 209 IPI00465363.3 Histone H2B type 1-A 29 14159 1 1 1 1 1619 5957 1 0 1 477.3049 952.5952 2 952.5957 -0.0005 0 29.22 0.0028 R LLLPGELAK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6491.6491.2.dta 209 IPI00454695.4 Histone H2B type 2-C 29 21971 1 1 1 1 1271 1000 1 0 1 451.2538 900.493 2 900.493 0 1 29.09 0.021 R LAHYNKR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1156.1156.2.dta 210 1 IPI00171525.2 Sentrin-specific protease 3 38 65596 1 1 1 1 4919 8211 1 1 1 707.8884 1413.7622 2 1413.765 -0.0028 0 37.67 0.00029 R LGLLGALMAEDGVR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8839.8839.2.dta 211 1 IPI00294567.3 F-box only protein 7 38 58922 1 1 1 1 5708 8032 1 1 1 774.3952 1546.7759 2 1546.778 -0.0021 0 37.57 0.00068 R DLFTASNDPLLWR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8661.8661.2.dta 212 1 IPI00152881.5 Shroom-related protein 37 218321 1 1 1 1 1482 2040 1 1 1 466.7433 931.4721 2 931.4723 -0.0001 1 37.22 0.0051 R SSPATADKR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2283.2283.2.dta 213 1 IPI00292135.1 Lamin-B receptor 37 71057 1 1 1 1 1673 4927 1 1 1 481.7686 961.5226 2 961.5233 -0.0007 0 37.17 0.00033 R TFEVTPIR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5449.5449.2.dta 214 1 IPI00030009.3 Isoform A of Bifunctional 3~-phosphoadenosine 5~-phosphosulfate synthetase 2 37 70587 3 3 3 3 5441 2193 1 1 1 499.9233 1496.7481 3 1496.7484 -0.0003 0 18.01 0.02 K STNVVYQAHHVSR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2451.2451.3.dta 214 1 IPI00030009.3 Isoform A of Bifunctional 3~-phosphoadenosine 5~-phosphosulfate synthetase 2 37 70587 3 3 3 3 7192 8088 1 1 1 915.5129 1829.0113 2 1829.0121 -0.0008 0 25.61 0.004 K VLSMAPGLTSVEIIPFR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8718.8718.2.dta 214 1 IPI00030009.3 Isoform A of Bifunctional 3~-phosphoadenosine 5~-phosphosulfate synthetase 2 37 70587 3 3 3 3 7660 4265 1 1 1 647.634 1939.8801 3 1939.8799 0.0001 0 21.4 0.0099 K GFTGIDSDYEKPETPER V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4731.4731.3.dta 215 1 IPI00386035.1 Profilaggrin (Fragment) 37 115321 1 1 1 1 6371 5188 1 1 1 553.9155 1658.7248 3 1658.7258 -0.0011 0 36.9 0.00035 R SGHSGSHHSHTTSQGR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.572.572.3.dta 216 1 IPI00013981.4 Proto-oncogene tyrosine-protein kinase Yes 36 61276 1 1 1 1 4835 5787 1 1 1 700.882 1399.7495 2 1399.7493 0.0002 0 36.34 0.00055 R AANILVGENLVCK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6321.6321.2.dta 217 1 IPI00163187.10 Fascin 36 55123 2 2 2 2 2439 1963 1 1 1 359.5089 1075.505 3 1075.5047 0.0003 0 18.01 0.02 R YSVQTADHR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2198.2198.3.dta 217 1 IPI00163187.10 Fascin 36 55123 2 2 2 2 7165 5381 1 1 1 607.3275 1818.9607 3 1818.9628 -0.0021 0 32.39 0.0011 R LVARPEPATGYTLEFR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5916.5916.3.dta 218 1 IPI00015953.3 Isoform 1 of Nucleolar RNA helicase 2 36 87804 2 2 2 2 3447 7487 1 1 1 610.8551 1219.6957 2 1219.6965 -0.0008 0 37.44 0.0016 R GVTFLFPIQAK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8082.8082.2.dta 218 1 IPI00015953.3 Isoform 1 of Nucleolar RNA helicase 2 36 87804 2 2 2 2 3842 7893 1 1 1 633.3604 1264.7062 2 1264.7067 -0.0006 0 16.21 0.03 K TFSFAIPLIEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8524.8524.2.dta 219 1 IPI00297322.3 GTPase-activating protein ZNF289 36 57027 1 1 1 1 3856 4167 1 1 1 634.8085 1267.6025 2 1267.6044 -0.0019 0 35.65 0.00045 K VSSQSFSEIER Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4625.4625.2.dta 220 1 IPI00739770.2 hypothetical protein 36 76042 2 2 2 2 653 1805 1 1 1 393.7451 785.4756 2 785.4759 -0.0003 1 34.8 0.0082 R ERVALAK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2027.2027.2.dta 220 1 IPI00739770.2 hypothetical protein 36 76042 2 2 2 2 2917 7556 1 1 1 572.3166 1142.6186 2 1142.6196 -0.001 0 25.8 0.035 K NFHSGLLLSR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8158.8158.2.dta 221 1 IPI00008240.2 "Methionyl-tRNA synthetase, cytoplasmic" 35 102249 1 1 1 1 4426 7644 1 1 1 673.8875 1345.7604 2 1345.7605 -0.0002 0 35.43 0.0015 K ITQDIFQQLLK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8258.8258.2.dta 222 1 IPI00007818.3 Cleavage and polyadenylation specificity factor subunit 3 35 78120 1 1 1 1 2189 7650 1 1 1 521.8237 1041.6329 2 1041.6335 -0.0006 0 35.05 0.0019 R GLIPVFALGR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8265.8265.2.dta 223 1 IPI00000104.1 Isoform 1 of mRNA capping enzyme 35 69425 1 1 1 1 2318 2235 1 1 1 529.7957 1057.5768 2 1057.5768 0 0 34.57 0.0037 K GVTQVTTQPK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2496.2496.2.dta 224 1 IPI00296099.6 Thrombospondin-1 precursor 34 133291 1 1 1 1 4790 7268 1 1 1 697.8689 1393.7232 2 1393.7242 -0.0009 0 33.86 0.0015 R FVFGTTPEDILR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7828.7828.2.dta 225 1 IPI00290791.1 Isoform A of Caspase-10 precursor 33 59597 1 1 1 1 1432 1407 1 1 1 462.7661 923.5176 2 923.515 0.0026 1 32.99 0.0059 R MLKFLEK T Oxidation (M) 0.1000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1597.1597.2.dta 226 1 IPI00160454.9 SDHALP2 protein 33 16681 1 1 1 1 2664 1997 1 1 1 555.2826 1108.5506 2 1108.5513 -0.0006 1 32.87 0.00083 R TEDGKIYQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2235.2235.2.dta 227 1 IPI00074870.1 DnaJ homolog subfamily C member 1 33 64185 1 1 1 1 1946 2155 1 1 1 502.2644 1002.5143 2 1002.5094 0.0049 1 32.67 0.013 K LGASEKNER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2409.2409.2.dta 228 1 IPI00299033.1 Importin alpha-3 subunit 32 58288 2 2 2 2 529 2341 1 0 1 379.73 757.4454 2 757.4446 0.0008 0 31.99 0.02 K VQTAALR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2611.2611.2.dta 228 1 IPI00299033.1 Importin alpha-3 subunit 32 58288 2 2 2 2 1533 6906 1 0 1 470.3154 938.6163 2 938.6164 -0.0001 0 20.32 0.0093 K SGILPILVK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7440.7440.2.dta 228 IPI00012578.1 Importin alpha-4 subunit 32 58364 1 1 1 1 529 2341 1 0 1 379.73 757.4454 2 757.4446 0.0008 0 31.99 0.02 K VQTAALR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2611.2611.2.dta 229 1 IPI00333975.6 CARD15-like protein 32 25434 1 1 1 1 374 3180 1 0 1 358.2207 714.4269 2 714.4276 -0.0006 0 31.74 0.011 K ALAEALK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3531.3531.2.dta 230 1 IPI00217471.3 Hemoglobin subunit epsilon 32 16249 1 1 1 1 3905 7079 1 1 1 637.8661 1273.7177 2 1273.7183 -0.0005 0 31.58 0.0012 R LLVVYPWTQR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7623.7623.2.dta 231 1 IPI00296374.3 Isoform 1 of Zinc finger protein-like 1 31 34833 1 1 1 1 2194 4401 1 1 1 522.2863 1042.558 2 1042.5593 -0.0014 0 31.21 0.0085 R LCNIPLASR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4878.4878.2.dta 232 1 IPI00141318.2 Isoform 1 of Cytoskeleton-associated protein 4 31 66097 2 2 2 2 1153 1454 1 1 1 438.7012 875.3878 2 875.3886 -0.0008 0 24.94 0.0064 R SHQDFSR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1648.1648.2.dta 232 1 IPI00141318.2 Isoform 1 of Cytoskeleton-associated protein 4 31 66097 2 2 2 2 4071 1022 1 1 1 650.8278 1299.6411 2 1299.6419 -0.0008 1 21.71 0.016 R SSQHKQDLTEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1180.1180.2.dta 233 1 IPI00515125.1 "ATPase family, AAA domain containing 3B" 31 13937 1 1 1 1 1353 1287 1 1 1 456.7216 911.4286 2 911.425 0.0037 0 30.65 0.0082 R WADHEVR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1467.1467.2.dta 234 1 IPI00373968.5 IMP dehydrogenase/GMP reductase family protein 31 70998 1 1 1 1 2718 2902 1 1 1 558.7842 1115.5538 2 1115.5571 -0.0033 0 30.62 0.018 R GSQLEDQALR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3222.3222.2.dta 235 1 IPI00033036.1 Methionine aminopeptidase 2 30 53713 1 1 1 1 1954 2785 1 1 1 335.5343 1003.5812 3 1003.5815 -0.0003 0 30.45 0.0014 K TYQVKPIR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3093.3093.3.dta 236 1 IPI00220592.3 Isoform 2 of Intersectin-1 30 137678 1 1 1 1 1727 1428 1 1 1 324.5204 970.5392 3 970.5447 -0.0055 0 30.41 0.017 K QILNDQLK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1620.1620.3.dta 237 1 IPI00216811.1 "TBC1 domain family, member 10C" 30 50194 1 1 1 1 1647 3368 1 1 1 479.7695 957.5245 2 957.5243 0.0002 0 30.02 0.011 R LALGTAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3749.3749.2.dta 238 1 IPI00020096.2 kinesin light chain 1 isoform 2 30 65782 1 1 1 1 4574 7599 1 1 1 685.3752 1368.7359 2 1368.7361 -0.0002 0 29.94 0.019 K DAANLLNDALAIR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8201.8201.2.dta 239 1 IPI00298347.1 Isoform 2 of Tyrosine-protein phosphatase non-receptor type 11 30 68538 1 1 1 1 1938 3457 1 1 1 501.7639 1001.5133 2 1001.5141 -0.0008 0 29.93 0.028 R INAAEIESR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3845.3845.2.dta 240 1 IPI00295857.6 Coatomer subunit alpha 30 139783 1 1 1 1 3204 6696 1 1 1 595.8423 1189.6701 2 1189.6707 -0.0005 0 29.89 0.0016 R TLDLPIYVTR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7232.7232.2.dta 241 1 IPI00296291.2 HP1-BP74 30 61454 1 1 1 1 425 7270 1 1 1 365.7145 729.4145 2 729.4133 0.0011 0 29.74 0.038 K KPATSAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.783.783.2.dta 242 1 IPI00016553.1 Isoform 1 of Solute carrier organic anion transporter family member 2B1 30 78017 1 1 1 1 998 2735 1 1 1 425.7295 849.4444 2 849.4444 0.0001 0 29.67 0.021 K SSISTVEK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3039.3039.2.dta 243 1 IPI00783527.1 Conserved hypothetical protein 29 4859 1 1 1 1 1004 3798 1 1 1 426.2113 850.408 2 850.4032 0.0048 0 29.48 0.019 R SSSLSSQVG - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4225.4225.2.dta 244 1 IPI00300221.4 Hypothetical protein DKFZp434I1916 29 14624 1 1 1 1 1164 2564 1 1 1 439.2155 876.4165 2 876.4123 0.0041 1 29.34 0.02 R QGEQKCK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2853.2853.2.dta 245 1 IPI00384184.1 Inositol polyphosphate-5-phosphatase F 29 25387 1 1 1 1 680 1023 1 1 1 396.2426 790.4706 2 790.4701 0.0004 1 29.32 0.014 R AGFALGKK - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1181.1181.2.dta 246 1 IPI00003886.2 Isoform 2 of Guanine nucleotide-binding protein-like 3 29 61020 1 1 1 1 1658 5971 1 1 1 480.7793 959.544 2 959.544 0 0 29.18 0.0077 K ELPTVVFR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6505.6505.2.dta 247 1 IPI00220991.2 Hypothetical protein DKFZp781K0743 29 106695 1 1 1 1 4753 7631 1 1 1 695.8835 1389.7525 2 1389.7538 -0.0012 0 28.98 0.01 R CVSTLLDLIQTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8243.8243.2.dta 248 1 IPI00001639.2 Importin beta-1 subunit 29 98420 1 1 1 1 5998 7474 1 1 1 803.4448 1604.875 2 1604.8773 -0.0024 0 28.92 0.0019 K LAATNALLNSLEFTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8064.8064.2.dta 249 1 IPI00220038.1 Isoform B of Arsenite-resistance protein 2 29 100670 1 1 1 1 5500 7787 1 1 1 758.3761 1514.7376 2 1514.7405 -0.0029 0 28.88 0.0031 K EVAFFNNFLTDAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8411.8411.2.dta 250 1 IPI00171248.1 embryonic ectoderm development isoform b 29 46066 1 1 1 1 2206 7478 1 1 1 522.8082 1043.6019 2 1043.6015 0.0004 0 28.62 0.015 R WLGDLILSK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8069.8069.2.dta 251 1 IPI00008215.1 NADP-dependent malic enzyme 28 64679 2 2 2 2 1051 5824 1 1 1 430.7479 859.4812 2 859.4803 0.0008 0 29.38 0.039 K IWLVDSK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6359.6359.2.dta 251 1 IPI00008215.1 NADP-dependent malic enzyme 28 64679 2 2 2 2 1652 3139 1 1 1 480.2615 958.5084 2 958.5084 0 0 20.6 0.014 K AIVVTDGER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3479.3479.2.dta 252 1 IPI00061267.2 Isoform 1 of RING finger and SPRY domain-containing protein 1 precursor 28 65450 1 1 1 1 5724 3705 1 1 1 517.2606 1548.76 3 1548.7672 -0.0071 0 28.05 0.0049 K EGDTVGFLLDLNEK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4123.4123.3.dta 253 1 IPI00217844.1 Isoform 2 of Probable G-protein coupled receptor 114 precursor 28 59988 1 1 1 1 728 3483 1 1 1 403.7042 805.3938 2 805.393 0.0008 0 27.77 0.047 K QSDSLTR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3875.3875.2.dta 254 1 IPI00013214.1 DNA replication licensing factor MCM3 28 91551 1 1 1 1 1487 7493 1 1 1 466.7817 931.5488 2 931.5491 -0.0003 0 27.68 0.0025 K VALLDVFR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8089.8089.2.dta 255 1 IPI00180292.5 Isoform 5 of Brain-specific angiogenesis inhibitor 1-associated protein 2 28 57637 1 1 1 1 4985 8146 1 1 1 713.4015 1424.7884 2 1424.7875 0.0009 0 27.65 0.0026 K EGDLITLLVPEAR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8774.8774.2.dta 256 1 IPI00014424.1 Elongation factor 1-alpha 2 27 50780 1 1 1 1 4215 5802 1 1 1 657.8734 1313.7323 2 1313.7343 -0.002 0 27.42 0.0027 R EHALLAYTLGVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6336.6336.2.dta 257 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 27 90261 1 1 1 1 7134 3206 1 1 1 605.3173 1812.93 3 1812.933 -0.003 1 27.3 0.015 R VLVNDAQKVTEGQQER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3563.3563.3.dta 258 1 IPI00745628.1 hypothetical protein 27 38367 1 1 1 1 4214 4102 1 1 1 657.809 1313.6035 2 1313.5921 0.0114 0 27.16 0.02 K GMEEIYNLSSR K Oxidation (M) 0.01000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4554.4554.2.dta 259 1 IPI00152427.3 zinc finger protein 675 27 68479 1 1 1 1 632 1184 1 1 1 391.7116 781.4087 2 781.4082 0.0004 1 26.81 0.027 K AFSRSSK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1356.1356.2.dta 260 1 IPI00100984.4 Isoform 1 of HEAT repeat-containing protein 3 27 75789 1 1 1 1 4539 7594 1 1 1 682.4187 1362.8229 2 1362.8235 -0.0006 0 26.71 0.0062 R LGPLLLDPSLAVR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8197.8197.2.dta 261 1 IPI00167941.1 Midasin 27 638008 1 1 1 1 1255 2887 1 1 1 449.7447 897.4749 2 897.4708 0.004 0 26.62 0.041 K QFPLHEK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3205.3205.2.dta 262 1 IPI00419054.1 "CDNA FLJ43586 fis, clone SKNMC2007504" 27 42528 1 1 1 1 409 2381 1 1 1 364.2096 726.4046 2 726.4024 0.0022 0 26.61 0.029 M SSPPALR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2655.2655.2.dta 263 1 IPI00020668.4 Undifferentiated embryonic cell transcription factor 1 26 36644 1 1 1 1 1540 9039 1 1 1 471.2492 940.4839 2 940.4839 0 0 26.43 0.03 R SPGSGRPQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.970.970.2.dta 264 1 IPI00328309.1 mRNA decapping enzyme 1B 26 68208 1 1 1 1 8716 3166 1 1 1 861.4254 2581.2542 3 2581.2554 -0.0012 1 26.31 0.0034 K LQSTPGAANKCDPSTPAPASSAALNR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3509.3509.3.dta 265 1 IPI00021187.4 Isoform 1 of RuvB-like 1 26 50538 1 1 1 1 1171 7287 1 1 1 439.7457 877.4768 2 877.477 -0.0001 0 26.05 0.019 R IASHSHVK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.785.785.2.dta 266 1 IPI00030252.1 Fanconi anemia group E protein 26 59415 1 1 1 1 1535 8283 1 1 1 314.1798 939.5177 3 939.5138 0.0039 0 25.67 0.037 K AIQDQLPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.891.891.3.dta 267 1 IPI00140420.4 Staphylococcal nuclease domain-containing protein 1 26 102618 1 1 1 1 2235 7211 1 1 1 524.8005 1047.5865 2 1047.5865 0 0 25.56 0.036 K QFLPFLQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7765.7765.2.dta 268 1 IPI00645078.1 Ubiquitin-activating enzyme E1 26 118858 1 1 1 1 7457 7280 1 1 1 942.4814 1882.9483 2 1882.9384 0.0099 0 25.54 0.0055 R NEEDAAELVALAQAVNAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7840.7840.2.dta 269 1 IPI00744147.1 13 kDa protein 25 12576 1 1 1 1 1831 2659 1 1 1 330.8312 989.4719 3 989.4674 0.0045 0 24.95 0.012 M VDMMELPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2957.2957.3.dta 270 1 IPI00478046.3 Similar to Alu subfamily SB sequence contamination warning entry 25 6524 1 1 1 1 1431 1404 1 1 1 308.8461 923.5164 3 923.515 0.0014 0 24.78 0.048 K SGMIYLIK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1594.1594.3.dta 271 1 IPI00303565.4 hypothetical protein LOC55051 isoform 2 25 107860 2 2 2 2 58 3892 7 0 1 308.2071 614.3997 2 614.4003 -0.0006 0 24.75 0.033 K LILEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4327.4327.2.dta 271 1 IPI00303565.4 hypothetical protein LOC55051 isoform 2 25 107860 2 2 2 2 6541 6675 1 1 1 842.4557 1682.8968 2 1682.8814 0.0154 1 19.48 0.029 R MYLNFLVSLGNKER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7211.7211.2.dta 272 1 IPI00016570.2 Isoform 3 of Bromodomain-containing protein 8 24 81588 1 1 1 1 2296 7542 1 1 1 528.8135 1055.6125 2 1055.6087 0.0038 1 24.4 0.042 K KNIENGLIR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8142.8142.2.dta 273 1 IPI00219077.4 Isoform 1 of Leukotriene A-4 hydrolase 24 69868 1 1 1 1 4311 4278 1 1 1 664.8491 1327.6836 2 1327.6806 0.003 0 24.13 0.049 R AILPCQDTPSVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4745.4745.2.dta 274 1 IPI00386731.3 Isoform 4 of F-box/LRR-repeat protein 18 24 80294 1 1 1 1 3631 8363 1 1 1 620.803 1239.5915 2 1239.5924 -0.0009 0 23.72 0.006 R VAEEPPNLWW - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8989.8989.2.dta 275 1 IPI00103026.1 PRMT3 protein (Fragment) 24 62555 1 1 1 1 5358 7762 1 1 1 739.9256 1477.8366 2 1477.8392 -0.0025 0 23.64 0.0061 K AVIPEAVVEVLDPK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8387.8387.2.dta 276 1 IPI00220113.1 Isoform 2 of Microtubule-associated protein 4 24 103241 1 1 1 1 4637 2452 1 1 1 689.3501 1376.6856 2 1376.6896 -0.0039 0 23.61 0.0061 K TTTAAAVASTGPSSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2731.2731.2.dta 277 1 IPI00396435.2 DEAH (Asp-Glu-Ala-His) box polypeptide 15 23 93568 1 1 1 1 4013 8305 1 1 1 645.8696 1289.7246 2 1289.7265 -0.0019 0 23.48 0.016 R TLATDILMGVLK E Oxidation (M) 0.000000010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8931.8931.2.dta 278 1 IPI00445869.1 "CDNA FLJ43311 fis, clone NT2RI2009855" 23 25721 1 1 1 1 4823 5174 1 1 1 700.3611 1398.7076 2 1398.7103 -0.0027 0 23.29 0.0065 K LLTSGDPPASASQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5705.5705.2.dta 279 1 IPI00306933.1 Isoform Short of Myosin-IXb 23 230697 1 1 1 1 2202 2982 1 1 1 522.775 1043.5354 2 1043.5359 -0.0005 1 22.97 0.022 K EREALEAAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3310.3310.2.dta 280 1 IPI00008455.1 Isoform 2 of Myosin-VI 23 147324 3 3 1 1 770 2406 1 1 1 405.7502 809.4859 2 809.4872 -0.0013 1 20.39 0.045 K SKLAVHR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2682.2682.2.dta 280 1 IPI00008455.1 Isoform 2 of Myosin-VI 23 147324 3 3 1 1 771 1820 1 1 1 405.7503 809.4861 2 809.4872 -0.001 1 20.04 0.049 K SKLAVHR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2044.2044.2.dta 280 1 IPI00008455.1 Isoform 2 of Myosin-VI 23 147324 3 3 1 1 772 1681 1 1 1 405.7511 809.4877 2 809.4872 0.0006 1 20.48 0.044 K SKLAVHR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1893.1893.2.dta 281 1 IPI00030320.4 Probable ATP-dependent RNA helicase DDX6 23 54781 1 1 1 1 3516 7482 1 1 1 616.3552 1230.6959 2 1230.6972 -0.0013 0 22.87 0.0072 K SGAYLIPLLER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8073.8073.2.dta 282 1 IPI00021290.5 ATP-citrate synthase 23 121674 1 1 1 1 5807 7438 1 1 1 784.4571 1566.8996 2 1566.8981 0.0016 0 22.75 0.03 R TIAIIAEGIPEALTR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8023.8023.2.dta 283 1 IPI00386765.2 "Isoform 7 of cAMP-specific 3~,5~-cyclic phosphodiesterase 4D" 23 23995 1 1 1 1 1088 5796 1 1 1 434.7661 867.5177 2 867.5178 -0.0001 0 22.72 0.021 K LSPVISPR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6330.6330.2.dta 284 1 IPI00295898.4 Hypothetical protein FLJ36492 22 83698 1 1 1 1 1039 3095 1 1 1 429.7219 857.4292 2 857.4355 -0.0063 1 22.27 0.043 K RGGAEGSPK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3431.3431.2.dta 285 1 IPI00645608.2 Interferon regulatory factor 2-binding protein 1 22 62561 1 1 1 1 7061 1778 1 1 1 597.9635 1790.8687 3 1790.866 0.0027 0 22.23 0.0082 R AGGASPAASSTAQPPTQHR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1998.1998.3.dta 286 1 IPI00022265.3 Coiled-coil domain-containing protein 22 22 71054 1 1 1 1 5004 8415 1 1 1 714.8763 1427.7381 2 1427.7409 -0.0027 0 22.22 0.032 R DLGELLQAWGAGAK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.9040.9040.2.dta 287 1 IPI00016384.2 glycine/arginine rich protein 1 22 29035 1 1 1 1 2295 5668 1 1 1 528.8056 1055.5967 2 1055.5975 -0.0008 0 22.13 0.035 R ALVEVLGAER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6203.6203.2.dta 288 1 IPI00009362.1 Secretogranin-2 precursor 22 70825 1 1 1 1 3461 1779 1 0 1 613.2736 1224.5327 2 1224.5444 -0.0118 0 21.97 0.022 R QMAYENLNDK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1999.1999.2.dta 289 1 IPI00179057.6 Isoform 1 of Cullin-4B 22 102805 1 1 1 1 1988 8027 1 1 1 505.7869 1009.5592 2 1009.5597 -0.0004 0 21.56 0.02 R SIFLFLDR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8657.8657.2.dta 290 1 IPI00455268.3 tRNA (guanine-N(1)-)-methyltransferase 22 58561 1 1 1 1 1194 4798 1 1 1 442.2844 882.5542 2 882.5538 0.0004 0 21.52 0.012 K TVNIPVLK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5308.5308.2.dta 291 1 IPI00013457.1 Isoform 1 of Zinc finger protein 207 21 51002 1 1 1 1 5789 4615 1 1 1 522.598 1564.7722 3 1564.7733 -0.001 0 21.37 0.0099 K LIHPDEDISLEER R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5110.5110.3.dta 292 1 IPI00217422.2 OTTHUMP00000016593 21 50174 1 1 1 1 723 2339 1 1 1 402.7507 803.4869 2 803.4939 -0.007 1 21.34 0.047 K KMILATK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2609.2609.2.dta 293 1 IPI00073779.1 "28S ribosomal protein S35, mitochondrial precursor" 21 37106 1 1 1 1 427 1392 1 1 1 365.7184 729.4223 2 729.4207 0.0016 1 21.31 0.031 K KGVPMAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1581.1581.2.dta 294 1 IPI00456970.1 Isoform 1 of Cell division cycle 2-like protein kinase 5 21 165564 1 1 1 1 2410 2563 1 1 1 537.2842 1072.5538 2 1072.5513 0.0025 0 20.96 0.039 K SQGSSNVAPVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2852.2852.2.dta 295 1 IPI00411291.1 Peroxisome biogenesis factor 1 21 143804 1 1 1 1 2485 2201 1 1 1 541.2678 1080.5211 2 1080.5307 -0.0096 1 20.87 0.035 K GMMKELQTK Q Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2460.2460.2.dta 296 1 IPI00420108.4 "Dihydrolipoyllysine-residue succinyltransferase component of 2- oxoglutarate dehydrogenase complex, mitochondrial precursor" 21 48952 1 1 1 1 4977 8519 1 1 1 712.4124 1422.8103 2 1422.8082 0.0021 1 20.76 0.011 K AAVEDPRVLLLDL - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.9143.9143.2.dta 297 1 IPI00010349.1 "Alkyldihydroxyacetonephosphate synthase, peroxisomal precursor" 21 73664 1 1 1 1 8123 3143 1 1 1 747.061 2238.1613 3 2238.1604 0.0009 1 20.67 0.012 R RAASAATAAPTATPAAQESGTIPK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3483.3483.3.dta 298 1 IPI00738688.2 hypothetical protein LOC80169 20 123539 1 1 1 1 6817 7611 1 1 1 868.459 1734.9034 2 1734.8901 0.0134 0 20.38 0.015 R NQGSTLPLSYSQVSVR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8217.8217.2.dta 299 1 IPI00784061.1 "Similar to Tyrosine-protein phosphatase, non-receptor type 11" 20 3716 1 1 1 1 9190 96 1 1 1 828.1891 3308.7272 4 3308.7189 0.0084 0 20.23 0.015 - MTEGSPLAFYSLLTMSLQHVTLYLPVIPR L 2 Oxidation (M) 0.10000000000000100000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.10118.10118.4.dta 300 1 IPI00101049.2 CGI-07 protein 20 58745 1 1 1 1 6639 3687 1 1 1 848.4203 1694.826 2 1694.8264 -0.0003 0 19.87 0.014 R LISQDIHSNTYNYK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4102.4102.2.dta 301 1 IPI00020258.3 Mitogen-activated protein kinase kinase kinase kinase 1 20 92265 1 1 1 1 6896 5817 1 1 1 876.4177 1750.8208 2 1750.8117 0.009 1 19.6 0.015 K MVKMEPDDDVSTLQK E Oxidation (M) 0.000100000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6352.6352.2.dta 302 1 IPI00184376.4 Isoform 2 of Uncharacterized protein C9orf126 19 73317 1 1 1 1 4628 7591 1 1 1 688.804 1375.5934 2 1375.5932 0.0001 0 19.3 0.015 R NVFFENTIDDY - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8192.8192.2.dta 303 1 IPI00171798.1 Metastasis-associated protein MTA2 19 75717 1 1 1 1 5723 5741 1 1 1 775.3755 1548.7365 2 1548.7379 -0.0014 0 19.11 0.016 R DISSSLNSLADSNAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6276.6276.2.dta 304 1 IPI00290272.2 DNA polymerase subunit alpha B 19 66762 1 1 1 1 4680 5453 1 1 1 461.8773 1382.6101 3 1382.6109 -0.0008 1 18.93 0.039 R HSTCKDSGHAGAR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.599.599.3.dta 305 1 IPI00294627.3 Isoform 2 of Splicing factor 1 19 68817 1 1 1 1 6316 7126 1 1 1 824.9762 1647.9378 2 1647.9382 -0.0004 0 18.85 0.042 K TVIPGMPTVIPPGLTR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7672.7672.2.dta 306 1 IPI00442895.2 Isoform 3 of UBX domain-containing protein 7 19 34826 1 1 1 1 5417 7867 1 1 1 746.3951 1490.7756 2 1490.7769 -0.0013 0 18.74 0.017 K LGDFPYVSILDPR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8498.8498.2.dta 307 1 IPI00064428.3 Zinc finger and BTB domain-containing protein 45 19 54829 1 1 1 1 6940 2509 1 1 1 587.9146 1760.7218 3 1760.7247 -0.0028 0 18.63 0.027 R TPGAEPPTYECSHCR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2793.2793.3.dta 308 1 IPI00013070.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 18 96250 1 1 1 1 6285 4473 1 1 1 548.9459 1643.8158 3 1643.8189 -0.0031 1 18.37 0.02 K AIVICPTDEDLKDR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4956.4956.3.dta 309 1 IPI00465357.3 hypothetical protein LOC54463 isoform 2 18 39748 1 1 1 1 3033 2935 1 1 1 582.2595 1162.5045 2 1162.4965 0.008 0 18.24 0.019 - MPEGEDFGPGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3259.3259.2.dta 310 1 IPI00297396.5 RNA exonuclease 1 homolog 18 132760 1 1 1 1 1793 2751 1 1 1 491.7646 981.5147 2 981.5243 -0.0096 0 18.07 0.02 R SAEAPALAPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3056.3056.2.dta 311 1 IPI00023860.1 Nucleosome assembly protein 1-like 1 18 45631 1 1 1 1 7927 6976 1 1 1 699.0161 2094.0265 3 2094.0303 -0.0038 0 17.85 0.021 K NVDLLSDMVQEHDEPILK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7511.7511.3.dta 312 1 IPI00023736.2 Coronin-2A 17 60239 1 1 1 1 4477 7604 1 1 1 677.8914 1353.7682 2 1353.769 -0.0008 0 16.87 0.038 K SLIEPISMIVPR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8208.8208.2.dta 313 1 IPI00456750.2 Niban-like protein 17 83144 1 1 1 1 4915 7678 1 1 1 707.8538 1413.693 2 1413.6929 0.0001 0 16.58 0.028 R FQELIFEDFAR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8295.8295.2.dta 314 1 IPI00008943.3 Isoform 1 of ATP-dependent RNA helicase DDX19B 16 54349 1 1 1 1 8996 5762 1 1 1 943.8168 2828.4285 3 2828.4304 -0.002 1 15.84 0.033 R SNLVDNTNQVEVLQRDPNSPLYSVK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6297.6297.3.dta 315 1 IPI00335584.5 "CDNA FLJ32744 fis, clone TESTI2001420, weakly similar to D.melanogaster putative organic cation transporter" 16 40733 1 1 1 1 669 3319 1 1 1 395.2317 788.4488 2 788.4466 0.0022 0 15.78 0.037 K IVDIMAK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3696.3696.2.dta 316 1 IPI00448997.2 26 kDa protein 15 26232 1 1 1 1 6035 5955 1 1 1 807.9043 1613.794 2 1613.7937 0.0004 0 15.48 0.036 M SLVSEEFPEEVPPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6489.6489.2.dta 317 1 IPI00301323.1 ATP-dependent RNA helicase DDX18 15 75702 1 1 1 1 2842 3301 1 1 1 568.2535 1134.4924 2 1134.4863 0.0061 0 15.37 0.036 K MVNDAEPDTK K Oxidation (M) 0.1000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3675.3675.2.dta 318 1 IPI00220219.6 Coatomer subunit beta~ 15 103278 1 1 1 1 2975 1852 1 1 1 577.3009 1152.5873 2 1152.5887 -0.0015 0 15.35 0.036 K HSEVQQANLK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2078.2078.2.dta 319 1 IPI00784883.3 similar to hampin isoform 5 15 67771 1 1 1 1 3380 1615 1 1 1 605.3043 1208.594 2 1208.5898 0.0042 0 15.11 0.038 K AAAAPAGGNPEQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.1821.1821.2.dta 320 1 IPI00304693.6 Isoform 2 of Nucleoporin-like protein RIP 15 54434 1 1 1 1 3821 8001 1 1 1 631.8294 1261.6443 2 1261.6455 -0.0013 0 15.09 0.038 K QIWLGLFDDR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.8630.8630.2.dta 321 1 IPI00296535.1 2-hydroxyacyl-CoA lyase 1 15 64429 1 1 1 1 7478 6682 1 1 1 631.0154 1890.0243 3 1890.0251 -0.0008 0 15.02 0.039 K FSARPSSIEAIPFVIEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.7218.7218.3.dta 322 1 IPI00746756.3 KIAA0672 gene product 15 89818 1 1 1 1 1067 3057 1 1 1 432.2889 862.5632 2 862.564 -0.0008 1 15.01 0.032 K KLAPIPPK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.3391.3391.2.dta 323 1 IPI00289499.3 Bifunctional purine biosynthesis protein PURH 15 65089 1 1 1 1 1868 5618 1 1 1 497.7819 993.5493 2 993.5495 -0.0002 0 14.84 0.041 K SLFSNVVTK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.6153.6153.2.dta 324 1 IPI00103373.1 Cytoglobin 15 21505 1 1 1 1 4224 4970 1 1 1 658.8321 1315.6496 2 1315.6442 0.0055 1 14.78 0.041 M EKVPGEMEIER R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.5496.5496.2.dta 325 1 IPI00216438.3 Solute carrier family 12 member 3 15 114207 1 1 1 1 6434 953 1 1 1 556.3016 1665.8831 3 1665.8735 0.0096 0 14.77 0.041 R CMLNIWGVILYLR L Oxidation (M) 0.0100000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.11339.11339.3.dta 326 1 IPI00292817.6 Novel protein 15 149343 1 1 1 1 5573 4185 1 1 1 762.887 1523.7594 2 1523.7692 -0.0099 0 14.51 0.044 R GQAGLPGGLVSPGSGDR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.4644.4644.2.dta 327 1 IPI00743330.1 Similar to Breast carcinoma amplified sequence 3 (GAOB1) (Maab1 protein). Splice isoform 5 14 11835 1 1 1 1 6515 2334 1 1 1 560.2792 1677.8157 3 1677.8322 -0.0165 1 14.25 0.046 R ESNTEEVRFELGLR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.2604.2604.3.dta 328 1 IPI00384529.5 Isoform 1 of Protein cordon-bleu 14 136446 1 1 1 1 5829 8736 1 1 1 394.1922 1572.7398 4 1572.738 0.0019 1 14.04 0.048 R VNSQPVNEKDSNDK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-4.9363.9363.4.dta