Header -------------------------------------------------------- Search title orb_160921_AE-MF-2_#5-5.raw Timestamp 2016-09-28T01:40:44Z User lu-31 Email Report URI http://mascot.bioreg.kyushu-u.ac.jp/mascot/cgi/master_results.pl?file=D:/2016/20160928/F073895.dat Peak list data path D:\data\oda\160921_AE-MF-2\orb_160921_AE-MF-2_#5-5.raw Peak list format Mascot generic Search type MIS Mascot version 2.5.1 Database ipi_HUM_NEW Fasta file ipi_HUM_NEW_3.26.fasta Total sequences 67667 Total residues 28462731 Sequences after taxonomy filter 67667 Number of queries 8657 Fixed modifications -------------------------------------------------------- Identifier Name Delta Neutral loss 1 Carbamidomethyl (C) 57.021464 Variable modifications -------------------------------------------------------- Identifier Name Delta Neutral loss(es) 1 Oxidation (M) 15.994915 0 63.998285 Search Parameters -------------------------------------------------------- Taxonomy filter All entries Enzyme Trypsin Maximum Missed Cleavages 1 Fixed modifications Carbamidomethyl (C) Variable modifications Oxidation (M) Peptide Mass Tolerance 10 Peptide Mass Tolerance Units ppm Fragment Mass Tolerance 0.8 Fragment Mass Tolerance Units Da Mass values Monoisotopic Instrument type ESI-TRAP Format parameters -------------------------------------------------------- Significance threshold 0.05 Max. number of hits 0 Min. number of sig. unique sequences 1 Use MudPIT protein scoring 1 Ions score cut-off -1 Include same-set proteins 0 Include sub-set proteins 1 Include unassigned 0 Require bold red 0 Use homology threshold 1 Group protein families 1 Show duplicate peptides 1 Protein hits -------------------------------------------------------- prot_hit_num prot_family_member prot_acc prot_desc prot_score prot_mass prot_matches prot_matches_sig prot_sequences prot_sequences_sig pep_query pep_index pep_rank pep_isbold pep_isunique pep_exp_mz pep_exp_mr pep_exp_z pep_calc_mr pep_delta pep_miss pep_score pep_expect pep_res_before pep_seq pep_res_after pep_var_mod pep_var_mod_pos pep_summed_mod_pos pep_local_mod_pos pep_scan_title 1 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1136 53671 44 44 35 35 53 2021 1 1 0 311.168 620.3214 2 620.3203 0.0011 0 26.92 0.02 K MLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1964.1964.2.dta 1 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1136 53671 44 44 35 35 97 1338 1 1 1 322.2289 642.4433 2 642.4428 0.0005 1 38.13 0.00042 R AVVVKK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1214.1214.2.dta 1 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1136 53671 44 44 35 35 206 1433 1 1 1 352.1908 702.367 2 702.3661 0.001 0 29.95 0.036 K VSTSGPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1318.1318.2.dta 1 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1136 53671 44 44 35 35 551 4870 1 1 0 414.2186 826.4227 2 826.4225 0.0002 0 39.72 0.0021 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5192.5192.2.dta 1 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1136 53671 44 44 35 35 699 592 1 1 1 434.7229 867.4313 2 867.4311 0.0002 1 38.62 0.0023 K HGDDLRR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1077.1077.2.dta 1 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1136 53671 44 44 35 35 708 2962 1 1 1 435.7201 869.4256 2 869.4243 0.0013 0 45.06 0.00045 R ISSSSFSR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2999.2999.2.dta 1 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1136 53671 44 44 35 35 837 2672 1 1 0 453.7375 905.4604 2 905.4607 -0.0002 0 42.33 0.0018 R FLEQQNK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2684.2684.2.dta 1 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1136 53671 44 44 35 35 857 1857 1 1 1 456.2148 910.415 2 910.4145 0.0006 0 31.01 0.0016 R SYTSGPGSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1779.1779.2.dta 1 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1136 53671 44 44 35 35 1242 4517 1 1 1 500.7875 999.5605 2 999.56 0.0005 0 43.38 0.00059 R LQAEIEGLK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4768.4768.2.dta 1 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1136 53671 44 44 35 35 1438 3323 1 1 1 523.2802 1044.5459 2 1044.5451 0.0008 0 41.98 0.00019 R QLETLGQEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3427.3427.2.dta 1 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1136 53671 44 44 35 35 1529 2096 1 1 0 533.7612 1065.5079 2 1065.509 -0.0011 1 23.99 0.0056 K YEDEINKR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2044.2044.2.dta 1 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1136 53671 44 44 35 35 1603 2188 1 1 1 361.1934 1080.5583 3 1080.5564 0.002 1 33.65 0.0041 K SYKVSTSGPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2144.2144.3.dta 1 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1136 53671 44 44 35 35 1608 4791 1 1 0 541.8032 1081.5918 2 1081.592 -0.0003 1 44.92 0.00044 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5102.5102.2.dta 1 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1136 53671 44 44 35 35 1609 4801 1 1 0 361.5381 1081.5926 3 1081.592 0.0006 1 24.32 0.012 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5114.5114.3.dta 1 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1136 53671 44 44 35 35 1629 2126 1 1 0 544.308 1086.6015 2 1086.6033 -0.0018 1 34.49 0.002 K EQIKTLNNK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2076.2076.2.dta 1 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1136 53671 44 44 35 35 1792 2762 1 1 1 565.3132 1128.6119 2 1128.6138 -0.0019 1 70.27 2.20E-06 R GELAIKDANAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2781.2781.2.dta 1 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1136 53671 44 44 35 35 1793 5196 1 1 1 565.3143 1128.6141 2 1128.6138 0.0003 0 79.66 3.00E-07 K LSELEAALQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5582.5582.2.dta 1 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1136 53671 44 44 35 35 1890 4566 1 1 0 577.2817 1152.5488 2 1152.5485 0.0003 0 31.48 0.0029 R EYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4821.4821.2.dta 1 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1136 53671 44 44 35 35 1962 4074 1 1 1 587.3218 1172.629 2 1172.6289 0.0001 0 54.97 2.30E-05 K LVSESSDVLPK - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4285.4285.2.dta 1 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1136 53671 44 44 35 35 2070 2733 1 1 1 601.3294 1200.6443 2 1200.6462 -0.002 1 55.02 6.70E-05 R RQLETLGQEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2750.2750.2.dta 1 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1136 53671 44 44 35 35 2137 2535 1 1 1 403.536 1207.586 3 1207.5867 -0.0006 1 25.74 0.024 R TKTEISEMNR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2533.2533.3.dta 1 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1136 53671 44 44 35 35 2184 1678 1 1 1 408.8676 1223.5808 3 1223.5816 -0.0007 1 35.43 0.001 R TKTEISEMNR N Oxidation (M) 0.0000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1586.1586.3.dta 1 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1136 53671 44 44 35 35 2185 1677 1 1 1 612.7977 1223.5809 2 1223.5816 -0.0007 1 25.71 0.0039 R TKTEISEMNR N Oxidation (M) 0.0000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1585.1585.2.dta 1 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1136 53671 44 44 35 35 2422 6369 1 1 0 639.3589 1276.7032 2 1276.7027 0.0006 0 70.01 1.40E-06 K LALDIEIATYR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7116.7116.2.dta 1 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1136 53671 44 44 35 35 2607 6633 1 1 1 660.8408 1319.6671 2 1319.6642 0.0028 0 91.81 1.50E-08 R SLDMDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7481.7481.2.dta 1 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1136 53671 44 44 35 35 2689 3712 1 1 1 671.3787 1340.7429 2 1340.7412 0.0017 1 68.08 2.10E-06 R LQAEIEGLKGQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3883.3883.2.dta 1 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1136 53671 44 44 35 35 2702 5558 1 1 1 672.8407 1343.6668 2 1343.6681 -0.0012 0 95.83 3.80E-09 R ASLEAAIADAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6007.6007.2.dta 1 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1136 53671 44 44 35 35 2969 5179 1 1 0 699.3744 1396.7343 2 1396.735 -0.0007 1 72.05 3.20E-07 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5562.5562.2.dta 1 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1136 53671 44 44 35 35 2970 5184 1 1 0 466.5854 1396.7344 3 1396.735 -0.0006 1 37.73 0.00083 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5568.5568.3.dta 1 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1136 53671 44 44 35 35 2971 5173 1 1 0 466.586 1396.7361 3 1396.735 0.001 1 48.02 9.80E-05 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5556.5556.3.dta 1 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1136 53671 44 44 35 35 3058 6765 1 1 1 710.3782 1418.7418 2 1418.7405 0.0013 0 56.67 3.50E-05 R LEGLTDEINFLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7648.7648.2.dta 1 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1136 53671 44 44 35 35 3293 4196 1 1 1 737.3926 1472.7707 2 1472.7722 -0.0015 1 73.29 9.00E-07 R DGKLVSESSDVLPK - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4417.4417.2.dta 1 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1136 53671 44 44 35 35 3294 4194 1 1 1 491.9313 1472.772 3 1472.7722 -0.0002 1 49.82 8.10E-05 R DGKLVSESSDVLPK - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4415.4415.3.dta 1 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1136 53671 44 44 35 35 3327 5224 1 1 1 740.8885 1479.7625 2 1479.7643 -0.0017 1 57.4 4.10E-06 R TEMENEFVLIKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5615.5615.2.dta 1 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1136 53671 44 44 35 35 3328 5207 1 1 1 494.2619 1479.764 3 1479.7643 -0.0003 1 42.43 0.00022 R TEMENEFVLIKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5596.5596.3.dta 1 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1136 53671 44 44 35 35 3579 4856 1 1 1 517.6055 1549.7948 3 1549.7922 0.0025 1 39.15 0.00036 R QLREYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5176.5176.3.dta 1 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1136 53671 44 44 35 35 4723 4683 1 1 1 599.9495 1796.8267 3 1796.825 0.0017 1 58.59 4.30E-06 K DVDEAYMNKVELESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4970.4970.3.dta 1 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1136 53671 44 44 35 35 4760 3899 1 1 1 605.2803 1812.819 3 1812.82 -0.001 1 21.93 0.015 K DVDEAYMNKVELESR L Oxidation (M) 0.000000100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4093.4093.3.dta 1 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1136 53671 44 44 35 35 5266 6385 1 1 1 652.685 1955.0332 3 1955.0323 0.0009 1 30.47 0.003 R ASLEAAIADAEQRGELAIK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7137.7137.3.dta 1 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1136 53671 44 44 35 35 5944 5742 1 1 1 763.3748 2287.1026 3 2287.1041 -0.0015 1 41.63 0.00012 R AEAESMYQIKYEELQSLAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6260.6260.3.dta 1 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1136 53671 44 44 35 35 6295 7952 1 1 1 596.0468 2380.1582 4 2380.158 0.0002 1 17.63 0.043 R SLDMDSIIAEVKAQYEDIANR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9105.9105.4.dta 1 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1136 53671 44 44 35 35 6322 5163 1 1 1 797.0535 2388.1386 3 2388.1413 -0.0027 1 27.17 0.017 K LLEGEESRLESGMQNMSIHTK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5545.5545.3.dta 1 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1136 53671 44 44 35 35 6358 7041 1 1 1 799.7247 2396.1524 3 2396.1529 -0.0005 1 48.7 2.70E-05 R SLDMDSIIAEVKAQYEDIANR S Oxidation (M) 0.000100000000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7979.7979.3.dta 1 1 IPI00554648.3 "Keratin, type II cytoskeletal 8" 1136 53671 44 44 35 35 8163 7360 1 1 1 1057.1812 3168.5216 3 3168.5244 -0.0028 1 59.67 2.50E-06 R QLYEEEIRELQSQISDTSVVLSMDNSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8370.8370.3.dta 1 2 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1016 66149 28 28 22 22 140 2399 1 0 1 337.1977 672.3808 2 672.3806 0.0002 0 33.59 0.0091 K VDLQAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2384.2384.2.dta 1 2 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1016 66149 28 28 22 22 945 1926 1 0 1 466.7556 931.4967 2 931.4974 -0.0007 1 22.23 0.027 R SEIDNVKK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1853.1853.2.dta 1 2 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1016 66149 28 28 22 22 1384 3536 1 0 1 517.2623 1032.51 2 1032.5087 0.0013 0 48.33 2.90E-05 R TLLEGEESR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3687.3687.2.dta 1 2 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1016 66149 28 28 22 22 1529 2096 1 0 0 533.7612 1065.5079 2 1065.509 -0.0011 1 23.99 0.0056 K YEDEINKR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2044.2044.2.dta 1 2 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1016 66149 28 28 22 22 1649 1603 1 0 1 546.7524 1091.4902 2 1091.4956 -0.0054 0 93.37 4.60E-09 R GSGGGSSGGSIGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1504.1504.2.dta 1 2 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1016 66149 28 28 22 22 1982 4500 1 0 1 590.3033 1178.5921 2 1178.5931 -0.001 0 58.01 3.10E-05 K YEELQITAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4750.4750.2.dta 1 2 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1016 66149 28 28 22 22 2365 4737 1 0 1 633.321 1264.6275 2 1264.6299 -0.0024 0 62.36 1.20E-05 R TNAENEFVTIK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5036.5036.2.dta 1 2 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1016 66149 28 28 22 22 2422 6369 1 0 1 639.3589 1276.7032 2 1276.7027 0.0006 0 70.01 1.40E-06 K LALDLEIATYR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7116.7116.2.dta 1 2 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1016 66149 28 28 22 22 2518 3872 1 0 1 651.8528 1301.6911 2 1301.6939 -0.0027 1 40.66 0.0008 R NSKIEISELNR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4064.4064.2.dta 1 2 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1016 66149 28 28 22 22 2519 3882 1 0 1 434.905 1301.6932 3 1301.6939 -0.0007 1 27.91 0.02 R NSKIEISELNR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4075.4075.3.dta 1 2 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1016 66149 28 28 22 22 2520 7182 1 0 1 651.8632 1301.7119 2 1301.7078 0.0041 0 91.75 1.10E-08 R SLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8155.8155.2.dta 1 2 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1016 66149 28 28 22 22 2681 2751 1 0 1 670.837 1339.6594 2 1339.6619 -0.0025 1 69.7 1.50E-06 K SKAEAESLYQSK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2769.2769.2.dta 1 2 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1016 66149 28 28 22 22 2682 2757 1 0 1 447.5613 1339.662 3 1339.6619 0.0001 1 35.73 0.00045 K SKAEAESLYQSK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2776.2776.3.dta 1 2 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1016 66149 28 28 22 22 2946 3835 1 0 1 697.3688 1392.723 2 1392.7249 -0.0019 1 69.76 4.40E-07 R TNAENEFVTIKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4024.4024.2.dta 1 2 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1016 66149 28 28 22 22 2947 3832 1 0 1 465.2485 1392.7236 3 1392.7249 -0.0013 1 39.69 0.00032 R TNAENEFVTIKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4021.4021.3.dta 1 2 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1016 66149 28 28 22 22 3317 5999 1 0 1 738.3768 1474.739 2 1474.7416 -0.0026 0 67.46 4.70E-07 K WELLQQVDTSTR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6627.6627.2.dta 1 2 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1016 66149 28 28 22 22 3319 4285 1 0 0 738.3964 1474.7783 2 1474.778 0.0003 0 81.84 1.40E-07 R FLEQQNQVLQTK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4516.4516.2.dta 1 2 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1016 66149 28 28 22 22 3487 4887 1 0 1 508.601 1522.7812 3 1522.7813 -0.0001 1 42.27 0.00011 R LLRDYQELMNTK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5212.5212.3.dta 1 2 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1016 66149 28 28 22 22 3539 3888 1 0 1 513.933 1538.7771 3 1538.7762 0.0009 1 27.72 0.0025 R LLRDYQELMNTK L Oxidation (M) 0.000000001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4081.4081.3.dta 1 2 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1016 66149 28 28 22 22 4057 6245 1 0 1 546.9589 1637.8549 3 1637.8525 0.0024 1 39.39 0.00036 K SLNNQFASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6961.6961.3.dta 1 2 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1016 66149 28 28 22 22 4058 6256 1 0 1 819.9359 1637.8573 2 1637.8525 0.0047 1 95.21 1.20E-09 K SLNNQFASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6975.6975.2.dta 1 2 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1016 66149 28 28 22 22 4640 4463 1 0 1 883.3694 1764.7243 2 1764.7275 -0.0032 0 122.32 1.30E-12 R FSSCGGGGGSFGAGGGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4710.4710.2.dta 1 2 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1016 66149 28 28 22 22 5335 7207 1 0 1 665.3308 1992.9706 3 1992.9693 0.0013 0 40.89 0.00032 R THNLEPYFESFINNLR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8184.8184.3.dta 1 2 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1016 66149 28 28 22 22 5942 5121 1 0 1 762.7123 2285.115 3 2285.1175 -0.0025 1 26.09 0.004 K AEAESLYQSKYEELQITAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5493.5493.3.dta 1 2 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1016 66149 28 28 22 22 6307 2726 1 0 1 795.3223 2382.9452 3 2382.9447 0.0005 0 61.64 6.90E-07 R GGGGGGYGSGGSSYGSGGGSYGSGGGGGGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2742.2742.3.dta 1 2 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1016 66149 28 28 22 22 6771 4016 1 0 1 855.7261 2564.1566 3 2564.1595 -0.003 0 38.29 0.00026 R MSGECAPNVSVSVSTSHTTISGGGSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4220.4220.3.dta 1 2 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1016 66149 28 28 22 22 6836 3837 1 0 1 861.0591 2580.1554 3 2580.1545 0.001 0 35.88 0.001 R MSGECAPNVSVSVSTSHTTISGGGSR G Oxidation (M) 0.10000000000000000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4026.4026.3.dta 1 2 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1016 66149 28 28 22 22 7881 6351 1 0 1 978.1751 2931.5035 3 2931.509 -0.0055 1 72.18 5.00E-07 R FLEQQNQVLQTKWELLQQVDTSTR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7092.7092.3.dta 1 3 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 942 60448 36 36 28 28 551 4870 1 0 0 414.2186 826.4227 2 826.4225 0.0002 0 39.72 0.0021 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5192.5192.2.dta 1 3 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 942 60448 36 36 28 28 837 2672 1 0 0 453.7375 905.4604 2 905.4607 -0.0002 0 42.33 0.0018 R FLEQQNK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2684.2684.2.dta 1 3 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 942 60448 36 36 28 28 997 2971 1 0 0 473.2597 944.5049 2 944.5039 0.0009 1 31.68 0.016 R GRLDSELR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3009.3009.2.dta 1 3 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 942 60448 36 36 28 28 998 2966 1 0 0 315.8431 944.5075 3 944.5039 0.0036 1 28.02 0.039 R GRLDSELR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3003.3003.3.dta 1 3 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 942 60448 36 36 28 28 1076 1898 1 0 1 483.2486 964.4827 2 964.4839 -0.0012 1 27.13 0.038 R RGFSANSAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1823.1823.2.dta 1 3 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 942 60448 36 36 28 28 1171 1330 1 0 0 495.2299 988.4453 2 988.4462 -0.0009 0 42.94 9.40E-05 K YTTTSSSSR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1205.1205.2.dta 1 3 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 942 60448 36 36 28 28 1262 2916 1 0 0 503.2372 1004.4599 2 1004.4597 0.0003 0 40.72 0.0004 K LLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2949.2949.2.dta 1 3 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 942 60448 36 36 28 28 1316 4166 1 0 0 508.7724 1015.5302 2 1015.5298 0.0004 0 36.01 0.00069 R QLDSIVGER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4386.4386.2.dta 1 3 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 942 60448 36 36 28 28 1358 4287 1 0 0 513.7645 1025.5144 2 1025.5142 0.0002 0 72.26 2.90E-07 R SGFSSISVSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4518.4518.2.dta 1 3 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 942 60448 36 36 28 28 1400 3527 1 0 0 519.2907 1036.5669 2 1036.5665 0.0003 1 33.55 0.0018 R SLYGLGGSKR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3675.3675.2.dta 1 3 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 942 60448 36 36 28 28 1529 2096 1 0 0 533.7612 1065.5079 2 1065.509 -0.0011 1 23.99 0.0056 K YEDEINKR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2044.2044.2.dta 1 3 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 942 60448 36 36 28 28 1608 4791 1 0 0 541.8032 1081.5918 2 1081.592 -0.0003 1 44.92 0.00044 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5102.5102.2.dta 1 3 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 942 60448 36 36 28 28 1609 4801 1 0 0 361.5381 1081.5926 3 1081.592 0.0006 1 24.32 0.012 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5114.5114.3.dta 1 3 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 942 60448 36 36 28 28 1629 2126 1 0 0 544.308 1086.6015 2 1086.6033 -0.0018 1 34.49 0.002 R EQIKTLNNK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2076.2076.2.dta 1 3 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 942 60448 36 36 28 28 1737 7997 1 0 0 559.2776 1116.5407 2 1116.5411 -0.0004 1 29.47 0.0025 K YTTTSSSSRK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.916.916.2.dta 1 3 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 942 60448 36 36 28 28 1814 2589 1 0 0 567.2827 1132.5509 2 1132.5546 -0.0038 1 51.21 7.10E-05 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2594.2594.2.dta 1 3 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 942 60448 36 36 28 28 1815 2591 1 0 0 378.5255 1132.5547 3 1132.5546 0.0001 1 25.04 0.0071 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2596.2596.3.dta 1 3 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 942 60448 36 36 28 28 1890 4566 1 0 0 577.2817 1152.5488 2 1152.5485 0.0003 0 31.48 0.0029 K EYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4821.4821.2.dta 1 3 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 942 60448 36 36 28 28 1933 3958 1 0 0 583.2938 1164.573 2 1164.5775 -0.0045 0 70.17 5.00E-07 K YEELQVTAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4157.4157.2.dta 1 3 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 942 60448 36 36 28 28 2125 5340 1 0 0 602.3217 1202.6288 2 1202.6295 -0.0008 0 38.48 0.0015 K WTLLQEQGTK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5753.5753.2.dta 1 3 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 942 60448 36 36 28 28 2578 2942 1 0 0 439.2363 1314.6872 3 1314.6891 -0.002 1 36.59 0.0016 R NTKQEIAEINR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2977.2977.3.dta 1 3 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 942 60448 36 36 28 28 2649 7173 1 0 0 665.3684 1328.7223 2 1328.7187 0.0035 0 77.54 2.40E-07 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8142.8142.2.dta 1 3 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 942 60448 36 36 28 28 2741 4009 1 0 0 675.8657 1349.7168 2 1349.7191 -0.0023 1 94.5 6.40E-09 R TAAENEFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4212.4212.2.dta 1 3 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 942 60448 36 36 28 28 2742 4002 1 0 0 450.9134 1349.7184 3 1349.7191 -0.0006 1 27.09 0.01 R TAAENEFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4205.4205.3.dta 1 3 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 942 60448 36 36 28 28 2969 5179 1 0 0 699.3744 1396.7343 2 1396.735 -0.0007 1 72.05 3.20E-07 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5562.5562.2.dta 1 3 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 942 60448 36 36 28 28 2970 5184 1 0 0 466.5854 1396.7344 3 1396.735 -0.0006 1 37.73 0.00083 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5568.5568.3.dta 1 3 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 942 60448 36 36 28 28 2971 5173 1 0 0 466.586 1396.7361 3 1396.735 0.001 1 48.02 9.80E-05 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5556.5556.3.dta 1 3 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 942 60448 36 36 28 28 3016 6592 1 0 0 704.36 1406.7054 2 1406.7041 0.0013 0 84.72 6.10E-08 K ADTLTDEINFLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7428.7428.2.dta 1 3 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 942 60448 36 36 28 28 3082 3728 1 0 0 712.8193 1423.624 2 1423.6263 -0.0023 0 62.89 1.30E-06 R GSGGLGGACGGAGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3904.3904.2.dta 1 3 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 942 60448 36 36 28 28 3190 4286 1 0 1 724.3907 1446.7669 2 1446.7678 -0.0009 0 73.45 3.60E-07 R AIGGGLSSVGGGSSTIK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4517.4517.2.dta 1 3 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 942 60448 36 36 28 28 3320 3782 1 0 1 492.9388 1475.7944 3 1475.7984 -0.0039 1 22.47 0.024 R FLEQQNKVLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3964.3964.3.dta 1 3 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 942 60448 36 36 28 28 3321 3793 1 0 1 738.9055 1475.7965 2 1475.7984 -0.0019 1 43.57 0.00014 R FLEQQNKVLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3978.3978.2.dta 1 3 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 942 60448 36 36 28 28 3792 4488 1 0 0 799.882 1597.7494 2 1597.7519 -0.0025 0 80.51 1.40E-07 R ISIGGGSCAISGGYGSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4737.4737.2.dta 1 3 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 942 60448 36 36 28 28 4203 3260 1 0 0 556.593 1666.7572 3 1666.7594 -0.0022 1 66.4 5.90E-07 R SRGSGGLGGACGGAGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3343.3343.3.dta 1 3 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 942 60448 36 36 28 28 6405 8367 1 0 0 605.3181 2417.2431 4 2417.2438 -0.0006 1 22.58 0.021 R NLDLDSIIAEVKAQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9611.9611.4.dta 1 3 IPI00479403.3 "Keratin, type II cytoskeletal 6C" 942 60448 36 36 28 28 6406 8356 1 0 0 806.7551 2417.2436 3 2417.2438 -0.0002 1 35.35 0.00073 R NLDLDSIIAEVKAQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9598.9598.3.dta 1 4 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 910 60247 34 34 27 27 551 4870 1 0 0 414.2186 826.4227 2 826.4225 0.0002 0 39.72 0.0021 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5192.5192.2.dta 1 4 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 910 60247 34 34 27 27 837 2672 1 0 0 453.7375 905.4604 2 905.4607 -0.0002 0 42.33 0.0018 R FLEQQNK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2684.2684.2.dta 1 4 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 910 60247 34 34 27 27 997 2971 1 0 0 473.2597 944.5049 2 944.5039 0.0009 1 31.68 0.016 R GRLDSELR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3009.3009.2.dta 1 4 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 910 60247 34 34 27 27 998 2966 1 0 0 315.8431 944.5075 3 944.5039 0.0036 1 28.02 0.039 R GRLDSELR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3003.3003.3.dta 1 4 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 910 60247 34 34 27 27 1171 1330 1 0 0 495.2299 988.4453 2 988.4462 -0.0009 0 42.94 9.40E-05 K YTTTSSSSR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1205.1205.2.dta 1 4 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 910 60247 34 34 27 27 1262 2916 1 0 0 503.2372 1004.4599 2 1004.4597 0.0003 0 40.72 0.0004 K LLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2949.2949.2.dta 1 4 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 910 60247 34 34 27 27 1316 4166 1 0 0 508.7724 1015.5302 2 1015.5298 0.0004 0 36.01 0.00069 R QLDSIVGER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4386.4386.2.dta 1 4 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 910 60247 34 34 27 27 1358 4287 1 0 0 513.7645 1025.5144 2 1025.5142 0.0002 0 72.26 2.90E-07 R SGFSSISVSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4518.4518.2.dta 1 4 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 910 60247 34 34 27 27 1400 3527 1 0 0 519.2907 1036.5669 2 1036.5665 0.0003 1 33.55 0.0018 R SLYGLGGSKR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3675.3675.2.dta 1 4 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 910 60247 34 34 27 27 1529 2096 1 0 0 533.7612 1065.5079 2 1065.509 -0.0011 1 23.99 0.0056 K YEDEINKR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2044.2044.2.dta 1 4 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 910 60247 34 34 27 27 1608 4791 1 0 0 541.8032 1081.5918 2 1081.592 -0.0003 1 44.92 0.00044 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5102.5102.2.dta 1 4 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 910 60247 34 34 27 27 1609 4801 1 0 0 361.5381 1081.5926 3 1081.592 0.0006 1 24.32 0.012 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5114.5114.3.dta 1 4 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 910 60247 34 34 27 27 1629 2126 1 0 0 544.308 1086.6015 2 1086.6033 -0.0018 1 34.49 0.002 R EQIKTLNNK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2076.2076.2.dta 1 4 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 910 60247 34 34 27 27 1737 7997 1 0 0 559.2776 1116.5407 2 1116.5411 -0.0004 1 29.47 0.0025 K YTTTSSSSRK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.916.916.2.dta 1 4 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 910 60247 34 34 27 27 1814 2589 1 0 0 567.2827 1132.5509 2 1132.5546 -0.0038 1 51.21 7.10E-05 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2594.2594.2.dta 1 4 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 910 60247 34 34 27 27 1815 2591 1 0 0 378.5255 1132.5547 3 1132.5546 0.0001 1 25.04 0.0071 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2596.2596.3.dta 1 4 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 910 60247 34 34 27 27 1890 4566 1 0 0 577.2817 1152.5488 2 1152.5485 0.0003 0 31.48 0.0029 K EYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4821.4821.2.dta 1 4 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 910 60247 34 34 27 27 1933 3958 1 0 0 583.2938 1164.573 2 1164.5775 -0.0045 0 70.17 5.00E-07 K YEELQVTAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4157.4157.2.dta 1 4 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 910 60247 34 34 27 27 2125 5340 1 0 0 602.3217 1202.6288 2 1202.6295 -0.0008 0 38.48 0.0015 K WTLLQEQGTK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5753.5753.2.dta 1 4 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 910 60247 34 34 27 27 2578 2942 1 0 0 439.2363 1314.6872 3 1314.6891 -0.002 1 36.59 0.0016 R NTKQEIAEINR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2977.2977.3.dta 1 4 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 910 60247 34 34 27 27 2649 7173 1 0 0 665.3684 1328.7223 2 1328.7187 0.0035 0 77.54 2.40E-07 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8142.8142.2.dta 1 4 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 910 60247 34 34 27 27 2741 4009 1 0 0 675.8657 1349.7168 2 1349.7191 -0.0023 1 94.5 6.40E-09 R TAAENEFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4212.4212.2.dta 1 4 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 910 60247 34 34 27 27 2742 4002 1 0 0 450.9134 1349.7184 3 1349.7191 -0.0006 1 27.09 0.01 R TAAENEFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4205.4205.3.dta 1 4 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 910 60247 34 34 27 27 2969 5179 1 0 0 699.3744 1396.7343 2 1396.735 -0.0007 1 72.05 3.20E-07 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5562.5562.2.dta 1 4 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 910 60247 34 34 27 27 2970 5184 1 0 0 466.5854 1396.7344 3 1396.735 -0.0006 1 37.73 0.00083 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5568.5568.3.dta 1 4 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 910 60247 34 34 27 27 2971 5173 1 0 0 466.586 1396.7361 3 1396.735 0.001 1 48.02 9.80E-05 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5556.5556.3.dta 1 4 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 910 60247 34 34 27 27 3016 6592 1 0 0 704.36 1406.7054 2 1406.7041 0.0013 0 84.72 6.10E-08 K ADTLTDEINFLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7428.7428.2.dta 1 4 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 910 60247 34 34 27 27 3082 3728 1 0 0 712.8193 1423.624 2 1423.6263 -0.0023 0 62.89 1.30E-06 R GSGGLGGACGGAGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3904.3904.2.dta 1 4 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 910 60247 34 34 27 27 3128 3553 1 0 1 718.3708 1434.7271 2 1434.7315 -0.0043 0 46.21 9.20E-05 R ATGGGLSSVGGGSSTIK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3706.3706.2.dta 1 4 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 910 60247 34 34 27 27 3792 4488 1 0 0 799.882 1597.7494 2 1597.7519 -0.0025 0 80.51 1.40E-07 R ISIGGGSCAISGGYGSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4737.4737.2.dta 1 4 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 910 60247 34 34 27 27 4203 3260 1 0 0 556.593 1666.7572 3 1666.7594 -0.0022 1 66.4 5.90E-07 R SRGSGGLGGACGGAGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3343.3343.3.dta 1 4 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 910 60247 34 34 27 27 4619 5433 1 0 0 587.3246 1758.9521 3 1758.9516 0.0005 1 46.07 0.00019 K VLDTKWTLLQEQGTK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5861.5861.3.dta 1 4 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 910 60247 34 34 27 27 6405 8367 1 0 0 605.3181 2417.2431 4 2417.2438 -0.0006 1 22.58 0.021 R NLDLDSIIAEVKAQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9611.9611.4.dta 1 4 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 910 60247 34 34 27 27 6406 8356 1 0 0 806.7551 2417.2436 3 2417.2438 -0.0002 1 35.35 0.00073 R NLDLDSIIAEVKAQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9598.9598.3.dta 1 5 IPI00306959.10 "Keratin, type II cytoskeletal 7" 724 51443 25 25 20 20 551 4870 1 0 0 414.2186 826.4227 2 826.4225 0.0002 0 39.72 0.0021 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5192.5192.2.dta 1 5 IPI00306959.10 "Keratin, type II cytoskeletal 7" 724 51443 25 25 20 20 837 2672 1 0 0 453.7375 905.4604 2 905.4607 -0.0002 0 42.33 0.0018 R FLEQQNK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2684.2684.2.dta 1 5 IPI00306959.10 "Keratin, type II cytoskeletal 7" 724 51443 25 25 20 20 1441 5349 1 0 1 523.2872 1044.5598 2 1044.5604 -0.0006 0 36.49 0.00083 K WTLLQEQK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5763.5763.2.dta 1 5 IPI00306959.10 "Keratin, type II cytoskeletal 7" 724 51443 25 25 20 20 1608 4791 1 0 0 541.8032 1081.5918 2 1081.592 -0.0003 1 44.92 0.00044 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5102.5102.2.dta 1 5 IPI00306959.10 "Keratin, type II cytoskeletal 7" 724 51443 25 25 20 20 1609 4801 1 0 0 361.5381 1081.5926 3 1081.592 0.0006 1 24.32 0.012 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5114.5114.3.dta 1 5 IPI00306959.10 "Keratin, type II cytoskeletal 7" 724 51443 25 25 20 20 1611 1429 1 0 1 542.2676 1082.5207 2 1082.5217 -0.001 1 14.67 0.042 K HGDDLRNTR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1313.1313.2.dta 1 5 IPI00306959.10 "Keratin, type II cytoskeletal 7" 724 51443 25 25 20 20 1691 3847 1 0 1 552.7925 1103.5704 2 1103.5724 -0.002 0 58.62 3.60E-05 R SAYGGPVGAGIR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4037.4037.2.dta 1 5 IPI00306959.10 "Keratin, type II cytoskeletal 7" 724 51443 25 25 20 20 2281 1790 1 0 1 623.3248 1244.635 2 1244.636 -0.0011 1 44.53 0.0009 R VRQEESEQIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1706.1706.2.dta 1 5 IPI00306959.10 "Keratin, type II cytoskeletal 7" 724 51443 25 25 20 20 2406 6908 1 0 1 636.8571 1271.6997 2 1271.6973 0.0024 0 84.54 6.20E-08 R SLDLDGIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7818.7818.2.dta 1 5 IPI00306959.10 "Keratin, type II cytoskeletal 7" 724 51443 25 25 20 20 2422 6369 1 0 0 639.3589 1276.7032 2 1276.7027 0.0006 0 70.01 1.40E-06 K LALDIEIATYR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7116.7116.2.dta 1 5 IPI00306959.10 "Keratin, type II cytoskeletal 7" 724 51443 25 25 20 20 2805 2676 1 0 1 682.322 1362.6294 2 1362.631 -0.0016 1 26.61 0.0032 R NTRNEISEMNR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2688.2688.2.dta 1 5 IPI00306959.10 "Keratin, type II cytoskeletal 7" 724 51443 25 25 20 20 2906 3933 1 0 1 693.3708 1384.727 2 1384.731 -0.004 1 69.51 7.30E-07 R AKQEELEAALQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4130.4130.2.dta 1 5 IPI00306959.10 "Keratin, type II cytoskeletal 7" 724 51443 25 25 20 20 2907 3932 1 0 1 462.5845 1384.7318 3 1384.731 0.0008 1 35.89 0.0057 R AKQEELEAALQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4129.4129.3.dta 1 5 IPI00306959.10 "Keratin, type II cytoskeletal 7" 724 51443 25 25 20 20 2969 5179 1 0 0 699.3744 1396.7343 2 1396.735 -0.0007 1 72.05 3.20E-07 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5562.5562.2.dta 1 5 IPI00306959.10 "Keratin, type II cytoskeletal 7" 724 51443 25 25 20 20 2970 5184 1 0 0 466.5854 1396.7344 3 1396.735 -0.0006 1 37.73 0.00083 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5568.5568.3.dta 1 5 IPI00306959.10 "Keratin, type II cytoskeletal 7" 724 51443 25 25 20 20 2971 5173 1 0 0 466.586 1396.7361 3 1396.735 0.001 1 48.02 9.80E-05 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5556.5556.3.dta 1 5 IPI00306959.10 "Keratin, type II cytoskeletal 7" 724 51443 25 25 20 20 3050 6437 1 0 1 709.8674 1417.7203 2 1417.7201 0.0002 0 91.71 6.20E-09 K VDALNDEINFLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7200.7200.2.dta 1 5 IPI00306959.10 "Keratin, type II cytoskeletal 7" 724 51443 25 25 20 20 3175 3420 1 0 1 721.3906 1440.7667 2 1440.7684 -0.0018 1 75.78 7.80E-08 R LQAEIDNIKNQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3538.3538.2.dta 1 5 IPI00306959.10 "Keratin, type II cytoskeletal 7" 724 51443 25 25 20 20 3178 7018 1 0 1 721.9036 1441.7926 2 1441.7929 -0.0003 0 77.73 8.40E-08 R LPDIFEAQIAGLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7953.7953.2.dta 1 5 IPI00306959.10 "Keratin, type II cytoskeletal 7" 724 51443 25 25 20 20 3364 4353 1 0 0 497.612 1489.8141 3 1489.814 0.0001 1 27.76 0.0037 R FLEQQNKLLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4589.4589.3.dta 1 5 IPI00306959.10 "Keratin, type II cytoskeletal 7" 724 51443 25 25 20 20 4666 6545 1 0 1 591.6602 1771.9586 3 1771.9581 0.0006 1 62.6 7.10E-06 K SSRLPDIFEAQIAGLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7365.7365.3.dta 1 5 IPI00306959.10 "Keratin, type II cytoskeletal 7" 724 51443 25 25 20 20 5540 6528 1 0 1 696.7039 2087.0897 3 2087.0898 -0.0001 1 45.16 5.80E-05 K VELEAKVDALNDEINFLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7341.7341.3.dta 1 5 IPI00306959.10 "Keratin, type II cytoskeletal 7" 724 51443 25 25 20 20 5721 8169 1 0 1 1112.0629 2222.1112 2 2222.114 -0.0028 1 16.02 0.031 R SLDLDGIIAEVKAQYEEMAK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9367.9367.2.dta 1 5 IPI00306959.10 "Keratin, type II cytoskeletal 7" 724 51443 25 25 20 20 5722 8155 1 0 1 741.7128 2222.1165 3 2222.114 0.0025 1 35.47 0.00076 R SLDLDGIIAEVKAQYEEMAK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9351.9351.3.dta 1 5 IPI00306959.10 "Keratin, type II cytoskeletal 7" 724 51443 25 25 20 20 8002 7247 1 0 1 1004.1553 3009.4442 3 3009.4448 -0.0006 0 27.61 0.0026 R TLNETELTELQSQISDTSVVLSMDNSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8231.8231.3.dta 1 6 IPI00009867.2 "Keratin, type II cytoskeletal 5" 660 62637 27 27 22 22 551 4870 1 0 0 414.2186 826.4227 2 826.4225 0.0002 0 39.72 0.0021 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5192.5192.2.dta 1 6 IPI00009867.2 "Keratin, type II cytoskeletal 5" 660 62637 27 27 22 22 691 2094 1 0 1 433.1992 864.3839 2 864.3839 0 0 66.56 5.70E-07 R SGGGGGGGFGR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2042.2042.2.dta 1 6 IPI00009867.2 "Keratin, type II cytoskeletal 5" 660 62637 27 27 22 22 837 2672 1 0 0 453.7375 905.4604 2 905.4607 -0.0002 0 42.33 0.0018 R FLEQQNK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2684.2684.2.dta 1 6 IPI00009867.2 "Keratin, type II cytoskeletal 5" 660 62637 27 27 22 22 997 2971 1 0 0 473.2597 944.5049 2 944.5039 0.0009 1 31.68 0.016 R GRLDSELR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3009.3009.2.dta 1 6 IPI00009867.2 "Keratin, type II cytoskeletal 5" 660 62637 27 27 22 22 998 2966 1 0 0 315.8431 944.5075 3 944.5039 0.0036 1 28.02 0.039 R GRLDSELR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3003.3003.3.dta 1 6 IPI00009867.2 "Keratin, type II cytoskeletal 5" 660 62637 27 27 22 22 1262 2916 1 0 0 503.2372 1004.4599 2 1004.4597 0.0003 0 40.72 0.0004 K LLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2949.2949.2.dta 1 6 IPI00009867.2 "Keratin, type II cytoskeletal 5" 660 62637 27 27 22 22 1316 4166 1 0 0 508.7724 1015.5302 2 1015.5298 0.0004 0 36.01 0.00069 R QLDSIVGER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4386.4386.2.dta 1 6 IPI00009867.2 "Keratin, type II cytoskeletal 5" 660 62637 27 27 22 22 1529 2096 1 0 0 533.7612 1065.5079 2 1065.509 -0.0011 1 23.99 0.0056 K YEDEINKR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2044.2044.2.dta 1 6 IPI00009867.2 "Keratin, type II cytoskeletal 5" 660 62637 27 27 22 22 1608 4791 1 0 0 541.8032 1081.5918 2 1081.592 -0.0003 1 44.92 0.00044 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5102.5102.2.dta 1 6 IPI00009867.2 "Keratin, type II cytoskeletal 5" 660 62637 27 27 22 22 1609 4801 1 0 0 361.5381 1081.5926 3 1081.592 0.0006 1 24.32 0.012 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5114.5114.3.dta 1 6 IPI00009867.2 "Keratin, type II cytoskeletal 5" 660 62637 27 27 22 22 1629 2126 1 0 0 544.308 1086.6015 2 1086.6033 -0.0018 1 34.49 0.002 R EQIKTLNNK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2076.2076.2.dta 1 6 IPI00009867.2 "Keratin, type II cytoskeletal 5" 660 62637 27 27 22 22 1814 2589 1 0 0 567.2827 1132.5509 2 1132.5546 -0.0038 1 51.21 7.10E-05 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2594.2594.2.dta 1 6 IPI00009867.2 "Keratin, type II cytoskeletal 5" 660 62637 27 27 22 22 1815 2591 1 0 0 378.5255 1132.5547 3 1132.5546 0.0001 1 25.04 0.0071 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2596.2596.3.dta 1 6 IPI00009867.2 "Keratin, type II cytoskeletal 5" 660 62637 27 27 22 22 2034 2952 1 0 1 597.79 1193.5654 2 1193.5676 -0.0022 0 59.67 1.10E-05 K YEELQQTAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2988.2988.2.dta 1 6 IPI00009867.2 "Keratin, type II cytoskeletal 5" 660 62637 27 27 22 22 2125 5340 1 0 0 602.3217 1202.6288 2 1202.6295 -0.0008 0 38.48 0.0015 K WTLLQEQGTK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5753.5753.2.dta 1 6 IPI00009867.2 "Keratin, type II cytoskeletal 5" 660 62637 27 27 22 22 2649 7173 1 0 0 665.3684 1328.7223 2 1328.7187 0.0035 0 77.54 2.40E-07 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8142.8142.2.dta 1 6 IPI00009867.2 "Keratin, type II cytoskeletal 5" 660 62637 27 27 22 22 2908 5554 1 0 1 462.5929 1384.7569 3 1384.7561 0.0007 1 31.39 0.0021 R NKLAELEEALQK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6003.6003.3.dta 1 6 IPI00009867.2 "Keratin, type II cytoskeletal 5" 660 62637 27 27 22 22 2969 5179 1 0 0 699.3744 1396.7343 2 1396.735 -0.0007 1 72.05 3.20E-07 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5562.5562.2.dta 1 6 IPI00009867.2 "Keratin, type II cytoskeletal 5" 660 62637 27 27 22 22 2970 5184 1 0 0 466.5854 1396.7344 3 1396.735 -0.0006 1 37.73 0.00083 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5568.5568.3.dta 1 6 IPI00009867.2 "Keratin, type II cytoskeletal 5" 660 62637 27 27 22 22 2971 5173 1 0 0 466.586 1396.7361 3 1396.735 0.001 1 48.02 9.80E-05 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5556.5556.3.dta 1 6 IPI00009867.2 "Keratin, type II cytoskeletal 5" 660 62637 27 27 22 22 3021 4250 1 0 1 705.8424 1409.6703 2 1409.6722 -0.0019 0 92.6 2.70E-09 R VSLAGACGVGGYGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4477.4477.2.dta 1 6 IPI00009867.2 "Keratin, type II cytoskeletal 5" 660 62637 27 27 22 22 3022 4445 1 0 1 705.8636 1409.7127 2 1409.7151 -0.0023 0 39.33 0.00027 R SFSTASAITPSVSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4691.4691.2.dta 1 6 IPI00009867.2 "Keratin, type II cytoskeletal 5" 660 62637 27 27 22 22 3023 4633 1 0 1 470.9149 1409.7228 3 1409.7224 0.0004 1 32.16 0.0033 R TTAENEFVMLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4910.4910.3.dta 1 6 IPI00009867.2 "Keratin, type II cytoskeletal 5" 660 62637 27 27 22 22 3528 5002 1 0 1 513.2725 1536.7957 3 1536.797 -0.0012 1 23.18 0.0067 R LLREYQELMNTK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5355.5355.3.dta 1 6 IPI00009867.2 "Keratin, type II cytoskeletal 5" 660 62637 27 27 22 22 4619 5433 1 0 0 587.3246 1758.9521 3 1758.9516 0.0005 1 46.07 0.00019 K VLDTKWTLLQEQGTK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5861.5861.3.dta 1 6 IPI00009867.2 "Keratin, type II cytoskeletal 5" 660 62637 27 27 22 22 6366 8400 1 0 1 802.0836 2403.229 3 2403.2281 0.0009 1 50.3 0.00012 R NLDLDSIIAEVKAQYEEIANR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9650.9650.3.dta 1 6 IPI00009867.2 "Keratin, type II cytoskeletal 5" 660 62637 27 27 22 22 6404 5423 1 0 1 806.7112 2417.1119 3 2417.1135 -0.0016 1 49.29 2.40E-05 R TEAESWYQTKYEELQQTAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5850.5850.3.dta 1 7 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 613 66110 23 23 17 17 389 2190 1 0 1 390.1934 778.3722 2 778.3722 0 0 49 5.90E-05 K AAFGGSGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2146.2146.2.dta 1 7 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 613 66110 23 23 17 17 551 4870 1 0 0 414.2186 826.4227 2 826.4225 0.0002 0 39.72 0.0021 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5192.5192.2.dta 1 7 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 613 66110 23 23 17 17 1262 2916 1 0 0 503.2372 1004.4599 2 1004.4597 0.0003 0 40.72 0.0004 K LLEGEECR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2949.2949.2.dta 1 7 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 613 66110 23 23 17 17 1398 4529 1 0 1 519.2665 1036.5184 2 1036.5189 -0.0005 0 60 1.60E-05 R YLDGLTAER T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4781.4781.2.dta 1 7 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 613 66110 23 23 17 17 1529 2096 1 0 0 533.7612 1065.5079 2 1065.509 -0.0011 1 23.99 0.0056 K YEDEINKR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2044.2044.2.dta 1 7 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 613 66110 23 23 17 17 1608 4791 1 0 0 541.8032 1081.5918 2 1081.592 -0.0003 1 44.92 0.00044 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5102.5102.2.dta 1 7 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 613 66110 23 23 17 17 1609 4801 1 0 0 361.5381 1081.5926 3 1081.592 0.0006 1 24.32 0.012 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5114.5114.3.dta 1 7 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 613 66110 23 23 17 17 1629 2126 1 0 0 544.308 1086.6015 2 1086.6033 -0.0018 1 34.49 0.002 R EQIKTLNNK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2076.2076.2.dta 1 7 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 613 66110 23 23 17 17 1802 3848 1 0 1 566.2581 1130.5017 2 1130.5026 -0.0009 0 52.47 2.10E-05 R STSSFSCLSR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4038.4038.2.dta 1 7 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 613 66110 23 23 17 17 1814 2589 1 0 0 567.2827 1132.5509 2 1132.5546 -0.0038 1 51.21 7.10E-05 R KLLEGEECR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2594.2594.2.dta 1 7 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 613 66110 23 23 17 17 1815 2591 1 0 0 378.5255 1132.5547 3 1132.5546 0.0001 1 25.04 0.0071 R KLLEGEECR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2596.2596.3.dta 1 7 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 613 66110 23 23 17 17 2049 2255 1 0 1 599.2776 1196.5407 2 1196.5422 -0.0015 0 28.09 0.015 K GGSISGGGYGSGGGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2218.2218.2.dta 1 7 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 613 66110 23 23 17 17 2649 7173 1 0 0 665.3684 1328.7223 2 1328.7187 0.0035 0 77.54 2.40E-07 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8142.8142.2.dta 1 7 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 613 66110 23 23 17 17 2672 3949 1 0 1 668.8583 1335.702 2 1335.7034 -0.0014 1 70.66 2.40E-07 R TAAENDFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4147.4147.2.dta 1 7 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 613 66110 23 23 17 17 2673 3946 1 0 1 446.242 1335.7041 3 1335.7034 0.0007 1 26.95 0.0059 R TAAENDFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4144.4144.3.dta 1 7 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 613 66110 23 23 17 17 2934 2459 1 0 1 464.5646 1390.672 3 1390.6728 -0.0008 1 46.61 0.00025 R SKEEAEALYHSK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2449.2449.3.dta 1 7 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 613 66110 23 23 17 17 2969 5179 1 0 0 699.3744 1396.7343 2 1396.735 -0.0007 1 72.05 3.20E-07 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5562.5562.2.dta 1 7 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 613 66110 23 23 17 17 2970 5184 1 0 0 466.5854 1396.7344 3 1396.735 -0.0006 1 37.73 0.00083 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5568.5568.3.dta 1 7 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 613 66110 23 23 17 17 2971 5173 1 0 0 466.586 1396.7361 3 1396.735 0.001 1 48.02 9.80E-05 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5556.5556.3.dta 1 7 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 613 66110 23 23 17 17 3247 7050 1 0 1 730.9034 1459.7922 2 1459.7922 0 0 62.18 4.60E-06 K VDLLNQEIEFLK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7992.7992.2.dta 1 7 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 613 66110 23 23 17 17 3319 4285 1 0 0 738.3964 1474.7783 2 1474.778 0.0003 0 81.84 1.40E-07 R FLEQQNQVLQTK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4516.4516.2.dta 1 7 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 613 66110 23 23 17 17 6405 8367 1 0 0 605.3181 2417.2431 4 2417.2438 -0.0006 1 22.58 0.021 R NLDLDSIIAEVKAQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9611.9611.4.dta 1 7 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 613 66110 23 23 17 17 6406 8356 1 0 0 806.7551 2417.2436 3 2417.2438 -0.0002 1 35.35 0.00073 R NLDLDSIIAEVKAQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9598.9598.3.dta 1 8 IPI00418471.6 Vimentin 496 53676 23 23 19 19 103 3356 1 0 0 323.182 644.3494 2 644.3493 0.0001 0 33.71 0.019 R LDLER K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3468.3468.2.dta 1 8 IPI00418471.6 Vimentin 496 53676 23 23 19 19 199 2574 1 0 1 351.2008 700.3871 2 700.3868 0.0003 0 56.6 5.60E-05 R SSVPGVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2577.2577.2.dta 1 8 IPI00418471.6 Vimentin 496 53676 23 23 19 19 837 2672 1 0 0 453.7375 905.4604 2 905.4607 -0.0002 0 42.33 0.0018 R FLEQQNK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2684.2684.2.dta 1 8 IPI00418471.6 Vimentin 496 53676 23 23 19 19 1349 2293 1 0 1 512.2592 1022.5038 2 1022.5032 0.0005 0 37.2 0.00052 R QQYESVAAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2260.2260.2.dta 1 8 IPI00418471.6 Vimentin 496 53676 23 23 19 19 1367 1564 1 0 1 514.7586 1027.5027 2 1027.5047 -0.002 1 28.71 0.017 R SVSSSSYRR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1460.1460.2.dta 1 8 IPI00418471.6 Vimentin 496 53676 23 23 19 19 1775 4040 1 0 1 375.8732 1124.5978 3 1124.5978 0 1 32.19 0.0019 R FANYIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4247.4247.3.dta 1 8 IPI00418471.6 Vimentin 496 53676 23 23 19 19 2452 2240 1 0 1 644.3356 1286.6567 2 1286.6579 -0.0012 1 42.7 0.0012 R QVDQLTNDKAR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2201.2201.2.dta 1 8 IPI00418471.6 Vimentin 496 53676 23 23 19 19 2453 2236 1 0 1 429.8934 1286.6583 3 1286.6579 0.0004 1 27.14 0.017 R QVDQLTNDKAR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2196.2196.3.dta 1 8 IPI00418471.6 Vimentin 496 53676 23 23 19 19 3385 4324 1 0 1 748.3952 1494.7759 2 1494.779 -0.0032 0 21.5 0.0096 R TYSLGSALRPSTSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4558.4558.2.dta 1 8 IPI00418471.6 Vimentin 496 53676 23 23 19 19 3386 4320 1 0 1 499.2664 1494.7774 3 1494.779 -0.0016 0 27.95 0.0031 R TYSLGSALRPSTSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4554.4554.3.dta 1 8 IPI00418471.6 Vimentin 496 53676 23 23 19 19 3495 4622 1 0 1 762.8683 1523.7221 2 1523.7256 -0.0034 1 74.7 1.00E-07 K NLQEAEEWYKSK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4898.4898.2.dta 1 8 IPI00418471.6 Vimentin 496 53676 23 23 19 19 3502 4617 1 0 1 509.9476 1526.8209 3 1526.8205 0.0004 1 25.51 0.018 R HLREYQDLLNVK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4893.4893.3.dta 1 8 IPI00418471.6 Vimentin 496 53676 23 23 19 19 3510 6036 1 0 1 511.9556 1532.845 3 1532.845 0 1 57.15 2.60E-05 R KVESLQEEIAFLK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6677.6677.3.dta 1 8 IPI00418471.6 Vimentin 496 53676 23 23 19 19 3541 5749 1 0 1 770.4577 1538.9009 2 1538.9032 -0.0023 1 55 9.50E-06 K ILLAELEQLKGQGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6267.6267.2.dta 1 8 IPI00418471.6 Vimentin 496 53676 23 23 19 19 3542 5731 1 0 1 513.9752 1538.9036 3 1538.9032 0.0005 1 39.37 0.00043 K ILLAELEQLKGQGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6245.6245.3.dta 1 8 IPI00418471.6 Vimentin 496 53676 23 23 19 19 3639 7404 1 0 1 785.9518 1569.889 2 1569.8878 0.0012 0 38.07 0.00027 R ISLPLPNFSSLNLR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8432.8432.2.dta 1 8 IPI00418471.6 Vimentin 496 53676 23 23 19 19 4308 5231 1 0 1 563.6131 1687.8175 3 1687.8199 -0.0024 1 33.8 0.00095 R VEVERDNLAEDIMR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5623.5623.3.dta 1 8 IPI00418471.6 Vimentin 496 53676 23 23 19 19 4679 4184 1 0 1 592.9589 1775.8548 3 1775.855 -0.0003 1 42.21 0.00036 K FADLSEAANRNNDALR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4404.4404.3.dta 1 8 IPI00418471.6 Vimentin 496 53676 23 23 19 19 4846 3302 1 0 1 612.9382 1835.7927 3 1835.7922 0.0005 0 23.25 0.0066 R DGQVINETSQHHDDLE - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3403.3403.3.dta 1 8 IPI00418471.6 Vimentin 496 53676 23 23 19 19 5605 7504 1 0 1 1063.5366 2125.0587 2 2125.0579 0.0008 0 72.69 1.50E-07 R LLQDSVDFSLADAINTEFK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8561.8561.2.dta 1 8 IPI00418471.6 Vimentin 496 53676 23 23 19 19 5606 7510 1 0 1 709.3605 2125.0596 3 2125.0579 0.0017 0 45.27 5.70E-05 R LLQDSVDFSLADAINTEFK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8568.8568.3.dta 1 8 IPI00418471.6 Vimentin 496 53676 23 23 19 19 6281 5372 1 0 1 793.0584 2376.1532 3 2376.1591 -0.0059 1 23.35 0.0065 R QVQSLTCEVDALKGTNESLER Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5791.5791.3.dta 1 8 IPI00418471.6 Vimentin 496 53676 23 23 19 19 6606 7160 1 0 1 833.0903 2496.2492 3 2496.2496 -0.0005 1 37.94 0.00047 R LLQDSVDFSLADAINTEFKNTR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8129.8129.3.dta 1 9 IPI00182654.5 "Keratin, hair, basic, 1" 188 57059 6 6 6 6 837 2672 1 0 0 453.7375 905.4604 2 905.4607 -0.0002 0 42.33 0.0018 R FLEQQNK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2684.2684.2.dta 1 9 IPI00182654.5 "Keratin, hair, basic, 1" 188 57059 6 6 6 6 1089 4092 1 0 1 484.7508 967.4871 2 967.4875 -0.0005 0 30.33 0.0041 K LQFYQNR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4304.4304.2.dta 1 9 IPI00182654.5 "Keratin, hair, basic, 1" 188 57059 6 6 6 6 1531 4762 1 0 1 533.8051 1065.5957 2 1065.5971 -0.0014 1 64.97 1.20E-06 R FAAFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5063.5063.2.dta 1 9 IPI00182654.5 "Keratin, hair, basic, 1" 188 57059 6 6 6 6 2282 2828 1 0 1 623.3253 1244.636 2 1244.636 -0.0001 1 54.41 4.90E-05 R TKEEINELNR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2854.2854.2.dta 1 9 IPI00182654.5 "Keratin, hair, basic, 1" 188 57059 6 6 6 6 2610 4077 1 0 1 660.8607 1319.7069 2 1319.7085 -0.0016 1 76.06 5.20E-07 R ATAENEFVALKK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4288.4288.2.dta 1 9 IPI00182654.5 "Keratin, hair, basic, 1" 188 57059 6 6 6 6 3364 4353 1 0 0 497.612 1489.8141 3 1489.814 0.0001 1 27.76 0.0037 R FLEQQNKLLETK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4589.4589.3.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 937 60273 35 35 28 28 551 4870 1 0 0 414.2186 826.4227 2 826.4225 0.0002 0 39.72 0.0021 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5192.5192.2.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 937 60273 35 35 28 28 837 2672 1 0 0 453.7375 905.4604 2 905.4607 -0.0002 0 42.33 0.0018 R FLEQQNK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2684.2684.2.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 937 60273 35 35 28 28 997 2971 1 0 0 473.2597 944.5049 2 944.5039 0.0009 1 31.68 0.016 R GRLDSELR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3009.3009.2.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 937 60273 35 35 28 28 998 2966 1 0 0 315.8431 944.5075 3 944.5039 0.0036 1 28.02 0.039 R GRLDSELR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3003.3003.3.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 937 60273 35 35 28 28 1076 1898 1 0 1 483.2486 964.4827 2 964.4839 -0.0012 1 27.13 0.038 R RGFSANSAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1823.1823.2.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 937 60273 35 35 28 28 1171 1330 1 0 0 495.2299 988.4453 2 988.4462 -0.0009 0 42.94 9.40E-05 K YTTTSSSSR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1205.1205.2.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 937 60273 35 35 28 28 1262 2916 1 0 0 503.2372 1004.4599 2 1004.4597 0.0003 0 40.72 0.0004 K LLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2949.2949.2.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 937 60273 35 35 28 28 1316 4166 1 0 0 508.7724 1015.5302 2 1015.5298 0.0004 0 36.01 0.00069 R QLDSIVGER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4386.4386.2.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 937 60273 35 35 28 28 1358 4287 1 0 0 513.7645 1025.5144 2 1025.5142 0.0002 0 72.26 2.90E-07 R SGFSSISVSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4518.4518.2.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 937 60273 35 35 28 28 1400 3527 1 0 0 519.2907 1036.5669 2 1036.5665 0.0003 1 33.55 0.0018 R SLYGLGGSKR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3675.3675.2.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 937 60273 35 35 28 28 1529 2096 1 0 0 533.7612 1065.5079 2 1065.509 -0.0011 1 23.99 0.0056 K YEDEINKR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2044.2044.2.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 937 60273 35 35 28 28 1608 4791 1 0 0 541.8032 1081.5918 2 1081.592 -0.0003 1 44.92 0.00044 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5102.5102.2.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 937 60273 35 35 28 28 1609 4801 1 0 0 361.5381 1081.5926 3 1081.592 0.0006 1 24.32 0.012 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5114.5114.3.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 937 60273 35 35 28 28 1629 2126 1 0 0 544.308 1086.6015 2 1086.6033 -0.0018 1 34.49 0.002 R EQIKTLNNK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2076.2076.2.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 937 60273 35 35 28 28 1737 7997 1 0 0 559.2776 1116.5407 2 1116.5411 -0.0004 1 29.47 0.0025 K YTTTSSSSRK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.916.916.2.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 937 60273 35 35 28 28 1814 2589 1 0 0 567.2827 1132.5509 2 1132.5546 -0.0038 1 51.21 7.10E-05 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2594.2594.2.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 937 60273 35 35 28 28 1815 2591 1 0 0 378.5255 1132.5547 3 1132.5546 0.0001 1 25.04 0.0071 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2596.2596.3.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 937 60273 35 35 28 28 1890 4566 1 0 0 577.2817 1152.5488 2 1152.5485 0.0003 0 31.48 0.0029 K EYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4821.4821.2.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 937 60273 35 35 28 28 1933 3958 1 0 0 583.2938 1164.573 2 1164.5775 -0.0045 0 70.17 5.00E-07 K YEELQVTAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4157.4157.2.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 937 60273 35 35 28 28 2125 5340 1 0 0 602.3217 1202.6288 2 1202.6295 -0.0008 0 38.48 0.0015 K WTLLQEQGTK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5753.5753.2.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 937 60273 35 35 28 28 2578 2942 1 0 0 439.2363 1314.6872 3 1314.6891 -0.002 1 36.59 0.0016 R NTKQEIAEINR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2977.2977.3.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 937 60273 35 35 28 28 2649 7173 1 0 0 665.3684 1328.7223 2 1328.7187 0.0035 0 77.54 2.40E-07 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8142.8142.2.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 937 60273 35 35 28 28 2741 4009 1 0 0 675.8657 1349.7168 2 1349.7191 -0.0023 1 94.5 6.40E-09 R TAAENEFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4212.4212.2.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 937 60273 35 35 28 28 2742 4002 1 0 0 450.9134 1349.7184 3 1349.7191 -0.0006 1 27.09 0.01 R TAAENEFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4205.4205.3.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 937 60273 35 35 28 28 2969 5179 1 0 0 699.3744 1396.7343 2 1396.735 -0.0007 1 72.05 3.20E-07 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5562.5562.2.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 937 60273 35 35 28 28 2970 5184 1 0 0 466.5854 1396.7344 3 1396.735 -0.0006 1 37.73 0.00083 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5568.5568.3.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 937 60273 35 35 28 28 2971 5173 1 0 0 466.586 1396.7361 3 1396.735 0.001 1 48.02 9.80E-05 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5556.5556.3.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 937 60273 35 35 28 28 3016 6592 1 0 0 704.36 1406.7054 2 1406.7041 0.0013 0 84.72 6.10E-08 K ADTLTDEINFLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7428.7428.2.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 937 60273 35 35 28 28 3082 3728 1 0 0 712.8193 1423.624 2 1423.6263 -0.0023 0 62.89 1.30E-06 R GSGGLGGACGGAGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3904.3904.2.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 937 60273 35 35 28 28 3190 4286 1 0 1 724.3907 1446.7669 2 1446.7678 -0.0009 0 73.45 3.60E-07 R AIGGGLSSVGGGSSTIK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4517.4517.2.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 937 60273 35 35 28 28 3792 4488 1 0 0 799.882 1597.7494 2 1597.7519 -0.0025 0 80.51 1.40E-07 R ISIGGGSCAISGGYGSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4737.4737.2.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 937 60273 35 35 28 28 4203 3260 1 0 0 556.593 1666.7572 3 1666.7594 -0.0022 1 66.4 5.90E-07 R SRGSGGLGGACGGAGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3343.3343.3.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 937 60273 35 35 28 28 4619 5433 1 0 0 587.3246 1758.9521 3 1758.9516 0.0005 1 46.07 0.00019 K VLDTKWTLLQEQGTK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5861.5861.3.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 937 60273 35 35 28 28 6405 8367 1 0 0 605.3181 2417.2431 4 2417.2438 -0.0006 1 22.58 0.021 R NLDLDSIIAEVKAQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9611.9611.4.dta 1 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 937 60273 35 35 28 28 6406 8356 1 0 0 806.7551 2417.2436 3 2417.2438 -0.0002 1 35.35 0.00073 R NLDLDSIIAEVKAQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9598.9598.3.dta 1 IPI00816709.1 Keratin 6C 894 60245 32 32 26 26 551 4870 1 0 0 414.2186 826.4227 2 826.4225 0.0002 0 39.72 0.0021 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5192.5192.2.dta 1 IPI00816709.1 Keratin 6C 894 60245 32 32 26 26 997 2971 1 0 0 473.2597 944.5049 2 944.5039 0.0009 1 31.68 0.016 R GRLDSELR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3009.3009.2.dta 1 IPI00816709.1 Keratin 6C 894 60245 32 32 26 26 998 2966 1 0 0 315.8431 944.5075 3 944.5039 0.0036 1 28.02 0.039 R GRLDSELR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3003.3003.3.dta 1 IPI00816709.1 Keratin 6C 894 60245 32 32 26 26 1076 1898 1 0 1 483.2486 964.4827 2 964.4839 -0.0012 1 27.13 0.038 R RGFSANSAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1823.1823.2.dta 1 IPI00816709.1 Keratin 6C 894 60245 32 32 26 26 1171 1330 1 0 0 495.2299 988.4453 2 988.4462 -0.0009 0 42.94 9.40E-05 K YTTTSSSSR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1205.1205.2.dta 1 IPI00816709.1 Keratin 6C 894 60245 32 32 26 26 1262 2916 1 0 0 503.2372 1004.4599 2 1004.4597 0.0003 0 40.72 0.0004 K LLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2949.2949.2.dta 1 IPI00816709.1 Keratin 6C 894 60245 32 32 26 26 1316 4166 1 0 0 508.7724 1015.5302 2 1015.5298 0.0004 0 36.01 0.00069 R QLDSIVGER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4386.4386.2.dta 1 IPI00816709.1 Keratin 6C 894 60245 32 32 26 26 1358 4287 1 0 0 513.7645 1025.5144 2 1025.5142 0.0002 0 72.26 2.90E-07 R SGFSSISVSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4518.4518.2.dta 1 IPI00816709.1 Keratin 6C 894 60245 32 32 26 26 1400 3527 1 0 0 519.2907 1036.5669 2 1036.5665 0.0003 1 33.55 0.0018 R SLYGLGGSKR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3675.3675.2.dta 1 IPI00816709.1 Keratin 6C 894 60245 32 32 26 26 1529 2096 1 0 0 533.7612 1065.5079 2 1065.509 -0.0011 1 23.99 0.0056 K YEDEINKR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2044.2044.2.dta 1 IPI00816709.1 Keratin 6C 894 60245 32 32 26 26 1629 2126 1 0 0 544.308 1086.6015 2 1086.6033 -0.0018 1 34.49 0.002 R EQIKTLNNK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2076.2076.2.dta 1 IPI00816709.1 Keratin 6C 894 60245 32 32 26 26 1737 7997 1 0 0 559.2776 1116.5407 2 1116.5411 -0.0004 1 29.47 0.0025 K YTTTSSSSRK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.916.916.2.dta 1 IPI00816709.1 Keratin 6C 894 60245 32 32 26 26 1814 2589 1 0 0 567.2827 1132.5509 2 1132.5546 -0.0038 1 51.21 7.10E-05 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2594.2594.2.dta 1 IPI00816709.1 Keratin 6C 894 60245 32 32 26 26 1815 2591 1 0 0 378.5255 1132.5547 3 1132.5546 0.0001 1 25.04 0.0071 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2596.2596.3.dta 1 IPI00816709.1 Keratin 6C 894 60245 32 32 26 26 1890 4566 1 0 0 577.2817 1152.5488 2 1152.5485 0.0003 0 31.48 0.0029 K EYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4821.4821.2.dta 1 IPI00816709.1 Keratin 6C 894 60245 32 32 26 26 1933 3958 1 0 0 583.2938 1164.573 2 1164.5775 -0.0045 0 70.17 5.00E-07 K YEELQVTAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4157.4157.2.dta 1 IPI00816709.1 Keratin 6C 894 60245 32 32 26 26 2125 5340 1 0 0 602.3217 1202.6288 2 1202.6295 -0.0008 0 38.48 0.0015 K WTLLQEQGTK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5753.5753.2.dta 1 IPI00816709.1 Keratin 6C 894 60245 32 32 26 26 2578 2942 1 0 0 439.2363 1314.6872 3 1314.6891 -0.002 1 36.59 0.0016 R NTKQEIAEINR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2977.2977.3.dta 1 IPI00816709.1 Keratin 6C 894 60245 32 32 26 26 2649 7173 1 0 0 665.3684 1328.7223 2 1328.7187 0.0035 0 77.54 2.40E-07 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8142.8142.2.dta 1 IPI00816709.1 Keratin 6C 894 60245 32 32 26 26 2741 4009 1 0 0 675.8657 1349.7168 2 1349.7191 -0.0023 1 94.5 6.40E-09 R TAAENEFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4212.4212.2.dta 1 IPI00816709.1 Keratin 6C 894 60245 32 32 26 26 2742 4002 1 0 0 450.9134 1349.7184 3 1349.7191 -0.0006 1 27.09 0.01 R TAAENEFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4205.4205.3.dta 1 IPI00816709.1 Keratin 6C 894 60245 32 32 26 26 2969 5179 1 0 0 699.3744 1396.7343 2 1396.735 -0.0007 1 72.05 3.20E-07 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5562.5562.2.dta 1 IPI00816709.1 Keratin 6C 894 60245 32 32 26 26 2970 5184 1 0 0 466.5854 1396.7344 3 1396.735 -0.0006 1 37.73 0.00083 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5568.5568.3.dta 1 IPI00816709.1 Keratin 6C 894 60245 32 32 26 26 2971 5173 1 0 0 466.586 1396.7361 3 1396.735 0.001 1 48.02 9.80E-05 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5556.5556.3.dta 1 IPI00816709.1 Keratin 6C 894 60245 32 32 26 26 3016 6592 1 0 0 704.36 1406.7054 2 1406.7041 0.0013 0 84.72 6.10E-08 K ADTLTDEINFLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7428.7428.2.dta 1 IPI00816709.1 Keratin 6C 894 60245 32 32 26 26 3082 3728 1 0 0 712.8193 1423.624 2 1423.6263 -0.0023 0 62.89 1.30E-06 R GSGGLGGACGGAGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3904.3904.2.dta 1 IPI00816709.1 Keratin 6C 894 60245 32 32 26 26 3190 4286 1 0 1 724.3907 1446.7669 2 1446.7678 -0.0009 0 73.45 3.60E-07 R AIGGGLSSVGGGSSTIK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4517.4517.2.dta 1 IPI00816709.1 Keratin 6C 894 60245 32 32 26 26 3792 4488 1 0 0 799.882 1597.7494 2 1597.7519 -0.0025 0 80.51 1.40E-07 R ISIGGGSCAISGGYGSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4737.4737.2.dta 1 IPI00816709.1 Keratin 6C 894 60245 32 32 26 26 4203 3260 1 0 0 556.593 1666.7572 3 1666.7594 -0.0022 1 66.4 5.90E-07 R SRGSGGLGGACGGAGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3343.3343.3.dta 1 IPI00816709.1 Keratin 6C 894 60245 32 32 26 26 4619 5433 1 0 0 587.3246 1758.9521 3 1758.9516 0.0005 1 46.07 0.00019 K VLDTKWTLLQEQGTK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5861.5861.3.dta 1 IPI00816709.1 Keratin 6C 894 60245 32 32 26 26 6405 8367 1 0 0 605.3181 2417.2431 4 2417.2438 -0.0006 1 22.58 0.021 R NLDLDSIIAEVKAQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9611.9611.4.dta 1 IPI00816709.1 Keratin 6C 894 60245 32 32 26 26 6406 8356 1 0 0 806.7551 2417.2436 3 2417.2438 -0.0002 1 35.35 0.00073 R NLDLDSIIAEVKAQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9598.9598.3.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 889 60293 35 35 27 27 551 4870 1 0 0 414.2186 826.4227 2 826.4225 0.0002 0 39.72 0.0021 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5192.5192.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 889 60293 35 35 27 27 837 2672 1 0 0 453.7375 905.4604 2 905.4607 -0.0002 0 42.33 0.0018 R FLEQQNK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2684.2684.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 889 60293 35 35 27 27 997 2971 1 0 0 473.2597 944.5049 2 944.5039 0.0009 1 31.68 0.016 R GRLDSELR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3009.3009.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 889 60293 35 35 27 27 998 2966 1 0 0 315.8431 944.5075 3 944.5039 0.0036 1 28.02 0.039 R GRLDSELR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3003.3003.3.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 889 60293 35 35 27 27 1076 1898 1 0 1 483.2486 964.4827 2 964.4839 -0.0012 1 27.13 0.038 R RGFSANSAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1823.1823.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 889 60293 35 35 27 27 1171 1330 1 0 0 495.2299 988.4453 2 988.4462 -0.0009 0 42.94 9.40E-05 K YTTTSSSSR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1205.1205.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 889 60293 35 35 27 27 1262 2916 1 0 0 503.2372 1004.4599 2 1004.4597 0.0003 0 40.72 0.0004 K LLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2949.2949.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 889 60293 35 35 27 27 1316 4166 1 0 0 508.7724 1015.5302 2 1015.5298 0.0004 0 36.01 0.00069 R QLDSIVGER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4386.4386.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 889 60293 35 35 27 27 1400 3527 1 0 0 519.2907 1036.5669 2 1036.5665 0.0003 1 33.55 0.0018 R SLYGLGGSKR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3675.3675.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 889 60293 35 35 27 27 1529 2096 1 0 0 533.7612 1065.5079 2 1065.509 -0.0011 1 23.99 0.0056 K YEDEINKR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2044.2044.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 889 60293 35 35 27 27 1608 4791 1 0 0 541.8032 1081.5918 2 1081.592 -0.0003 1 44.92 0.00044 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5102.5102.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 889 60293 35 35 27 27 1609 4801 1 0 0 361.5381 1081.5926 3 1081.592 0.0006 1 24.32 0.012 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5114.5114.3.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 889 60293 35 35 27 27 1629 2126 1 0 0 544.308 1086.6015 2 1086.6033 -0.0018 1 34.49 0.002 R EQIKTLNNK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2076.2076.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 889 60293 35 35 27 27 1737 7997 1 0 0 559.2776 1116.5407 2 1116.5411 -0.0004 1 29.47 0.0025 K YTTTSSSSRK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.916.916.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 889 60293 35 35 27 27 1814 2589 1 0 0 567.2827 1132.5509 2 1132.5546 -0.0038 1 51.21 7.10E-05 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2594.2594.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 889 60293 35 35 27 27 1815 2591 1 0 0 378.5255 1132.5547 3 1132.5546 0.0001 1 25.04 0.0071 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2596.2596.3.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 889 60293 35 35 27 27 1890 4566 1 0 0 577.2817 1152.5488 2 1152.5485 0.0003 0 31.48 0.0029 K EYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4821.4821.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 889 60293 35 35 27 27 1933 3958 1 0 0 583.2938 1164.573 2 1164.5775 -0.0045 0 70.17 5.00E-07 K YEELQVTAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4157.4157.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 889 60293 35 35 27 27 2125 5340 1 0 0 602.3217 1202.6288 2 1202.6295 -0.0008 0 38.48 0.0015 K WTLLQEQGTK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5753.5753.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 889 60293 35 35 27 27 2578 2942 1 0 0 439.2363 1314.6872 3 1314.6891 -0.002 1 36.59 0.0016 R NTKQEIAEINR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2977.2977.3.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 889 60293 35 35 27 27 2649 7173 1 0 0 665.3684 1328.7223 2 1328.7187 0.0035 0 77.54 2.40E-07 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8142.8142.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 889 60293 35 35 27 27 2741 4009 1 0 0 675.8657 1349.7168 2 1349.7191 -0.0023 1 94.5 6.40E-09 R TAAENEFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4212.4212.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 889 60293 35 35 27 27 2742 4002 1 0 0 450.9134 1349.7184 3 1349.7191 -0.0006 1 27.09 0.01 R TAAENEFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4205.4205.3.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 889 60293 35 35 27 27 2969 5179 1 0 0 699.3744 1396.7343 2 1396.735 -0.0007 1 72.05 3.20E-07 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5562.5562.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 889 60293 35 35 27 27 2970 5184 1 0 0 466.5854 1396.7344 3 1396.735 -0.0006 1 37.73 0.00083 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5568.5568.3.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 889 60293 35 35 27 27 2971 5173 1 0 0 466.586 1396.7361 3 1396.735 0.001 1 48.02 9.80E-05 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5556.5556.3.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 889 60293 35 35 27 27 3016 6592 1 0 0 704.36 1406.7054 2 1406.7041 0.0013 0 84.72 6.10E-08 K ADTLTDEINFLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7428.7428.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 889 60293 35 35 27 27 3082 3728 1 0 0 712.8193 1423.624 2 1423.6263 -0.0023 0 62.89 1.30E-06 R GSGGLGGACGGAGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3904.3904.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 889 60293 35 35 27 27 3190 4286 1 0 1 724.3907 1446.7669 2 1446.7678 -0.0009 0 73.45 3.60E-07 R AIGGGLSSVGGGSSTIK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4517.4517.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 889 60293 35 35 27 27 3320 3782 1 0 1 492.9388 1475.7944 3 1475.7984 -0.0039 1 22.47 0.024 R FLEQQNKVLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3964.3964.3.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 889 60293 35 35 27 27 3321 3793 1 0 1 738.9055 1475.7965 2 1475.7984 -0.0019 1 43.57 0.00014 R FLEQQNKVLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3978.3978.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 889 60293 35 35 27 27 3792 4488 1 0 0 799.882 1597.7494 2 1597.7519 -0.0025 0 80.51 1.40E-07 R ISIGGGSCAISGGYGSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4737.4737.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 889 60293 35 35 27 27 4203 3260 1 0 0 556.593 1666.7572 3 1666.7594 -0.0022 1 66.4 5.90E-07 R SRGSGGLGGACGGAGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3343.3343.3.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 889 60293 35 35 27 27 6405 8367 1 0 0 605.3181 2417.2431 4 2417.2438 -0.0006 1 22.58 0.021 R NLDLDSIIAEVKAQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9611.9611.4.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 889 60293 35 35 27 27 6406 8356 1 0 0 806.7551 2417.2436 3 2417.2438 -0.0002 1 35.35 0.00073 R NLDLDSIIAEVKAQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9598.9598.3.dta 1 IPI00793917.1 27 kDa protein 642 26765 21 21 17 17 699 592 1 0 1 434.7229 867.4313 2 867.4311 0.0002 1 38.62 0.0023 K HGDDLRR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1077.1077.2.dta 1 IPI00793917.1 27 kDa protein 642 26765 21 21 17 17 1242 4517 1 0 1 500.7875 999.5605 2 999.56 0.0005 0 43.38 0.00059 R LQAEIEGLK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4768.4768.2.dta 1 IPI00793917.1 27 kDa protein 642 26765 21 21 17 17 1792 2762 1 0 1 565.3132 1128.6119 2 1128.6138 -0.0019 1 70.27 2.20E-06 R GELAIKDANAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2781.2781.2.dta 1 IPI00793917.1 27 kDa protein 642 26765 21 21 17 17 1793 5196 1 0 1 565.3143 1128.6141 2 1128.6138 0.0003 0 79.66 3.00E-07 K LSELEAALQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5582.5582.2.dta 1 IPI00793917.1 27 kDa protein 642 26765 21 21 17 17 1890 4566 1 0 0 577.2817 1152.5488 2 1152.5485 0.0003 0 31.48 0.0029 R EYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4821.4821.2.dta 1 IPI00793917.1 27 kDa protein 642 26765 21 21 17 17 2137 2535 1 0 1 403.536 1207.586 3 1207.5867 -0.0006 1 25.74 0.024 R TKTEISEMNR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2533.2533.3.dta 1 IPI00793917.1 27 kDa protein 642 26765 21 21 17 17 2184 1678 1 0 1 408.8676 1223.5808 3 1223.5816 -0.0007 1 35.43 0.001 R TKTEISEMNR N Oxidation (M) 0.0000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1586.1586.3.dta 1 IPI00793917.1 27 kDa protein 642 26765 21 21 17 17 2185 1677 1 0 1 612.7977 1223.5809 2 1223.5816 -0.0007 1 25.71 0.0039 R TKTEISEMNR N Oxidation (M) 0.0000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1585.1585.2.dta 1 IPI00793917.1 27 kDa protein 642 26765 21 21 17 17 2422 6369 1 0 0 639.3589 1276.7032 2 1276.7027 0.0006 0 70.01 1.40E-06 K LALDIEIATYR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7116.7116.2.dta 1 IPI00793917.1 27 kDa protein 642 26765 21 21 17 17 2607 6633 1 0 1 660.8408 1319.6671 2 1319.6642 0.0028 0 91.81 1.50E-08 R SLDMDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7481.7481.2.dta 1 IPI00793917.1 27 kDa protein 642 26765 21 21 17 17 2689 3712 1 0 1 671.3787 1340.7429 2 1340.7412 0.0017 1 68.08 2.10E-06 R LQAEIEGLKGQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3883.3883.2.dta 1 IPI00793917.1 27 kDa protein 642 26765 21 21 17 17 2702 5558 1 0 1 672.8407 1343.6668 2 1343.6681 -0.0012 0 95.83 3.80E-09 R ASLEAAIADAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6007.6007.2.dta 1 IPI00793917.1 27 kDa protein 642 26765 21 21 17 17 3058 6765 1 0 1 710.3782 1418.7418 2 1418.7405 0.0013 0 56.67 3.50E-05 R LEGLTDEINFLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7648.7648.2.dta 1 IPI00793917.1 27 kDa protein 642 26765 21 21 17 17 3579 4856 1 0 1 517.6055 1549.7948 3 1549.7922 0.0025 1 39.15 0.00036 R QLREYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5176.5176.3.dta 1 IPI00793917.1 27 kDa protein 642 26765 21 21 17 17 4723 4683 1 0 1 599.9495 1796.8267 3 1796.825 0.0017 1 58.59 4.30E-06 K DVDEAYMNKVELESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4970.4970.3.dta 1 IPI00793917.1 27 kDa protein 642 26765 21 21 17 17 4760 3899 1 0 1 605.2803 1812.819 3 1812.82 -0.001 1 21.93 0.015 K DVDEAYMNKVELESR L Oxidation (M) 0.000000100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4093.4093.3.dta 1 IPI00793917.1 27 kDa protein 642 26765 21 21 17 17 5266 6385 1 0 1 652.685 1955.0332 3 1955.0323 0.0009 1 30.47 0.003 R ASLEAAIADAEQRGELAIK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7137.7137.3.dta 1 IPI00793917.1 27 kDa protein 642 26765 21 21 17 17 5944 5742 1 0 1 763.3748 2287.1026 3 2287.1041 -0.0015 1 41.63 0.00012 R AEAESMYQIKYEELQSLAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6260.6260.3.dta 1 IPI00793917.1 27 kDa protein 642 26765 21 21 17 17 6295 7952 1 0 1 596.0468 2380.1582 4 2380.158 0.0002 1 17.63 0.043 R SLDMDSIIAEVKAQYEDIANR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9105.9105.4.dta 1 IPI00793917.1 27 kDa protein 642 26765 21 21 17 17 6358 7041 1 0 1 799.7247 2396.1524 3 2396.1529 -0.0005 1 48.7 2.70E-05 R SLDMDSIIAEVKAQYEDIANR S Oxidation (M) 0.000100000000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7979.7979.3.dta 1 IPI00793917.1 27 kDa protein 642 26765 21 21 17 17 8163 7360 1 0 1 1057.1812 3168.5216 3 3168.5244 -0.0028 1 59.67 2.50E-06 R QLYEEEIRELQSQISDTSVVLSMDNSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8370.8370.3.dta 1 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 565 47891 18 18 17 17 53 2021 1 0 0 311.168 620.3214 2 620.3203 0.0011 0 26.92 0.02 K MLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1964.1964.2.dta 1 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 565 47891 18 18 17 17 97 1338 1 0 1 322.2289 642.4433 2 642.4428 0.0005 1 38.13 0.00042 R AVVVKK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1214.1214.2.dta 1 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 565 47891 18 18 17 17 837 2672 1 0 0 453.7375 905.4604 2 905.4607 -0.0002 0 42.33 0.0018 R FLEQQNK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2684.2684.2.dta 1 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 565 47891 18 18 17 17 1438 3323 1 0 1 523.2802 1044.5459 2 1044.5451 0.0008 0 41.98 0.00019 R QLETLGQEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3427.3427.2.dta 1 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 565 47891 18 18 17 17 1629 2126 1 0 0 544.308 1086.6015 2 1086.6033 -0.0018 1 34.49 0.002 K EQIKTLNNK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2076.2076.2.dta 1 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 565 47891 18 18 17 17 1792 2762 1 0 1 565.3132 1128.6119 2 1128.6138 -0.0019 1 70.27 2.20E-06 R GELAIKDANAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2781.2781.2.dta 1 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 565 47891 18 18 17 17 1793 5196 1 0 1 565.3143 1128.6141 2 1128.6138 0.0003 0 79.66 3.00E-07 K LSELEAALQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5582.5582.2.dta 1 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 565 47891 18 18 17 17 1890 4566 1 0 0 577.2817 1152.5488 2 1152.5485 0.0003 0 31.48 0.0029 R EYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4821.4821.2.dta 1 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 565 47891 18 18 17 17 2070 2733 1 0 1 601.3294 1200.6443 2 1200.6462 -0.002 1 55.02 6.70E-05 R RQLETLGQEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2750.2750.2.dta 1 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 565 47891 18 18 17 17 2422 6369 1 0 0 639.3589 1276.7032 2 1276.7027 0.0006 0 70.01 1.40E-06 K LALDIEIATYR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7116.7116.2.dta 1 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 565 47891 18 18 17 17 2607 6633 1 0 1 660.8408 1319.6671 2 1319.6642 0.0028 0 91.81 1.50E-08 R SLDMDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7481.7481.2.dta 1 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 565 47891 18 18 17 17 2702 5558 1 0 1 672.8407 1343.6668 2 1343.6681 -0.0012 0 95.83 3.80E-09 R ASLEAAIADAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6007.6007.2.dta 1 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 565 47891 18 18 17 17 3058 6765 1 0 1 710.3782 1418.7418 2 1418.7405 0.0013 0 56.67 3.50E-05 R LEGLTDEINFLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7648.7648.2.dta 1 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 565 47891 18 18 17 17 3579 4856 1 0 1 517.6055 1549.7948 3 1549.7922 0.0025 1 39.15 0.00036 R QLREYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5176.5176.3.dta 1 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 565 47891 18 18 17 17 4723 4683 1 0 1 599.9495 1796.8267 3 1796.825 0.0017 1 58.59 4.30E-06 K DVDEAYMNKVELESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4970.4970.3.dta 1 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 565 47891 18 18 17 17 4760 3899 1 0 1 605.2803 1812.819 3 1812.82 -0.001 1 21.93 0.015 K DVDEAYMNKVELESR L Oxidation (M) 0.000000100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4093.4093.3.dta 1 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 565 47891 18 18 17 17 5266 6385 1 0 1 652.685 1955.0332 3 1955.0323 0.0009 1 30.47 0.003 R ASLEAAIADAEQRGELAIK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7137.7137.3.dta 1 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 565 47891 18 18 17 17 5944 5742 1 0 1 763.3748 2287.1026 3 2287.1041 -0.0015 1 41.63 0.00012 R AEAESMYQIKYEELQSLAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6260.6260.3.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 559 42557 22 22 18 18 837 2672 1 0 0 453.7375 905.4604 2 905.4607 -0.0002 0 42.33 0.0018 R FLEQQNK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2684.2684.2.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 559 42557 22 22 18 18 997 2971 1 0 0 473.2597 944.5049 2 944.5039 0.0009 1 31.68 0.016 R GRLDSELR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3009.3009.2.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 559 42557 22 22 18 18 998 2966 1 0 0 315.8431 944.5075 3 944.5039 0.0036 1 28.02 0.039 R GRLDSELR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3003.3003.3.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 559 42557 22 22 18 18 1171 1330 1 0 0 495.2299 988.4453 2 988.4462 -0.0009 0 42.94 9.40E-05 K YTTTSSSSR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1205.1205.2.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 559 42557 22 22 18 18 1262 2916 1 0 0 503.2372 1004.4599 2 1004.4597 0.0003 0 40.72 0.0004 K LLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2949.2949.2.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 559 42557 22 22 18 18 1316 4166 1 0 0 508.7724 1015.5302 2 1015.5298 0.0004 0 36.01 0.00069 R QLDSIVGER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4386.4386.2.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 559 42557 22 22 18 18 1529 2096 1 0 0 533.7612 1065.5079 2 1065.509 -0.0011 1 23.99 0.0056 K YEDEINKR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2044.2044.2.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 559 42557 22 22 18 18 1737 7997 1 0 0 559.2776 1116.5407 2 1116.5411 -0.0004 1 29.47 0.0025 K YTTTSSSSRK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.916.916.2.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 559 42557 22 22 18 18 1814 2589 1 0 0 567.2827 1132.5509 2 1132.5546 -0.0038 1 51.21 7.10E-05 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2594.2594.2.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 559 42557 22 22 18 18 1815 2591 1 0 0 378.5255 1132.5547 3 1132.5546 0.0001 1 25.04 0.0071 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2596.2596.3.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 559 42557 22 22 18 18 1890 4566 1 0 0 577.2817 1152.5488 2 1152.5485 0.0003 0 31.48 0.0029 K EYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4821.4821.2.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 559 42557 22 22 18 18 1933 3958 1 0 0 583.2938 1164.573 2 1164.5775 -0.0045 0 70.17 5.00E-07 K YEELQVTAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4157.4157.2.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 559 42557 22 22 18 18 2125 5340 1 0 0 602.3217 1202.6288 2 1202.6295 -0.0008 0 38.48 0.0015 K WTLLQEQGTK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5753.5753.2.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 559 42557 22 22 18 18 2578 2942 1 0 0 439.2363 1314.6872 3 1314.6891 -0.002 1 36.59 0.0016 R NTKQEIAEINR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2977.2977.3.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 559 42557 22 22 18 18 2649 7173 1 0 0 665.3684 1328.7223 2 1328.7187 0.0035 0 77.54 2.40E-07 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8142.8142.2.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 559 42557 22 22 18 18 2741 4009 1 0 0 675.8657 1349.7168 2 1349.7191 -0.0023 1 94.5 6.40E-09 R TAAENEFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4212.4212.2.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 559 42557 22 22 18 18 2742 4002 1 0 0 450.9134 1349.7184 3 1349.7191 -0.0006 1 27.09 0.01 R TAAENEFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4205.4205.3.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 559 42557 22 22 18 18 3016 6592 1 0 0 704.36 1406.7054 2 1406.7041 0.0013 0 84.72 6.10E-08 K ADTLTDEINFLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7428.7428.2.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 559 42557 22 22 18 18 3190 4286 1 0 1 724.3907 1446.7669 2 1446.7678 -0.0009 0 73.45 3.60E-07 R AIGGGLSSVGGGSSTIK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4517.4517.2.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 559 42557 22 22 18 18 4619 5433 1 0 0 587.3246 1758.9521 3 1758.9516 0.0005 1 46.07 0.00019 K VLDTKWTLLQEQGTK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5861.5861.3.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 559 42557 22 22 18 18 6405 8367 1 0 0 605.3181 2417.2431 4 2417.2438 -0.0006 1 22.58 0.021 R NLDLDSIIAEVKAQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9611.9611.4.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 559 42557 22 22 18 18 6406 8356 1 0 0 806.7551 2417.2436 3 2417.2438 -0.0002 1 35.35 0.00073 R NLDLDSIIAEVKAQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9598.9598.3.dta 1 IPI00792642.1 25 kDa protein 548 24809 21 21 15 15 53 2021 1 0 0 311.168 620.3214 2 620.3203 0.0011 0 26.92 0.02 K MLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1964.1964.2.dta 1 IPI00792642.1 25 kDa protein 548 24809 21 21 15 15 551 4870 1 0 0 414.2186 826.4227 2 826.4225 0.0002 0 39.72 0.0021 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5192.5192.2.dta 1 IPI00792642.1 25 kDa protein 548 24809 21 21 15 15 837 2672 1 0 0 453.7375 905.4604 2 905.4607 -0.0002 0 42.33 0.0018 R FLEQQNK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2684.2684.2.dta 1 IPI00792642.1 25 kDa protein 548 24809 21 21 15 15 1438 3323 1 0 1 523.2802 1044.5459 2 1044.5451 0.0008 0 41.98 0.00019 R QLETLGQEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3427.3427.2.dta 1 IPI00792642.1 25 kDa protein 548 24809 21 21 15 15 1529 2096 1 0 0 533.7612 1065.5079 2 1065.509 -0.0011 1 23.99 0.0056 K YEDEINKR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2044.2044.2.dta 1 IPI00792642.1 25 kDa protein 548 24809 21 21 15 15 1608 4791 1 0 0 541.8032 1081.5918 2 1081.592 -0.0003 1 44.92 0.00044 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5102.5102.2.dta 1 IPI00792642.1 25 kDa protein 548 24809 21 21 15 15 1609 4801 1 0 0 361.5381 1081.5926 3 1081.592 0.0006 1 24.32 0.012 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5114.5114.3.dta 1 IPI00792642.1 25 kDa protein 548 24809 21 21 15 15 1629 2126 1 0 0 544.308 1086.6015 2 1086.6033 -0.0018 1 34.49 0.002 K EQIKTLNNK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2076.2076.2.dta 1 IPI00792642.1 25 kDa protein 548 24809 21 21 15 15 2070 2733 1 0 1 601.3294 1200.6443 2 1200.6462 -0.002 1 55.02 6.70E-05 R RQLETLGQEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2750.2750.2.dta 1 IPI00792642.1 25 kDa protein 548 24809 21 21 15 15 2607 6633 1 0 1 660.8408 1319.6671 2 1319.6642 0.0028 0 91.81 1.50E-08 R SLDMDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7481.7481.2.dta 1 IPI00792642.1 25 kDa protein 548 24809 21 21 15 15 2969 5179 1 0 0 699.3744 1396.7343 2 1396.735 -0.0007 1 72.05 3.20E-07 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5562.5562.2.dta 1 IPI00792642.1 25 kDa protein 548 24809 21 21 15 15 2970 5184 1 0 0 466.5854 1396.7344 3 1396.735 -0.0006 1 37.73 0.00083 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5568.5568.3.dta 1 IPI00792642.1 25 kDa protein 548 24809 21 21 15 15 2971 5173 1 0 0 466.586 1396.7361 3 1396.735 0.001 1 48.02 9.80E-05 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5556.5556.3.dta 1 IPI00792642.1 25 kDa protein 548 24809 21 21 15 15 3058 6765 1 0 1 710.3782 1418.7418 2 1418.7405 0.0013 0 56.67 3.50E-05 R LEGLTDEINFLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7648.7648.2.dta 1 IPI00792642.1 25 kDa protein 548 24809 21 21 15 15 3327 5224 1 0 1 740.8885 1479.7625 2 1479.7643 -0.0017 1 57.4 4.10E-06 R TEMENEFVLIKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5615.5615.2.dta 1 IPI00792642.1 25 kDa protein 548 24809 21 21 15 15 3328 5207 1 0 1 494.2619 1479.764 3 1479.7643 -0.0003 1 42.43 0.00022 R TEMENEFVLIKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5596.5596.3.dta 1 IPI00792642.1 25 kDa protein 548 24809 21 21 15 15 4723 4683 1 0 1 599.9495 1796.8267 3 1796.825 0.0017 1 58.59 4.30E-06 K DVDEAYMNKVELESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4970.4970.3.dta 1 IPI00792642.1 25 kDa protein 548 24809 21 21 15 15 4760 3899 1 0 1 605.2803 1812.819 3 1812.82 -0.001 1 21.93 0.015 K DVDEAYMNKVELESR L Oxidation (M) 0.000000100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4093.4093.3.dta 1 IPI00792642.1 25 kDa protein 548 24809 21 21 15 15 6295 7952 1 0 1 596.0468 2380.1582 4 2380.158 0.0002 1 17.63 0.043 R SLDMDSIIAEVKAQYEDIANR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9105.9105.4.dta 1 IPI00792642.1 25 kDa protein 548 24809 21 21 15 15 6358 7041 1 0 1 799.7247 2396.1524 3 2396.1529 -0.0005 1 48.7 2.70E-05 R SLDMDSIIAEVKAQYEDIANR S Oxidation (M) 0.000100000000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7979.7979.3.dta 1 IPI00792642.1 25 kDa protein 548 24809 21 21 15 15 8163 7360 1 0 1 1057.1812 3168.5216 3 3168.5244 -0.0028 1 59.67 2.50E-06 R QLYEEEIRELQSQISDTSVVLSMDNSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8370.8370.3.dta 1 IPI00827679.1 50 kDa protein 487 49680 22 22 18 18 103 3356 1 0 0 323.182 644.3494 2 644.3493 0.0001 0 33.71 0.019 R LDLER K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3468.3468.2.dta 1 IPI00827679.1 50 kDa protein 487 49680 22 22 18 18 199 2574 1 0 1 351.2008 700.3871 2 700.3868 0.0003 0 56.6 5.60E-05 R SSVPGVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2577.2577.2.dta 1 IPI00827679.1 50 kDa protein 487 49680 22 22 18 18 837 2672 1 0 0 453.7375 905.4604 2 905.4607 -0.0002 0 42.33 0.0018 R FLEQQNK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2684.2684.2.dta 1 IPI00827679.1 50 kDa protein 487 49680 22 22 18 18 1349 2293 1 0 1 512.2592 1022.5038 2 1022.5032 0.0005 0 37.2 0.00052 R QQYESVAAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2260.2260.2.dta 1 IPI00827679.1 50 kDa protein 487 49680 22 22 18 18 1367 1564 1 0 1 514.7586 1027.5027 2 1027.5047 -0.002 1 28.71 0.017 R SVSSSSYRR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1460.1460.2.dta 1 IPI00827679.1 50 kDa protein 487 49680 22 22 18 18 1775 4040 1 0 1 375.8732 1124.5978 3 1124.5978 0 1 32.19 0.0019 R FANYIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4247.4247.3.dta 1 IPI00827679.1 50 kDa protein 487 49680 22 22 18 18 2452 2240 1 0 1 644.3356 1286.6567 2 1286.6579 -0.0012 1 42.7 0.0012 R QVDQLTNDKAR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2201.2201.2.dta 1 IPI00827679.1 50 kDa protein 487 49680 22 22 18 18 2453 2236 1 0 1 429.8934 1286.6583 3 1286.6579 0.0004 1 27.14 0.017 R QVDQLTNDKAR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2196.2196.3.dta 1 IPI00827679.1 50 kDa protein 487 49680 22 22 18 18 3385 4324 1 0 1 748.3952 1494.7759 2 1494.779 -0.0032 0 21.5 0.0096 R TYSLGSALRPSTSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4558.4558.2.dta 1 IPI00827679.1 50 kDa protein 487 49680 22 22 18 18 3386 4320 1 0 1 499.2664 1494.7774 3 1494.779 -0.0016 0 27.95 0.0031 R TYSLGSALRPSTSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4554.4554.3.dta 1 IPI00827679.1 50 kDa protein 487 49680 22 22 18 18 3495 4622 1 0 1 762.8683 1523.7221 2 1523.7256 -0.0034 1 74.7 1.00E-07 K NLQEAEEWYKSK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4898.4898.2.dta 1 IPI00827679.1 50 kDa protein 487 49680 22 22 18 18 3502 4617 1 0 1 509.9476 1526.8209 3 1526.8205 0.0004 1 25.51 0.018 R HLREYQDLLNVK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4893.4893.3.dta 1 IPI00827679.1 50 kDa protein 487 49680 22 22 18 18 3510 6036 1 0 1 511.9556 1532.845 3 1532.845 0 1 57.15 2.60E-05 R KVESLQEEIAFLK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6677.6677.3.dta 1 IPI00827679.1 50 kDa protein 487 49680 22 22 18 18 3541 5749 1 0 1 770.4577 1538.9009 2 1538.9032 -0.0023 1 55 9.50E-06 K ILLAELEQLKGQGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6267.6267.2.dta 1 IPI00827679.1 50 kDa protein 487 49680 22 22 18 18 3542 5731 1 0 1 513.9752 1538.9036 3 1538.9032 0.0005 1 39.37 0.00043 K ILLAELEQLKGQGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6245.6245.3.dta 1 IPI00827679.1 50 kDa protein 487 49680 22 22 18 18 3639 7404 1 0 1 785.9518 1569.889 2 1569.8878 0.0012 0 38.07 0.00027 R ISLPLPNFSSLNLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8432.8432.2.dta 1 IPI00827679.1 50 kDa protein 487 49680 22 22 18 18 4308 5231 1 0 1 563.6131 1687.8175 3 1687.8199 -0.0024 1 33.8 0.00095 R VEVERDNLAEDIMR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5623.5623.3.dta 1 IPI00827679.1 50 kDa protein 487 49680 22 22 18 18 4679 4184 1 0 1 592.9589 1775.8548 3 1775.855 -0.0003 1 42.21 0.00036 K FADLSEAANRNNDALR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4404.4404.3.dta 1 IPI00827679.1 50 kDa protein 487 49680 22 22 18 18 5605 7504 1 0 1 1063.5366 2125.0587 2 2125.0579 0.0008 0 72.69 1.50E-07 R LLQDSVDFSLADAINTEFK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8561.8561.2.dta 1 IPI00827679.1 50 kDa protein 487 49680 22 22 18 18 5606 7510 1 0 1 709.3605 2125.0596 3 2125.0579 0.0017 0 45.27 5.70E-05 R LLQDSVDFSLADAINTEFK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8568.8568.3.dta 1 IPI00827679.1 50 kDa protein 487 49680 22 22 18 18 6281 5372 1 0 1 793.0584 2376.1532 3 2376.1591 -0.0059 1 23.35 0.0065 R QVQSLTCEVDALKGTNESLER Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5791.5791.3.dta 1 IPI00827679.1 50 kDa protein 487 49680 22 22 18 18 6606 7160 1 0 1 833.0903 2496.2492 3 2496.2496 -0.0005 1 37.94 0.00047 R LLQDSVDFSLADAINTEFKNTR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8129.8129.3.dta 1 IPI00795725.1 17 kDa protein 461 16798 15 15 12 12 699 592 1 0 1 434.7229 867.4313 2 867.4311 0.0002 1 38.62 0.0023 K HGDDLRR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1077.1077.2.dta 1 IPI00795725.1 17 kDa protein 461 16798 15 15 12 12 1242 4517 1 0 1 500.7875 999.5605 2 999.56 0.0005 0 43.38 0.00059 R LQAEIEGLK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4768.4768.2.dta 1 IPI00795725.1 17 kDa protein 461 16798 15 15 12 12 1792 2762 1 0 1 565.3132 1128.6119 2 1128.6138 -0.0019 1 70.27 2.20E-06 R GELAIKDANAK - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2781.2781.2.dta 1 IPI00795725.1 17 kDa protein 461 16798 15 15 12 12 2137 2535 1 0 1 403.536 1207.586 3 1207.5867 -0.0006 1 25.74 0.024 R TKTEISEMNR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2533.2533.3.dta 1 IPI00795725.1 17 kDa protein 461 16798 15 15 12 12 2184 1678 1 0 1 408.8676 1223.5808 3 1223.5816 -0.0007 1 35.43 0.001 R TKTEISEMNR N Oxidation (M) 0.0000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1586.1586.3.dta 1 IPI00795725.1 17 kDa protein 461 16798 15 15 12 12 2185 1677 1 0 1 612.7977 1223.5809 2 1223.5816 -0.0007 1 25.71 0.0039 R TKTEISEMNR N Oxidation (M) 0.0000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1585.1585.2.dta 1 IPI00795725.1 17 kDa protein 461 16798 15 15 12 12 2607 6633 1 0 1 660.8408 1319.6671 2 1319.6642 0.0028 0 91.81 1.50E-08 R SLDMDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7481.7481.2.dta 1 IPI00795725.1 17 kDa protein 461 16798 15 15 12 12 2689 3712 1 0 1 671.3787 1340.7429 2 1340.7412 0.0017 1 68.08 2.10E-06 R LQAEIEGLKGQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3883.3883.2.dta 1 IPI00795725.1 17 kDa protein 461 16798 15 15 12 12 2702 5558 1 0 1 672.8407 1343.6668 2 1343.6681 -0.0012 0 95.83 3.80E-09 R ASLEAAIADAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6007.6007.2.dta 1 IPI00795725.1 17 kDa protein 461 16798 15 15 12 12 3058 6765 1 0 1 710.3782 1418.7418 2 1418.7405 0.0013 0 56.67 3.50E-05 R LEGLTDEINFLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7648.7648.2.dta 1 IPI00795725.1 17 kDa protein 461 16798 15 15 12 12 5266 6385 1 0 1 652.685 1955.0332 3 1955.0323 0.0009 1 30.47 0.003 R ASLEAAIADAEQRGELAIK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7137.7137.3.dta 1 IPI00795725.1 17 kDa protein 461 16798 15 15 12 12 5944 5742 1 0 1 763.3748 2287.1026 3 2287.1041 -0.0015 1 41.63 0.00012 R AEAESMYQIKYEELQSLAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6260.6260.3.dta 1 IPI00795725.1 17 kDa protein 461 16798 15 15 12 12 6295 7952 1 0 1 596.0468 2380.1582 4 2380.158 0.0002 1 17.63 0.043 R SLDMDSIIAEVKAQYEDIANR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9105.9105.4.dta 1 IPI00795725.1 17 kDa protein 461 16798 15 15 12 12 6358 7041 1 0 1 799.7247 2396.1524 3 2396.1529 -0.0005 1 48.7 2.70E-05 R SLDMDSIIAEVKAQYEDIANR S Oxidation (M) 0.000100000000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7979.7979.3.dta 1 IPI00795725.1 17 kDa protein 461 16798 15 15 12 12 8163 7360 1 0 1 1057.1812 3168.5216 3 3168.5244 -0.0028 1 59.67 2.50E-06 R QLYEEEIRELQSQISDTSVVLSMDNSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8370.8370.3.dta 1 IPI00005859.2 Keratin-75 439 59809 17 17 12 12 551 4870 1 0 0 414.2186 826.4227 2 826.4225 0.0002 0 39.72 0.0021 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5192.5192.2.dta 1 IPI00005859.2 Keratin-75 439 59809 17 17 12 12 837 2672 1 0 0 453.7375 905.4604 2 905.4607 -0.0002 0 42.33 0.0018 R FLEQQNK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2684.2684.2.dta 1 IPI00005859.2 Keratin-75 439 59809 17 17 12 12 1262 2916 1 0 0 503.2372 1004.4599 2 1004.4597 0.0003 0 40.72 0.0004 K LLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2949.2949.2.dta 1 IPI00005859.2 Keratin-75 439 59809 17 17 12 12 1529 2096 1 0 0 533.7612 1065.5079 2 1065.509 -0.0011 1 23.99 0.0056 R YEDEINKR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2044.2044.2.dta 1 IPI00005859.2 Keratin-75 439 59809 17 17 12 12 1608 4791 1 0 0 541.8032 1081.5918 2 1081.592 -0.0003 1 44.92 0.00044 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5102.5102.2.dta 1 IPI00005859.2 Keratin-75 439 59809 17 17 12 12 1609 4801 1 0 0 361.5381 1081.5926 3 1081.592 0.0006 1 24.32 0.012 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5114.5114.3.dta 1 IPI00005859.2 Keratin-75 439 59809 17 17 12 12 1629 2126 1 0 0 544.308 1086.6015 2 1086.6033 -0.0018 1 34.49 0.002 R EQIKTLNNK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2076.2076.2.dta 1 IPI00005859.2 Keratin-75 439 59809 17 17 12 12 1814 2589 1 0 0 567.2827 1132.5509 2 1132.5546 -0.0038 1 51.21 7.10E-05 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2594.2594.2.dta 1 IPI00005859.2 Keratin-75 439 59809 17 17 12 12 1815 2591 1 0 0 378.5255 1132.5547 3 1132.5546 0.0001 1 25.04 0.0071 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2596.2596.3.dta 1 IPI00005859.2 Keratin-75 439 59809 17 17 12 12 1933 3958 1 0 0 583.2938 1164.573 2 1164.5775 -0.0045 0 70.17 5.00E-07 K YEELQVTAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4157.4157.2.dta 1 IPI00005859.2 Keratin-75 439 59809 17 17 12 12 2610 4077 2 0 1 660.8607 1319.7069 2 1319.7085 -0.0016 1 70.27 2.00E-06 R TAAENEFVALKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4288.4288.2.dta 1 IPI00005859.2 Keratin-75 439 59809 17 17 12 12 2649 7173 1 0 0 665.3684 1328.7223 2 1328.7187 0.0035 0 77.54 2.40E-07 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8142.8142.2.dta 1 IPI00005859.2 Keratin-75 439 59809 17 17 12 12 2969 5179 1 0 0 699.3744 1396.7343 2 1396.735 -0.0007 1 72.05 3.20E-07 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5562.5562.2.dta 1 IPI00005859.2 Keratin-75 439 59809 17 17 12 12 2970 5184 1 0 0 466.5854 1396.7344 3 1396.735 -0.0006 1 37.73 0.00083 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5568.5568.3.dta 1 IPI00005859.2 Keratin-75 439 59809 17 17 12 12 2971 5173 1 0 0 466.586 1396.7361 3 1396.735 0.001 1 48.02 9.80E-05 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5556.5556.3.dta 1 IPI00005859.2 Keratin-75 439 59809 17 17 12 12 3320 3782 1 0 1 492.9388 1475.7944 3 1475.7984 -0.0039 1 22.47 0.024 R FLEQQNKVLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3964.3964.3.dta 1 IPI00005859.2 Keratin-75 439 59809 17 17 12 12 3321 3793 1 0 1 738.9055 1475.7965 2 1475.7984 -0.0019 1 43.57 0.00014 R FLEQQNKVLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3978.3978.2.dta 1 IPI00787392.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 1" 429 30826 11 11 11 11 97 1338 1 0 1 322.2289 642.4433 2 642.4428 0.0005 1 38.13 0.00042 R AVVVKK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1214.1214.2.dta 1 IPI00787392.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 1" 429 30826 11 11 11 11 1792 2762 1 0 1 565.3132 1128.6119 2 1128.6138 -0.0019 1 70.27 2.20E-06 R GELAIKDANAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2781.2781.2.dta 1 IPI00787392.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 1" 429 30826 11 11 11 11 1793 5196 1 0 1 565.3143 1128.6141 2 1128.6138 0.0003 0 79.66 3.00E-07 K LSELEAALQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5582.5582.2.dta 1 IPI00787392.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 1" 429 30826 11 11 11 11 1890 4566 1 0 0 577.2817 1152.5488 2 1152.5485 0.0003 0 31.48 0.0029 R EYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4821.4821.2.dta 1 IPI00787392.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 1" 429 30826 11 11 11 11 2422 6369 1 0 0 639.3589 1276.7032 2 1276.7027 0.0006 0 70.01 1.40E-06 K LALDIEIATYR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7116.7116.2.dta 1 IPI00787392.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 1" 429 30826 11 11 11 11 2607 6633 1 0 1 660.8408 1319.6671 2 1319.6642 0.0028 0 91.81 1.50E-08 R SLDMDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7481.7481.2.dta 1 IPI00787392.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 1" 429 30826 11 11 11 11 2702 5558 1 0 1 672.8407 1343.6668 2 1343.6681 -0.0012 0 95.83 3.80E-09 R ASLEAAIADAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6007.6007.2.dta 1 IPI00787392.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 1" 429 30826 11 11 11 11 3058 6765 1 0 1 710.3782 1418.7418 2 1418.7405 0.0013 0 56.67 3.50E-05 R LEGLTDEINFLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7648.7648.2.dta 1 IPI00787392.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 1" 429 30826 11 11 11 11 3579 4856 1 0 1 517.6055 1549.7948 3 1549.7922 0.0025 1 39.15 0.00036 R QLREYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5176.5176.3.dta 1 IPI00787392.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 1" 429 30826 11 11 11 11 5266 6385 1 0 1 652.685 1955.0332 3 1955.0323 0.0009 1 30.47 0.003 R ASLEAAIADAEQRGELAIK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7137.7137.3.dta 1 IPI00787392.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 1" 429 30826 11 11 11 11 5944 5742 1 0 1 763.3748 2287.1026 3 2287.1041 -0.0015 1 41.63 0.00012 R AEAESMYQIKYEELQSLAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6260.6260.3.dta 1 IPI00791912.1 22 kDa protein 377 22195 18 18 14 14 53 2021 1 0 0 311.168 620.3214 2 620.3203 0.0011 0 26.92 0.02 K MLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1964.1964.2.dta 1 IPI00791912.1 22 kDa protein 377 22195 18 18 14 14 206 1433 1 0 1 352.1908 702.367 2 702.3661 0.001 0 29.95 0.036 K VSTSGPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1318.1318.2.dta 1 IPI00791912.1 22 kDa protein 377 22195 18 18 14 14 551 4870 1 0 0 414.2186 826.4227 2 826.4225 0.0002 0 39.72 0.0021 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5192.5192.2.dta 1 IPI00791912.1 22 kDa protein 377 22195 18 18 14 14 708 2962 1 0 1 435.7201 869.4256 2 869.4243 0.0013 0 45.06 0.00045 R ISSSSFSR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2999.2999.2.dta 1 IPI00791912.1 22 kDa protein 377 22195 18 18 14 14 837 2672 1 0 0 453.7375 905.4604 2 905.4607 -0.0002 0 42.33 0.0018 R FLEQQNK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2684.2684.2.dta 1 IPI00791912.1 22 kDa protein 377 22195 18 18 14 14 857 1857 1 0 1 456.2148 910.415 2 910.4145 0.0006 0 31.01 0.0016 R SYTSGPGSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1779.1779.2.dta 1 IPI00791912.1 22 kDa protein 377 22195 18 18 14 14 1438 3323 1 0 1 523.2802 1044.5459 2 1044.5451 0.0008 0 41.98 0.00019 R QLETLGQEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3427.3427.2.dta 1 IPI00791912.1 22 kDa protein 377 22195 18 18 14 14 1529 2096 1 0 0 533.7612 1065.5079 2 1065.509 -0.0011 1 23.99 0.0056 K YEDEINKR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2044.2044.2.dta 1 IPI00791912.1 22 kDa protein 377 22195 18 18 14 14 1603 2188 1 0 1 361.1934 1080.5583 3 1080.5564 0.002 1 33.65 0.0041 K SYKVSTSGPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2144.2144.3.dta 1 IPI00791912.1 22 kDa protein 377 22195 18 18 14 14 1608 4791 1 0 0 541.8032 1081.5918 2 1081.592 -0.0003 1 44.92 0.00044 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5102.5102.2.dta 1 IPI00791912.1 22 kDa protein 377 22195 18 18 14 14 1609 4801 1 0 0 361.5381 1081.5926 3 1081.592 0.0006 1 24.32 0.012 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5114.5114.3.dta 1 IPI00791912.1 22 kDa protein 377 22195 18 18 14 14 1629 2126 1 0 0 544.308 1086.6015 2 1086.6033 -0.0018 1 34.49 0.002 K EQIKTLNNK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2076.2076.2.dta 1 IPI00791912.1 22 kDa protein 377 22195 18 18 14 14 2070 2733 1 0 1 601.3294 1200.6443 2 1200.6462 -0.002 1 55.02 6.70E-05 R RQLETLGQEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2750.2750.2.dta 1 IPI00791912.1 22 kDa protein 377 22195 18 18 14 14 2969 5179 1 0 0 699.3744 1396.7343 2 1396.735 -0.0007 1 72.05 3.20E-07 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5562.5562.2.dta 1 IPI00791912.1 22 kDa protein 377 22195 18 18 14 14 2970 5184 1 0 0 466.5854 1396.7344 3 1396.735 -0.0006 1 37.73 0.00083 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5568.5568.3.dta 1 IPI00791912.1 22 kDa protein 377 22195 18 18 14 14 2971 5173 1 0 0 466.586 1396.7361 3 1396.735 0.001 1 48.02 9.80E-05 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5556.5556.3.dta 1 IPI00791912.1 22 kDa protein 377 22195 18 18 14 14 3327 5224 1 0 1 740.8885 1479.7625 2 1479.7643 -0.0017 1 57.4 4.10E-06 R TEMENEFVLIKK - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5615.5615.2.dta 1 IPI00791912.1 22 kDa protein 377 22195 18 18 14 14 3328 5207 1 0 1 494.2619 1479.764 3 1479.7643 -0.0003 1 42.43 0.00022 R TEMENEFVLIKK - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5596.5596.3.dta 1 IPI00290857.2 "Keratin, type II cytoskeletal 3" 308 64636 13 13 8 8 551 4870 1 0 0 414.2186 826.4227 2 826.4225 0.0002 0 39.72 0.0021 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5192.5192.2.dta 1 IPI00290857.2 "Keratin, type II cytoskeletal 3" 308 64636 13 13 8 8 837 2672 1 0 0 453.7375 905.4604 2 905.4607 -0.0002 0 42.33 0.0018 R FLEQQNK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2684.2684.2.dta 1 IPI00290857.2 "Keratin, type II cytoskeletal 3" 308 64636 13 13 8 8 1529 2096 1 0 0 533.7612 1065.5079 2 1065.509 -0.0011 1 23.99 0.0056 K YEDEINKR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2044.2044.2.dta 1 IPI00290857.2 "Keratin, type II cytoskeletal 3" 308 64636 13 13 8 8 1608 4791 1 0 0 541.8032 1081.5918 2 1081.592 -0.0003 1 44.92 0.00044 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5102.5102.2.dta 1 IPI00290857.2 "Keratin, type II cytoskeletal 3" 308 64636 13 13 8 8 1609 4801 1 0 0 361.5381 1081.5926 3 1081.592 0.0006 1 24.32 0.012 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5114.5114.3.dta 1 IPI00290857.2 "Keratin, type II cytoskeletal 3" 308 64636 13 13 8 8 1629 2126 1 0 0 544.308 1086.6015 2 1086.6033 -0.0018 1 34.49 0.002 R EQIKTLNNK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2076.2076.2.dta 1 IPI00290857.2 "Keratin, type II cytoskeletal 3" 308 64636 13 13 8 8 2741 4009 1 0 0 675.8657 1349.7168 2 1349.7191 -0.0023 1 94.5 6.40E-09 R TAAENEFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4212.4212.2.dta 1 IPI00290857.2 "Keratin, type II cytoskeletal 3" 308 64636 13 13 8 8 2742 4002 1 0 0 450.9134 1349.7184 3 1349.7191 -0.0006 1 27.09 0.01 R TAAENEFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4205.4205.3.dta 1 IPI00290857.2 "Keratin, type II cytoskeletal 3" 308 64636 13 13 8 8 2969 5179 1 0 0 699.3744 1396.7343 2 1396.735 -0.0007 1 72.05 3.20E-07 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5562.5562.2.dta 1 IPI00290857.2 "Keratin, type II cytoskeletal 3" 308 64636 13 13 8 8 2970 5184 1 0 0 466.5854 1396.7344 3 1396.735 -0.0006 1 37.73 0.00083 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5568.5568.3.dta 1 IPI00290857.2 "Keratin, type II cytoskeletal 3" 308 64636 13 13 8 8 2971 5173 1 0 0 466.586 1396.7361 3 1396.735 0.001 1 48.02 9.80E-05 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5556.5556.3.dta 1 IPI00290857.2 "Keratin, type II cytoskeletal 3" 308 64636 13 13 8 8 3320 3782 1 0 1 492.9388 1475.7944 3 1475.7984 -0.0039 1 22.47 0.024 R FLEQQNKVLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3964.3964.3.dta 1 IPI00290857.2 "Keratin, type II cytoskeletal 3" 308 64636 13 13 8 8 3321 3793 1 0 1 738.9055 1475.7965 2 1475.7984 -0.0019 1 43.57 0.00014 R FLEQQNKVLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3978.3978.2.dta 1 IPI00791341.1 20 kDa protein 302 19686 15 15 12 12 53 2021 1 0 0 311.168 620.3214 2 620.3203 0.0011 0 26.92 0.02 K MLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1964.1964.2.dta 1 IPI00791341.1 20 kDa protein 302 19686 15 15 12 12 206 1433 1 0 1 352.1908 702.367 2 702.3661 0.001 0 29.95 0.036 K VSTSGPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1318.1318.2.dta 1 IPI00791341.1 20 kDa protein 302 19686 15 15 12 12 551 4870 1 0 0 414.2186 826.4227 2 826.4225 0.0002 0 39.72 0.0021 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5192.5192.2.dta 1 IPI00791341.1 20 kDa protein 302 19686 15 15 12 12 708 2962 1 0 1 435.7201 869.4256 2 869.4243 0.0013 0 45.06 0.00045 R ISSSSFSR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2999.2999.2.dta 1 IPI00791341.1 20 kDa protein 302 19686 15 15 12 12 837 2672 1 0 0 453.7375 905.4604 2 905.4607 -0.0002 0 42.33 0.0018 R FLEQQNK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2684.2684.2.dta 1 IPI00791341.1 20 kDa protein 302 19686 15 15 12 12 857 1857 1 0 1 456.2148 910.415 2 910.4145 0.0006 0 31.01 0.0016 R SYTSGPGSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1779.1779.2.dta 1 IPI00791341.1 20 kDa protein 302 19686 15 15 12 12 1438 3323 1 0 1 523.2802 1044.5459 2 1044.5451 0.0008 0 41.98 0.00019 R QLETLGQEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3427.3427.2.dta 1 IPI00791341.1 20 kDa protein 302 19686 15 15 12 12 1603 2188 1 0 1 361.1934 1080.5583 3 1080.5564 0.002 1 33.65 0.0041 K SYKVSTSGPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2144.2144.3.dta 1 IPI00791341.1 20 kDa protein 302 19686 15 15 12 12 1608 4791 1 0 0 541.8032 1081.5918 2 1081.592 -0.0003 1 44.92 0.00044 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5102.5102.2.dta 1 IPI00791341.1 20 kDa protein 302 19686 15 15 12 12 1609 4801 1 0 0 361.5381 1081.5926 3 1081.592 0.0006 1 24.32 0.012 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5114.5114.3.dta 1 IPI00791341.1 20 kDa protein 302 19686 15 15 12 12 1629 2126 1 0 0 544.308 1086.6015 2 1086.6033 -0.0018 1 34.49 0.002 K EQIKTLNNK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2076.2076.2.dta 1 IPI00791341.1 20 kDa protein 302 19686 15 15 12 12 2070 2733 1 0 1 601.3294 1200.6443 2 1200.6462 -0.002 1 55.02 6.70E-05 R RQLETLGQEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2750.2750.2.dta 1 IPI00791341.1 20 kDa protein 302 19686 15 15 12 12 2969 5179 1 0 0 699.3744 1396.7343 2 1396.735 -0.0007 1 72.05 3.20E-07 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5562.5562.2.dta 1 IPI00791341.1 20 kDa protein 302 19686 15 15 12 12 2970 5184 1 0 0 466.5854 1396.7344 3 1396.735 -0.0006 1 37.73 0.00083 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5568.5568.3.dta 1 IPI00791341.1 20 kDa protein 302 19686 15 15 12 12 2971 5173 1 0 0 466.586 1396.7361 3 1396.735 0.001 1 48.02 9.80E-05 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5556.5556.3.dta 1 IPI00008359.1 "Keratin, type II cytoskeletal 2 oral" 291 66400 14 14 9 9 551 4870 1 0 0 414.2186 826.4227 2 826.4225 0.0002 0 39.72 0.0021 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5192.5192.2.dta 1 IPI00008359.1 "Keratin, type II cytoskeletal 2 oral" 291 66400 14 14 9 9 837 2672 1 0 0 453.7375 905.4604 2 905.4607 -0.0002 0 42.33 0.0018 R FLEQQNK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2684.2684.2.dta 1 IPI00008359.1 "Keratin, type II cytoskeletal 2 oral" 291 66400 14 14 9 9 1262 2916 1 0 0 503.2372 1004.4599 2 1004.4597 0.0003 0 40.72 0.0004 K LLEGEECR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2949.2949.2.dta 1 IPI00008359.1 "Keratin, type II cytoskeletal 2 oral" 291 66400 14 14 9 9 1529 2096 1 0 0 533.7612 1065.5079 2 1065.509 -0.0011 1 23.99 0.0056 K YEDEINKR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2044.2044.2.dta 1 IPI00008359.1 "Keratin, type II cytoskeletal 2 oral" 291 66400 14 14 9 9 1608 4791 1 0 0 541.8032 1081.5918 2 1081.592 -0.0003 1 44.92 0.00044 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5102.5102.2.dta 1 IPI00008359.1 "Keratin, type II cytoskeletal 2 oral" 291 66400 14 14 9 9 1609 4801 1 0 0 361.5381 1081.5926 3 1081.592 0.0006 1 24.32 0.012 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5114.5114.3.dta 1 IPI00008359.1 "Keratin, type II cytoskeletal 2 oral" 291 66400 14 14 9 9 1629 2126 1 0 0 544.308 1086.6015 2 1086.6033 -0.0018 1 34.49 0.002 R EQIKTLNNK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2076.2076.2.dta 1 IPI00008359.1 "Keratin, type II cytoskeletal 2 oral" 291 66400 14 14 9 9 1814 2589 1 0 0 567.2827 1132.5509 2 1132.5546 -0.0038 1 51.21 7.10E-05 R KLLEGEECR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2594.2594.2.dta 1 IPI00008359.1 "Keratin, type II cytoskeletal 2 oral" 291 66400 14 14 9 9 1815 2591 1 0 0 378.5255 1132.5547 3 1132.5546 0.0001 1 25.04 0.0071 R KLLEGEECR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2596.2596.3.dta 1 IPI00008359.1 "Keratin, type II cytoskeletal 2 oral" 291 66400 14 14 9 9 2969 5179 1 0 0 699.3744 1396.7343 2 1396.735 -0.0007 1 72.05 3.20E-07 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5562.5562.2.dta 1 IPI00008359.1 "Keratin, type II cytoskeletal 2 oral" 291 66400 14 14 9 9 2970 5184 1 0 0 466.5854 1396.7344 3 1396.735 -0.0006 1 37.73 0.00083 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5568.5568.3.dta 1 IPI00008359.1 "Keratin, type II cytoskeletal 2 oral" 291 66400 14 14 9 9 2971 5173 1 0 0 466.586 1396.7361 3 1396.735 0.001 1 48.02 9.80E-05 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5556.5556.3.dta 1 IPI00008359.1 "Keratin, type II cytoskeletal 2 oral" 291 66400 14 14 9 9 3320 3782 1 0 1 492.9388 1475.7944 3 1475.7984 -0.0039 1 22.47 0.024 R FLEQQNKVLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3964.3964.3.dta 1 IPI00008359.1 "Keratin, type II cytoskeletal 2 oral" 291 66400 14 14 9 9 3321 3793 1 0 1 738.9055 1475.7965 2 1475.7984 -0.0019 1 43.57 0.00014 R FLEQQNKVLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3978.3978.2.dta 1 IPI00017870.1 Keratin-8-like protein 1 288 55459 11 11 7 7 551 4870 1 0 0 414.2186 826.4227 2 826.4225 0.0002 0 39.72 0.0021 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5192.5192.2.dta 1 IPI00017870.1 Keratin-8-like protein 1 288 55459 11 11 7 7 1438 3323 1 0 1 523.2802 1044.5459 2 1044.5451 0.0008 0 41.98 0.00019 R QLETLGQEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3427.3427.2.dta 1 IPI00017870.1 Keratin-8-like protein 1 288 55459 11 11 7 7 1629 2126 1 0 0 544.308 1086.6015 2 1086.6033 -0.0018 1 34.49 0.002 K EQIKTLNNK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2076.2076.2.dta 1 IPI00017870.1 Keratin-8-like protein 1 288 55459 11 11 7 7 1793 5196 1 0 1 565.3143 1128.6141 2 1128.6138 0.0003 0 79.66 3.00E-07 K LSELEAALQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5582.5582.2.dta 1 IPI00017870.1 Keratin-8-like protein 1 288 55459 11 11 7 7 2070 2733 1 0 1 601.3294 1200.6443 2 1200.6462 -0.002 1 55.02 6.70E-05 R RQLETLGQEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2750.2750.2.dta 1 IPI00017870.1 Keratin-8-like protein 1 288 55459 11 11 7 7 2137 2535 1 0 1 403.536 1207.586 3 1207.5867 -0.0006 1 25.74 0.024 R TKTEISEMNR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2533.2533.3.dta 1 IPI00017870.1 Keratin-8-like protein 1 288 55459 11 11 7 7 2184 1678 1 0 1 408.8676 1223.5808 3 1223.5816 -0.0007 1 35.43 0.001 R TKTEISEMNR N Oxidation (M) 0.0000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1586.1586.3.dta 1 IPI00017870.1 Keratin-8-like protein 1 288 55459 11 11 7 7 2185 1677 1 0 1 612.7977 1223.5809 2 1223.5816 -0.0007 1 25.71 0.0039 R TKTEISEMNR N Oxidation (M) 0.0000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1585.1585.2.dta 1 IPI00017870.1 Keratin-8-like protein 1 288 55459 11 11 7 7 2969 5179 1 0 0 699.3744 1396.7343 2 1396.735 -0.0007 1 72.05 3.20E-07 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5562.5562.2.dta 1 IPI00017870.1 Keratin-8-like protein 1 288 55459 11 11 7 7 2970 5184 1 0 0 466.5854 1396.7344 3 1396.735 -0.0006 1 37.73 0.00083 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5568.5568.3.dta 1 IPI00017870.1 Keratin-8-like protein 1 288 55459 11 11 7 7 2971 5173 1 0 0 466.586 1396.7361 3 1396.735 0.001 1 48.02 9.80E-05 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5556.5556.3.dta 1 IPI00241841.8 keratin 6L 284 58085 13 13 8 8 551 4870 1 0 0 414.2186 826.4227 2 826.4225 0.0002 0 39.72 0.0021 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5192.5192.2.dta 1 IPI00241841.8 keratin 6L 284 58085 13 13 8 8 837 2672 1 0 0 453.7375 905.4604 2 905.4607 -0.0002 0 42.33 0.0018 R FLEQQNK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2684.2684.2.dta 1 IPI00241841.8 keratin 6L 284 58085 13 13 8 8 997 2971 1 0 0 473.2597 944.5049 2 944.5039 0.0009 1 31.68 0.016 R GRLDSELR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3009.3009.2.dta 1 IPI00241841.8 keratin 6L 284 58085 13 13 8 8 998 2966 1 0 0 315.8431 944.5075 3 944.5039 0.0036 1 28.02 0.039 R GRLDSELR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3003.3003.3.dta 1 IPI00241841.8 keratin 6L 284 58085 13 13 8 8 1608 4791 1 0 0 541.8032 1081.5918 2 1081.592 -0.0003 1 44.92 0.00044 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5102.5102.2.dta 1 IPI00241841.8 keratin 6L 284 58085 13 13 8 8 1609 4801 1 0 0 361.5381 1081.5926 3 1081.592 0.0006 1 24.32 0.012 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5114.5114.3.dta 1 IPI00241841.8 keratin 6L 284 58085 13 13 8 8 1629 2126 1 0 0 544.308 1086.6015 2 1086.6033 -0.0018 1 34.49 0.002 R EQIKTLNNK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2076.2076.2.dta 1 IPI00241841.8 keratin 6L 284 58085 13 13 8 8 2649 7173 1 0 0 665.3684 1328.7223 2 1328.7187 0.0035 0 77.54 2.40E-07 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8142.8142.2.dta 1 IPI00241841.8 keratin 6L 284 58085 13 13 8 8 2969 5179 1 0 0 699.3744 1396.7343 2 1396.735 -0.0007 1 72.05 3.20E-07 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5562.5562.2.dta 1 IPI00241841.8 keratin 6L 284 58085 13 13 8 8 2970 5184 1 0 0 466.5854 1396.7344 3 1396.735 -0.0006 1 37.73 0.00083 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5568.5568.3.dta 1 IPI00241841.8 keratin 6L 284 58085 13 13 8 8 2971 5173 1 0 0 466.586 1396.7361 3 1396.735 0.001 1 48.02 9.80E-05 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5556.5556.3.dta 1 IPI00241841.8 keratin 6L 284 58085 13 13 8 8 3320 3782 1 0 1 492.9388 1475.7944 3 1475.7984 -0.0039 1 22.47 0.024 R FLEQQNKVLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3964.3964.3.dta 1 IPI00241841.8 keratin 6L 284 58085 13 13 8 8 3321 3793 1 0 1 738.9055 1475.7965 2 1475.7984 -0.0019 1 43.57 0.00014 R FLEQQNKVLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3978.3978.2.dta 1 IPI00796330.1 18 kDa protein 272 18135 10 10 7 7 997 2971 1 0 0 473.2597 944.5049 2 944.5039 0.0009 1 31.68 0.016 R GRLDSELR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3009.3009.2.dta 1 IPI00796330.1 18 kDa protein 272 18135 10 10 7 7 998 2966 1 0 0 315.8431 944.5075 3 944.5039 0.0036 1 28.02 0.039 R GRLDSELR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3003.3003.3.dta 1 IPI00796330.1 18 kDa protein 272 18135 10 10 7 7 1316 4166 1 0 0 508.7724 1015.5302 2 1015.5298 0.0004 0 36.01 0.00069 R QLDSIVGER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4386.4386.2.dta 1 IPI00796330.1 18 kDa protein 272 18135 10 10 7 7 1529 2096 1 0 0 533.7612 1065.5079 2 1065.509 -0.0011 1 23.99 0.0056 K YEDEINKR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2044.2044.2.dta 1 IPI00796330.1 18 kDa protein 272 18135 10 10 7 7 2649 7173 1 0 0 665.3684 1328.7223 2 1328.7187 0.0035 0 77.54 2.40E-07 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8142.8142.2.dta 1 IPI00796330.1 18 kDa protein 272 18135 10 10 7 7 2741 4009 1 0 0 675.8657 1349.7168 2 1349.7191 -0.0023 1 94.5 6.40E-09 R TAAENEFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4212.4212.2.dta 1 IPI00796330.1 18 kDa protein 272 18135 10 10 7 7 2742 4002 1 0 0 450.9134 1349.7184 3 1349.7191 -0.0006 1 27.09 0.01 R TAAENEFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4205.4205.3.dta 1 IPI00796330.1 18 kDa protein 272 18135 10 10 7 7 3016 6592 1 0 0 704.36 1406.7054 2 1406.7041 0.0013 0 84.72 6.10E-08 K ADTLTDEINFLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7428.7428.2.dta 1 IPI00796330.1 18 kDa protein 272 18135 10 10 7 7 6405 8367 1 0 0 605.3181 2417.2431 4 2417.2438 -0.0006 1 22.58 0.021 R NLDLDSIIAEVKAQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9611.9611.4.dta 1 IPI00796330.1 18 kDa protein 272 18135 10 10 7 7 6406 8356 1 0 0 806.7551 2417.2436 3 2417.2438 -0.0002 1 35.35 0.00073 R NLDLDSIIAEVKAQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9598.9598.3.dta 1 IPI00795197.1 24 kDa protein 253 24107 9 9 8 8 1262 2916 1 0 0 503.2372 1004.4599 2 1004.4597 0.0003 0 40.72 0.0004 K LLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2949.2949.2.dta 1 IPI00795197.1 24 kDa protein 253 24107 9 9 8 8 1814 2589 1 0 0 567.2827 1132.5509 2 1132.5546 -0.0038 1 51.21 7.10E-05 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2594.2594.2.dta 1 IPI00795197.1 24 kDa protein 253 24107 9 9 8 8 1815 2591 1 0 0 378.5255 1132.5547 3 1132.5546 0.0001 1 25.04 0.0071 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2596.2596.3.dta 1 IPI00795197.1 24 kDa protein 253 24107 9 9 8 8 2034 2952 1 0 1 597.79 1193.5654 2 1193.5676 -0.0022 0 59.67 1.10E-05 K YEELQQTAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2988.2988.2.dta 1 IPI00795197.1 24 kDa protein 253 24107 9 9 8 8 2649 7173 1 0 0 665.3684 1328.7223 2 1328.7187 0.0035 0 77.54 2.40E-07 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8142.8142.2.dta 1 IPI00795197.1 24 kDa protein 253 24107 9 9 8 8 2908 5554 1 0 1 462.5929 1384.7569 3 1384.7561 0.0007 1 31.39 0.0021 R NKLAELEEALQK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6003.6003.3.dta 1 IPI00795197.1 24 kDa protein 253 24107 9 9 8 8 3528 5002 1 0 1 513.2725 1536.7957 3 1536.797 -0.0012 1 23.18 0.0067 R LLREYQELMNTK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5355.5355.3.dta 1 IPI00795197.1 24 kDa protein 253 24107 9 9 8 8 6366 8400 1 0 1 802.0836 2403.229 3 2403.2281 0.0009 1 50.3 0.00012 R NLDLDSIIAEVKAQYEEIANR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9650.9650.3.dta 1 IPI00795197.1 24 kDa protein 253 24107 9 9 8 8 6404 5423 1 0 1 806.7112 2417.1119 3 2417.1135 -0.0016 1 49.29 2.40E-05 R TEAESWYQTKYEELQQTAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5850.5850.3.dta 1 IPI00793202.1 14 kDa protein 233 14435 9 9 7 7 53 2021 1 0 0 311.168 620.3214 2 620.3203 0.0011 0 26.92 0.02 - MLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1964.1964.2.dta 1 IPI00793202.1 14 kDa protein 233 14435 9 9 7 7 1438 3323 1 0 1 523.2802 1044.5459 2 1044.5451 0.0008 0 41.98 0.00019 R QLETLGQEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3427.3427.2.dta 1 IPI00793202.1 14 kDa protein 233 14435 9 9 7 7 1529 2096 1 0 0 533.7612 1065.5079 2 1065.509 -0.0011 1 23.99 0.0056 K YEDEINKR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2044.2044.2.dta 1 IPI00793202.1 14 kDa protein 233 14435 9 9 7 7 2070 2733 1 0 1 601.3294 1200.6443 2 1200.6462 -0.002 1 55.02 6.70E-05 R RQLETLGQEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2750.2750.2.dta 1 IPI00793202.1 14 kDa protein 233 14435 9 9 7 7 3058 6765 1 0 1 710.3782 1418.7418 2 1418.7405 0.0013 0 56.67 3.50E-05 R LEGLTDEINFLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7648.7648.2.dta 1 IPI00793202.1 14 kDa protein 233 14435 9 9 7 7 3327 5224 1 0 1 740.8885 1479.7625 2 1479.7643 -0.0017 1 57.4 4.10E-06 R TEMENEFVLIKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5615.5615.2.dta 1 IPI00793202.1 14 kDa protein 233 14435 9 9 7 7 3328 5207 1 0 1 494.2619 1479.764 3 1479.7643 -0.0003 1 42.43 0.00022 R TEMENEFVLIKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5596.5596.3.dta 1 IPI00793202.1 14 kDa protein 233 14435 9 9 7 7 4723 4683 1 0 1 599.9495 1796.8267 3 1796.825 0.0017 1 58.59 4.30E-06 K DVDEAYMNKVELESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4970.4970.3.dta 1 IPI00793202.1 14 kDa protein 233 14435 9 9 7 7 4760 3899 1 0 1 605.2803 1812.819 3 1812.82 -0.001 1 21.93 0.015 K DVDEAYMNKVELESR L Oxidation (M) 0.000000100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4093.4093.3.dta 1 IPI00792167.1 9 kDa protein 211 8852 6 6 5 5 2406 6908 1 0 1 636.8571 1271.6997 2 1271.6973 0.0024 0 84.54 6.20E-08 R SLDLDGIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7818.7818.2.dta 1 IPI00792167.1 9 kDa protein 211 8852 6 6 5 5 3050 6437 1 0 1 709.8674 1417.7203 2 1417.7201 0.0002 0 91.71 6.20E-09 K VDALNDEINFLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7200.7200.2.dta 1 IPI00792167.1 9 kDa protein 211 8852 6 6 5 5 5540 6528 1 0 1 696.7039 2087.0897 3 2087.0898 -0.0001 1 45.16 5.80E-05 K VELEAKVDALNDEINFLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7341.7341.3.dta 1 IPI00792167.1 9 kDa protein 211 8852 6 6 5 5 5721 8169 1 0 1 1112.0629 2222.1112 2 2222.114 -0.0028 1 16.02 0.031 R SLDLDGIIAEVKAQYEEMAK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9367.9367.2.dta 1 IPI00792167.1 9 kDa protein 211 8852 6 6 5 5 5722 8155 1 0 1 741.7128 2222.1165 3 2222.114 0.0025 1 35.47 0.00076 R SLDLDGIIAEVKAQYEEMAK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9351.9351.3.dta 1 IPI00792167.1 9 kDa protein 211 8852 6 6 5 5 8002 7247 1 0 1 1004.1553 3009.4442 3 3009.4448 -0.0006 0 27.61 0.0026 R TLNETELTELQSQISDTSVVLSMDNSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8231.8231.3.dta 1 IPI00300052.1 Keratin type II cuticular Hb4 203 65938 9 9 6 6 551 4870 1 0 0 414.2186 826.4227 2 826.4225 0.0002 0 39.72 0.0021 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5192.5192.2.dta 1 IPI00300052.1 Keratin type II cuticular Hb4 203 65938 9 9 6 6 837 2672 1 0 0 453.7375 905.4604 2 905.4607 -0.0002 0 42.33 0.0018 R FLEQQNK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2684.2684.2.dta 1 IPI00300052.1 Keratin type II cuticular Hb4 203 65938 9 9 6 6 1608 4791 1 0 0 541.8032 1081.5918 2 1081.592 -0.0003 1 44.92 0.00044 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5102.5102.2.dta 1 IPI00300052.1 Keratin type II cuticular Hb4 203 65938 9 9 6 6 1609 4801 1 0 0 361.5381 1081.5926 3 1081.592 0.0006 1 24.32 0.012 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5114.5114.3.dta 1 IPI00300052.1 Keratin type II cuticular Hb4 203 65938 9 9 6 6 1629 2126 1 0 0 544.308 1086.6015 2 1086.6033 -0.0018 1 34.49 0.002 K EQIKTLNNK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2076.2076.2.dta 1 IPI00300052.1 Keratin type II cuticular Hb4 203 65938 9 9 6 6 2969 5179 1 0 0 699.3744 1396.7343 2 1396.735 -0.0007 1 72.05 3.20E-07 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5562.5562.2.dta 1 IPI00300052.1 Keratin type II cuticular Hb4 203 65938 9 9 6 6 2970 5184 1 0 0 466.5854 1396.7344 3 1396.735 -0.0006 1 37.73 0.00083 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5568.5568.3.dta 1 IPI00300052.1 Keratin type II cuticular Hb4 203 65938 9 9 6 6 2971 5173 1 0 0 466.586 1396.7361 3 1396.735 0.001 1 48.02 9.80E-05 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5556.5556.3.dta 1 IPI00300052.1 Keratin type II cuticular Hb4 203 65938 9 9 6 6 3364 4353 1 0 0 497.612 1489.8141 3 1489.814 0.0001 1 27.76 0.0037 R FLEQQNKLLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4589.4589.3.dta 1 IPI00793849.1 Protein 192 22010 6 6 6 6 1529 2096 1 0 0 533.7612 1065.5079 2 1065.509 -0.0011 1 23.99 0.0056 R YEDEINKR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2044.2044.2.dta 1 IPI00793849.1 Protein 192 22010 6 6 6 6 2034 2952 1 0 1 597.79 1193.5654 2 1193.5676 -0.0022 0 59.67 1.10E-05 K YEELQQTAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2988.2988.2.dta 1 IPI00793849.1 Protein 192 22010 6 6 6 6 2649 7173 1 0 0 665.3684 1328.7223 2 1328.7187 0.0035 0 77.54 2.40E-07 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8142.8142.2.dta 1 IPI00793849.1 Protein 192 22010 6 6 6 6 3023 4633 1 0 1 470.9149 1409.7228 3 1409.7224 0.0004 1 32.16 0.0033 R TTAENEFVMLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4910.4910.3.dta 1 IPI00793849.1 Protein 192 22010 6 6 6 6 6366 8400 1 0 1 802.0836 2403.229 3 2403.2281 0.0009 1 50.3 0.00012 R NLDLDSIIAEVKAQYEEIANR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9650.9650.3.dta 1 IPI00793849.1 Protein 192 22010 6 6 6 6 6404 5423 1 0 1 806.7112 2417.1119 3 2417.1135 -0.0016 1 49.29 2.40E-05 R TEAESWYQTKYEELQQTAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5850.5850.3.dta 1 IPI00297795.3 Keratin type II cuticular Hb3 177 56004 5 5 5 5 837 2672 1 0 0 453.7375 905.4604 2 905.4607 -0.0002 0 42.33 0.0018 R FLEQQNK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2684.2684.2.dta 1 IPI00297795.3 Keratin type II cuticular Hb3 177 56004 5 5 5 5 1531 4762 1 0 1 533.8051 1065.5957 2 1065.5971 -0.0014 1 64.97 1.20E-06 R FAAFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5063.5063.2.dta 1 IPI00297795.3 Keratin type II cuticular Hb3 177 56004 5 5 5 5 2282 2828 1 0 1 623.3253 1244.636 2 1244.636 -0.0001 1 54.41 4.90E-05 R TKEEINELNR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2854.2854.2.dta 1 IPI00297795.3 Keratin type II cuticular Hb3 177 56004 5 5 5 5 2610 4077 1 0 1 660.8607 1319.7069 2 1319.7085 -0.0016 1 76.06 5.20E-07 R ATAENEFVALKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4288.4288.2.dta 1 IPI00297795.3 Keratin type II cuticular Hb3 177 56004 5 5 5 5 3364 4353 1 0 0 497.612 1489.8141 3 1489.814 0.0001 1 27.76 0.0037 R FLEQQNKLLETK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4589.4589.3.dta 1 IPI00794362.1 Protein 172 13787 4 4 4 4 2034 2952 1 0 1 597.79 1193.5654 2 1193.5676 -0.0022 0 59.67 1.10E-05 K YEELQQTAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2988.2988.2.dta 1 IPI00794362.1 Protein 172 13787 4 4 4 4 2649 7173 1 0 0 665.3684 1328.7223 2 1328.7187 0.0035 0 77.54 2.40E-07 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8142.8142.2.dta 1 IPI00794362.1 Protein 172 13787 4 4 4 4 6366 8400 1 0 1 802.0836 2403.229 3 2403.2281 0.0009 1 50.3 0.00012 R NLDLDSIIAEVKAQYEEIANR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9650.9650.3.dta 1 IPI00794362.1 Protein 172 13787 4 4 4 4 6404 5423 1 0 1 806.7112 2417.1119 3 2417.1135 -0.0016 1 49.29 2.40E-05 R TEAESWYQTKYEELQQTAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5850.5850.3.dta 1 IPI00655639.1 Hypothetical protein (Fragment) 170 12922 6 6 5 5 1611 1429 1 0 1 542.2676 1082.5207 2 1082.5217 -0.001 1 14.67 0.042 K HGDDLRNTR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1313.1313.2.dta 1 IPI00655639.1 Hypothetical protein (Fragment) 170 12922 6 6 5 5 2406 6908 1 0 1 636.8571 1271.6997 2 1271.6973 0.0024 0 84.54 6.20E-08 R SLDLDGIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7818.7818.2.dta 1 IPI00655639.1 Hypothetical protein (Fragment) 170 12922 6 6 5 5 2805 2676 1 0 1 682.322 1362.6294 2 1362.631 -0.0016 1 26.61 0.0032 R NTRNEISEMNR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2688.2688.2.dta 1 IPI00655639.1 Hypothetical protein (Fragment) 170 12922 6 6 5 5 3175 3420 1 0 1 721.3906 1440.7667 2 1440.7684 -0.0018 1 75.78 7.80E-08 R LQAEIDNIKNQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3538.3538.2.dta 1 IPI00655639.1 Hypothetical protein (Fragment) 170 12922 6 6 5 5 5721 8169 1 0 1 1112.0629 2222.1112 2 2222.114 -0.0028 1 16.02 0.031 R SLDLDGIIAEVKAQYEEMAK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9367.9367.2.dta 1 IPI00655639.1 Hypothetical protein (Fragment) 170 12922 6 6 5 5 5722 8155 1 0 1 741.7128 2222.1165 3 2222.114 0.0025 1 35.47 0.00076 R SLDLDGIIAEVKAQYEEMAK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9351.9351.3.dta 1 IPI00552689.1 Vimentin 159 20138 5 5 5 5 103 3356 1 0 0 323.182 644.3494 2 644.3493 0.0001 0 33.71 0.019 R LDLER K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3468.3468.2.dta 1 IPI00552689.1 Vimentin 159 20138 5 5 5 5 1349 2293 1 0 1 512.2592 1022.5038 2 1022.5032 0.0005 0 37.2 0.00052 R QQYESVAAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2260.2260.2.dta 1 IPI00552689.1 Vimentin 159 20138 5 5 5 5 3495 4622 1 0 1 762.8683 1523.7221 2 1523.7256 -0.0034 1 74.7 1.00E-07 K NLQEAEEWYKSK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4898.4898.2.dta 1 IPI00552689.1 Vimentin 159 20138 5 5 5 5 3510 6036 1 0 1 511.9556 1532.845 3 1532.845 0 1 57.15 2.60E-05 R KVESLQEEIAFLK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6677.6677.3.dta 1 IPI00552689.1 Vimentin 159 20138 5 5 5 5 4679 4184 1 0 1 592.9589 1775.8548 3 1775.855 -0.0003 1 42.21 0.00036 K FADLSEAANRNNDALR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4404.4404.3.dta 1 IPI00215804.4 "similar to Keratin, type II cytoskeletal 8" 141 23165 3 3 3 3 97 1338 1 0 1 322.2289 642.4433 2 642.4428 0.0005 1 38.13 0.00042 R AVVVKK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1214.1214.2.dta 1 IPI00215804.4 "similar to Keratin, type II cytoskeletal 8" 141 23165 3 3 3 3 1792 2762 1 0 1 565.3132 1128.6119 2 1128.6138 -0.0019 1 70.27 2.20E-06 R GELAIKDANAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2781.2781.2.dta 1 IPI00215804.4 "similar to Keratin, type II cytoskeletal 8" 141 23165 3 3 3 3 1793 5196 1 0 1 565.3143 1128.6141 2 1128.6138 0.0003 0 79.66 3.00E-07 K LSELEAALQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5582.5582.2.dta 1 IPI00793572.1 6 kDa protein 130 6322 3 3 3 3 3050 6437 1 0 1 709.8674 1417.7203 2 1417.7201 0.0002 0 91.71 6.20E-09 K VDALNDEINFLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7200.7200.2.dta 1 IPI00793572.1 6 kDa protein 130 6322 3 3 3 3 5540 6528 1 0 1 696.7039 2087.0897 3 2087.0898 -0.0001 1 45.16 5.80E-05 K VELEAKVDALNDEINFLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7341.7341.3.dta 1 IPI00793572.1 6 kDa protein 130 6322 3 3 3 3 8002 7247 1 0 1 1004.1553 3009.4442 3 3009.4448 -0.0006 0 27.61 0.0026 R TLNETELTELQSQISDTSVVLSMDNSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8231.8231.3.dta 1 IPI00376379.3 Keratin 77 129 62050 5 5 4 4 551 4870 1 0 0 414.2186 826.4227 2 826.4225 0.0002 0 39.72 0.0021 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5192.5192.2.dta 1 IPI00376379.3 Keratin 77 129 62050 5 5 4 4 1529 2096 1 0 0 533.7612 1065.5079 2 1065.509 -0.0011 1 23.99 0.0056 K YEDEINKR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2044.2044.2.dta 1 IPI00376379.3 Keratin 77 129 62050 5 5 4 4 1608 4791 1 0 0 541.8032 1081.5918 2 1081.592 -0.0003 1 44.92 0.00044 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5102.5102.2.dta 1 IPI00376379.3 Keratin 77 129 62050 5 5 4 4 1609 4801 1 0 0 361.5381 1081.5926 3 1081.592 0.0006 1 24.32 0.012 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5114.5114.3.dta 1 IPI00376379.3 Keratin 77 129 62050 5 5 4 4 3319 4285 1 0 0 738.3964 1474.7783 2 1474.778 0.0003 0 81.84 1.40E-07 R FLEQQNQVLQTK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4516.4516.2.dta 1 IPI00791554.1 17 kDa protein 128 17100 3 3 2 2 2422 6369 1 0 0 639.3589 1276.7032 2 1276.7027 0.0006 0 70.01 1.40E-06 K LALDIEIATYR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7116.7116.2.dta 1 IPI00791554.1 17 kDa protein 128 17100 3 3 2 2 2906 3933 1 0 1 693.3708 1384.727 2 1384.731 -0.004 1 69.51 7.30E-07 R AKQEELEAALQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4130.4130.2.dta 1 IPI00791554.1 17 kDa protein 128 17100 3 3 2 2 2907 3932 1 0 1 462.5845 1384.7318 3 1384.731 0.0008 1 35.89 0.0057 R AKQEELEAALQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4129.4129.3.dta 1 IPI00032541.1 Keratin type II cuticular Hb5 126 57306 4 4 4 4 837 2672 1 0 0 453.7375 905.4604 2 905.4607 -0.0002 0 42.33 0.0018 R FLEQQNK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2684.2684.2.dta 1 IPI00032541.1 Keratin type II cuticular Hb5 126 57306 4 4 4 4 1531 4762 1 0 1 533.8051 1065.5957 2 1065.5971 -0.0014 1 64.97 1.20E-06 R FAAFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5063.5063.2.dta 1 IPI00032541.1 Keratin type II cuticular Hb5 126 57306 4 4 4 4 2282 2828 1 0 1 623.3253 1244.636 2 1244.636 -0.0001 1 54.41 4.90E-05 R TKEEINELNR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2854.2854.2.dta 1 IPI00032541.1 Keratin type II cuticular Hb5 126 57306 4 4 4 4 3364 4353 1 0 0 497.612 1489.8141 3 1489.814 0.0001 1 27.76 0.0037 R FLEQQNKLLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4589.4589.3.dta 1 IPI00174775.2 Keratin 6 irs3 123 59457 6 6 4 4 551 4870 1 0 0 414.2186 826.4227 2 826.4225 0.0002 0 39.72 0.0021 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5192.5192.2.dta 1 IPI00174775.2 Keratin 6 irs3 123 59457 6 6 4 4 1262 2916 1 0 0 503.2372 1004.4599 2 1004.4597 0.0003 0 40.72 0.0004 K LLEGEECR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2949.2949.2.dta 1 IPI00174775.2 Keratin 6 irs3 123 59457 6 6 4 4 1608 4791 1 0 0 541.8032 1081.5918 2 1081.592 -0.0003 1 44.92 0.00044 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5102.5102.2.dta 1 IPI00174775.2 Keratin 6 irs3 123 59457 6 6 4 4 1609 4801 1 0 0 361.5381 1081.5926 3 1081.592 0.0006 1 24.32 0.012 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5114.5114.3.dta 1 IPI00174775.2 Keratin 6 irs3 123 59457 6 6 4 4 1814 2589 1 0 0 567.2827 1132.5509 2 1132.5546 -0.0038 1 51.21 7.10E-05 R KLLEGEECR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2594.2594.2.dta 1 IPI00174775.2 Keratin 6 irs3 123 59457 6 6 4 4 1815 2591 1 0 0 378.5255 1132.5547 3 1132.5546 0.0001 1 25.04 0.0071 R KLLEGEECR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2596.2596.3.dta 1 IPI00217437.4 Tau-tubulin kinase 121 185741 5 5 5 5 53 2021 1 0 0 311.168 620.3214 2 620.3203 0.0011 0 26.92 0.02 K MLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1964.1964.2.dta 1 IPI00217437.4 Tau-tubulin kinase 121 185741 5 5 5 5 837 2672 1 0 0 453.7375 905.4604 2 905.4607 -0.0002 0 42.33 0.0018 R FLEQQNK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2684.2684.2.dta 1 IPI00217437.4 Tau-tubulin kinase 121 185741 5 5 5 5 1792 2762 1 0 1 565.3132 1128.6119 2 1128.6138 -0.0019 1 70.27 2.20E-06 R GELAIKDANAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2781.2781.2.dta 1 IPI00217437.4 Tau-tubulin kinase 121 185741 5 5 5 5 1890 4566 1 0 0 577.2817 1152.5488 2 1152.5485 0.0003 0 31.48 0.0029 R EYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4821.4821.2.dta 1 IPI00217437.4 Tau-tubulin kinase 121 185741 5 5 5 5 3579 4856 1 0 1 517.6055 1549.7948 3 1549.7922 0.0025 1 39.15 0.00036 R QLREYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5176.5176.3.dta 1 IPI00008669.2 38 kDa protein 105 39031 2 2 2 2 2282 2828 1 0 1 623.3253 1244.636 2 1244.636 -0.0001 1 54.41 4.90E-05 R TKEEINELNR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2854.2854.2.dta 1 IPI00008669.2 38 kDa protein 105 39031 2 2 2 2 2610 4077 1 0 1 660.8607 1319.7069 2 1319.7085 -0.0016 1 76.06 5.20E-07 R ATAENEFVALKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4288.4288.2.dta 1 IPI00793778.1 Keratin 104 10027 2 2 2 2 2649 7173 1 0 0 665.3684 1328.7223 2 1328.7187 0.0035 0 77.54 2.40E-07 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8142.8142.2.dta 1 IPI00793778.1 Keratin 104 10027 2 2 2 2 6366 8400 1 0 1 802.0836 2403.229 3 2403.2281 0.0009 1 50.3 0.00012 R NLDLDSIIAEVKAQYEEIANR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9650.9650.3.dta 1 IPI00025363.1 "Isoform 1 of Glial fibrillary acidic protein, astrocyte" 93 49907 3 3 3 3 103 3356 1 0 0 323.182 644.3494 2 644.3493 0.0001 0 33.71 0.019 R LDLER K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3468.3468.2.dta 1 IPI00025363.1 "Isoform 1 of Glial fibrillary acidic protein, astrocyte" 93 49907 3 3 3 3 837 2672 1 0 0 453.7375 905.4604 2 905.4607 -0.0002 0 42.33 0.0018 R FLEQQNK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2684.2684.2.dta 1 IPI00025363.1 "Isoform 1 of Glial fibrillary acidic protein, astrocyte" 93 49907 3 3 3 3 2422 6369 1 0 0 639.3589 1276.7032 2 1276.7027 0.0006 0 70.01 1.40E-06 K LALDIEIATYR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7116.7116.2.dta 1 IPI00748057.2 "Similar to Keratin, type II cytoskeletal 8" 92 11491 3 3 2 2 1529 2096 1 0 0 533.7612 1065.5079 2 1065.509 -0.0011 1 23.99 0.0056 K YEDEINKR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2044.2044.2.dta 1 IPI00748057.2 "Similar to Keratin, type II cytoskeletal 8" 92 11491 3 3 2 2 3327 5224 1 0 1 740.8885 1479.7625 2 1479.7643 -0.0017 1 57.4 4.10E-06 R TEMENEFVLIKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5615.5615.2.dta 1 IPI00748057.2 "Similar to Keratin, type II cytoskeletal 8" 92 11491 3 3 2 2 3328 5207 1 0 1 494.2619 1479.764 3 1479.7643 -0.0003 1 42.43 0.00022 R TEMENEFVLIKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5596.5596.3.dta 1 IPI00166205.2 Keratin-78 88 57728 4 4 3 3 837 2672 1 0 0 453.7375 905.4604 2 905.4607 -0.0002 0 42.33 0.0018 R FLEQQNK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2684.2684.2.dta 1 IPI00166205.2 Keratin-78 88 57728 4 4 3 3 1262 2916 1 0 0 503.2372 1004.4599 2 1004.4597 0.0003 0 40.72 0.0004 R LLEGEECR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2949.2949.2.dta 1 IPI00166205.2 Keratin-78 88 57728 4 4 3 3 3320 3782 1 0 1 492.9388 1475.7944 3 1475.7984 -0.0039 1 22.47 0.024 R FLEQQNKVLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3964.3964.3.dta 1 IPI00166205.2 Keratin-78 88 57728 4 4 3 3 3321 3793 1 0 1 738.9055 1475.7965 2 1475.7984 -0.0019 1 43.57 0.00014 R FLEQQNKVLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3978.3978.2.dta 1 IPI00290078.5 keratin 4 85 64442 2 2 2 2 551 4870 1 0 0 414.2186 826.4227 2 826.4225 0.0002 0 39.72 0.0021 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5192.5192.2.dta 1 IPI00290078.5 keratin 4 85 64442 2 2 2 2 2422 6369 1 0 0 639.3589 1276.7032 2 1276.7027 0.0006 0 70.01 1.40E-06 K LALDIEIATYR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7116.7116.2.dta 1 IPI00021751.5 Neurofilament triplet H protein 79 112640 3 3 2 2 1262 2916 1 0 0 503.2372 1004.4599 2 1004.4597 0.0003 0 40.72 0.0004 K LLEGEECR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2949.2949.2.dta 1 IPI00021751.5 Neurofilament triplet H protein 79 112640 3 3 2 2 1814 2589 1 0 0 567.2827 1132.5509 2 1132.5546 -0.0038 1 51.21 7.10E-05 R KLLEGEECR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2594.2594.2.dta 1 IPI00021751.5 Neurofilament triplet H protein 79 112640 3 3 2 2 1815 2591 1 0 0 378.5255 1132.5547 3 1132.5546 0.0001 1 25.04 0.0071 R KLLEGEECR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2596.2596.3.dta 1 IPI00013164.4 Isoform 1 of Peripherin 75 53732 1 1 1 1 3495 4622 1 0 1 762.8683 1523.7221 2 1523.7256 -0.0034 1 74.7 1.00E-07 K NLQEAEEWYKSK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4898.4898.2.dta 1 IPI00375843.2 Keratin-80 70 54728 1 1 1 1 2422 6369 1 0 0 639.3589 1276.7032 2 1276.7027 0.0006 0 70.01 1.40E-06 K LALDIEIATYR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7116.7116.2.dta 1 IPI00061200.3 Keratin-71 64 57769 3 3 2 2 551 4870 1 0 0 414.2186 826.4227 2 826.4225 0.0002 0 39.72 0.0021 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5192.5192.2.dta 1 IPI00061200.3 Keratin-71 64 57769 3 3 2 2 1608 4791 1 0 0 541.8032 1081.5918 2 1081.592 -0.0003 1 44.92 0.00044 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5102.5102.2.dta 1 IPI00061200.3 Keratin-71 64 57769 3 3 2 2 1609 4801 1 0 0 361.5381 1081.5926 3 1081.592 0.0006 1 24.32 0.012 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5114.5114.3.dta 1 IPI00738902.1 "similar to keratin, hair, basic, 6" 54 22583 1 1 1 1 2282 2828 1 0 1 623.3253 1244.636 2 1244.636 -0.0001 1 54.41 4.90E-05 R TKEEINELNR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2854.2854.2.dta 1 IPI00791653.1 8 kDa protein 49 7516 1 1 1 1 389 2190 1 0 1 390.1934 778.3722 2 778.3722 0 0 49 5.90E-05 K AAFGGSGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2146.2146.2.dta 1 IPI00790961.1 KRT8L2 protein 34 13076 1 1 1 1 1629 2126 1 0 0 544.308 1086.6015 2 1086.6033 -0.0018 1 34.49 0.002 K EQIKTLNNK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2076.2076.2.dta 1 IPI00465084.6 Desmin 34 53560 2 2 2 2 103 3356 1 0 1 323.182 644.3494 2 644.3493 0.0001 0 33.71 0.019 R IDLER R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3468.3468.2.dta 1 IPI00465084.6 Desmin 34 53560 2 2 2 2 3502 4617 1 0 1 509.9476 1526.8209 3 1526.8205 0.0004 1 25.51 0.018 R HLREYQDLLNVK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4893.4893.3.dta 1 IPI00794122.1 13 kDa protein 28 13581 2 2 2 2 1611 1429 1 0 1 542.2676 1082.5207 2 1082.5217 -0.001 1 14.67 0.042 K HGDDLRNTR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1313.1313.2.dta 1 IPI00794122.1 13 kDa protein 28 13581 2 2 2 2 2805 2676 1 0 1 682.322 1362.6294 2 1362.631 -0.0016 1 26.61 0.0032 R NTRNEISEMNR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2688.2688.2.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 997 48029 39 39 29 29 250 3519 1 1 1 359.7002 717.3858 2 717.3843 0.0015 0 31.36 0.024 K IMADIR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3665.3665.2.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 997 48029 39 39 29 29 287 2851 1 1 1 367.698 733.3815 2 733.3792 0.0023 0 42.42 0.0016 K IMADIR A Oxidation (M) 0.010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2879.2879.2.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 997 48029 39 39 29 29 470 3740 1 1 0 404.204 806.3935 2 806.3923 0.0013 0 30.65 0.0032 R LAADDFR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3918.3918.2.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 997 48029 39 39 29 29 906 1595 2 1 1 462.7662 923.5179 2 923.5188 -0.001 1 28.3 0.017 K IREHLEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1496.1496.2.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 997 48029 39 39 29 29 1074 3425 1 1 1 483.238 964.4615 2 964.4614 0.0001 0 40.57 0.0018 R AQYDELAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3544.3544.2.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 997 48029 39 39 29 29 1112 3290 1 1 1 488.2301 974.4457 2 974.4458 0 0 44.41 0.00042 R STFSTNYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3389.3389.2.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 997 48029 39 39 29 29 1181 1410 1 1 1 496.748 991.4815 2 991.4822 -0.0007 0 24.11 0.018 K VVSETNDTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1293.1293.2.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 997 48029 39 39 29 29 1415 4698 1 1 0 521.3065 1040.5984 2 1040.5978 0.0005 0 45.25 0.00015 R IVLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4986.4986.2.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 997 48029 39 39 29 29 1446 3272 1 1 1 523.7783 1045.5421 2 1045.5404 0.0017 0 42.7 0.0016 K VIDDTNITR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3364.3364.2.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 997 48029 39 39 29 29 1526 4220 1 1 1 533.2823 1064.5501 2 1064.5502 0 0 64.58 3.30E-06 K LEAEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4443.4443.2.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 997 48029 39 39 29 29 1655 3990 1 1 1 546.8112 1091.6078 2 1091.6087 -0.001 1 34.01 0.0021 R LASYLDRVR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4192.4192.2.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 997 48029 39 39 29 29 1657 2968 1 1 1 547.2523 1092.4901 2 1092.487 0.0031 0 30.71 0.0097 K ETMQSLNDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3005.3005.2.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 997 48029 39 39 29 29 1659 2803 1 1 1 547.2851 1092.5556 2 1092.5563 -0.0007 1 47.85 0.00014 R AQYDELARK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2826.2826.2.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 997 48029 39 39 29 29 1660 2797 1 1 1 365.193 1092.5571 3 1092.5563 0.0007 1 29.98 0.02 R AQYDELARK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2819.2819.3.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 997 48029 39 39 29 29 2179 3532 1 1 1 611.3341 1220.6537 2 1220.6513 0.0024 1 26.11 0.0066 K LEAEIATYRR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3681.3681.2.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 997 48029 39 39 29 29 2258 3870 1 1 1 413.8856 1238.6349 3 1238.6329 0.0021 1 38 0.0017 R VKYETELAMR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4062.4062.3.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 997 48029 39 39 29 29 2276 4394 1 1 1 622.8506 1243.6866 2 1243.6884 -0.0018 1 35.66 0.00078 R NLKASLENSLR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4636.4636.2.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 997 48029 39 39 29 29 2320 3173 1 1 1 628.3186 1254.6227 2 1254.6278 -0.0051 1 58.74 3.10E-06 R VKYETELAMR Q Oxidation (M) 0.0000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3240.3240.2.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 997 48029 39 39 29 29 2376 3621 1 1 1 634.3223 1266.63 2 1266.6317 -0.0017 0 54.53 2.30E-05 R QSVENDIHGLR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3782.3782.2.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 997 48029 39 39 29 29 2377 3617 1 1 1 423.2176 1266.6309 3 1266.6317 -0.0007 0 16.17 0.031 R QSVENDIHGLR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3778.3778.3.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 997 48029 39 39 29 29 2488 4479 1 1 1 646.863 1291.7114 2 1291.7136 -0.0022 1 49.82 3.90E-05 K VKLEAEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4727.4727.2.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 997 48029 39 39 29 29 2489 4478 1 1 1 431.5784 1291.7134 3 1291.7136 -0.0002 1 37.39 0.0006 K VKLEAEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4726.4726.3.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 997 48029 39 39 29 29 2602 4354 1 1 1 660.3369 1318.6592 2 1318.6629 -0.0038 0 81.02 3.10E-08 R AQIFANTVDNAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4590.4590.2.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 997 48029 39 39 29 29 2962 3066 1 1 1 698.3719 1394.7293 2 1394.7266 0.0027 1 58.34 3.40E-06 R QSVENDIHGLRK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3121.3121.2.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 997 48029 39 39 29 29 3056 5884 1 1 1 710.3774 1418.7402 2 1418.7405 -0.0003 0 54.58 6.80E-05 R QAQEYEALLNIK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6478.6478.2.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 997 48029 39 39 29 29 3414 2728 1 1 1 752.8956 1503.7766 2 1503.7781 -0.0015 1 50.25 1.90E-05 R IVDGKVVSETNDTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2744.2744.2.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 997 48029 39 39 29 29 3415 2647 1 1 1 502.2664 1503.7773 3 1503.7781 -0.0007 1 33.03 0.0011 R IVDGKVVSETNDTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2657.2657.3.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 997 48029 39 39 29 29 3424 6215 1 1 1 753.877 1505.7395 2 1505.7395 -0.0001 0 97.45 3.50E-09 R TVQSLEIDLDSMR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6925.6925.2.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 997 48029 39 39 29 29 3425 6225 1 1 1 502.9205 1505.7398 3 1505.7395 0.0002 0 37.71 0.0035 R TVQSLEIDLDSMR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6936.6936.3.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 997 48029 39 39 29 29 3480 5444 1 1 1 761.8732 1521.7319 2 1521.7345 -0.0026 0 69.06 3.30E-07 R TVQSLEIDLDSMR N Oxidation (M) 0.0000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5873.5873.2.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 997 48029 39 39 29 29 5275 5591 1 1 1 654.3411 1960.0015 3 1960.0013 0.0002 1 50.18 2.10E-05 R AEGQRQAQEYEALLNIK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6051.6051.3.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 997 48029 39 39 29 29 5492 5944 1 1 1 1030.0489 2058.0833 2 2058.0858 -0.0024 1 32.08 0.00098 K IIEDLRAQIFANTVDNAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6562.6562.2.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 997 48029 39 39 29 29 5493 5936 1 1 1 687.0362 2058.0868 3 2058.0858 0.001 1 63.46 1.10E-06 K IIEDLRAQIFANTVDNAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6547.6547.3.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 997 48029 39 39 29 29 5675 7730 1 1 1 731.729 2192.1652 3 2192.165 0.0002 1 35.07 0.0016 R LQLETEIEALKEELLFMK K Oxidation (M) 0.000000000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8833.8833.3.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 997 48029 39 39 29 29 7139 8461 1 1 1 890.8033 2669.3882 3 2669.3846 0.0036 0 76.44 6.80E-08 R YALQMEQLNGILLHLESELAQTR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9741.9741.3.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 997 48029 39 39 29 29 7173 7888 1 1 1 896.1346 2685.3819 3 2685.3795 0.0024 0 63.68 1.10E-06 R YALQMEQLNGILLHLESELAQTR A Oxidation (M) 0.00001000000000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9029.9029.3.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 997 48029 39 39 29 29 7383 5417 1 1 1 688.1059 2748.3945 4 2748.393 0.0015 1 48.86 0.00014 K NHEEEVKGLQAQIASSGLTVEVDAPK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5843.5843.4.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 997 48029 39 39 29 29 7821 6133 1 1 1 966.1238 2895.3495 3 2895.3556 -0.0061 1 32.48 0.0009 R RLLEDGEDFNLGDALDSSNSMQTIQK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6806.6806.3.dta 2 1 IPI00784347.2 "Keratin, type I cytoskeletal 18" 997 48029 39 39 29 29 8236 7464 1 1 1 807.6689 3226.6467 4 3226.6404 0.0063 1 24.06 0.019 R YALQMEQLNGILLHLESELAQTRAEGQR Q Oxidation (M) 0.0000100000000000000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8512.8512.4.dta 2 2 IPI00384444.5 "Keratin, type I cytoskeletal 14" 798 51875 24 24 19 19 197 4796 1 0 0 350.7337 699.4528 2 699.4531 -0.0003 0 37.55 0.00058 K ILLDVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5107.5107.2.dta 2 2 IPI00384444.5 "Keratin, type I cytoskeletal 14" 798 51875 24 24 19 19 470 3740 1 0 0 404.204 806.3935 2 806.3923 0.0013 0 30.65 0.0032 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3918.3918.2.dta 2 2 IPI00384444.5 "Keratin, type I cytoskeletal 14" 798 51875 24 24 19 19 1172 2953 1 0 0 495.2721 988.5297 2 988.5301 -0.0004 1 27.65 0.047 K SEISELRR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2989.2989.2.dta 2 2 IPI00384444.5 "Keratin, type I cytoskeletal 14" 798 51875 24 24 19 19 1373 5337 1 0 0 515.3007 1028.5869 2 1028.5866 0.0003 0 50.26 0.00016 R VLDELTLAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5750.5750.2.dta 2 2 IPI00384444.5 "Keratin, type I cytoskeletal 14" 798 51875 24 24 19 19 1522 3928 1 0 0 355.5416 1063.603 3 1063.6026 0.0004 1 21.08 0.014 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4125.4125.3.dta 2 2 IPI00384444.5 "Keratin, type I cytoskeletal 14" 798 51875 24 24 19 19 1696 2070 1 0 0 553.7662 1105.5178 2 1105.5186 -0.0008 0 56.68 4.20E-05 K VTMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2017.2017.2.dta 2 2 IPI00384444.5 "Keratin, type I cytoskeletal 14" 798 51875 24 24 19 19 1697 3550 1 0 0 553.7845 1105.5545 2 1105.555 -0.0004 0 68.21 4.00E-06 R ISSVLAGGSCR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3703.3703.2.dta 2 2 IPI00384444.5 "Keratin, type I cytoskeletal 14" 798 51875 24 24 19 19 1698 3559 1 0 0 553.7849 1105.5552 2 1105.555 0.0002 0 73.98 8.50E-07 R ISSVLAGGSCR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3713.3713.2.dta 2 2 IPI00384444.5 "Keratin, type I cytoskeletal 14" 798 51875 24 24 19 19 1757 3753 1 0 0 561.7919 1121.5692 2 1121.5717 -0.0025 0 55.46 4.00E-05 R LEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3932.3932.2.dta 2 2 IPI00384444.5 "Keratin, type I cytoskeletal 14" 798 51875 24 24 19 19 1758 3742 1 0 0 561.7934 1121.5722 2 1121.5717 0.0006 0 68.56 1.70E-06 R LEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3920.3920.2.dta 2 2 IPI00384444.5 "Keratin, type I cytoskeletal 14" 798 51875 24 24 19 19 2369 3926 1 0 1 633.8362 1265.6578 2 1265.6615 -0.0037 1 50.24 1.90E-05 R TKYETELNLR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4122.4122.2.dta 2 2 IPI00384444.5 "Keratin, type I cytoskeletal 14" 798 51875 24 24 19 19 2370 3934 1 0 1 422.8945 1265.6617 3 1265.6615 0.0001 1 37.08 0.0033 R TKYETELNLR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4131.4131.3.dta 2 2 IPI00384444.5 "Keratin, type I cytoskeletal 14" 798 51875 24 24 19 19 2423 3181 1 0 0 639.7946 1277.5747 2 1277.5783 -0.0036 0 85.61 3.50E-08 K GSCGIGGGIGGGSSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3249.3249.2.dta 2 2 IPI00384444.5 "Keratin, type I cytoskeletal 14" 798 51875 24 24 19 19 2515 4153 1 0 0 651.3337 1300.6529 2 1300.651 0.0019 0 67.28 3.40E-06 R ALEEANADLEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4372.4372.2.dta 2 2 IPI00384444.5 "Keratin, type I cytoskeletal 14" 798 51875 24 24 19 19 2790 3146 1 0 0 681.3486 1360.6826 2 1360.6834 -0.0008 0 85.68 2.20E-08 R EVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3209.3209.2.dta 2 2 IPI00384444.5 "Keratin, type I cytoskeletal 14" 798 51875 24 24 19 19 2889 4323 1 0 0 690.3658 1378.7171 2 1378.7204 -0.0033 1 60.65 2.10E-06 K TRLEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4557.4557.2.dta 2 2 IPI00384444.5 "Keratin, type I cytoskeletal 14" 798 51875 24 24 19 19 3087 3682 1 0 1 713.3515 1424.6885 2 1424.6896 -0.0011 0 77.09 5.90E-08 R APSTYGGGLSVSSSR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3850.3850.2.dta 2 2 IPI00384444.5 "Keratin, type I cytoskeletal 14" 798 51875 24 24 19 19 3115 3585 1 0 0 717.3644 1432.7143 2 1432.7157 -0.0014 1 51.78 6.90E-05 K ASLENSLEETKGR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3741.3741.2.dta 2 2 IPI00384444.5 "Keratin, type I cytoskeletal 14" 798 51875 24 24 19 19 3116 3577 1 0 0 478.5789 1432.7148 3 1432.7157 -0.0009 1 36.34 0.00089 K ASLENSLEETKGR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3732.3732.3.dta 2 2 IPI00384444.5 "Keratin, type I cytoskeletal 14" 798 51875 24 24 19 19 3163 3518 1 0 0 719.8531 1437.6917 2 1437.6922 -0.0004 1 57.78 2.90E-05 R ILNEMRDQYEK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3664.3664.2.dta 2 2 IPI00384444.5 "Keratin, type I cytoskeletal 14" 798 51875 24 24 19 19 4551 4357 1 0 1 581.3015 1740.8825 3 1740.8835 -0.001 1 33.76 0.00068 R QRPAEIKDYSPYFK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4594.4594.3.dta 2 2 IPI00384444.5 "Keratin, type I cytoskeletal 14" 798 51875 24 24 19 19 4552 4348 1 0 1 436.2283 1740.8842 4 1740.8835 0.0007 1 33.42 0.00074 R QRPAEIKDYSPYFK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4584.4584.4.dta 2 2 IPI00384444.5 "Keratin, type I cytoskeletal 14" 798 51875 24 24 19 19 5572 3994 1 0 0 702.0209 2103.0408 3 2103.0444 -0.0036 1 61.36 1.90E-06 K TEELNREVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4196.4196.3.dta 2 2 IPI00384444.5 "Keratin, type I cytoskeletal 14" 798 51875 24 24 19 19 6002 4131 1 0 1 770.359 2308.0552 3 2308.0567 -0.0015 0 50.98 1.70E-05 R LLEGEDAHLSSSQFSSGSQSSR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4348.4348.3.dta 2 3 IPI00217963.3 "Keratin, type I cytoskeletal 16" 749 51578 21 21 17 17 470 3740 1 0 0 404.204 806.3935 2 806.3923 0.0013 0 30.65 0.0032 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3918.3918.2.dta 2 3 IPI00217963.3 "Keratin, type I cytoskeletal 16" 749 51578 21 21 17 17 1373 5337 1 0 0 515.3007 1028.5869 2 1028.5866 0.0003 0 50.26 0.00016 R VLDELTLAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5750.5750.2.dta 2 3 IPI00217963.3 "Keratin, type I cytoskeletal 16" 749 51578 21 21 17 17 1522 3928 1 0 0 355.5416 1063.603 3 1063.6026 0.0004 1 21.08 0.014 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4125.4125.3.dta 2 3 IPI00217963.3 "Keratin, type I cytoskeletal 16" 749 51578 21 21 17 17 1672 6219 1 0 1 548.7689 1095.5233 2 1095.5237 -0.0004 0 51.81 9.30E-05 R DAETWFLSK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6929.6929.2.dta 2 3 IPI00217963.3 "Keratin, type I cytoskeletal 16" 749 51578 21 21 17 17 1696 2070 1 0 0 553.7662 1105.5178 2 1105.5186 -0.0008 0 56.68 4.20E-05 K VTMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2017.2017.2.dta 2 3 IPI00217963.3 "Keratin, type I cytoskeletal 16" 749 51578 21 21 17 17 1697 3550 1 0 0 553.7845 1105.5545 2 1105.555 -0.0004 0 68.21 4.00E-06 R ISSVLAGGSCR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3703.3703.2.dta 2 3 IPI00217963.3 "Keratin, type I cytoskeletal 16" 749 51578 21 21 17 17 1698 3559 1 0 0 553.7849 1105.5552 2 1105.555 0.0002 0 73.98 8.50E-07 R ISSVLAGGSCR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3713.3713.2.dta 2 3 IPI00217963.3 "Keratin, type I cytoskeletal 16" 749 51578 21 21 17 17 1757 3753 1 0 0 561.7919 1121.5692 2 1121.5717 -0.0025 0 55.46 4.00E-05 R LEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3932.3932.2.dta 2 3 IPI00217963.3 "Keratin, type I cytoskeletal 16" 749 51578 21 21 17 17 1758 3742 1 0 0 561.7934 1121.5722 2 1121.5717 0.0006 0 68.56 1.70E-06 R LEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3920.3920.2.dta 2 3 IPI00217963.3 "Keratin, type I cytoskeletal 16" 749 51578 21 21 17 17 2351 2622 1 0 1 630.7877 1259.5609 2 1259.563 -0.0021 0 63.67 1.10E-06 R EVFTSSSSSSSR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2629.2629.2.dta 2 3 IPI00217963.3 "Keratin, type I cytoskeletal 16" 749 51578 21 21 17 17 2423 3181 1 0 0 639.7946 1277.5747 2 1277.5783 -0.0036 0 85.61 3.50E-08 K GSCGIGGGIGGGSSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3249.3249.2.dta 2 3 IPI00217963.3 "Keratin, type I cytoskeletal 16" 749 51578 21 21 17 17 2515 4153 1 0 0 651.3337 1300.6529 2 1300.651 0.0019 0 67.28 3.40E-06 R ALEEANADLEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4372.4372.2.dta 2 3 IPI00217963.3 "Keratin, type I cytoskeletal 16" 749 51578 21 21 17 17 2675 3754 1 0 1 669.8341 1337.6537 2 1337.6575 -0.0039 0 75.64 3.50E-07 R APSTYGGGLSVSSR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3933.3933.2.dta 2 3 IPI00217963.3 "Keratin, type I cytoskeletal 16" 749 51578 21 21 17 17 2889 4323 1 0 0 690.3658 1378.7171 2 1378.7204 -0.0033 1 60.65 2.10E-06 K TRLEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4557.4557.2.dta 2 3 IPI00217963.3 "Keratin, type I cytoskeletal 16" 749 51578 21 21 17 17 3115 3585 1 0 0 717.3644 1432.7143 2 1432.7157 -0.0014 1 51.78 6.90E-05 K ASLENSLEETKGR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3741.3741.2.dta 2 3 IPI00217963.3 "Keratin, type I cytoskeletal 16" 749 51578 21 21 17 17 3116 3577 1 0 0 478.5789 1432.7148 3 1432.7157 -0.0009 1 36.34 0.00089 K ASLENSLEETKGR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3732.3732.3.dta 2 3 IPI00217963.3 "Keratin, type I cytoskeletal 16" 749 51578 21 21 17 17 4607 4252 1 0 1 586.6332 1756.8777 3 1756.8784 -0.0007 1 21.82 0.009 R QRPSEIKDYSPYFK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4479.4479.3.dta 2 3 IPI00217963.3 "Keratin, type I cytoskeletal 16" 749 51578 21 21 17 17 5506 6172 1 0 1 1032.574 2063.1334 2 2063.1375 -0.0041 0 66.4 5.90E-07 K IIAATIENAQPILQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6861.6861.2.dta 2 3 IPI00217963.3 "Keratin, type I cytoskeletal 16" 749 51578 21 21 17 17 5507 6161 1 0 1 688.7202 2063.1386 3 2063.1375 0.0012 0 54.03 8.60E-06 K IIAATIENAQPILQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6846.6846.3.dta 2 3 IPI00217963.3 "Keratin, type I cytoskeletal 16" 749 51578 21 21 17 17 5629 7538 1 0 1 717.7057 2150.0952 3 2150.0929 0.0024 1 44.1 8.90E-05 R TDLEMQIEGLKEELAYLR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8600.8600.3.dta 2 3 IPI00217963.3 "Keratin, type I cytoskeletal 16" 749 51578 21 21 17 17 6159 3573 1 0 1 784.0352 2349.0836 3 2349.0833 0.0004 0 56.12 5.50E-06 R LLEGEDAHLSSQQASGQSYSSR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3728.3728.3.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 689 48361 24 24 21 21 197 4796 1 0 0 350.7337 699.4528 2 699.4531 -0.0003 0 37.55 0.00058 K ILLDVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5107.5107.2.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 689 48361 24 24 21 21 470 3740 1 0 0 404.204 806.3935 2 806.3923 0.0013 0 30.65 0.0032 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3918.3918.2.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 689 48361 24 24 21 21 1172 2953 1 0 0 495.2721 988.5297 2 988.5301 -0.0004 1 27.65 0.047 K SEISELRR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2989.2989.2.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 689 48361 24 24 21 21 1188 3770 1 0 1 497.7151 993.4157 2 993.4192 -0.0034 0 23.27 0.0066 R DYSQYYR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3951.3951.2.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 689 48361 24 24 21 21 1230 7643 1 0 1 499.7547 997.4948 2 997.4941 0.0007 0 19.93 0.045 R EQVHQTTR - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.873.873.2.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 689 48361 24 24 21 21 1373 5337 1 0 0 515.3007 1028.5869 2 1028.5866 0.0003 0 50.26 0.00016 R VLDELTLAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5750.5750.2.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 689 48361 24 24 21 21 1386 2815 1 0 1 517.7556 1033.4967 2 1033.4975 -0.0008 0 69.38 2.20E-06 R LSGGLGAGSCR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2839.2839.2.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 689 48361 24 24 21 21 1511 2750 1 0 1 531.7527 1061.4909 2 1061.4924 -0.0014 0 44.39 0.00065 K ATMQNLNDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2768.2768.2.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 689 48361 24 24 21 21 1522 3928 1 0 0 355.5416 1063.603 3 1063.6026 0.0004 1 21.08 0.014 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4125.4125.3.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 689 48361 24 24 21 21 1578 1777 1 0 1 539.7505 1077.4864 2 1077.4873 -0.0009 0 19.83 0.022 K ATMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1692.1692.2.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 689 48361 24 24 21 21 1757 3753 1 0 0 561.7919 1121.5692 2 1121.5717 -0.0025 0 55.46 4.00E-05 R LEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3932.3932.2.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 689 48361 24 24 21 21 1758 3742 1 0 0 561.7934 1121.5722 2 1121.5717 0.0006 0 68.56 1.70E-06 R LEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3920.3920.2.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 689 48361 24 24 21 21 2182 3192 1 0 0 408.2188 1221.6347 3 1221.6353 -0.0006 1 45.45 0.00068 R TKFETEQALR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3261.3261.3.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 689 48361 24 24 21 21 2695 4738 1 0 1 448.2532 1341.7377 3 1341.7364 0.0013 1 32.99 0.009 R LSVEADINGLRR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5037.5037.3.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 689 48361 24 24 21 21 2708 4214 1 0 1 673.3458 1344.6771 2 1344.6772 -0.0001 0 84.44 2.90E-08 R ALEEANTELEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4437.4437.2.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 689 48361 24 24 21 21 2790 3146 1 0 0 681.3486 1360.6826 2 1360.6834 -0.0008 0 85.68 2.20E-08 R EVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3209.3209.2.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 689 48361 24 24 21 21 2889 4323 1 0 0 690.3658 1378.7171 2 1378.7204 -0.0033 1 60.65 2.10E-06 K TRLEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4557.4557.2.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 689 48361 24 24 21 21 2991 3953 1 0 1 702.3404 1402.6662 2 1402.6688 -0.0026 0 75.36 1.60E-07 K ASLEGNLAETENR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4152.4152.2.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 689 48361 24 24 21 21 3163 3518 1 0 0 719.8531 1437.6917 2 1437.6922 -0.0004 1 57.78 2.90E-05 R ILNEMRDQYEK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3664.3664.2.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 689 48361 24 24 21 21 4148 4440 1 0 1 830.4496 1658.8847 2 1658.8839 0.0008 1 90.63 3.20E-09 R TIVEEVQDGKVISSR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4686.4686.2.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 689 48361 24 24 21 21 5023 3219 1 0 1 629.643 1885.9072 3 1885.913 -0.0058 1 41.94 0.00012 R QFTSSSSIKGSSGLGGGSSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3290.3290.3.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 689 48361 24 24 21 21 5572 3994 1 0 0 702.0209 2103.0408 3 2103.0444 -0.0036 1 61.36 1.90E-06 K TEELNREVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4196.4196.3.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 689 48361 24 24 21 21 8012 8007 1 0 1 1008.5496 3022.627 3 3022.6298 -0.0028 1 30.39 0.0037 R TIEELQNKILTATVDNANILLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9170.9170.3.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 689 48361 24 24 21 21 8013 8019 1 0 1 756.6663 3022.6359 4 3022.6298 0.0061 1 25.8 0.0089 R TIEELQNKILTATVDNANILLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9183.9183.4.dta 2 5 IPI00479145.2 "Keratin, type I cytoskeletal 19" 613 44065 20 20 19 19 344 2080 1 0 1 381.7092 761.4039 2 761.4032 0.0007 0 33.44 0.014 R GVSVSSAR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2027.2027.2.dta 2 5 IPI00479145.2 "Keratin, type I cytoskeletal 19" 613 44065 20 20 19 19 470 3740 1 0 0 404.204 806.3935 2 806.3923 0.0013 0 30.65 0.0032 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3918.3918.2.dta 2 5 IPI00479145.2 "Keratin, type I cytoskeletal 19" 613 44065 20 20 19 19 652 4925 1 0 1 425.7322 849.4499 2 849.4497 0.0001 0 57.83 2.00E-05 R FGPGVAFR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5258.5258.2.dta 2 5 IPI00479145.2 "Keratin, type I cytoskeletal 19" 613 44065 20 20 19 19 1113 2563 1 0 1 325.8459 974.5158 3 974.5145 0.0013 1 31.55 0.01 R SEVTDLRR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2566.2566.3.dta 2 5 IPI00479145.2 "Keratin, type I cytoskeletal 19" 613 44065 20 20 19 19 1197 1583 1 0 1 498.2552 994.4958 2 994.4944 0.0013 0 55.45 3.10E-05 R APSIHGGSGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1483.1483.2.dta 2 5 IPI00479145.2 "Keratin, type I cytoskeletal 19" 613 44065 20 20 19 19 1373 5337 1 0 0 515.3007 1028.5869 2 1028.5866 0.0003 0 50.26 0.00016 R VLDELTLAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5750.5750.2.dta 2 5 IPI00479145.2 "Keratin, type I cytoskeletal 19" 613 44065 20 20 19 19 1415 4698 1 0 0 521.3065 1040.5984 2 1040.5978 0.0005 0 45.25 0.00015 R IVLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4986.4986.2.dta 2 5 IPI00479145.2 "Keratin, type I cytoskeletal 19" 613 44065 20 20 19 19 1522 3928 1 0 0 355.5416 1063.603 3 1063.6026 0.0004 1 21.08 0.014 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4125.4125.3.dta 2 5 IPI00479145.2 "Keratin, type I cytoskeletal 19" 613 44065 20 20 19 19 1554 3991 1 0 1 537.3017 1072.5888 2 1072.5876 0.0012 0 48.87 3.00E-05 K ILGATIENSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4193.4193.2.dta 2 5 IPI00479145.2 "Keratin, type I cytoskeletal 19" 613 44065 20 20 19 19 1606 5662 1 0 1 541.7491 1081.4837 2 1081.4829 0.0009 0 46.83 0.0001 K DAEAWFTSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6149.6149.2.dta 2 5 IPI00479145.2 "Keratin, type I cytoskeletal 19" 613 44065 20 20 19 19 1757 3753 1 0 0 561.7919 1121.5692 2 1121.5717 -0.0025 0 55.46 4.00E-05 R LEQEIATYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3932.3932.2.dta 2 5 IPI00479145.2 "Keratin, type I cytoskeletal 19" 613 44065 20 20 19 19 1758 3742 1 0 0 561.7934 1121.5722 2 1121.5717 0.0006 0 68.56 1.70E-06 R LEQEIATYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3920.3920.2.dta 2 5 IPI00479145.2 "Keratin, type I cytoskeletal 19" 613 44065 20 20 19 19 2182 3192 1 0 0 408.2188 1221.6347 3 1221.6353 -0.0006 1 45.45 0.00068 R TKFETEQALR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3261.3261.3.dta 2 5 IPI00479145.2 "Keratin, type I cytoskeletal 19" 613 44065 20 20 19 19 2196 3106 1 0 1 614.301 1226.5874 2 1226.5891 -0.0017 0 44.68 0.00025 K NHEEEISTLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3165.3165.2.dta 2 5 IPI00479145.2 "Keratin, type I cytoskeletal 19" 613 44065 20 20 19 19 2269 4223 1 0 1 622.329 1242.6434 2 1242.6455 -0.0021 0 64.85 2.20E-06 R ALEAANGELEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4447.4447.2.dta 2 5 IPI00479145.2 "Keratin, type I cytoskeletal 19" 613 44065 20 20 19 19 2822 4311 1 0 1 455.9088 1364.7044 3 1364.7048 -0.0004 1 35.28 0.006 K SRLEQEIATYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4544.4544.3.dta 2 5 IPI00479145.2 "Keratin, type I cytoskeletal 19" 613 44065 20 20 19 19 2923 4766 1 0 1 695.3434 1388.6723 2 1388.6783 -0.006 0 103.37 3.20E-10 K AALEDTLAETEAR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5067.5067.2.dta 2 5 IPI00479145.2 "Keratin, type I cytoskeletal 19" 613 44065 20 20 19 19 3587 4451 1 0 1 777.8782 1553.7419 2 1553.7434 -0.0015 0 96.61 8.70E-10 R QSSATSSFGGLGGGSVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4698.4698.2.dta 2 5 IPI00479145.2 "Keratin, type I cytoskeletal 19" 613 44065 20 20 19 19 5159 4977 1 0 1 639.9697 1916.8874 3 1916.8904 -0.0031 1 30.45 0.0014 R DYSHYYTTIQDLRDK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5319.5319.3.dta 2 5 IPI00479145.2 "Keratin, type I cytoskeletal 19" 613 44065 20 20 19 19 5738 3854 1 0 1 743.3594 2227.0563 3 2227.0651 -0.0088 1 50.72 6.20E-05 R TEELNREVAGHTEQLQMSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4044.4044.3.dta 2 6 IPI00009865.1 "Keratin, type I cytoskeletal 10" 553 59711 16 16 15 15 470 3740 1 0 0 404.204 806.3935 2 806.3923 0.0013 0 30.65 0.0032 R LAADDFR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3918.3918.2.dta 2 6 IPI00009865.1 "Keratin, type I cytoskeletal 10" 553 59711 16 16 15 15 1186 3544 1 0 1 497.2538 992.4931 2 992.4927 0.0004 0 52.26 0.00011 K YENEVALR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3696.3696.2.dta 2 6 IPI00009865.1 "Keratin, type I cytoskeletal 10" 553 59711 16 16 15 15 1198 3584 1 0 1 332.5118 994.5136 3 994.5123 0.0013 1 35.99 0.0033 K IKEWYEK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3740.3740.3.dta 2 6 IPI00009865.1 "Keratin, type I cytoskeletal 10" 553 59711 16 16 15 15 1380 5166 1 0 1 516.3027 1030.5908 2 1030.591 -0.0002 0 63.35 1.10E-06 R VLDELTLTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5548.5548.2.dta 2 6 IPI00009865.1 "Keratin, type I cytoskeletal 10" 553 59711 16 16 15 15 1522 3928 1 0 0 355.5416 1063.603 3 1063.6026 0.0004 1 21.08 0.014 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4125.4125.3.dta 2 6 IPI00009865.1 "Keratin, type I cytoskeletal 10" 553 59711 16 16 15 15 1696 2070 1 0 0 553.7662 1105.5178 2 1105.5186 -0.0008 0 56.68 4.20E-05 K VTMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2017.2017.2.dta 2 6 IPI00009865.1 "Keratin, type I cytoskeletal 10" 553 59711 16 16 15 15 2510 2351 1 0 1 434.203 1299.5873 3 1299.5877 -0.0004 1 35.99 0.0008 K NHEEEMKDLR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2332.2332.3.dta 2 6 IPI00009865.1 "Keratin, type I cytoskeletal 10" 553 59711 16 16 15 15 2893 3952 1 0 1 691.326 1380.6374 2 1380.6408 -0.0034 0 86.05 8.50E-09 R ALEESNYELEGK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4151.4151.2.dta 2 6 IPI00009865.1 "Keratin, type I cytoskeletal 10" 553 59711 16 16 15 15 3124 4347 1 0 1 717.8874 1433.7602 2 1433.7626 -0.0024 1 62.48 8.80E-06 K IRLENEIQTYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4583.4583.2.dta 2 6 IPI00009865.1 "Keratin, type I cytoskeletal 10" 553 59711 16 16 15 15 3367 2805 1 0 1 747.37 1492.7254 2 1492.727 -0.0015 1 63.01 2.30E-06 R SQYEQLAEQNRK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2828.2828.2.dta 2 6 IPI00009865.1 "Keratin, type I cytoskeletal 10" 553 59711 16 16 15 15 3576 2811 1 0 1 775.3416 1548.6686 2 1548.67 -0.0014 0 61.18 1.80E-06 R SGGGGGGGGCGGGGGVSSLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2834.2834.2.dta 2 6 IPI00009865.1 "Keratin, type I cytoskeletal 10" 553 59711 16 16 15 15 4412 5394 1 0 1 854.3884 1706.7623 2 1706.7649 -0.0026 0 92.49 2.10E-09 K GSLGGGFSSGGFSGGSFSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5815.5815.2.dta 2 6 IPI00009865.1 "Keratin, type I cytoskeletal 10" 553 59711 16 16 15 15 4720 7007 1 0 1 599.6755 1796.0048 3 1796.0043 0.0005 0 48.61 6.30E-05 R NVQALEIELQSQLALK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7938.7938.3.dta 2 6 IPI00009865.1 "Keratin, type I cytoskeletal 10" 553 59711 16 16 15 15 7758 7653 1 0 1 958.1362 2871.3867 3 2871.3855 0.0012 0 60.58 2.10E-06 R NVSTGDVNVEMNAAPGVDLTQLLNNMR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8740.8740.3.dta 2 6 IPI00009865.1 "Keratin, type I cytoskeletal 10" 553 59711 16 16 15 15 8051 8009 1 0 1 1018.2128 3051.6165 3 3051.62 -0.0035 1 35.97 0.00092 K TIDDLKNQILNLTTDNANILLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9172.9172.3.dta 2 6 IPI00009865.1 "Keratin, type I cytoskeletal 10" 553 59711 16 16 15 15 8052 8032 1 0 1 763.9125 3051.6208 4 3051.62 0.0008 1 34.35 0.0012 K TIDDLKNQILNLTTDNANILLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9196.9196.4.dta 2 7 IPI00297632.3 "Keratin, type I cuticular Ha3-I" 199 47161 8 8 7 7 534 3363 1 0 1 412.201 822.3874 2 822.3872 0.0002 0 29.5 0.008 K LASDDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3475.3475.2.dta 2 7 IPI00297632.3 "Keratin, type I cuticular Ha3-I" 199 47161 8 8 7 7 538 3605 1 0 1 412.2314 822.4482 2 822.4487 -0.0005 0 34.38 0.0006 R LASYLEK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3765.3765.2.dta 2 7 IPI00297632.3 "Keratin, type I cuticular Ha3-I" 199 47161 8 8 7 7 1163 3131 1 0 1 494.7688 987.5231 2 987.5237 -0.0005 0 53.84 0.00011 K TIEELQQK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3193.3193.2.dta 2 7 IPI00297632.3 "Keratin, type I cuticular Ha3-I" 199 47161 8 8 7 7 1239 4118 1 0 1 500.2954 998.5762 2 998.576 0.0002 0 47.57 0.00018 R LVVQIDNAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4334.4334.2.dta 2 7 IPI00297632.3 "Keratin, type I cuticular Ha3-I" 199 47161 8 8 7 7 2826 2365 1 0 1 456.5597 1366.6572 3 1366.6589 -0.0018 0 26.77 0.029 K QNHEQEVNTLR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2347.2347.3.dta 2 7 IPI00297632.3 "Keratin, type I cuticular Ha3-I" 199 47161 8 8 7 7 3412 5817 1 0 1 752.8946 1503.7746 2 1503.7681 0.0065 0 57.86 4.30E-06 R QNQEYQVLLDVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6383.6383.2.dta 2 7 IPI00297632.3 "Keratin, type I cuticular Ha3-I" 199 47161 8 8 7 7 5575 5705 1 0 1 702.3599 2104.0579 3 2104.0549 0.0031 1 47.57 5.60E-05 R SDLERQNQEYQVLLDVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6212.6212.3.dta 2 7 IPI00297632.3 "Keratin, type I cuticular Ha3-I" 199 47161 8 8 7 7 5576 5694 1 0 1 702.3635 2104.0687 3 2104.0549 0.0139 1 45.99 0.00013 R SDLERQNQEYQVLLDVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6196.6196.3.dta 2 8 IPI00008692.1 "Keratin, type I cuticular Ha6" 73 53354 3 3 2 2 470 3740 1 0 0 404.204 806.3935 2 806.3923 0.0013 0 30.65 0.0032 K LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3918.3918.2.dta 2 8 IPI00008692.1 "Keratin, type I cuticular Ha6" 73 53354 3 3 2 2 3289 2748 1 0 1 737.3676 1472.7207 2 1472.7219 -0.0012 1 48.99 5.90E-05 R QLERENAELESR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2766.2766.2.dta 2 8 IPI00008692.1 "Keratin, type I cuticular Ha6" 73 53354 3 3 2 2 3290 2743 1 0 1 491.9146 1472.7219 3 1472.7219 0 1 34.35 0.0065 R QLERENAELESR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2761.2761.3.dta 2 IPI00554788.4 49 kDa protein 971 48793 38 38 28 28 250 3519 1 0 1 359.7002 717.3858 2 717.3843 0.0015 0 31.36 0.024 K IMADIR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3665.3665.2.dta 2 IPI00554788.4 49 kDa protein 971 48793 38 38 28 28 287 2851 1 0 1 367.698 733.3815 2 733.3792 0.0023 0 42.42 0.0016 K IMADIR A Oxidation (M) 0.010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2879.2879.2.dta 2 IPI00554788.4 49 kDa protein 971 48793 38 38 28 28 470 3740 1 0 0 404.204 806.3935 2 806.3923 0.0013 0 30.65 0.0032 R LAADDFR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3918.3918.2.dta 2 IPI00554788.4 49 kDa protein 971 48793 38 38 28 28 906 1595 2 0 1 462.7662 923.5179 2 923.5188 -0.001 1 28.3 0.017 K IREHLEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1496.1496.2.dta 2 IPI00554788.4 49 kDa protein 971 48793 38 38 28 28 1074 3425 1 0 1 483.238 964.4615 2 964.4614 0.0001 0 40.57 0.0018 R AQYDELAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3544.3544.2.dta 2 IPI00554788.4 49 kDa protein 971 48793 38 38 28 28 1112 3290 1 0 1 488.2301 974.4457 2 974.4458 0 0 44.41 0.00042 R STFSTNYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3389.3389.2.dta 2 IPI00554788.4 49 kDa protein 971 48793 38 38 28 28 1181 1410 1 0 1 496.748 991.4815 2 991.4822 -0.0007 0 24.11 0.018 K VVSETNDTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1293.1293.2.dta 2 IPI00554788.4 49 kDa protein 971 48793 38 38 28 28 1415 4698 1 0 0 521.3065 1040.5984 2 1040.5978 0.0005 0 45.25 0.00015 R IVLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4986.4986.2.dta 2 IPI00554788.4 49 kDa protein 971 48793 38 38 28 28 1446 3272 1 0 1 523.7783 1045.5421 2 1045.5404 0.0017 0 42.7 0.0016 K VIDDTNITR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3364.3364.2.dta 2 IPI00554788.4 49 kDa protein 971 48793 38 38 28 28 1526 4220 1 0 1 533.2823 1064.5501 2 1064.5502 0 0 64.58 3.30E-06 K LEAEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4443.4443.2.dta 2 IPI00554788.4 49 kDa protein 971 48793 38 38 28 28 1655 3990 1 0 1 546.8112 1091.6078 2 1091.6087 -0.001 1 34.01 0.0021 R LASYLDRVR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4192.4192.2.dta 2 IPI00554788.4 49 kDa protein 971 48793 38 38 28 28 1657 2968 1 0 1 547.2523 1092.4901 2 1092.487 0.0031 0 30.71 0.0097 K ETMQSLNDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3005.3005.2.dta 2 IPI00554788.4 49 kDa protein 971 48793 38 38 28 28 1659 2803 1 0 1 547.2851 1092.5556 2 1092.5563 -0.0007 1 47.85 0.00014 R AQYDELARK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2826.2826.2.dta 2 IPI00554788.4 49 kDa protein 971 48793 38 38 28 28 1660 2797 1 0 1 365.193 1092.5571 3 1092.5563 0.0007 1 29.98 0.02 R AQYDELARK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2819.2819.3.dta 2 IPI00554788.4 49 kDa protein 971 48793 38 38 28 28 2179 3532 1 0 1 611.3341 1220.6537 2 1220.6513 0.0024 1 26.11 0.0066 K LEAEIATYRR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3681.3681.2.dta 2 IPI00554788.4 49 kDa protein 971 48793 38 38 28 28 2258 3870 1 0 1 413.8856 1238.6349 3 1238.6329 0.0021 1 38 0.0017 R VKYETELAMR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4062.4062.3.dta 2 IPI00554788.4 49 kDa protein 971 48793 38 38 28 28 2276 4394 1 0 1 622.8506 1243.6866 2 1243.6884 -0.0018 1 35.66 0.00078 R NLKASLENSLR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4636.4636.2.dta 2 IPI00554788.4 49 kDa protein 971 48793 38 38 28 28 2320 3173 1 0 1 628.3186 1254.6227 2 1254.6278 -0.0051 1 58.74 3.10E-06 R VKYETELAMR Q Oxidation (M) 0.0000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3240.3240.2.dta 2 IPI00554788.4 49 kDa protein 971 48793 38 38 28 28 2376 3621 1 0 1 634.3223 1266.63 2 1266.6317 -0.0017 0 54.53 2.30E-05 R QSVENDIHGLR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3782.3782.2.dta 2 IPI00554788.4 49 kDa protein 971 48793 38 38 28 28 2377 3617 1 0 1 423.2176 1266.6309 3 1266.6317 -0.0007 0 16.17 0.031 R QSVENDIHGLR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3778.3778.3.dta 2 IPI00554788.4 49 kDa protein 971 48793 38 38 28 28 2488 4479 1 0 1 646.863 1291.7114 2 1291.7136 -0.0022 1 49.82 3.90E-05 K VKLEAEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4727.4727.2.dta 2 IPI00554788.4 49 kDa protein 971 48793 38 38 28 28 2489 4478 1 0 1 431.5784 1291.7134 3 1291.7136 -0.0002 1 37.39 0.0006 K VKLEAEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4726.4726.3.dta 2 IPI00554788.4 49 kDa protein 971 48793 38 38 28 28 2602 4354 1 0 1 660.3369 1318.6592 2 1318.6629 -0.0038 0 81.02 3.10E-08 R AQIFANTVDNAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4590.4590.2.dta 2 IPI00554788.4 49 kDa protein 971 48793 38 38 28 28 2962 3066 1 0 1 698.3719 1394.7293 2 1394.7266 0.0027 1 58.34 3.40E-06 R QSVENDIHGLRK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3121.3121.2.dta 2 IPI00554788.4 49 kDa protein 971 48793 38 38 28 28 3056 5884 1 0 1 710.3774 1418.7402 2 1418.7405 -0.0003 0 54.58 6.80E-05 R QAQEYEALLNIK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6478.6478.2.dta 2 IPI00554788.4 49 kDa protein 971 48793 38 38 28 28 3414 2728 1 0 1 752.8956 1503.7766 2 1503.7781 -0.0015 1 50.25 1.90E-05 R IVDGKVVSETNDTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2744.2744.2.dta 2 IPI00554788.4 49 kDa protein 971 48793 38 38 28 28 3415 2647 1 0 1 502.2664 1503.7773 3 1503.7781 -0.0007 1 33.03 0.0011 R IVDGKVVSETNDTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2657.2657.3.dta 2 IPI00554788.4 49 kDa protein 971 48793 38 38 28 28 3424 6215 1 0 1 753.877 1505.7395 2 1505.7395 -0.0001 0 97.45 3.50E-09 R TVQSLEIDLDSMR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6925.6925.2.dta 2 IPI00554788.4 49 kDa protein 971 48793 38 38 28 28 3425 6225 1 0 1 502.9205 1505.7398 3 1505.7395 0.0002 0 37.71 0.0035 R TVQSLEIDLDSMR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6936.6936.3.dta 2 IPI00554788.4 49 kDa protein 971 48793 38 38 28 28 3480 5444 1 0 1 761.8732 1521.7319 2 1521.7345 -0.0026 0 69.06 3.30E-07 R TVQSLEIDLDSMR N Oxidation (M) 0.0000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5873.5873.2.dta 2 IPI00554788.4 49 kDa protein 971 48793 38 38 28 28 5275 5591 1 0 1 654.3411 1960.0015 3 1960.0013 0.0002 1 50.18 2.10E-05 R AEGQRQAQEYEALLNIK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6051.6051.3.dta 2 IPI00554788.4 49 kDa protein 971 48793 38 38 28 28 5492 5944 1 0 1 1030.0489 2058.0833 2 2058.0858 -0.0024 1 32.08 0.00098 K IIEDLRAQIFANTVDNAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6562.6562.2.dta 2 IPI00554788.4 49 kDa protein 971 48793 38 38 28 28 5493 5936 1 0 1 687.0362 2058.0868 3 2058.0858 0.001 1 63.46 1.10E-06 K IIEDLRAQIFANTVDNAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6547.6547.3.dta 2 IPI00554788.4 49 kDa protein 971 48793 38 38 28 28 5675 7730 1 0 1 731.729 2192.1652 3 2192.165 0.0002 1 35.07 0.0016 R LQLETEIEALKEELLFMK K Oxidation (M) 0.000000000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8833.8833.3.dta 2 IPI00554788.4 49 kDa protein 971 48793 38 38 28 28 7139 8461 1 0 1 890.8033 2669.3882 3 2669.3846 0.0036 0 76.44 6.80E-08 R YALQMEQLNGILLHLESELAQTR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9741.9741.3.dta 2 IPI00554788.4 49 kDa protein 971 48793 38 38 28 28 7173 7888 1 0 1 896.1346 2685.3819 3 2685.3795 0.0024 0 63.68 1.10E-06 R YALQMEQLNGILLHLESELAQTR A Oxidation (M) 0.00001000000000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9029.9029.3.dta 2 IPI00554788.4 49 kDa protein 971 48793 38 38 28 28 7821 6133 1 0 1 966.1238 2895.3495 3 2895.3556 -0.0061 1 32.48 0.0009 R RLLEDGEDFNLGDALDSSNSMQTIQK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6806.6806.3.dta 2 IPI00554788.4 49 kDa protein 971 48793 38 38 28 28 8236 7464 1 0 1 807.6689 3226.6467 4 3226.6404 0.0063 1 24.06 0.019 R YALQMEQLNGILLHLESELAQTRAEGQR Q Oxidation (M) 0.0000100000000000000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8512.8512.4.dta 2 IPI00747707.1 KRT17 protein 526 41332 18 18 16 16 197 4796 1 0 0 350.7337 699.4528 2 699.4531 -0.0003 0 37.55 0.00058 K ILLDVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5107.5107.2.dta 2 IPI00747707.1 KRT17 protein 526 41332 18 18 16 16 470 3740 1 0 0 404.204 806.3935 2 806.3923 0.0013 0 30.65 0.0032 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3918.3918.2.dta 2 IPI00747707.1 KRT17 protein 526 41332 18 18 16 16 1172 2953 1 0 0 495.2721 988.5297 2 988.5301 -0.0004 1 27.65 0.047 K SEISELRR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2989.2989.2.dta 2 IPI00747707.1 KRT17 protein 526 41332 18 18 16 16 1188 3770 1 0 1 497.7151 993.4157 2 993.4192 -0.0034 0 23.27 0.0066 R DYSQYYR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3951.3951.2.dta 2 IPI00747707.1 KRT17 protein 526 41332 18 18 16 16 1230 7643 1 0 1 499.7547 997.4948 2 997.4941 0.0007 0 19.93 0.045 R EQVHQTTR - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.873.873.2.dta 2 IPI00747707.1 KRT17 protein 526 41332 18 18 16 16 1373 5337 1 0 0 515.3007 1028.5869 2 1028.5866 0.0003 0 50.26 0.00016 R VLDELTLAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5750.5750.2.dta 2 IPI00747707.1 KRT17 protein 526 41332 18 18 16 16 1757 3753 1 0 0 561.7919 1121.5692 2 1121.5717 -0.0025 0 55.46 4.00E-05 R LEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3932.3932.2.dta 2 IPI00747707.1 KRT17 protein 526 41332 18 18 16 16 1758 3742 1 0 0 561.7934 1121.5722 2 1121.5717 0.0006 0 68.56 1.70E-06 R LEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3920.3920.2.dta 2 IPI00747707.1 KRT17 protein 526 41332 18 18 16 16 2182 3192 1 0 0 408.2188 1221.6347 3 1221.6353 -0.0006 1 45.45 0.00068 R TKFETEQALR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3261.3261.3.dta 2 IPI00747707.1 KRT17 protein 526 41332 18 18 16 16 2695 4738 1 0 1 448.2532 1341.7377 3 1341.7364 0.0013 1 32.99 0.009 R LSVEADINGLRR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5037.5037.3.dta 2 IPI00747707.1 KRT17 protein 526 41332 18 18 16 16 2790 3146 1 0 0 681.3486 1360.6826 2 1360.6834 -0.0008 0 85.68 2.20E-08 R EVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3209.3209.2.dta 2 IPI00747707.1 KRT17 protein 526 41332 18 18 16 16 2889 4323 1 0 0 690.3658 1378.7171 2 1378.7204 -0.0033 1 60.65 2.10E-06 K TRLEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4557.4557.2.dta 2 IPI00747707.1 KRT17 protein 526 41332 18 18 16 16 2991 3953 1 0 1 702.3404 1402.6662 2 1402.6688 -0.0026 0 75.36 1.60E-07 K ASLEGNLAETENR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4152.4152.2.dta 2 IPI00747707.1 KRT17 protein 526 41332 18 18 16 16 3163 3518 1 0 0 719.8531 1437.6917 2 1437.6922 -0.0004 1 57.78 2.90E-05 R ILNEMRDQYEK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3664.3664.2.dta 2 IPI00747707.1 KRT17 protein 526 41332 18 18 16 16 4148 4440 1 0 1 830.4496 1658.8847 2 1658.8839 0.0008 1 90.63 3.20E-09 R TIVEEVQDGKVISSR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4686.4686.2.dta 2 IPI00747707.1 KRT17 protein 526 41332 18 18 16 16 5572 3994 1 0 0 702.0209 2103.0408 3 2103.0444 -0.0036 1 61.36 1.90E-06 K TEELNREVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4196.4196.3.dta 2 IPI00747707.1 KRT17 protein 526 41332 18 18 16 16 8012 8007 1 0 1 1008.5496 3022.627 3 3022.6298 -0.0028 1 30.39 0.0037 R TIEELQNKILTATVDNANILLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9170.9170.3.dta 2 IPI00747707.1 KRT17 protein 526 41332 18 18 16 16 8013 8019 1 0 1 756.6663 3022.6359 4 3022.6298 0.0061 1 25.8 0.0089 R TIEELQNKILTATVDNANILLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9183.9183.4.dta 2 IPI00383111.2 57 kDa protein 508 56699 15 15 14 14 470 3740 1 0 0 404.204 806.3935 2 806.3923 0.0013 0 30.65 0.0032 R LAADDFR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3918.3918.2.dta 2 IPI00383111.2 57 kDa protein 508 56699 15 15 14 14 1186 3544 1 0 1 497.2538 992.4931 2 992.4927 0.0004 0 52.26 0.00011 K YENEVALR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3696.3696.2.dta 2 IPI00383111.2 57 kDa protein 508 56699 15 15 14 14 1198 3584 1 0 1 332.5118 994.5136 3 994.5123 0.0013 1 35.99 0.0033 K IKEWYEK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3740.3740.3.dta 2 IPI00383111.2 57 kDa protein 508 56699 15 15 14 14 1380 5166 1 0 1 516.3027 1030.5908 2 1030.591 -0.0002 0 63.35 1.10E-06 R VLDELTLTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5548.5548.2.dta 2 IPI00383111.2 57 kDa protein 508 56699 15 15 14 14 1522 3928 1 0 0 355.5416 1063.603 3 1063.6026 0.0004 1 21.08 0.014 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4125.4125.3.dta 2 IPI00383111.2 57 kDa protein 508 56699 15 15 14 14 1696 2070 1 0 0 553.7662 1105.5178 2 1105.5186 -0.0008 0 56.68 4.20E-05 K VTMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2017.2017.2.dta 2 IPI00383111.2 57 kDa protein 508 56699 15 15 14 14 2510 2351 1 0 1 434.203 1299.5873 3 1299.5877 -0.0004 1 35.99 0.0008 K NHEEEMKDLR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2332.2332.3.dta 2 IPI00383111.2 57 kDa protein 508 56699 15 15 14 14 2893 3952 1 0 1 691.326 1380.6374 2 1380.6408 -0.0034 0 86.05 8.50E-09 R ALEESNYELEGK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4151.4151.2.dta 2 IPI00383111.2 57 kDa protein 508 56699 15 15 14 14 3124 4347 1 0 1 717.8874 1433.7602 2 1433.7626 -0.0024 1 62.48 8.80E-06 K IRLENEIQTYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4583.4583.2.dta 2 IPI00383111.2 57 kDa protein 508 56699 15 15 14 14 3367 2805 1 0 1 747.37 1492.7254 2 1492.727 -0.0015 1 63.01 2.30E-06 R SQYEQLAEQNRK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2828.2828.2.dta 2 IPI00383111.2 57 kDa protein 508 56699 15 15 14 14 4412 5394 1 0 1 854.3884 1706.7623 2 1706.7649 -0.0026 0 92.49 2.10E-09 K GSLGGGFSSGGFSGGSFSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5815.5815.2.dta 2 IPI00383111.2 57 kDa protein 508 56699 15 15 14 14 4720 7007 1 0 1 599.6755 1796.0048 3 1796.0043 0.0005 0 48.61 6.30E-05 R NVQALEIELQSQLALK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7938.7938.3.dta 2 IPI00383111.2 57 kDa protein 508 56699 15 15 14 14 7758 7653 1 0 1 958.1362 2871.3867 3 2871.3855 0.0012 0 60.58 2.10E-06 R NVSTGDVNVEMNAAPGVDLTQLLNNMR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8740.8740.3.dta 2 IPI00383111.2 57 kDa protein 508 56699 15 15 14 14 8051 8009 1 0 1 1018.2128 3051.6165 3 3051.62 -0.0035 1 35.97 0.00092 K TIDDLKNQILNLTTDNANILLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9172.9172.3.dta 2 IPI00383111.2 57 kDa protein 508 56699 15 15 14 14 8052 8032 1 0 1 763.9125 3051.6208 4 3051.62 0.0008 1 34.35 0.0012 K TIDDLKNQILNLTTDNANILLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9196.9196.4.dta 2 IPI00794807.1 15 kDa protein 480 15435 15 15 10 10 1074 3425 1 0 1 483.238 964.4615 2 964.4614 0.0001 0 40.57 0.0018 R AQYDELAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3544.3544.2.dta 2 IPI00794807.1 15 kDa protein 480 15435 15 15 10 10 1526 4220 1 0 1 533.2823 1064.5501 2 1064.5502 0 0 64.58 3.30E-06 K LEAEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4443.4443.2.dta 2 IPI00794807.1 15 kDa protein 480 15435 15 15 10 10 1659 2803 1 0 1 547.2851 1092.5556 2 1092.5563 -0.0007 1 47.85 0.00014 R AQYDELARK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2826.2826.2.dta 2 IPI00794807.1 15 kDa protein 480 15435 15 15 10 10 1660 2797 1 0 1 365.193 1092.5571 3 1092.5563 0.0007 1 29.98 0.02 R AQYDELARK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2819.2819.3.dta 2 IPI00794807.1 15 kDa protein 480 15435 15 15 10 10 2179 3532 1 0 1 611.3341 1220.6537 2 1220.6513 0.0024 1 26.11 0.0066 K LEAEIATYRR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3681.3681.2.dta 2 IPI00794807.1 15 kDa protein 480 15435 15 15 10 10 2488 4479 1 0 1 646.863 1291.7114 2 1291.7136 -0.0022 1 49.82 3.90E-05 K VKLEAEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4727.4727.2.dta 2 IPI00794807.1 15 kDa protein 480 15435 15 15 10 10 2489 4478 1 0 1 431.5784 1291.7134 3 1291.7136 -0.0002 1 37.39 0.0006 K VKLEAEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4726.4726.3.dta 2 IPI00794807.1 15 kDa protein 480 15435 15 15 10 10 3056 5884 1 0 1 710.3774 1418.7402 2 1418.7405 -0.0003 0 54.58 6.80E-05 R QAQEYEALLNIK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6478.6478.2.dta 2 IPI00794807.1 15 kDa protein 480 15435 15 15 10 10 3424 6215 1 0 1 753.877 1505.7395 2 1505.7395 -0.0001 0 97.45 3.50E-09 R TVQSLEIDLDSMR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6925.6925.2.dta 2 IPI00794807.1 15 kDa protein 480 15435 15 15 10 10 3425 6225 1 0 1 502.9205 1505.7398 3 1505.7395 0.0002 0 37.71 0.0035 R TVQSLEIDLDSMR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6936.6936.3.dta 2 IPI00794807.1 15 kDa protein 480 15435 15 15 10 10 3480 5444 1 0 1 761.8732 1521.7319 2 1521.7345 -0.0026 0 69.06 3.30E-07 R TVQSLEIDLDSMR N Oxidation (M) 0.0000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5873.5873.2.dta 2 IPI00794807.1 15 kDa protein 480 15435 15 15 10 10 5275 5591 1 0 1 654.3411 1960.0015 3 1960.0013 0.0002 1 50.18 2.10E-05 R AEGQRQAQEYEALLNIK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6051.6051.3.dta 2 IPI00794807.1 15 kDa protein 480 15435 15 15 10 10 7139 8461 1 0 1 890.8033 2669.3882 3 2669.3846 0.0036 0 76.44 6.80E-08 R YALQMEQLNGILLHLESELAQTR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9741.9741.3.dta 2 IPI00794807.1 15 kDa protein 480 15435 15 15 10 10 7173 7888 1 0 1 896.1346 2685.3819 3 2685.3795 0.0024 0 63.68 1.10E-06 R YALQMEQLNGILLHLESELAQTR A Oxidation (M) 0.00001000000000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9029.9029.3.dta 2 IPI00794807.1 15 kDa protein 480 15435 15 15 10 10 8236 7464 1 0 1 807.6689 3226.6467 4 3226.6404 0.0063 1 24.06 0.019 R YALQMEQLNGILLHLESELAQTRAEGQR Q Oxidation (M) 0.0000100000000000000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8512.8512.4.dta 2 IPI00791852.1 42 kDa protein 419 41729 17 17 15 15 470 3740 1 0 0 404.204 806.3935 2 806.3923 0.0013 0 30.65 0.0032 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3918.3918.2.dta 2 IPI00791852.1 42 kDa protein 419 41729 17 17 15 15 1172 2953 1 0 0 495.2721 988.5297 2 988.5301 -0.0004 1 27.65 0.047 K SEISELRR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2989.2989.2.dta 2 IPI00791852.1 42 kDa protein 419 41729 17 17 15 15 1188 3770 1 0 1 497.7151 993.4157 2 993.4192 -0.0034 0 23.27 0.0066 R DYSQYYR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3951.3951.2.dta 2 IPI00791852.1 42 kDa protein 419 41729 17 17 15 15 1373 5337 1 0 0 515.3007 1028.5869 2 1028.5866 0.0003 0 50.26 0.00016 R VLDELTLAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5750.5750.2.dta 2 IPI00791852.1 42 kDa protein 419 41729 17 17 15 15 1386 2815 1 0 1 517.7556 1033.4967 2 1033.4975 -0.0008 0 69.38 2.20E-06 R LSGGLGAGSCR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2839.2839.2.dta 2 IPI00791852.1 42 kDa protein 419 41729 17 17 15 15 1511 2750 1 0 1 531.7527 1061.4909 2 1061.4924 -0.0014 0 44.39 0.00065 K ATMQNLNDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2768.2768.2.dta 2 IPI00791852.1 42 kDa protein 419 41729 17 17 15 15 1522 3928 1 0 0 355.5416 1063.603 3 1063.6026 0.0004 1 21.08 0.014 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4125.4125.3.dta 2 IPI00791852.1 42 kDa protein 419 41729 17 17 15 15 1578 1777 1 0 1 539.7505 1077.4864 2 1077.4873 -0.0009 0 19.83 0.022 K ATMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1692.1692.2.dta 2 IPI00791852.1 42 kDa protein 419 41729 17 17 15 15 2182 3192 1 0 0 408.2188 1221.6347 3 1221.6353 -0.0006 1 45.45 0.00068 R TKFETEQALR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3261.3261.3.dta 2 IPI00791852.1 42 kDa protein 419 41729 17 17 15 15 2695 4738 1 0 1 448.2532 1341.7377 3 1341.7364 0.0013 1 32.99 0.009 R LSVEADINGLRR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5037.5037.3.dta 2 IPI00791852.1 42 kDa protein 419 41729 17 17 15 15 2708 4214 1 0 1 673.3458 1344.6771 2 1344.6772 -0.0001 0 84.44 2.90E-08 R ALEEANTELEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4437.4437.2.dta 2 IPI00791852.1 42 kDa protein 419 41729 17 17 15 15 2790 3146 1 0 0 681.3486 1360.6826 2 1360.6834 -0.0008 0 85.68 2.20E-08 R EVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3209.3209.2.dta 2 IPI00791852.1 42 kDa protein 419 41729 17 17 15 15 3163 3518 1 0 0 719.8531 1437.6917 2 1437.6922 -0.0004 1 57.78 2.90E-05 R ILNEMRDQYEK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3664.3664.2.dta 2 IPI00791852.1 42 kDa protein 419 41729 17 17 15 15 5023 3219 1 0 1 629.643 1885.9072 3 1885.913 -0.0058 1 41.94 0.00012 R QFTSSSSIKGSSGLGGGSSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3290.3290.3.dta 2 IPI00791852.1 42 kDa protein 419 41729 17 17 15 15 5572 3994 1 0 0 702.0209 2103.0408 3 2103.0444 -0.0036 1 61.36 1.90E-06 K TEELNREVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4196.4196.3.dta 2 IPI00791852.1 42 kDa protein 419 41729 17 17 15 15 8012 8007 1 0 1 1008.5496 3022.627 3 3022.6298 -0.0028 1 30.39 0.0037 R TIEELQNKILTATVDNANILLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9170.9170.3.dta 2 IPI00791852.1 42 kDa protein 419 41729 17 17 15 15 8013 8019 1 0 1 756.6663 3022.6359 4 3022.6298 0.0061 1 25.8 0.0089 R TIEELQNKILTATVDNANILLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9183.9183.4.dta 2 IPI00792454.1 30 kDa protein 411 30075 12 12 10 10 197 4796 1 0 0 350.7337 699.4528 2 699.4531 -0.0003 0 37.55 0.00058 K ILLDVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5107.5107.2.dta 2 IPI00792454.1 30 kDa protein 411 30075 12 12 10 10 1172 2953 1 0 0 495.2721 988.5297 2 988.5301 -0.0004 1 27.65 0.047 K SEISELRR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2989.2989.2.dta 2 IPI00792454.1 30 kDa protein 411 30075 12 12 10 10 1373 5337 1 0 0 515.3007 1028.5869 2 1028.5866 0.0003 0 50.26 0.00016 R VLDELTLAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5750.5750.2.dta 2 IPI00792454.1 30 kDa protein 411 30075 12 12 10 10 1757 3753 1 0 0 561.7919 1121.5692 2 1121.5717 -0.0025 0 55.46 4.00E-05 R LEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3932.3932.2.dta 2 IPI00792454.1 30 kDa protein 411 30075 12 12 10 10 1758 3742 1 0 0 561.7934 1121.5722 2 1121.5717 0.0006 0 68.56 1.70E-06 R LEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3920.3920.2.dta 2 IPI00792454.1 30 kDa protein 411 30075 12 12 10 10 2790 3146 1 0 0 681.3486 1360.6826 2 1360.6834 -0.0008 0 85.68 2.20E-08 R EVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3209.3209.2.dta 2 IPI00792454.1 30 kDa protein 411 30075 12 12 10 10 2889 4323 1 0 0 690.3658 1378.7171 2 1378.7204 -0.0033 1 60.65 2.10E-06 K TRLEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4557.4557.2.dta 2 IPI00792454.1 30 kDa protein 411 30075 12 12 10 10 3115 3585 1 0 0 717.3644 1432.7143 2 1432.7157 -0.0014 1 51.78 6.90E-05 K ASLENSLEETKGR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3741.3741.2.dta 2 IPI00792454.1 30 kDa protein 411 30075 12 12 10 10 3116 3577 1 0 0 478.5789 1432.7148 3 1432.7157 -0.0009 1 36.34 0.00089 K ASLENSLEETKGR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3732.3732.3.dta 2 IPI00792454.1 30 kDa protein 411 30075 12 12 10 10 3163 3518 1 0 0 719.8531 1437.6917 2 1437.6922 -0.0004 1 57.78 2.90E-05 R ILNEMRDQYEK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3664.3664.2.dta 2 IPI00792454.1 30 kDa protein 411 30075 12 12 10 10 5572 3994 1 0 0 702.0209 2103.0408 3 2103.0444 -0.0036 1 61.36 1.90E-06 K TEELNREVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4196.4196.3.dta 2 IPI00792454.1 30 kDa protein 411 30075 12 12 10 10 6002 4131 1 0 1 770.359 2308.0552 3 2308.0567 -0.0015 0 50.98 1.70E-05 R LLEGEDAHLSSSQFSSGSQSSR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4348.4348.3.dta 2 IPI00789750.1 27 kDa protein 382 26775 10 10 8 8 470 3740 1 0 0 404.204 806.3935 2 806.3923 0.0013 0 30.65 0.0032 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3918.3918.2.dta 2 IPI00789750.1 27 kDa protein 382 26775 10 10 8 8 1373 5337 1 0 0 515.3007 1028.5869 2 1028.5866 0.0003 0 50.26 0.00016 R VLDELTLAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5750.5750.2.dta 2 IPI00789750.1 27 kDa protein 382 26775 10 10 8 8 1696 2070 1 0 0 553.7662 1105.5178 2 1105.5186 -0.0008 0 56.68 4.20E-05 K VTMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2017.2017.2.dta 2 IPI00789750.1 27 kDa protein 382 26775 10 10 8 8 1697 3550 1 0 0 553.7845 1105.5545 2 1105.555 -0.0004 0 68.21 4.00E-06 R ISSVLAGGSCR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3703.3703.2.dta 2 IPI00789750.1 27 kDa protein 382 26775 10 10 8 8 1698 3559 1 0 0 553.7849 1105.5552 2 1105.555 0.0002 0 73.98 8.50E-07 R ISSVLAGGSCR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3713.3713.2.dta 2 IPI00789750.1 27 kDa protein 382 26775 10 10 8 8 2369 3926 1 0 1 633.8362 1265.6578 2 1265.6615 -0.0037 1 50.24 1.90E-05 R TKYETELNLR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4122.4122.2.dta 2 IPI00789750.1 27 kDa protein 382 26775 10 10 8 8 2370 3934 1 0 1 422.8945 1265.6617 3 1265.6615 0.0001 1 37.08 0.0033 R TKYETELNLR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4131.4131.3.dta 2 IPI00789750.1 27 kDa protein 382 26775 10 10 8 8 2423 3181 1 0 0 639.7946 1277.5747 2 1277.5783 -0.0036 0 85.61 3.50E-08 K GSCGIGGGIGGGSSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3249.3249.2.dta 2 IPI00789750.1 27 kDa protein 382 26775 10 10 8 8 3087 3682 1 0 1 713.3515 1424.6885 2 1424.6896 -0.0011 0 77.09 5.90E-08 R APSTYGGGLSVSSSR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3850.3850.2.dta 2 IPI00789750.1 27 kDa protein 382 26775 10 10 8 8 3163 3518 1 0 0 719.8531 1437.6917 2 1437.6922 -0.0004 1 57.78 2.90E-05 R ILNEMRDQYEK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3664.3664.2.dta 2 IPI00791156.1 31 kDa protein 310 30866 14 14 12 12 470 3740 1 0 0 404.204 806.3935 2 806.3923 0.0013 0 30.65 0.0032 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3918.3918.2.dta 2 IPI00791156.1 31 kDa protein 310 30866 14 14 12 12 1188 3770 1 0 1 497.7151 993.4157 2 993.4192 -0.0034 0 23.27 0.0066 R DYSQYYR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3951.3951.2.dta 2 IPI00791156.1 31 kDa protein 310 30866 14 14 12 12 1373 5337 1 0 0 515.3007 1028.5869 2 1028.5866 0.0003 0 50.26 0.00016 R VLDELTLAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5750.5750.2.dta 2 IPI00791156.1 31 kDa protein 310 30866 14 14 12 12 1386 2815 1 0 1 517.7556 1033.4967 2 1033.4975 -0.0008 0 69.38 2.20E-06 R LSGGLGAGSCR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2839.2839.2.dta 2 IPI00791156.1 31 kDa protein 310 30866 14 14 12 12 1511 2750 1 0 1 531.7527 1061.4909 2 1061.4924 -0.0014 0 44.39 0.00065 K ATMQNLNDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2768.2768.2.dta 2 IPI00791156.1 31 kDa protein 310 30866 14 14 12 12 1522 3928 1 0 0 355.5416 1063.603 3 1063.6026 0.0004 1 21.08 0.014 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4125.4125.3.dta 2 IPI00791156.1 31 kDa protein 310 30866 14 14 12 12 1578 1777 1 0 1 539.7505 1077.4864 2 1077.4873 -0.0009 0 19.83 0.022 K ATMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1692.1692.2.dta 2 IPI00791156.1 31 kDa protein 310 30866 14 14 12 12 2182 3192 1 0 0 408.2188 1221.6347 3 1221.6353 -0.0006 1 45.45 0.00068 R TKFETEQALR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3261.3261.3.dta 2 IPI00791156.1 31 kDa protein 310 30866 14 14 12 12 2695 4738 1 0 1 448.2532 1341.7377 3 1341.7364 0.0013 1 32.99 0.009 R LSVEADINGLRR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5037.5037.3.dta 2 IPI00791156.1 31 kDa protein 310 30866 14 14 12 12 2708 4214 1 0 1 673.3458 1344.6771 2 1344.6772 -0.0001 0 84.44 2.90E-08 R ALEEANTELEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4437.4437.2.dta 2 IPI00791156.1 31 kDa protein 310 30866 14 14 12 12 3163 3518 1 0 0 719.8531 1437.6917 2 1437.6922 -0.0004 1 57.78 2.90E-05 R ILNEMRDQYEK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3664.3664.2.dta 2 IPI00791156.1 31 kDa protein 310 30866 14 14 12 12 5023 3219 1 0 1 629.643 1885.9072 3 1885.913 -0.0058 1 41.94 0.00012 R QFTSSSSIKGSSGLGGGSSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3290.3290.3.dta 2 IPI00791156.1 31 kDa protein 310 30866 14 14 12 12 8012 8007 1 0 1 1008.5496 3022.627 3 3022.6298 -0.0028 1 30.39 0.0037 R TIEELQNKILTATVDNANILLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9170.9170.3.dta 2 IPI00791156.1 31 kDa protein 310 30866 14 14 12 12 8013 8019 1 0 1 756.6663 3022.6359 4 3022.6298 0.0061 1 25.8 0.0089 R TIEELQNKILTATVDNANILLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9183.9183.4.dta 2 IPI00790191.1 25 kDa protein 305 25322 9 9 8 8 1113 2563 1 0 1 325.8459 974.5158 3 974.5145 0.0013 1 31.55 0.01 R SEVTDLRR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2566.2566.3.dta 2 IPI00790191.1 25 kDa protein 305 25322 9 9 8 8 1373 5337 1 0 0 515.3007 1028.5869 2 1028.5866 0.0003 0 50.26 0.00016 R VLDELTLAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5750.5750.2.dta 2 IPI00790191.1 25 kDa protein 305 25322 9 9 8 8 1606 5662 1 0 1 541.7491 1081.4837 2 1081.4829 0.0009 0 46.83 0.0001 K DAEAWFTSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6149.6149.2.dta 2 IPI00790191.1 25 kDa protein 305 25322 9 9 8 8 1757 3753 1 0 0 561.7919 1121.5692 2 1121.5717 -0.0025 0 55.46 4.00E-05 R LEQEIATYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3932.3932.2.dta 2 IPI00790191.1 25 kDa protein 305 25322 9 9 8 8 1758 3742 1 0 0 561.7934 1121.5722 2 1121.5717 0.0006 0 68.56 1.70E-06 R LEQEIATYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3920.3920.2.dta 2 IPI00790191.1 25 kDa protein 305 25322 9 9 8 8 2196 3106 1 0 1 614.301 1226.5874 2 1226.5891 -0.0017 0 44.68 0.00025 K NHEEEISTLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3165.3165.2.dta 2 IPI00790191.1 25 kDa protein 305 25322 9 9 8 8 2822 4311 1 0 1 455.9088 1364.7044 3 1364.7048 -0.0004 1 35.28 0.006 K SRLEQEIATYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4544.4544.3.dta 2 IPI00790191.1 25 kDa protein 305 25322 9 9 8 8 2923 4766 1 0 1 695.3434 1388.6723 2 1388.6783 -0.006 0 103.37 3.20E-10 K AALEDTLAETEAR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5067.5067.2.dta 2 IPI00790191.1 25 kDa protein 305 25322 9 9 8 8 5738 3854 1 0 1 743.3594 2227.0563 3 2227.0651 -0.0088 1 50.72 6.20E-05 R TEELNREVAGHTEQLQMSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4044.4044.3.dta 2 IPI00794644.1 21 kDa protein 286 20831 10 10 10 10 344 2080 1 0 1 381.7092 761.4039 2 761.4032 0.0007 0 33.44 0.014 R GVSVSSAR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2027.2027.2.dta 2 IPI00794644.1 21 kDa protein 286 20831 10 10 10 10 470 3740 1 0 0 404.204 806.3935 2 806.3923 0.0013 0 30.65 0.0032 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3918.3918.2.dta 2 IPI00794644.1 21 kDa protein 286 20831 10 10 10 10 652 4925 1 0 1 425.7322 849.4499 2 849.4497 0.0001 0 57.83 2.00E-05 R FGPGVAFR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5258.5258.2.dta 2 IPI00794644.1 21 kDa protein 286 20831 10 10 10 10 1197 1583 1 0 1 498.2552 994.4958 2 994.4944 0.0013 0 55.45 3.10E-05 R APSIHGGSGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1483.1483.2.dta 2 IPI00794644.1 21 kDa protein 286 20831 10 10 10 10 1373 5337 1 0 0 515.3007 1028.5869 2 1028.5866 0.0003 0 50.26 0.00016 R VLDELTLAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5750.5750.2.dta 2 IPI00794644.1 21 kDa protein 286 20831 10 10 10 10 1415 4698 1 0 0 521.3065 1040.5984 2 1040.5978 0.0005 0 45.25 0.00015 R IVLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4986.4986.2.dta 2 IPI00794644.1 21 kDa protein 286 20831 10 10 10 10 1522 3928 1 0 0 355.5416 1063.603 3 1063.6026 0.0004 1 21.08 0.014 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4125.4125.3.dta 2 IPI00794644.1 21 kDa protein 286 20831 10 10 10 10 2182 3192 1 0 0 408.2188 1221.6347 3 1221.6353 -0.0006 1 45.45 0.00068 R TKFETEQALR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3261.3261.3.dta 2 IPI00794644.1 21 kDa protein 286 20831 10 10 10 10 2196 3106 1 0 1 614.301 1226.5874 2 1226.5891 -0.0017 0 44.68 0.00025 K NHEEEISTLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3165.3165.2.dta 2 IPI00794644.1 21 kDa protein 286 20831 10 10 10 10 3587 4451 1 0 1 777.8782 1553.7419 2 1553.7434 -0.0015 0 96.61 8.70E-10 R QSSATSSFGGLGGGSVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4698.4698.2.dta 2 IPI00794731.1 15 kDa protein 276 15182 7 7 5 5 1757 3753 1 0 0 561.7919 1121.5692 2 1121.5717 -0.0025 0 55.46 4.00E-05 R LEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3932.3932.2.dta 2 IPI00794731.1 15 kDa protein 276 15182 7 7 5 5 1758 3742 1 0 0 561.7934 1121.5722 2 1121.5717 0.0006 0 68.56 1.70E-06 R LEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3920.3920.2.dta 2 IPI00794731.1 15 kDa protein 276 15182 7 7 5 5 2351 2622 1 0 1 630.7877 1259.5609 2 1259.563 -0.0021 0 63.67 1.10E-06 R EVFTSSSSSSSR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2629.2629.2.dta 2 IPI00794731.1 15 kDa protein 276 15182 7 7 5 5 2889 4323 1 0 0 690.3658 1378.7171 2 1378.7204 -0.0033 1 60.65 2.10E-06 K TRLEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4557.4557.2.dta 2 IPI00794731.1 15 kDa protein 276 15182 7 7 5 5 3115 3585 1 0 0 717.3644 1432.7143 2 1432.7157 -0.0014 1 51.78 6.90E-05 K ASLENSLEETKGR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3741.3741.2.dta 2 IPI00794731.1 15 kDa protein 276 15182 7 7 5 5 3116 3577 1 0 0 478.5789 1432.7148 3 1432.7157 -0.0009 1 36.34 0.00089 K ASLENSLEETKGR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3732.3732.3.dta 2 IPI00794731.1 15 kDa protein 276 15182 7 7 5 5 6159 3573 1 0 1 784.0352 2349.0836 3 2349.0833 0.0004 0 56.12 5.50E-06 R LLEGEDAHLSSQQASGQSYSSR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3728.3728.3.dta 2 IPI00180956.6 49 kDa protein 273 49001 9 9 8 8 1188 3770 1 0 1 497.7151 993.4157 2 993.4192 -0.0034 0 23.27 0.0066 R DYSQYYR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3951.3951.2.dta 2 IPI00180956.6 49 kDa protein 273 49001 9 9 8 8 1373 5337 1 0 0 515.3007 1028.5869 2 1028.5866 0.0003 0 50.26 0.00016 R VLDELTLAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5750.5750.2.dta 2 IPI00180956.6 49 kDa protein 273 49001 9 9 8 8 1511 2750 1 0 1 531.7527 1061.4909 2 1061.4924 -0.0014 0 44.39 0.00065 K ATMQNLNDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2768.2768.2.dta 2 IPI00180956.6 49 kDa protein 273 49001 9 9 8 8 1522 3928 1 0 0 355.5416 1063.603 3 1063.6026 0.0004 1 21.08 0.014 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4125.4125.3.dta 2 IPI00180956.6 49 kDa protein 273 49001 9 9 8 8 1578 1777 1 0 1 539.7505 1077.4864 2 1077.4873 -0.0009 0 19.83 0.022 K ATMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1692.1692.2.dta 2 IPI00180956.6 49 kDa protein 273 49001 9 9 8 8 2790 3146 1 0 0 681.3486 1360.6826 2 1360.6834 -0.0008 0 85.68 2.20E-08 R EVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3209.3209.2.dta 2 IPI00180956.6 49 kDa protein 273 49001 9 9 8 8 2991 3953 1 0 1 702.3404 1402.6662 2 1402.6688 -0.0026 0 75.36 1.60E-07 K ASLEGNLAETENR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4152.4152.2.dta 2 IPI00180956.6 49 kDa protein 273 49001 9 9 8 8 5023 3219 1 0 1 629.643 1885.9072 3 1885.913 -0.0058 1 41.94 0.00012 R QFTSSSSIKGSSGLGGGSSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3290.3290.3.dta 2 IPI00180956.6 49 kDa protein 273 49001 9 9 8 8 5572 3994 1 0 0 702.0209 2103.0408 3 2103.0444 -0.0036 1 61.36 1.90E-06 K TEELNREVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4196.4196.3.dta 2 IPI00795353.1 11 kDa protein 259 10894 10 10 8 8 1181 1410 1 0 1 496.748 991.4815 2 991.4822 -0.0007 0 24.11 0.018 K VVSETNDTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1293.1293.2.dta 2 IPI00795353.1 11 kDa protein 259 10894 10 10 8 8 1526 4220 1 0 1 533.2823 1064.5501 2 1064.5502 0 0 64.58 3.30E-06 K LEAEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4443.4443.2.dta 2 IPI00795353.1 11 kDa protein 259 10894 10 10 8 8 2179 3532 1 0 1 611.3341 1220.6537 2 1220.6513 0.0024 1 26.11 0.0066 K LEAEIATYRR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3681.3681.2.dta 2 IPI00795353.1 11 kDa protein 259 10894 10 10 8 8 2488 4479 1 0 1 646.863 1291.7114 2 1291.7136 -0.0022 1 49.82 3.90E-05 K VKLEAEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4727.4727.2.dta 2 IPI00795353.1 11 kDa protein 259 10894 10 10 8 8 2489 4478 1 0 1 431.5784 1291.7134 3 1291.7136 -0.0002 1 37.39 0.0006 K VKLEAEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4726.4726.3.dta 2 IPI00795353.1 11 kDa protein 259 10894 10 10 8 8 3056 5884 1 0 1 710.3774 1418.7402 2 1418.7405 -0.0003 0 54.58 6.80E-05 R QAQEYEALLNIK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6478.6478.2.dta 2 IPI00795353.1 11 kDa protein 259 10894 10 10 8 8 3414 2728 1 0 1 752.8956 1503.7766 2 1503.7781 -0.0015 1 50.25 1.90E-05 R IVDGKVVSETNDTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2744.2744.2.dta 2 IPI00795353.1 11 kDa protein 259 10894 10 10 8 8 3415 2647 1 0 1 502.2664 1503.7773 3 1503.7781 -0.0007 1 33.03 0.0011 R IVDGKVVSETNDTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2657.2657.3.dta 2 IPI00795353.1 11 kDa protein 259 10894 10 10 8 8 5275 5591 1 0 1 654.3411 1960.0015 3 1960.0013 0.0002 1 50.18 2.10E-05 R AEGQRQAQEYEALLNIK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6051.6051.3.dta 2 IPI00795353.1 11 kDa protein 259 10894 10 10 8 8 7821 6133 1 0 1 966.1238 2895.3495 3 2895.3556 -0.0061 1 32.48 0.0009 R RLLEDGEDFNLGDALDSSNSMQTIQK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6806.6806.3.dta 2 IPI00654614.1 Epidermal type I keratin (Fragment) 245 17892 8 8 6 6 197 4796 1 0 0 350.7337 699.4528 2 699.4531 -0.0003 0 37.55 0.00058 K ILLDVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5107.5107.2.dta 2 IPI00654614.1 Epidermal type I keratin (Fragment) 245 17892 8 8 6 6 1172 2953 1 0 0 495.2721 988.5297 2 988.5301 -0.0004 1 27.65 0.047 K SEISELRR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2989.2989.2.dta 2 IPI00654614.1 Epidermal type I keratin (Fragment) 245 17892 8 8 6 6 1757 3753 1 0 0 561.7919 1121.5692 2 1121.5717 -0.0025 0 55.46 4.00E-05 R LEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3932.3932.2.dta 2 IPI00654614.1 Epidermal type I keratin (Fragment) 245 17892 8 8 6 6 1758 3742 1 0 0 561.7934 1121.5722 2 1121.5717 0.0006 0 68.56 1.70E-06 R LEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3920.3920.2.dta 2 IPI00654614.1 Epidermal type I keratin (Fragment) 245 17892 8 8 6 6 2889 4323 1 0 0 690.3658 1378.7171 2 1378.7204 -0.0033 1 60.65 2.10E-06 K TRLEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4557.4557.2.dta 2 IPI00654614.1 Epidermal type I keratin (Fragment) 245 17892 8 8 6 6 3115 3585 1 0 0 717.3644 1432.7143 2 1432.7157 -0.0014 1 51.78 6.90E-05 K ASLENSLEETKGR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3741.3741.2.dta 2 IPI00654614.1 Epidermal type I keratin (Fragment) 245 17892 8 8 6 6 3116 3577 1 0 0 478.5789 1432.7148 3 1432.7157 -0.0009 1 36.34 0.00089 K ASLENSLEETKGR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3732.3732.3.dta 2 IPI00654614.1 Epidermal type I keratin (Fragment) 245 17892 8 8 6 6 6002 4131 1 0 1 770.359 2308.0552 3 2308.0567 -0.0015 0 50.98 1.70E-05 R LLEGEDAHLSSSQFSSGSQSSR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4348.4348.3.dta 2 IPI00794267.1 18 kDa protein 233 18099 9 9 8 8 470 3740 1 0 0 404.204 806.3935 2 806.3923 0.0013 0 30.65 0.0032 R LAADDFR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3918.3918.2.dta 2 IPI00794267.1 18 kDa protein 233 18099 9 9 8 8 906 1595 2 0 1 462.7662 923.5179 2 923.5188 -0.001 1 28.3 0.017 K IREHLEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1496.1496.2.dta 2 IPI00794267.1 18 kDa protein 233 18099 9 9 8 8 1112 3290 1 0 1 488.2301 974.4457 2 974.4458 0 0 44.41 0.00042 R STFSTNYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3389.3389.2.dta 2 IPI00794267.1 18 kDa protein 233 18099 9 9 8 8 1415 4698 1 0 0 521.3065 1040.5984 2 1040.5978 0.0005 0 45.25 0.00015 R IVLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4986.4986.2.dta 2 IPI00794267.1 18 kDa protein 233 18099 9 9 8 8 1655 3990 1 0 1 546.8112 1091.6078 2 1091.6087 -0.001 1 34.01 0.0021 R LASYLDRVR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4192.4192.2.dta 2 IPI00794267.1 18 kDa protein 233 18099 9 9 8 8 1657 2968 1 0 1 547.2523 1092.4901 2 1092.487 0.0031 0 30.71 0.0097 K ETMQSLNDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3005.3005.2.dta 2 IPI00794267.1 18 kDa protein 233 18099 9 9 8 8 2602 4354 1 0 1 660.3369 1318.6592 2 1318.6629 -0.0038 0 81.02 3.10E-08 R AQIFANTVDNAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4590.4590.2.dta 2 IPI00794267.1 18 kDa protein 233 18099 9 9 8 8 5492 5944 1 0 1 1030.0489 2058.0833 2 2058.0858 -0.0024 1 32.08 0.00098 K IIEDLRAQIFANTVDNAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6562.6562.2.dta 2 IPI00794267.1 18 kDa protein 233 18099 9 9 8 8 5493 5936 1 0 1 687.0362 2058.0868 3 2058.0858 0.001 1 63.46 1.10E-06 K IIEDLRAQIFANTVDNAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6547.6547.3.dta 2 IPI00290077.1 "Keratin, type I cytoskeletal 15" 229 49365 7 7 6 6 470 3740 1 0 0 404.204 806.3935 2 806.3923 0.0013 0 30.65 0.0032 R LAADDFR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3918.3918.2.dta 2 IPI00290077.1 "Keratin, type I cytoskeletal 15" 229 49365 7 7 6 6 1373 5337 1 0 0 515.3007 1028.5869 2 1028.5866 0.0003 0 50.26 0.00016 R VLDELTLAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5750.5750.2.dta 2 IPI00290077.1 "Keratin, type I cytoskeletal 15" 229 49365 7 7 6 6 1522 3928 1 0 0 355.5416 1063.603 3 1063.6026 0.0004 1 21.08 0.014 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4125.4125.3.dta 2 IPI00290077.1 "Keratin, type I cytoskeletal 15" 229 49365 7 7 6 6 1757 3753 1 0 0 561.7919 1121.5692 2 1121.5717 -0.0025 0 55.46 4.00E-05 R LEQEIATYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3932.3932.2.dta 2 IPI00290077.1 "Keratin, type I cytoskeletal 15" 229 49365 7 7 6 6 1758 3742 1 0 0 561.7934 1121.5722 2 1121.5717 0.0006 0 68.56 1.70E-06 R LEQEIATYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3920.3920.2.dta 2 IPI00290077.1 "Keratin, type I cytoskeletal 15" 229 49365 7 7 6 6 2515 4153 1 0 0 651.3337 1300.6529 2 1300.651 0.0019 0 67.28 3.40E-06 R ALEEANADLEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4372.4372.2.dta 2 IPI00290077.1 "Keratin, type I cytoskeletal 15" 229 49365 7 7 6 6 2889 4323 1 0 0 690.3658 1378.7171 2 1378.7204 -0.0033 1 60.65 2.10E-06 K TRLEQEIATYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4557.4557.2.dta 2 IPI00789536.1 MGC102966 protein 228 15752 8 8 7 7 470 3740 1 0 0 404.204 806.3935 2 806.3923 0.0013 0 30.65 0.0032 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3918.3918.2.dta 2 IPI00789536.1 MGC102966 protein 228 15752 8 8 7 7 1373 5337 1 0 0 515.3007 1028.5869 2 1028.5866 0.0003 0 50.26 0.00016 R VLDELTLAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5750.5750.2.dta 2 IPI00789536.1 MGC102966 protein 228 15752 8 8 7 7 1522 3928 1 0 0 355.5416 1063.603 3 1063.6026 0.0004 1 21.08 0.014 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4125.4125.3.dta 2 IPI00789536.1 MGC102966 protein 228 15752 8 8 7 7 2515 4153 1 0 0 651.3337 1300.6529 2 1300.651 0.0019 0 67.28 3.40E-06 R ALEEANADLEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4372.4372.2.dta 2 IPI00789536.1 MGC102966 protein 228 15752 8 8 7 7 4607 4252 1 0 1 586.6332 1756.8777 3 1756.8784 -0.0007 1 21.82 0.009 R QRPSEIKDYSPYFK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4479.4479.3.dta 2 IPI00789536.1 MGC102966 protein 228 15752 8 8 7 7 5506 6172 1 0 1 1032.574 2063.1334 2 2063.1375 -0.0041 0 66.4 5.90E-07 K IIAATIENAQPILQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6861.6861.2.dta 2 IPI00789536.1 MGC102966 protein 228 15752 8 8 7 7 5507 6161 1 0 1 688.7202 2063.1386 3 2063.1375 0.0012 0 54.03 8.60E-06 K IIAATIENAQPILQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6846.6846.3.dta 2 IPI00789536.1 MGC102966 protein 228 15752 8 8 7 7 5629 7538 1 0 1 717.7057 2150.0952 3 2150.0929 0.0024 1 44.1 8.90E-05 R TDLEMQIEGLKEELAYLR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8600.8600.3.dta 2 IPI00184195.2 19 kDa protein 226 18696 9 9 9 9 470 3740 1 0 0 404.204 806.3935 2 806.3923 0.0013 0 30.65 0.0032 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3918.3918.2.dta 2 IPI00184195.2 19 kDa protein 226 18696 9 9 9 9 1373 5337 1 0 0 515.3007 1028.5869 2 1028.5866 0.0003 0 50.26 0.00016 R VLDELTLAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5750.5750.2.dta 2 IPI00184195.2 19 kDa protein 226 18696 9 9 9 9 1415 4698 1 0 0 521.3065 1040.5984 2 1040.5978 0.0005 0 45.25 0.00015 R IVLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4986.4986.2.dta 2 IPI00184195.2 19 kDa protein 226 18696 9 9 9 9 1522 3928 1 0 0 355.5416 1063.603 3 1063.6026 0.0004 1 21.08 0.014 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4125.4125.3.dta 2 IPI00184195.2 19 kDa protein 226 18696 9 9 9 9 1554 3991 1 0 1 537.3017 1072.5888 2 1072.5876 0.0012 0 48.87 3.00E-05 K ILGATIENSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4193.4193.2.dta 2 IPI00184195.2 19 kDa protein 226 18696 9 9 9 9 2182 3192 1 0 0 408.2188 1221.6347 3 1221.6353 -0.0006 1 45.45 0.00068 R TKFETEQALR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3261.3261.3.dta 2 IPI00184195.2 19 kDa protein 226 18696 9 9 9 9 2196 3106 1 0 1 614.301 1226.5874 2 1226.5891 -0.0017 0 44.68 0.00025 K NHEEEISTLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3165.3165.2.dta 2 IPI00184195.2 19 kDa protein 226 18696 9 9 9 9 2269 4223 1 0 1 622.329 1242.6434 2 1242.6455 -0.0021 0 64.85 2.20E-06 R ALEAANGELEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4447.4447.2.dta 2 IPI00184195.2 19 kDa protein 226 18696 9 9 9 9 5159 4977 1 0 1 639.9697 1916.8874 3 1916.8904 -0.0031 1 30.45 0.0014 R DYSHYYTTIQDLRDK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5319.5319.3.dta 2 IPI00794047.1 18 kDa protein 223 18209 10 10 8 8 470 3740 1 0 0 404.204 806.3935 2 806.3923 0.0013 0 30.65 0.0032 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3918.3918.2.dta 2 IPI00794047.1 18 kDa protein 223 18209 10 10 8 8 1188 3770 1 0 1 497.7151 993.4157 2 993.4192 -0.0034 0 23.27 0.0066 R DYSQYYR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3951.3951.2.dta 2 IPI00794047.1 18 kDa protein 223 18209 10 10 8 8 1386 2815 1 0 1 517.7556 1033.4967 2 1033.4975 -0.0008 0 69.38 2.20E-06 R LSGGLGAGSCR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2839.2839.2.dta 2 IPI00794047.1 18 kDa protein 223 18209 10 10 8 8 1511 2750 1 0 1 531.7527 1061.4909 2 1061.4924 -0.0014 0 44.39 0.00065 K ATMQNLNDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2768.2768.2.dta 2 IPI00794047.1 18 kDa protein 223 18209 10 10 8 8 1522 3928 1 0 0 355.5416 1063.603 3 1063.6026 0.0004 1 21.08 0.014 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4125.4125.3.dta 2 IPI00794047.1 18 kDa protein 223 18209 10 10 8 8 1578 1777 1 0 1 539.7505 1077.4864 2 1077.4873 -0.0009 0 19.83 0.022 K ATMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1692.1692.2.dta 2 IPI00794047.1 18 kDa protein 223 18209 10 10 8 8 2708 4214 1 0 1 673.3458 1344.6771 2 1344.6772 -0.0001 0 84.44 2.90E-08 R ALEEANTELEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4437.4437.2.dta 2 IPI00794047.1 18 kDa protein 223 18209 10 10 8 8 5023 3219 1 0 1 629.643 1885.9072 3 1885.913 -0.0058 1 41.94 0.00012 R QFTSSSSIKGSSGLGGGSSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3290.3290.3.dta 2 IPI00794047.1 18 kDa protein 223 18209 10 10 8 8 8012 8007 1 0 1 1008.5496 3022.627 3 3022.6298 -0.0028 1 30.39 0.0037 R TIEELQNKILTATVDNANILLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9170.9170.3.dta 2 IPI00794047.1 18 kDa protein 223 18209 10 10 8 8 8013 8019 1 0 1 756.6663 3022.6359 4 3022.6298 0.0061 1 25.8 0.0089 R TIEELQNKILTATVDNANILLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9183.9183.4.dta 2 IPI00791348.1 20 kDa protein 219 19811 4 4 3 3 1697 3550 1 0 0 553.7845 1105.5545 2 1105.555 -0.0004 0 68.21 4.00E-06 R ISSVLAGGSCR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3703.3703.2.dta 2 IPI00791348.1 20 kDa protein 219 19811 4 4 3 3 1698 3559 1 0 0 553.7849 1105.5552 2 1105.555 0.0002 0 73.98 8.50E-07 R ISSVLAGGSCR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3713.3713.2.dta 2 IPI00791348.1 20 kDa protein 219 19811 4 4 3 3 2423 3181 1 0 0 639.7946 1277.5747 2 1277.5783 -0.0036 0 85.61 3.50E-08 K GSCGIGGGIGGGSSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3249.3249.2.dta 2 IPI00791348.1 20 kDa protein 219 19811 4 4 3 3 2515 4153 1 0 0 651.3337 1300.6529 2 1300.651 0.0019 0 67.28 3.40E-06 R ALEEANADLEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4372.4372.2.dta 2 IPI00171196.2 keratin 13 isoform b 216 46181 6 6 5 5 470 3740 1 0 0 404.204 806.3935 2 806.3923 0.0013 0 30.65 0.0032 R LAADDFR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3918.3918.2.dta 2 IPI00171196.2 keratin 13 isoform b 216 46181 6 6 5 5 538 3605 1 0 1 412.2314 822.4482 2 822.4487 -0.0005 0 34.38 0.0006 R LASYLEK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3765.3765.2.dta 2 IPI00171196.2 keratin 13 isoform b 216 46181 6 6 5 5 1757 3753 1 0 0 561.7919 1121.5692 2 1121.5717 -0.0025 0 55.46 4.00E-05 R LEQEIATYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3932.3932.2.dta 2 IPI00171196.2 keratin 13 isoform b 216 46181 6 6 5 5 1758 3742 1 0 0 561.7934 1121.5722 2 1121.5717 0.0006 0 68.56 1.70E-06 R LEQEIATYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3920.3920.2.dta 2 IPI00171196.2 keratin 13 isoform b 216 46181 6 6 5 5 2515 4153 1 0 0 651.3337 1300.6529 2 1300.651 0.0019 0 67.28 3.40E-06 R ALEEANADLEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4372.4372.2.dta 2 IPI00171196.2 keratin 13 isoform b 216 46181 6 6 5 5 2889 4323 1 0 0 690.3658 1378.7171 2 1378.7204 -0.0033 1 60.65 2.10E-06 K TRLEQEIATYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4557.4557.2.dta 2 IPI00032513.2 "Keratin, type I cuticular Ha1" 207 48628 8 8 7 7 280 1906 1 0 1 366.2063 730.398 2 730.3973 0.0006 0 35.34 0.012 R VLNETR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1832.1832.2.dta 2 IPI00032513.2 "Keratin, type I cuticular Ha1" 207 48628 8 8 7 7 470 3740 1 0 0 404.204 806.3935 2 806.3923 0.0013 0 30.65 0.0032 K LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3918.3918.2.dta 2 IPI00032513.2 "Keratin, type I cuticular Ha1" 207 48628 8 8 7 7 538 3605 1 0 1 412.2314 822.4482 2 822.4487 -0.0005 0 34.38 0.0006 R LASYLEK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3765.3765.2.dta 2 IPI00032513.2 "Keratin, type I cuticular Ha1" 207 48628 8 8 7 7 1163 3131 1 0 1 494.7688 987.5231 2 987.5237 -0.0005 0 53.84 0.00011 K TIEELQQK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3193.3193.2.dta 2 IPI00032513.2 "Keratin, type I cuticular Ha1" 207 48628 8 8 7 7 1239 4118 1 0 1 500.2954 998.5762 2 998.576 0.0002 0 47.57 0.00018 R LVVQIDNAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4334.4334.2.dta 2 IPI00032513.2 "Keratin, type I cuticular Ha1" 207 48628 8 8 7 7 3412 5817 1 0 1 752.8946 1503.7746 2 1503.7681 0.0065 0 57.86 4.30E-06 R QNQEYQVLLDVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6383.6383.2.dta 2 IPI00032513.2 "Keratin, type I cuticular Ha1" 207 48628 8 8 7 7 5575 5705 1 0 1 702.3599 2104.0579 3 2104.0549 0.0031 1 47.57 5.60E-05 R SDLERQNQEYQVLLDVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6212.6212.3.dta 2 IPI00032513.2 "Keratin, type I cuticular Ha1" 207 48628 8 8 7 7 5576 5694 1 0 1 702.3635 2104.0687 3 2104.0549 0.0139 1 45.99 0.00013 R SDLERQNQEYQVLLDVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6196.6196.3.dta 2 IPI00009866.6 "Isoform 1 of Keratin, type I cytoskeletal 13" 204 49898 5 5 4 4 538 3605 1 0 1 412.2314 822.4482 2 822.4487 -0.0005 0 34.38 0.0006 R LASYLEK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3765.3765.2.dta 2 IPI00009866.6 "Isoform 1 of Keratin, type I cytoskeletal 13" 204 49898 5 5 4 4 1757 3753 1 0 0 561.7919 1121.5692 2 1121.5717 -0.0025 0 55.46 4.00E-05 R LEQEIATYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3932.3932.2.dta 2 IPI00009866.6 "Isoform 1 of Keratin, type I cytoskeletal 13" 204 49898 5 5 4 4 1758 3742 1 0 0 561.7934 1121.5722 2 1121.5717 0.0006 0 68.56 1.70E-06 R LEQEIATYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3920.3920.2.dta 2 IPI00009866.6 "Isoform 1 of Keratin, type I cytoskeletal 13" 204 49898 5 5 4 4 2515 4153 1 0 0 651.3337 1300.6529 2 1300.651 0.0019 0 67.28 3.40E-06 R ALEEANADLEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4372.4372.2.dta 2 IPI00009866.6 "Isoform 1 of Keratin, type I cytoskeletal 13" 204 49898 5 5 4 4 2889 4323 1 0 0 690.3658 1378.7171 2 1378.7204 -0.0033 1 60.65 2.10E-06 K TRLEQEIATYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4557.4557.2.dta 2 IPI00031423.1 "Keratin, type I cuticular Ha3-II" 203 47325 8 8 7 7 470 3740 1 0 0 404.204 806.3935 2 806.3923 0.0013 0 30.65 0.0032 K LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3918.3918.2.dta 2 IPI00031423.1 "Keratin, type I cuticular Ha3-II" 203 47325 8 8 7 7 538 3605 1 0 1 412.2314 822.4482 2 822.4487 -0.0005 0 34.38 0.0006 R LASYLEK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3765.3765.2.dta 2 IPI00031423.1 "Keratin, type I cuticular Ha3-II" 203 47325 8 8 7 7 1163 3131 1 0 1 494.7688 987.5231 2 987.5237 -0.0005 0 53.84 0.00011 K TIEELQQK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3193.3193.2.dta 2 IPI00031423.1 "Keratin, type I cuticular Ha3-II" 203 47325 8 8 7 7 1239 4118 1 0 1 500.2954 998.5762 2 998.576 0.0002 0 47.57 0.00018 R LVVQIDNAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4334.4334.2.dta 2 IPI00031423.1 "Keratin, type I cuticular Ha3-II" 203 47325 8 8 7 7 2826 2365 1 0 1 456.5597 1366.6572 3 1366.6589 -0.0018 0 26.77 0.029 K QNHEQEVNTLR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2347.2347.3.dta 2 IPI00031423.1 "Keratin, type I cuticular Ha3-II" 203 47325 8 8 7 7 3412 5817 1 0 1 752.8946 1503.7746 2 1503.7681 0.0065 0 57.86 4.30E-06 R QNQEYQVLLDVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6383.6383.2.dta 2 IPI00031423.1 "Keratin, type I cuticular Ha3-II" 203 47325 8 8 7 7 5575 5705 1 0 1 702.3599 2104.0579 3 2104.0549 0.0031 1 47.57 5.60E-05 R SDLERQNQEYQVLLDVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6212.6212.3.dta 2 IPI00031423.1 "Keratin, type I cuticular Ha3-II" 203 47325 8 8 7 7 5576 5694 1 0 1 702.3635 2104.0687 3 2104.0549 0.0139 1 45.99 0.00013 R SDLERQNQEYQVLLDVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6196.6196.3.dta 2 IPI00793186.1 9 kDa protein 196 9417 5 5 4 4 197 4796 1 0 0 350.7337 699.4528 2 699.4531 -0.0003 0 37.55 0.00058 K ILLDVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5107.5107.2.dta 2 IPI00793186.1 9 kDa protein 196 9417 5 5 4 4 1757 3753 1 0 0 561.7919 1121.5692 2 1121.5717 -0.0025 0 55.46 4.00E-05 R LEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3932.3932.2.dta 2 IPI00793186.1 9 kDa protein 196 9417 5 5 4 4 1758 3742 1 0 0 561.7934 1121.5722 2 1121.5717 0.0006 0 68.56 1.70E-06 R LEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3920.3920.2.dta 2 IPI00793186.1 9 kDa protein 196 9417 5 5 4 4 2889 4323 1 0 0 690.3658 1378.7171 2 1378.7204 -0.0033 1 60.65 2.10E-06 K TRLEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4557.4557.2.dta 2 IPI00793186.1 9 kDa protein 196 9417 5 5 4 4 6002 4131 1 0 1 770.359 2308.0552 3 2308.0567 -0.0015 0 50.98 1.70E-05 R LLEGEDAHLSSSQFSSGSQSSR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4348.4348.3.dta 2 IPI00797326.1 33 kDa protein 169 32778 4 4 3 3 1373 5337 1 0 0 515.3007 1028.5869 2 1028.5866 0.0003 0 50.26 0.00016 R VLDELTLAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5750.5750.2.dta 2 IPI00797326.1 33 kDa protein 169 32778 4 4 3 3 1757 3753 1 0 0 561.7919 1121.5692 2 1121.5717 -0.0025 0 55.46 4.00E-05 R LEQEIATYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3932.3932.2.dta 2 IPI00797326.1 33 kDa protein 169 32778 4 4 3 3 1758 3742 1 0 0 561.7934 1121.5722 2 1121.5717 0.0006 0 68.56 1.70E-06 R LEQEIATYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3920.3920.2.dta 2 IPI00797326.1 33 kDa protein 169 32778 4 4 3 3 2889 4323 1 0 0 690.3658 1378.7171 2 1378.7204 -0.0033 1 60.65 2.10E-06 K TRLEQEIATYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4557.4557.2.dta 2 IPI00795719.1 16 kDa protein 167 16241 5 5 4 4 470 3740 1 0 0 404.204 806.3935 2 806.3923 0.0013 0 30.65 0.0032 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3918.3918.2.dta 2 IPI00795719.1 16 kDa protein 167 16241 5 5 4 4 1522 3928 1 0 0 355.5416 1063.603 3 1063.6026 0.0004 1 21.08 0.014 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4125.4125.3.dta 2 IPI00795719.1 16 kDa protein 167 16241 5 5 4 4 2515 4153 1 0 0 651.3337 1300.6529 2 1300.651 0.0019 0 67.28 3.40E-06 R ALEEANADLEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4372.4372.2.dta 2 IPI00795719.1 16 kDa protein 167 16241 5 5 4 4 5506 6172 1 0 1 1032.574 2063.1334 2 2063.1375 -0.0041 0 66.4 5.90E-07 K IIAATIENAQPILQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6861.6861.2.dta 2 IPI00795719.1 16 kDa protein 167 16241 5 5 4 4 5507 6161 1 0 1 688.7202 2063.1386 3 2063.1375 0.0012 0 54.03 8.60E-06 K IIAATIENAQPILQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6846.6846.3.dta 2 IPI00783306.1 Similar to keratin 14 165 9604 5 5 3 3 197 4796 1 0 0 350.7337 699.4528 2 699.4531 -0.0003 0 37.55 0.00058 K ILLDVK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5107.5107.2.dta 2 IPI00783306.1 Similar to keratin 14 165 9604 5 5 3 3 1757 3753 1 0 0 561.7919 1121.5692 2 1121.5717 -0.0025 0 55.46 4.00E-05 R LEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3932.3932.2.dta 2 IPI00783306.1 Similar to keratin 14 165 9604 5 5 3 3 1758 3742 1 0 0 561.7934 1121.5722 2 1121.5717 0.0006 0 68.56 1.70E-06 R LEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3920.3920.2.dta 2 IPI00783306.1 Similar to keratin 14 165 9604 5 5 3 3 3115 3585 1 0 0 717.3644 1432.7143 2 1432.7157 -0.0014 1 51.78 6.90E-05 K ASLENSLEETKGR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3741.3741.2.dta 2 IPI00783306.1 Similar to keratin 14 165 9604 5 5 3 3 3116 3577 1 0 0 478.5789 1432.7148 3 1432.7157 -0.0009 1 36.34 0.00089 K ASLENSLEETKGR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3732.3732.3.dta 2 IPI00021298.1 "Keratin, type I cytoskeletal 20" 161 48514 4 4 3 3 538 3605 1 0 1 412.2314 822.4482 2 822.4487 -0.0005 0 34.38 0.0006 R LASYLEK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3765.3765.2.dta 2 IPI00021298.1 "Keratin, type I cytoskeletal 20" 161 48514 4 4 3 3 1757 3753 1 0 0 561.7919 1121.5692 2 1121.5717 -0.0025 0 55.46 4.00E-05 R LEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3932.3932.2.dta 2 IPI00021298.1 "Keratin, type I cytoskeletal 20" 161 48514 4 4 3 3 1758 3742 1 0 0 561.7934 1121.5722 2 1121.5717 0.0006 0 68.56 1.70E-06 R LEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3920.3920.2.dta 2 IPI00021298.1 "Keratin, type I cytoskeletal 20" 161 48514 4 4 3 3 2889 4323 1 0 0 690.3658 1378.7171 2 1378.7204 -0.0033 1 60.65 2.10E-06 K TRLEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4557.4557.2.dta 2 IPI00793702.1 7 kDa protein 148 6580 4 4 3 3 2276 4394 1 0 1 622.8506 1243.6866 2 1243.6884 -0.0018 1 35.66 0.00078 R NLKASLENSLR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4636.4636.2.dta 2 IPI00793702.1 7 kDa protein 148 6580 4 4 3 3 7139 8461 1 0 1 890.8033 2669.3882 3 2669.3846 0.0036 0 76.44 6.80E-08 R YALQMEQLNGILLHLESELAQTR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9741.9741.3.dta 2 IPI00793702.1 7 kDa protein 148 6580 4 4 3 3 7173 7888 1 0 1 896.1346 2685.3819 3 2685.3795 0.0024 0 63.68 1.10E-06 R YALQMEQLNGILLHLESELAQTR A Oxidation (M) 0.00001000000000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9029.9029.3.dta 2 IPI00793702.1 7 kDa protein 148 6580 4 4 3 3 8236 7464 1 0 1 807.6689 3226.6467 4 3226.6404 0.0063 1 24.06 0.019 R YALQMEQLNGILLHLESELAQTRAEGQR Q Oxidation (M) 0.0000100000000000000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8512.8512.4.dta 2 IPI00748465.1 44 kDa protein 144 44811 5 5 4 4 1112 3290 1 0 1 488.2301 974.4457 2 974.4458 0 0 44.41 0.00042 R STFSTNYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3389.3389.2.dta 2 IPI00748465.1 44 kDa protein 144 44811 5 5 4 4 1526 4220 1 0 1 533.2823 1064.5501 2 1064.5502 0 0 64.58 3.30E-06 K LEAEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4443.4443.2.dta 2 IPI00748465.1 44 kDa protein 144 44811 5 5 4 4 2179 3532 1 0 1 611.3341 1220.6537 2 1220.6513 0.0024 1 26.11 0.0066 K LEAEIATYRR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3681.3681.2.dta 2 IPI00748465.1 44 kDa protein 144 44811 5 5 4 4 2488 4479 1 0 1 646.863 1291.7114 2 1291.7136 -0.0022 1 49.82 3.90E-05 K VKLEAEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4727.4727.2.dta 2 IPI00748465.1 44 kDa protein 144 44811 5 5 4 4 2489 4478 1 0 1 431.5784 1291.7134 3 1291.7136 -0.0002 1 37.39 0.0006 K VKLEAEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4726.4726.3.dta 2 IPI00791342.1 13 kDa protein 127 13121 5 5 4 4 470 3740 1 0 0 404.204 806.3935 2 806.3923 0.0013 0 30.65 0.0032 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3918.3918.2.dta 2 IPI00791342.1 13 kDa protein 127 13121 5 5 4 4 1522 3928 1 0 0 355.5416 1063.603 3 1063.6026 0.0004 1 21.08 0.014 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4125.4125.3.dta 2 IPI00791342.1 13 kDa protein 127 13121 5 5 4 4 2369 3926 1 0 1 633.8362 1265.6578 2 1265.6615 -0.0037 1 50.24 1.90E-05 R TKYETELNLR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4122.4122.2.dta 2 IPI00791342.1 13 kDa protein 127 13121 5 5 4 4 2370 3934 1 0 1 422.8945 1265.6617 3 1265.6615 0.0001 1 37.08 0.0033 R TKYETELNLR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4131.4131.3.dta 2 IPI00791342.1 13 kDa protein 127 13121 5 5 4 4 2515 4153 1 0 0 651.3337 1300.6529 2 1300.651 0.0019 0 67.28 3.40E-06 R ALEEANADLEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4372.4372.2.dta 2 IPI00791927.1 32 kDa protein 119 32658 4 4 3 3 2826 2365 1 0 1 456.5597 1366.6572 3 1366.6589 -0.0018 0 26.77 0.029 K QNHEQEVNTLR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2347.2347.3.dta 2 IPI00791927.1 32 kDa protein 119 32658 4 4 3 3 3412 5817 1 0 1 752.8946 1503.7746 2 1503.7681 0.0065 0 57.86 4.30E-06 R QNQEYQVLLDVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6383.6383.2.dta 2 IPI00791927.1 32 kDa protein 119 32658 4 4 3 3 5575 5705 1 0 1 702.3599 2104.0579 3 2104.0549 0.0031 1 47.57 5.60E-05 R SDLERQNQEYQVLLDVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6212.6212.3.dta 2 IPI00791927.1 32 kDa protein 119 32658 4 4 3 3 5576 5694 1 0 1 702.3635 2104.0687 3 2104.0549 0.0139 1 45.99 0.00013 R SDLERQNQEYQVLLDVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6196.6196.3.dta 2 IPI00292715.3 keratin 34 116 50818 4 4 4 4 534 3363 1 0 1 412.201 822.3874 2 822.3872 0.0002 0 29.5 0.008 K LASDDFR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3475.3475.2.dta 2 IPI00292715.3 keratin 34 116 50818 4 4 4 4 538 3605 1 0 1 412.2314 822.4482 2 822.4487 -0.0005 0 34.38 0.0006 R LASYLEK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3765.3765.2.dta 2 IPI00292715.3 keratin 34 116 50818 4 4 4 4 1163 3131 1 0 1 494.7688 987.5231 2 987.5237 -0.0005 0 53.84 0.00011 K TIEELQQK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3193.3193.2.dta 2 IPI00292715.3 keratin 34 116 50818 4 4 4 4 3412 5817 1 0 1 752.8946 1503.7746 2 1503.7681 0.0065 0 57.86 4.30E-06 R QNQEYQVLLDVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6383.6383.2.dta 2 IPI00797594.1 18 kDa protein 104 19009 4 4 4 4 470 3740 1 0 0 404.204 806.3935 2 806.3923 0.0013 0 30.65 0.0032 K LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3918.3918.2.dta 2 IPI00797594.1 18 kDa protein 104 19009 4 4 4 4 538 3605 1 0 1 412.2314 822.4482 2 822.4487 -0.0005 0 34.38 0.0006 R LASYLEK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3765.3765.2.dta 2 IPI00797594.1 18 kDa protein 104 19009 4 4 4 4 1163 3131 1 0 1 494.7688 987.5231 2 987.5237 -0.0005 0 53.84 0.00011 K TIEELQQK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3193.3193.2.dta 2 IPI00797594.1 18 kDa protein 104 19009 4 4 4 4 1239 4118 1 0 1 500.2954 998.5762 2 998.576 0.0002 0 47.57 0.00018 R LVVQIDNAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4334.4334.2.dta 2 IPI00166126.2 Keratin 222 pseudogene 101 34308 2 2 1 1 1757 3753 1 0 0 561.7919 1121.5692 2 1121.5717 -0.0025 0 55.46 4.00E-05 R LEQEIATYR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3932.3932.2.dta 2 IPI00166126.2 Keratin 222 pseudogene 101 34308 2 2 1 1 1758 3742 1 0 0 561.7934 1121.5722 2 1121.5717 0.0006 0 68.56 1.70E-06 R LEQEIATYR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3920.3920.2.dta 2 IPI00790298.1 20 kDa protein 90 19591 2 2 2 2 1188 3770 1 0 1 497.7151 993.4157 2 993.4192 -0.0034 0 23.27 0.0066 R DYSQYYR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3951.3951.2.dta 2 IPI00790298.1 20 kDa protein 90 19591 2 2 2 2 2708 4214 1 0 1 673.3458 1344.6771 2 1344.6772 -0.0001 0 84.44 2.90E-08 R ALEEANTELEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4437.4437.2.dta 2 IPI00792629.1 18 kDa protein 83 18074 5 5 4 4 1188 3770 1 0 1 497.7151 993.4157 2 993.4192 -0.0034 0 23.27 0.0066 R DYSQYYR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3951.3951.2.dta 2 IPI00792629.1 18 kDa protein 83 18074 5 5 4 4 1511 2750 1 0 1 531.7527 1061.4909 2 1061.4924 -0.0014 0 44.39 0.00065 K ATMQNLNDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2768.2768.2.dta 2 IPI00792629.1 18 kDa protein 83 18074 5 5 4 4 1522 3928 1 0 0 355.5416 1063.603 3 1063.6026 0.0004 1 21.08 0.014 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4125.4125.3.dta 2 IPI00792629.1 18 kDa protein 83 18074 5 5 4 4 1578 1777 1 0 1 539.7505 1077.4864 2 1077.4873 -0.0009 0 19.83 0.022 K ATMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1692.1692.2.dta 2 IPI00792629.1 18 kDa protein 83 18074 5 5 4 4 5023 3219 1 0 1 629.643 1885.9072 3 1885.913 -0.0058 1 41.94 0.00012 R QFTSSSSIKGSSGLGGGSSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3290.3290.3.dta 2 IPI00550661.2 "Isoform 2 of Keratin, type I cytoskeletal 13" 82 38783 2 2 2 2 538 3605 1 0 1 412.2314 822.4482 2 822.4487 -0.0005 0 34.38 0.0006 R LASYLEK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3765.3765.2.dta 2 IPI00550661.2 "Isoform 2 of Keratin, type I cytoskeletal 13" 82 38783 2 2 2 2 2515 4153 1 0 0 651.3337 1300.6529 2 1300.651 0.0019 0 67.28 3.40E-06 R ALEEANADLEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4372.4372.2.dta 2 IPI00294649.5 keratin 35 81 51640 3 3 3 3 470 3740 1 0 0 404.204 806.3935 2 806.3923 0.0013 0 30.65 0.0032 K LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3918.3918.2.dta 2 IPI00294649.5 keratin 35 81 51640 3 3 3 3 1657 2968 1 0 1 547.2523 1092.4901 2 1092.487 0.0031 0 30.71 0.0097 K ETMQSLNDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3005.3005.2.dta 2 IPI00294649.5 keratin 35 81 51640 3 3 3 3 3412 5817 1 0 1 752.8946 1503.7746 2 1503.7681 0.0065 0 57.86 4.30E-06 R QNQEYQVLLDVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6383.6383.2.dta 2 IPI00789893.1 22 kDa protein 76 21912 2 2 2 2 470 3740 1 0 0 404.204 806.3935 2 806.3923 0.0013 0 30.65 0.0032 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3918.3918.2.dta 2 IPI00789893.1 22 kDa protein 76 21912 2 2 2 2 2515 4153 1 0 0 651.3337 1300.6529 2 1300.651 0.0019 0 67.28 3.40E-06 R ALEEANADLEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4372.4372.2.dta 2 IPI00291540.3 "Keratin, type I cuticular Ha2" 71 51769 2 2 2 2 470 3740 1 0 0 404.204 806.3935 2 806.3923 0.0013 0 30.65 0.0032 K LAADDFR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3918.3918.2.dta 2 IPI00291540.3 "Keratin, type I cuticular Ha2" 71 51769 2 2 2 2 3412 5817 1 0 1 752.8946 1503.7746 2 1503.7681 0.0065 0 57.86 4.30E-06 R QNQEYQVLLDVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6383.6383.2.dta 2 IPI00793909.1 19 kDa protein 67 19713 1 1 1 1 2515 4153 1 0 0 651.3337 1300.6529 2 1300.651 0.0019 0 67.28 3.40E-06 R ALEEANADLEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4372.4372.2.dta 2 IPI00418663.3 Keratin-28 66 53733 2 2 2 2 470 3740 1 0 0 404.204 806.3935 2 806.3923 0.0013 0 30.65 0.0032 R LAADDFR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3918.3918.2.dta 2 IPI00418663.3 Keratin-28 66 53733 2 2 2 2 1696 2070 1 0 0 553.7662 1105.5178 2 1105.5186 -0.0008 0 56.68 4.20E-05 K VTMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2017.2017.2.dta 2 IPI00329240.3 "Keratin, type I cuticular Ha7" 62 51084 2 2 2 2 470 3740 1 0 0 404.204 806.3935 2 806.3923 0.0013 0 30.65 0.0032 K LAADDFR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3918.3918.2.dta 2 IPI00329240.3 "Keratin, type I cuticular Ha7" 62 51084 2 2 2 2 1163 3131 1 0 1 494.7688 987.5231 2 987.5237 -0.0005 0 53.84 0.00011 R TIEELQQK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3193.3193.2.dta 2 IPI00304458.1 "Keratin, type I cytoskeletal 23" 61 48209 3 3 2 2 538 3605 1 0 1 412.2314 822.4482 2 822.4487 -0.0005 0 34.38 0.0006 R LASYLEK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3765.3765.2.dta 2 IPI00304458.1 "Keratin, type I cytoskeletal 23" 61 48209 3 3 2 2 1511 2750 1 0 1 531.7527 1061.4909 2 1061.4924 -0.0014 0 44.39 0.00065 K ATMQNLNDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2768.2768.2.dta 2 IPI00304458.1 "Keratin, type I cytoskeletal 23" 61 48209 3 3 2 2 1578 1777 1 0 1 539.7505 1077.4864 2 1077.4873 -0.0009 0 19.83 0.022 K ATMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1692.1692.2.dta 2 IPI00328103.2 Keratin-27 57 50419 1 1 1 1 1696 2070 1 0 0 553.7662 1105.5178 2 1105.5186 -0.0008 0 56.68 4.20E-05 K VTMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2017.2017.2.dta 2 IPI00743092.1 36 kDa protein 52 36504 2 2 2 2 2276 4394 1 0 1 622.8506 1243.6866 2 1243.6884 -0.0018 1 35.66 0.00078 R NLKASLENSLR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4636.4636.2.dta 2 IPI00743092.1 36 kDa protein 52 36504 2 2 2 2 5675 7730 1 0 1 731.729 2192.1652 3 2192.165 0.0002 1 35.07 0.0016 R LQLETEIEALKEELLFMK K Oxidation (M) 0.000000000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8833.8833.3.dta 2 IPI00788699.1 25 kDa protein 50 25020 1 1 1 1 1373 5337 1 0 0 515.3007 1028.5869 2 1028.5866 0.0003 0 50.26 0.00016 R VLDELTLAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5750.5750.2.dta 2 IPI00737922.1 "similar to Keratin, type I cytoskeletal 18" 42 9331 2 2 2 2 1181 1410 1 0 1 496.748 991.4815 2 991.4822 -0.0007 0 24.11 0.018 K VVSETNDTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1293.1293.2.dta 2 IPI00737922.1 "similar to Keratin, type I cytoskeletal 18" 42 9331 2 2 2 2 2276 4394 1 0 1 622.8506 1243.6866 2 1243.6884 -0.0018 1 35.66 0.00078 R NLKASLENSLR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4636.4636.2.dta 2 IPI00297641.1 "Keratin, type I cuticular Ha8" 38 52054 2 2 2 2 470 3740 1 0 0 404.204 806.3935 2 806.3923 0.0013 0 30.65 0.0032 K LAADDFR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3918.3918.2.dta 2 IPI00297641.1 "Keratin, type I cuticular Ha8" 38 52054 2 2 2 2 2822 4311 2 0 1 455.9088 1364.7044 3 1364.7048 -0.0004 1 29.16 0.025 K TRLENEIATYR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4544.4544.3.dta 2 IPI00248229.4 18 kDa protein 36 18515 1 1 1 1 2276 4394 1 0 1 622.8506 1243.6866 2 1243.6884 -0.0018 1 35.66 0.00078 R NLKASLENSLR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4636.4636.2.dta 2 IPI00552959.2 Keratin-40 34 50499 1 1 1 1 538 3605 1 0 1 412.2314 822.4482 2 822.4487 -0.0005 0 34.38 0.0006 R LASYLEK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3765.3765.2.dta 2 IPI00015309.1 "Keratin, type I cytoskeletal 12" 33 53592 2 2 2 2 1113 2563 1 0 1 325.8459 974.5158 3 974.5145 0.0013 1 31.55 0.01 K SEVTDLRR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2566.2566.3.dta 2 IPI00015309.1 "Keratin, type I cytoskeletal 12" 33 53592 2 2 2 2 1522 3928 1 0 0 355.5416 1063.603 3 1063.6026 0.0004 1 21.08 0.014 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4125.4125.3.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 698 42052 29 29 21 21 101 4891 1 1 1 322.7205 643.4264 2 643.4268 -0.0004 0 32.07 0.0039 R GILTLK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5217.5217.2.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 698 42052 29 29 21 21 436 3141 1 1 1 398.2399 794.4653 2 794.465 0.0003 0 27.7 0.011 K IIAPPER K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3204.3204.2.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 698 42052 29 29 21 21 829 2153 1 1 1 453.2289 904.4432 2 904.4436 -0.0004 1 35.01 0.0085 K CDVDIRK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2106.2106.2.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 698 42052 29 29 21 21 896 2416 1 1 1 462.2879 922.5612 2 922.56 0.0012 1 29 0.0061 K IIAPPERK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2403.2403.2.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 698 42052 29 29 21 21 1117 3001 1 1 1 488.7275 975.4405 2 975.441 -0.0005 0 71.36 6.50E-07 K AGFAGDDAPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3047.3047.2.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 698 42052 29 29 21 21 1229 6144 1 1 1 499.7469 997.4792 2 997.479 0.0001 0 32.62 0.0034 R DLTDYLMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6820.6820.2.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 698 42052 29 29 21 21 1394 3766 1 1 1 518.8276 1035.6406 2 1035.644 -0.0034 1 32.59 0.0012 K IKIIAPPER K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3947.3947.2.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 698 42052 29 29 21 21 1395 3765 1 1 1 346.2225 1035.6456 3 1035.644 0.0016 1 25.15 0.0069 K IKIIAPPER K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3946.3946.3.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 698 42052 29 29 21 21 1918 4553 1 1 1 581.3134 1160.6122 2 1160.6111 0.0011 0 39.78 0.0028 K EITALAPSTMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4807.4807.2.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 698 42052 29 29 21 21 1954 3060 1 1 1 586.2906 1170.5666 2 1170.5638 0.0028 0 68.15 4.10E-07 R HQGVMVGMGQK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3115.3115.2.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 698 42052 29 29 21 21 2009 2460 1 1 1 594.2858 1186.5571 2 1186.5587 -0.0016 0 16.45 0.029 R HQGVMVGMGQK D Oxidation (M) 0.00001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2450.2450.2.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 698 42052 29 29 21 21 2010 2071 1 1 1 594.2863 1186.558 2 1186.5587 -0.0008 0 34.51 0.00058 R HQGVMVGMGQK D Oxidation (M) 0.00000001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2018.2018.2.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 698 42052 29 29 21 21 2747 2252 1 1 1 677.8148 1353.615 2 1353.6161 -0.0011 1 51.73 1.70E-05 K DSYVGDEAQSKR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2214.2214.2.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 698 42052 29 29 21 21 2748 2254 1 1 1 452.2126 1353.616 3 1353.6161 0 1 44.37 0.00022 K DSYVGDEAQSKR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2217.2217.3.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 698 42052 29 29 21 21 3451 4300 1 1 1 505.9207 1514.7401 3 1514.7419 -0.0017 0 54.34 6.40E-05 K IWHHTFYNELR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4532.4532.3.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 698 42052 29 29 21 21 3455 3341 1 1 1 758.8536 1515.6926 2 1515.6954 -0.0028 0 59.46 2.70E-06 K QEYDESGPSIVHR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3449.3449.2.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 698 42052 29 29 21 21 3575 4268 1 1 1 516.9421 1547.8046 3 1547.8051 -0.0005 1 29.8 0.0066 R MQKEITALAPSTMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4496.4496.3.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 698 42052 29 29 21 21 3937 4889 1 1 1 815.4137 1628.8128 2 1628.8158 -0.003 1 27.03 0.0038 R GYSFTTTAEREIVR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5214.5214.2.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 698 42052 29 29 21 21 4567 4421 1 1 1 582.3008 1743.8805 3 1743.8792 0.0014 1 19.07 0.016 K ILTERGYSFTTTAER E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4665.4665.3.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 698 42052 29 29 21 21 4697 5642 1 1 1 895.9485 1789.8825 2 1789.8846 -0.0021 0 80.72 1.40E-07 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6125.6125.2.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 698 42052 29 29 21 21 4698 6003 1 1 1 597.6349 1789.883 3 1789.8846 -0.0016 0 47.04 0.00013 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6632.6632.3.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 698 42052 29 29 21 21 4699 5971 1 1 1 895.9489 1789.8833 2 1789.8846 -0.0014 0 76.37 3.80E-07 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6595.6595.2.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 698 42052 29 29 21 21 5259 5130 1 1 1 652.026 1953.0562 3 1953.0571 -0.0009 0 41.78 0.0005 R VAPEEHPVLLTEAPLNPK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5505.5505.3.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 698 42052 29 29 21 21 6161 3564 1 1 1 784.3683 2350.083 3 2350.0682 0.0148 1 22.1 0.0085 R HQGVMVGMGQKDSYVGDEAQSK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3718.3718.3.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 698 42052 29 29 21 21 6720 7343 1 1 1 1275.5906 2549.1666 2 2549.1665 0.0001 0 71.4 2.00E-07 K LCYVALDFEQEMATAASSSSLEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8346.8346.2.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 698 42052 29 29 21 21 6721 7338 1 1 1 850.7326 2549.176 3 2549.1665 0.0095 0 72.92 1.50E-07 K LCYVALDFEQEMATAASSSSLEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8339.8339.3.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 698 42052 29 29 21 21 7583 7150 1 1 1 936.4398 2806.2976 3 2806.3041 -0.0064 1 17.59 0.022 K EKLCYVALDFEQEMATAASSSSLEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8114.8114.3.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 698 42052 29 29 21 21 8171 6218 1 1 1 1061.873 3182.5973 3 3182.6071 -0.0097 0 34.61 0.00057 R TTGIVMDSGDGVTHTVPIYEGYALPHAILR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6928.6928.3.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 698 42052 29 29 21 21 8172 6222 1 1 1 796.6592 3182.6076 4 3182.6071 0.0006 0 29.63 0.0017 R TTGIVMDSGDGVTHTVPIYEGYALPHAILR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6933.6933.4.dta 3 IPI00021428.1 "Actin, alpha skeletal muscle" 461 42366 19 19 13 13 101 4891 1 0 1 322.7205 643.4264 2 643.4268 -0.0004 0 32.07 0.0039 R GILTLK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5217.5217.2.dta 3 IPI00021428.1 "Actin, alpha skeletal muscle" 461 42366 19 19 13 13 436 3141 1 0 1 398.2399 794.4653 2 794.465 0.0003 0 27.7 0.011 K IIAPPER K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3204.3204.2.dta 3 IPI00021428.1 "Actin, alpha skeletal muscle" 461 42366 19 19 13 13 896 2416 1 0 1 462.2879 922.5612 2 922.56 0.0012 1 29 0.0061 K IIAPPERK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2403.2403.2.dta 3 IPI00021428.1 "Actin, alpha skeletal muscle" 461 42366 19 19 13 13 1117 3001 1 0 1 488.7275 975.4405 2 975.441 -0.0005 0 71.36 6.50E-07 K AGFAGDDAPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3047.3047.2.dta 3 IPI00021428.1 "Actin, alpha skeletal muscle" 461 42366 19 19 13 13 1229 6144 1 0 1 499.7469 997.4792 2 997.479 0.0001 0 32.62 0.0034 R DLTDYLMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6820.6820.2.dta 3 IPI00021428.1 "Actin, alpha skeletal muscle" 461 42366 19 19 13 13 1394 3766 1 0 1 518.8276 1035.6406 2 1035.644 -0.0034 1 32.59 0.0012 K IKIIAPPER K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3947.3947.2.dta 3 IPI00021428.1 "Actin, alpha skeletal muscle" 461 42366 19 19 13 13 1395 3765 1 0 1 346.2225 1035.6456 3 1035.644 0.0016 1 25.15 0.0069 K IKIIAPPER K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3946.3946.3.dta 3 IPI00021428.1 "Actin, alpha skeletal muscle" 461 42366 19 19 13 13 1918 4553 1 0 1 581.3134 1160.6122 2 1160.6111 0.0011 0 39.78 0.0028 K EITALAPSTMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4807.4807.2.dta 3 IPI00021428.1 "Actin, alpha skeletal muscle" 461 42366 19 19 13 13 1954 3060 1 0 1 586.2906 1170.5666 2 1170.5638 0.0028 0 68.15 4.10E-07 R HQGVMVGMGQK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3115.3115.2.dta 3 IPI00021428.1 "Actin, alpha skeletal muscle" 461 42366 19 19 13 13 2009 2460 1 0 1 594.2858 1186.5571 2 1186.5587 -0.0016 0 16.45 0.029 R HQGVMVGMGQK D Oxidation (M) 0.00001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2450.2450.2.dta 3 IPI00021428.1 "Actin, alpha skeletal muscle" 461 42366 19 19 13 13 2010 2071 1 0 1 594.2863 1186.558 2 1186.5587 -0.0008 0 34.51 0.00058 R HQGVMVGMGQK D Oxidation (M) 0.00000001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2018.2018.2.dta 3 IPI00021428.1 "Actin, alpha skeletal muscle" 461 42366 19 19 13 13 2747 2252 1 0 1 677.8148 1353.615 2 1353.6161 -0.0011 1 51.73 1.70E-05 K DSYVGDEAQSKR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2214.2214.2.dta 3 IPI00021428.1 "Actin, alpha skeletal muscle" 461 42366 19 19 13 13 2748 2254 1 0 1 452.2126 1353.616 3 1353.6161 0 1 44.37 0.00022 K DSYVGDEAQSKR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2217.2217.3.dta 3 IPI00021428.1 "Actin, alpha skeletal muscle" 461 42366 19 19 13 13 3451 4300 1 0 1 505.9207 1514.7401 3 1514.7419 -0.0017 0 54.34 6.40E-05 K IWHHTFYNELR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4532.4532.3.dta 3 IPI00021428.1 "Actin, alpha skeletal muscle" 461 42366 19 19 13 13 3575 4268 1 0 1 516.9421 1547.8046 3 1547.8051 -0.0005 1 29.8 0.0066 R MQKEITALAPSTMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4496.4496.3.dta 3 IPI00021428.1 "Actin, alpha skeletal muscle" 461 42366 19 19 13 13 4697 5642 1 0 1 895.9485 1789.8825 2 1789.8846 -0.0021 0 80.72 1.40E-07 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6125.6125.2.dta 3 IPI00021428.1 "Actin, alpha skeletal muscle" 461 42366 19 19 13 13 4698 6003 1 0 1 597.6349 1789.883 3 1789.8846 -0.0016 0 47.04 0.00013 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6632.6632.3.dta 3 IPI00021428.1 "Actin, alpha skeletal muscle" 461 42366 19 19 13 13 4699 5971 1 0 1 895.9489 1789.8833 2 1789.8846 -0.0014 0 76.37 3.80E-07 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6595.6595.2.dta 3 IPI00021428.1 "Actin, alpha skeletal muscle" 461 42366 19 19 13 13 6161 3564 1 0 1 784.3683 2350.083 3 2350.0682 0.0148 1 22.1 0.0085 R HQGVMVGMGQKDSYVGDEAQSK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3718.3718.3.dta 3 IPI00515047.1 "Actin, alpha 1, skeletal muscle" 448 32370 18 18 12 12 101 4891 1 0 1 322.7205 643.4264 2 643.4268 -0.0004 0 32.07 0.0039 R GILTLK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5217.5217.2.dta 3 IPI00515047.1 "Actin, alpha 1, skeletal muscle" 448 32370 18 18 12 12 436 3141 1 0 1 398.2399 794.4653 2 794.465 0.0003 0 27.7 0.011 K IIAPPER K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3204.3204.2.dta 3 IPI00515047.1 "Actin, alpha 1, skeletal muscle" 448 32370 18 18 12 12 896 2416 1 0 1 462.2879 922.5612 2 922.56 0.0012 1 29 0.0061 K IIAPPERK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2403.2403.2.dta 3 IPI00515047.1 "Actin, alpha 1, skeletal muscle" 448 32370 18 18 12 12 1117 3001 1 0 1 488.7275 975.4405 2 975.441 -0.0005 0 71.36 6.50E-07 K AGFAGDDAPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3047.3047.2.dta 3 IPI00515047.1 "Actin, alpha 1, skeletal muscle" 448 32370 18 18 12 12 1394 3766 1 0 1 518.8276 1035.6406 2 1035.644 -0.0034 1 32.59 0.0012 K IKIIAPPER K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3947.3947.2.dta 3 IPI00515047.1 "Actin, alpha 1, skeletal muscle" 448 32370 18 18 12 12 1395 3765 1 0 1 346.2225 1035.6456 3 1035.644 0.0016 1 25.15 0.0069 K IKIIAPPER K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3946.3946.3.dta 3 IPI00515047.1 "Actin, alpha 1, skeletal muscle" 448 32370 18 18 12 12 1918 4553 1 0 1 581.3134 1160.6122 2 1160.6111 0.0011 0 39.78 0.0028 K EITALAPSTMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4807.4807.2.dta 3 IPI00515047.1 "Actin, alpha 1, skeletal muscle" 448 32370 18 18 12 12 1954 3060 1 0 1 586.2906 1170.5666 2 1170.5638 0.0028 0 68.15 4.10E-07 R HQGVMVGMGQK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3115.3115.2.dta 3 IPI00515047.1 "Actin, alpha 1, skeletal muscle" 448 32370 18 18 12 12 2009 2460 1 0 1 594.2858 1186.5571 2 1186.5587 -0.0016 0 16.45 0.029 R HQGVMVGMGQK D Oxidation (M) 0.00001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2450.2450.2.dta 3 IPI00515047.1 "Actin, alpha 1, skeletal muscle" 448 32370 18 18 12 12 2010 2071 1 0 1 594.2863 1186.558 2 1186.5587 -0.0008 0 34.51 0.00058 R HQGVMVGMGQK D Oxidation (M) 0.00000001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2018.2018.2.dta 3 IPI00515047.1 "Actin, alpha 1, skeletal muscle" 448 32370 18 18 12 12 2747 2252 1 0 1 677.8148 1353.615 2 1353.6161 -0.0011 1 51.73 1.70E-05 K DSYVGDEAQSKR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2214.2214.2.dta 3 IPI00515047.1 "Actin, alpha 1, skeletal muscle" 448 32370 18 18 12 12 2748 2254 1 0 1 452.2126 1353.616 3 1353.6161 0 1 44.37 0.00022 K DSYVGDEAQSKR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2217.2217.3.dta 3 IPI00515047.1 "Actin, alpha 1, skeletal muscle" 448 32370 18 18 12 12 3451 4300 1 0 1 505.9207 1514.7401 3 1514.7419 -0.0017 0 54.34 6.40E-05 K IWHHTFYNELR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4532.4532.3.dta 3 IPI00515047.1 "Actin, alpha 1, skeletal muscle" 448 32370 18 18 12 12 3575 4268 1 0 1 516.9421 1547.8046 3 1547.8051 -0.0005 1 29.8 0.0066 R MQKEITALAPSTMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4496.4496.3.dta 3 IPI00515047.1 "Actin, alpha 1, skeletal muscle" 448 32370 18 18 12 12 4697 5642 1 0 1 895.9485 1789.8825 2 1789.8846 -0.0021 0 80.72 1.40E-07 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6125.6125.2.dta 3 IPI00515047.1 "Actin, alpha 1, skeletal muscle" 448 32370 18 18 12 12 4698 6003 1 0 1 597.6349 1789.883 3 1789.8846 -0.0016 0 47.04 0.00013 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6632.6632.3.dta 3 IPI00515047.1 "Actin, alpha 1, skeletal muscle" 448 32370 18 18 12 12 4699 5971 1 0 1 895.9489 1789.8833 2 1789.8846 -0.0014 0 76.37 3.80E-07 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6595.6595.2.dta 3 IPI00515047.1 "Actin, alpha 1, skeletal muscle" 448 32370 18 18 12 12 6161 3564 1 0 1 784.3683 2350.083 3 2350.0682 0.0148 1 22.1 0.0085 R HQGVMVGMGQKDSYVGDEAQSK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3718.3718.3.dta 3 IPI00794523.2 ACTG1 protein 446 28478 19 19 14 14 436 3141 1 0 1 398.2399 794.4653 2 794.465 0.0003 0 27.7 0.011 K IIAPPER K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3204.3204.2.dta 3 IPI00794523.2 ACTG1 protein 446 28478 19 19 14 14 829 2153 1 0 1 453.2289 904.4432 2 904.4436 -0.0004 1 35.01 0.0085 K CDVDIRK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2106.2106.2.dta 3 IPI00794523.2 ACTG1 protein 446 28478 19 19 14 14 896 2416 1 0 1 462.2879 922.5612 2 922.56 0.0012 1 29 0.0061 K IIAPPERK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2403.2403.2.dta 3 IPI00794523.2 ACTG1 protein 446 28478 19 19 14 14 1229 6144 1 0 1 499.7469 997.4792 2 997.479 0.0001 0 32.62 0.0034 R DLTDYLMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6820.6820.2.dta 3 IPI00794523.2 ACTG1 protein 446 28478 19 19 14 14 1394 3766 1 0 1 518.8276 1035.6406 2 1035.644 -0.0034 1 32.59 0.0012 K IKIIAPPER K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3947.3947.2.dta 3 IPI00794523.2 ACTG1 protein 446 28478 19 19 14 14 1395 3765 1 0 1 346.2225 1035.6456 3 1035.644 0.0016 1 25.15 0.0069 K IKIIAPPER K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3946.3946.3.dta 3 IPI00794523.2 ACTG1 protein 446 28478 19 19 14 14 1918 4553 1 0 1 581.3134 1160.6122 2 1160.6111 0.0011 0 39.78 0.0028 K EITALAPSTMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4807.4807.2.dta 3 IPI00794523.2 ACTG1 protein 446 28478 19 19 14 14 3455 3341 1 0 1 758.8536 1515.6926 2 1515.6954 -0.0028 0 59.46 2.70E-06 K QEYDESGPSIVHR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3449.3449.2.dta 3 IPI00794523.2 ACTG1 protein 446 28478 19 19 14 14 3575 4268 1 0 1 516.9421 1547.8046 3 1547.8051 -0.0005 1 29.8 0.0066 R MQKEITALAPSTMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4496.4496.3.dta 3 IPI00794523.2 ACTG1 protein 446 28478 19 19 14 14 3937 4889 1 0 1 815.4137 1628.8128 2 1628.8158 -0.003 1 27.03 0.0038 R GYSFTTTAEREIVR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5214.5214.2.dta 3 IPI00794523.2 ACTG1 protein 446 28478 19 19 14 14 4567 4421 1 0 1 582.3008 1743.8805 3 1743.8792 0.0014 1 19.07 0.016 K ILTERGYSFTTTAER E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4665.4665.3.dta 3 IPI00794523.2 ACTG1 protein 446 28478 19 19 14 14 4697 5642 1 0 1 895.9485 1789.8825 2 1789.8846 -0.0021 0 80.72 1.40E-07 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6125.6125.2.dta 3 IPI00794523.2 ACTG1 protein 446 28478 19 19 14 14 4698 6003 1 0 1 597.6349 1789.883 3 1789.8846 -0.0016 0 47.04 0.00013 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6632.6632.3.dta 3 IPI00794523.2 ACTG1 protein 446 28478 19 19 14 14 4699 5971 1 0 1 895.9489 1789.8833 2 1789.8846 -0.0014 0 76.37 3.80E-07 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6595.6595.2.dta 3 IPI00794523.2 ACTG1 protein 446 28478 19 19 14 14 6720 7343 1 0 1 1275.5906 2549.1666 2 2549.1665 0.0001 0 71.4 2.00E-07 K LCYVALDFEQEMATAASSSSLEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8346.8346.2.dta 3 IPI00794523.2 ACTG1 protein 446 28478 19 19 14 14 6721 7338 1 0 1 850.7326 2549.176 3 2549.1665 0.0095 0 72.92 1.50E-07 K LCYVALDFEQEMATAASSSSLEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8339.8339.3.dta 3 IPI00794523.2 ACTG1 protein 446 28478 19 19 14 14 7583 7150 1 0 1 936.4398 2806.2976 3 2806.3041 -0.0064 1 17.59 0.022 K EKLCYVALDFEQEMATAASSSSLEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8114.8114.3.dta 3 IPI00794523.2 ACTG1 protein 446 28478 19 19 14 14 8171 6218 1 0 1 1061.873 3182.5973 3 3182.6071 -0.0097 0 34.61 0.00057 R TTGIVMDSGDGVTHTVPIYEGYALPHAILR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6928.6928.3.dta 3 IPI00794523.2 ACTG1 protein 446 28478 19 19 14 14 8172 6222 1 0 1 796.6592 3182.6076 4 3182.6071 0.0006 0 29.63 0.0017 R TTGIVMDSGDGVTHTVPIYEGYALPHAILR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6933.6933.4.dta 3 IPI00008603.1 "Actin, aortic smooth muscle" 431 42381 18 18 12 12 101 4891 1 0 1 322.7205 643.4264 2 643.4268 -0.0004 0 32.07 0.0039 R GILTLK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5217.5217.2.dta 3 IPI00008603.1 "Actin, aortic smooth muscle" 431 42381 18 18 12 12 436 3141 1 0 1 398.2399 794.4653 2 794.465 0.0003 0 27.7 0.011 K IIAPPER K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3204.3204.2.dta 3 IPI00008603.1 "Actin, aortic smooth muscle" 431 42381 18 18 12 12 896 2416 1 0 1 462.2879 922.5612 2 922.56 0.0012 1 29 0.0061 K IIAPPERK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2403.2403.2.dta 3 IPI00008603.1 "Actin, aortic smooth muscle" 431 42381 18 18 12 12 1117 3001 1 0 1 488.7275 975.4405 2 975.441 -0.0005 0 71.36 6.50E-07 K AGFAGDDAPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3047.3047.2.dta 3 IPI00008603.1 "Actin, aortic smooth muscle" 431 42381 18 18 12 12 1229 6144 1 0 1 499.7469 997.4792 2 997.479 0.0001 0 32.62 0.0034 R DLTDYLMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6820.6820.2.dta 3 IPI00008603.1 "Actin, aortic smooth muscle" 431 42381 18 18 12 12 1394 3766 1 0 1 518.8276 1035.6406 2 1035.644 -0.0034 1 32.59 0.0012 K IKIIAPPER K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3947.3947.2.dta 3 IPI00008603.1 "Actin, aortic smooth muscle" 431 42381 18 18 12 12 1395 3765 1 0 1 346.2225 1035.6456 3 1035.644 0.0016 1 25.15 0.0069 K IKIIAPPER K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3946.3946.3.dta 3 IPI00008603.1 "Actin, aortic smooth muscle" 431 42381 18 18 12 12 1918 4553 1 0 1 581.3134 1160.6122 2 1160.6111 0.0011 0 39.78 0.0028 K EITALAPSTMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4807.4807.2.dta 3 IPI00008603.1 "Actin, aortic smooth muscle" 431 42381 18 18 12 12 1954 3060 1 0 1 586.2906 1170.5666 2 1170.5638 0.0028 0 68.15 4.10E-07 R HQGVMVGMGQK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3115.3115.2.dta 3 IPI00008603.1 "Actin, aortic smooth muscle" 431 42381 18 18 12 12 2009 2460 1 0 1 594.2858 1186.5571 2 1186.5587 -0.0016 0 16.45 0.029 R HQGVMVGMGQK D Oxidation (M) 0.00001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2450.2450.2.dta 3 IPI00008603.1 "Actin, aortic smooth muscle" 431 42381 18 18 12 12 2010 2071 1 0 1 594.2863 1186.558 2 1186.5587 -0.0008 0 34.51 0.00058 R HQGVMVGMGQK D Oxidation (M) 0.00000001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2018.2018.2.dta 3 IPI00008603.1 "Actin, aortic smooth muscle" 431 42381 18 18 12 12 2747 2252 1 0 1 677.8148 1353.615 2 1353.6161 -0.0011 1 51.73 1.70E-05 K DSYVGDEAQSKR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2214.2214.2.dta 3 IPI00008603.1 "Actin, aortic smooth muscle" 431 42381 18 18 12 12 2748 2254 1 0 1 452.2126 1353.616 3 1353.6161 0 1 44.37 0.00022 K DSYVGDEAQSKR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2217.2217.3.dta 3 IPI00008603.1 "Actin, aortic smooth muscle" 431 42381 18 18 12 12 3575 4268 1 0 1 516.9421 1547.8046 3 1547.8051 -0.0005 1 29.8 0.0066 R MQKEITALAPSTMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4496.4496.3.dta 3 IPI00008603.1 "Actin, aortic smooth muscle" 431 42381 18 18 12 12 4697 5642 1 0 1 895.9485 1789.8825 2 1789.8846 -0.0021 0 80.72 1.40E-07 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6125.6125.2.dta 3 IPI00008603.1 "Actin, aortic smooth muscle" 431 42381 18 18 12 12 4698 6003 1 0 1 597.6349 1789.883 3 1789.8846 -0.0016 0 47.04 0.00013 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6632.6632.3.dta 3 IPI00008603.1 "Actin, aortic smooth muscle" 431 42381 18 18 12 12 4699 5971 1 0 1 895.9489 1789.8833 2 1789.8846 -0.0014 0 76.37 3.80E-07 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6595.6595.2.dta 3 IPI00008603.1 "Actin, aortic smooth muscle" 431 42381 18 18 12 12 6161 3564 1 0 1 784.3683 2350.083 3 2350.0682 0.0148 1 22.1 0.0085 R HQGVMVGMGQKDSYVGDEAQSK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3718.3718.3.dta 3 IPI00816229.1 ACTA2 protein (Fragment) 322 37125 11 11 7 7 101 4891 1 0 1 322.7205 643.4264 2 643.4268 -0.0004 0 32.07 0.0039 R GILTLK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5217.5217.2.dta 3 IPI00816229.1 ACTA2 protein (Fragment) 322 37125 11 11 7 7 1117 3001 1 0 1 488.7275 975.4405 2 975.441 -0.0005 0 71.36 6.50E-07 K AGFAGDDAPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3047.3047.2.dta 3 IPI00816229.1 ACTA2 protein (Fragment) 322 37125 11 11 7 7 1229 6144 1 0 1 499.7469 997.4792 2 997.479 0.0001 0 32.62 0.0034 R DLTDYLMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6820.6820.2.dta 3 IPI00816229.1 ACTA2 protein (Fragment) 322 37125 11 11 7 7 1918 4553 1 0 1 581.3134 1160.6122 2 1160.6111 0.0011 0 39.78 0.0028 K EITALAPSTMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4807.4807.2.dta 3 IPI00816229.1 ACTA2 protein (Fragment) 322 37125 11 11 7 7 1954 3060 1 0 1 586.2906 1170.5666 2 1170.5638 0.0028 0 68.15 4.10E-07 R HQGVMVGMGQK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3115.3115.2.dta 3 IPI00816229.1 ACTA2 protein (Fragment) 322 37125 11 11 7 7 2009 2460 1 0 1 594.2858 1186.5571 2 1186.5587 -0.0016 0 16.45 0.029 R HQGVMVGMGQK D Oxidation (M) 0.00001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2450.2450.2.dta 3 IPI00816229.1 ACTA2 protein (Fragment) 322 37125 11 11 7 7 2010 2071 1 0 1 594.2863 1186.558 2 1186.5587 -0.0008 0 34.51 0.00058 R HQGVMVGMGQK D Oxidation (M) 0.00000001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2018.2018.2.dta 3 IPI00816229.1 ACTA2 protein (Fragment) 322 37125 11 11 7 7 3575 4268 1 0 1 516.9421 1547.8046 3 1547.8051 -0.0005 1 29.8 0.0066 R MQKEITALAPSTMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4496.4496.3.dta 3 IPI00816229.1 ACTA2 protein (Fragment) 322 37125 11 11 7 7 4697 5642 1 0 1 895.9485 1789.8825 2 1789.8846 -0.0021 0 80.72 1.40E-07 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6125.6125.2.dta 3 IPI00816229.1 ACTA2 protein (Fragment) 322 37125 11 11 7 7 4698 6003 1 0 1 597.6349 1789.883 3 1789.8846 -0.0016 0 47.04 0.00013 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6632.6632.3.dta 3 IPI00816229.1 ACTA2 protein (Fragment) 322 37125 11 11 7 7 4699 5971 1 0 1 895.9489 1789.8833 2 1789.8846 -0.0014 0 76.37 3.80E-07 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6595.6595.2.dta 3 IPI00414057.2 Actin alpha 1 skeletal muscle protein 314 28454 15 15 11 11 101 4891 1 0 1 322.7205 643.4264 2 643.4268 -0.0004 0 32.07 0.0039 R GILTLK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5217.5217.2.dta 3 IPI00414057.2 Actin alpha 1 skeletal muscle protein 314 28454 15 15 11 11 436 3141 1 0 1 398.2399 794.4653 2 794.465 0.0003 0 27.7 0.011 K IIAPPER K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3204.3204.2.dta 3 IPI00414057.2 Actin alpha 1 skeletal muscle protein 314 28454 15 15 11 11 896 2416 1 0 1 462.2879 922.5612 2 922.56 0.0012 1 29 0.0061 K IIAPPERK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2403.2403.2.dta 3 IPI00414057.2 Actin alpha 1 skeletal muscle protein 314 28454 15 15 11 11 1117 3001 1 0 1 488.7275 975.4405 2 975.441 -0.0005 0 71.36 6.50E-07 K AGFAGDDAPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3047.3047.2.dta 3 IPI00414057.2 Actin alpha 1 skeletal muscle protein 314 28454 15 15 11 11 1394 3766 1 0 1 518.8276 1035.6406 2 1035.644 -0.0034 1 32.59 0.0012 K IKIIAPPER K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3947.3947.2.dta 3 IPI00414057.2 Actin alpha 1 skeletal muscle protein 314 28454 15 15 11 11 1395 3765 1 0 1 346.2225 1035.6456 3 1035.644 0.0016 1 25.15 0.0069 K IKIIAPPER K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3946.3946.3.dta 3 IPI00414057.2 Actin alpha 1 skeletal muscle protein 314 28454 15 15 11 11 1918 4553 1 0 1 581.3134 1160.6122 2 1160.6111 0.0011 0 39.78 0.0028 K EITALAPSTMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4807.4807.2.dta 3 IPI00414057.2 Actin alpha 1 skeletal muscle protein 314 28454 15 15 11 11 1954 3060 1 0 1 586.2906 1170.5666 2 1170.5638 0.0028 0 68.15 4.10E-07 R HQGVMVGMGQK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3115.3115.2.dta 3 IPI00414057.2 Actin alpha 1 skeletal muscle protein 314 28454 15 15 11 11 2009 2460 1 0 1 594.2858 1186.5571 2 1186.5587 -0.0016 0 16.45 0.029 R HQGVMVGMGQK D Oxidation (M) 0.00001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2450.2450.2.dta 3 IPI00414057.2 Actin alpha 1 skeletal muscle protein 314 28454 15 15 11 11 2010 2071 1 0 1 594.2863 1186.558 2 1186.5587 -0.0008 0 34.51 0.00058 R HQGVMVGMGQK D Oxidation (M) 0.00000001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2018.2018.2.dta 3 IPI00414057.2 Actin alpha 1 skeletal muscle protein 314 28454 15 15 11 11 2747 2252 1 0 1 677.8148 1353.615 2 1353.6161 -0.0011 1 51.73 1.70E-05 K DSYVGDEAQSKR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2214.2214.2.dta 3 IPI00414057.2 Actin alpha 1 skeletal muscle protein 314 28454 15 15 11 11 2748 2254 1 0 1 452.2126 1353.616 3 1353.6161 0 1 44.37 0.00022 K DSYVGDEAQSKR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2217.2217.3.dta 3 IPI00414057.2 Actin alpha 1 skeletal muscle protein 314 28454 15 15 11 11 3451 4300 1 0 1 505.9207 1514.7401 3 1514.7419 -0.0017 0 54.34 6.40E-05 K IWHHTFYNELR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4532.4532.3.dta 3 IPI00414057.2 Actin alpha 1 skeletal muscle protein 314 28454 15 15 11 11 3575 4268 1 0 1 516.9421 1547.8046 3 1547.8051 -0.0005 1 29.8 0.0066 R MQKEITALAPSTMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4496.4496.3.dta 3 IPI00414057.2 Actin alpha 1 skeletal muscle protein 314 28454 15 15 11 11 6161 3564 1 0 1 784.3683 2350.083 3 2350.0682 0.0148 1 22.1 0.0085 R HQGVMVGMGQKDSYVGDEAQSK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3718.3718.3.dta 3 IPI00003269.1 hypothetical protein LOC345651 307 42318 13 13 8 8 436 3141 1 0 1 398.2399 794.4653 2 794.465 0.0003 0 27.7 0.011 K IIAPPER K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3204.3204.2.dta 3 IPI00003269.1 hypothetical protein LOC345651 307 42318 13 13 8 8 829 2153 1 0 1 453.2289 904.4432 2 904.4436 -0.0004 1 35.01 0.0085 K CDVDIRK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2106.2106.2.dta 3 IPI00003269.1 hypothetical protein LOC345651 307 42318 13 13 8 8 896 2416 1 0 1 462.2879 922.5612 2 922.56 0.0012 1 29 0.0061 K IIAPPERK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2403.2403.2.dta 3 IPI00003269.1 hypothetical protein LOC345651 307 42318 13 13 8 8 1229 6144 1 0 1 499.7469 997.4792 2 997.479 0.0001 0 32.62 0.0034 R DLTDYLMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6820.6820.2.dta 3 IPI00003269.1 hypothetical protein LOC345651 307 42318 13 13 8 8 1394 3766 1 0 1 518.8276 1035.6406 2 1035.644 -0.0034 1 32.59 0.0012 K IKIIAPPER K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3947.3947.2.dta 3 IPI00003269.1 hypothetical protein LOC345651 307 42318 13 13 8 8 1395 3765 1 0 1 346.2225 1035.6456 3 1035.644 0.0016 1 25.15 0.0069 K IKIIAPPER K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3946.3946.3.dta 3 IPI00003269.1 hypothetical protein LOC345651 307 42318 13 13 8 8 1954 3060 1 0 1 586.2906 1170.5666 2 1170.5638 0.0028 0 68.15 4.10E-07 R HQGVMVGMGQK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3115.3115.2.dta 3 IPI00003269.1 hypothetical protein LOC345651 307 42318 13 13 8 8 2009 2460 1 0 1 594.2858 1186.5571 2 1186.5587 -0.0016 0 16.45 0.029 R HQGVMVGMGQK D Oxidation (M) 0.00001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2450.2450.2.dta 3 IPI00003269.1 hypothetical protein LOC345651 307 42318 13 13 8 8 2010 2071 1 0 1 594.2863 1186.558 2 1186.5587 -0.0008 0 34.51 0.00058 R HQGVMVGMGQK D Oxidation (M) 0.00000001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2018.2018.2.dta 3 IPI00003269.1 hypothetical protein LOC345651 307 42318 13 13 8 8 4697 5642 1 0 1 895.9485 1789.8825 2 1789.8846 -0.0021 0 80.72 1.40E-07 R SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6125.6125.2.dta 3 IPI00003269.1 hypothetical protein LOC345651 307 42318 13 13 8 8 4698 6003 1 0 1 597.6349 1789.883 3 1789.8846 -0.0016 0 47.04 0.00013 R SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6632.6632.3.dta 3 IPI00003269.1 hypothetical protein LOC345651 307 42318 13 13 8 8 4699 5971 1 0 1 895.9489 1789.8833 2 1789.8846 -0.0014 0 76.37 3.80E-07 R SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6595.6595.2.dta 3 IPI00003269.1 hypothetical protein LOC345651 307 42318 13 13 8 8 5259 5130 2 0 1 652.026 1953.0562 3 1953.0571 -0.0009 0 38.84 0.00098 R VAPDEHPILLTEAPLNPK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5505.5505.3.dta 3 IPI00739539.2 "similar to Prostate, ovary, testis expressed protein on chromosome 2" 289 123020 7 7 5 5 101 4891 1 0 1 322.7205 643.4264 2 643.4268 -0.0004 0 32.07 0.0039 R GILTLK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5217.5217.2.dta 3 IPI00739539.2 "similar to Prostate, ovary, testis expressed protein on chromosome 2" 289 123020 7 7 5 5 1117 3001 1 0 1 488.7275 975.4405 2 975.441 -0.0005 0 71.36 6.50E-07 K AGFAGDDAPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3047.3047.2.dta 3 IPI00739539.2 "similar to Prostate, ovary, testis expressed protein on chromosome 2" 289 123020 7 7 5 5 3451 4300 1 0 1 505.9207 1514.7401 3 1514.7419 -0.0017 0 54.34 6.40E-05 K IWHHTFYNELR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4532.4532.3.dta 3 IPI00739539.2 "similar to Prostate, ovary, testis expressed protein on chromosome 2" 289 123020 7 7 5 5 3455 3341 1 0 1 758.8536 1515.6926 2 1515.6954 -0.0028 0 59.46 2.70E-06 K QEYDESGPSIVHR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3449.3449.2.dta 3 IPI00739539.2 "similar to Prostate, ovary, testis expressed protein on chromosome 2" 289 123020 7 7 5 5 4697 5642 1 0 1 895.9485 1789.8825 2 1789.8846 -0.0021 0 80.72 1.40E-07 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6125.6125.2.dta 3 IPI00739539.2 "similar to Prostate, ovary, testis expressed protein on chromosome 2" 289 123020 7 7 5 5 4698 6003 1 0 1 597.6349 1789.883 3 1789.8846 -0.0016 0 47.04 0.00013 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6632.6632.3.dta 3 IPI00739539.2 "similar to Prostate, ovary, testis expressed protein on chromosome 2" 289 123020 7 7 5 5 4699 5971 1 0 1 895.9489 1789.8833 2 1789.8846 -0.0014 0 76.37 3.80E-07 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6595.6595.2.dta 3 IPI00790339.1 22 kDa protein 270 22189 10 10 7 7 101 4891 1 0 1 322.7205 643.4264 2 643.4268 -0.0004 0 32.07 0.0039 R GILTLK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5217.5217.2.dta 3 IPI00790339.1 22 kDa protein 270 22189 10 10 7 7 1117 3001 1 0 1 488.7275 975.4405 2 975.441 -0.0005 0 71.36 6.50E-07 K AGFAGDDAPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3047.3047.2.dta 3 IPI00790339.1 22 kDa protein 270 22189 10 10 7 7 1954 3060 1 0 1 586.2906 1170.5666 2 1170.5638 0.0028 0 68.15 4.10E-07 R HQGVMVGMGQK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3115.3115.2.dta 3 IPI00790339.1 22 kDa protein 270 22189 10 10 7 7 2009 2460 1 0 1 594.2858 1186.5571 2 1186.5587 -0.0016 0 16.45 0.029 R HQGVMVGMGQK D Oxidation (M) 0.00001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2450.2450.2.dta 3 IPI00790339.1 22 kDa protein 270 22189 10 10 7 7 2010 2071 1 0 1 594.2863 1186.558 2 1186.5587 -0.0008 0 34.51 0.00058 R HQGVMVGMGQK D Oxidation (M) 0.00000001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2018.2018.2.dta 3 IPI00790339.1 22 kDa protein 270 22189 10 10 7 7 2747 2252 1 0 1 677.8148 1353.615 2 1353.6161 -0.0011 1 51.73 1.70E-05 K DSYVGDEAQSKR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2214.2214.2.dta 3 IPI00790339.1 22 kDa protein 270 22189 10 10 7 7 2748 2254 1 0 1 452.2126 1353.616 3 1353.6161 0 1 44.37 0.00022 K DSYVGDEAQSKR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2217.2217.3.dta 3 IPI00790339.1 22 kDa protein 270 22189 10 10 7 7 3451 4300 1 0 1 505.9207 1514.7401 3 1514.7419 -0.0017 0 54.34 6.40E-05 K IWHHTFYNELR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4532.4532.3.dta 3 IPI00790339.1 22 kDa protein 270 22189 10 10 7 7 5259 5130 1 0 1 652.026 1953.0562 3 1953.0571 -0.0009 0 41.78 0.0005 R VAPEEHPVLLTEAPLNPK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5505.5505.3.dta 3 IPI00790339.1 22 kDa protein 270 22189 10 10 7 7 6161 3564 1 0 1 784.3683 2350.083 3 2350.0682 0.0148 1 22.1 0.0085 R HQGVMVGMGQKDSYVGDEAQSK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3718.3718.3.dta 3 IPI00555900.1 FKSG30 228 42331 5 5 3 3 3451 4300 1 0 1 505.9207 1514.7401 3 1514.7419 -0.0017 0 54.34 6.40E-05 K IWHHTFYNELR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4532.4532.3.dta 3 IPI00555900.1 FKSG30 228 42331 5 5 3 3 3455 3341 1 0 1 758.8536 1515.6926 2 1515.6954 -0.0028 0 59.46 2.70E-06 K QEYDESGPSIVHR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3449.3449.2.dta 3 IPI00555900.1 FKSG30 228 42331 5 5 3 3 4697 5642 1 0 1 895.9485 1789.8825 2 1789.8846 -0.0021 0 80.72 1.40E-07 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6125.6125.2.dta 3 IPI00555900.1 FKSG30 228 42331 5 5 3 3 4698 6003 1 0 1 597.6349 1789.883 3 1789.8846 -0.0016 0 47.04 0.00013 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6632.6632.3.dta 3 IPI00555900.1 FKSG30 228 42331 5 5 3 3 4699 5971 1 0 1 895.9489 1789.8833 2 1789.8846 -0.0014 0 76.37 3.80E-07 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6595.6595.2.dta 3 IPI00645534.1 "Actin, alpha 2, smooth muscle, aorta" 219 16919 8 8 5 5 101 4891 1 0 1 322.7205 643.4264 2 643.4268 -0.0004 0 32.07 0.0039 R GILTLK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5217.5217.2.dta 3 IPI00645534.1 "Actin, alpha 2, smooth muscle, aorta" 219 16919 8 8 5 5 1117 3001 1 0 1 488.7275 975.4405 2 975.441 -0.0005 0 71.36 6.50E-07 K AGFAGDDAPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3047.3047.2.dta 3 IPI00645534.1 "Actin, alpha 2, smooth muscle, aorta" 219 16919 8 8 5 5 1954 3060 1 0 1 586.2906 1170.5666 2 1170.5638 0.0028 0 68.15 4.10E-07 R HQGVMVGMGQK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3115.3115.2.dta 3 IPI00645534.1 "Actin, alpha 2, smooth muscle, aorta" 219 16919 8 8 5 5 2009 2460 1 0 1 594.2858 1186.5571 2 1186.5587 -0.0016 0 16.45 0.029 R HQGVMVGMGQK D Oxidation (M) 0.00001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2450.2450.2.dta 3 IPI00645534.1 "Actin, alpha 2, smooth muscle, aorta" 219 16919 8 8 5 5 2010 2071 1 0 1 594.2863 1186.558 2 1186.5587 -0.0008 0 34.51 0.00058 R HQGVMVGMGQK D Oxidation (M) 0.00000001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2018.2018.2.dta 3 IPI00645534.1 "Actin, alpha 2, smooth muscle, aorta" 219 16919 8 8 5 5 2747 2252 1 0 1 677.8148 1353.615 2 1353.6161 -0.0011 1 51.73 1.70E-05 K DSYVGDEAQSKR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2214.2214.2.dta 3 IPI00645534.1 "Actin, alpha 2, smooth muscle, aorta" 219 16919 8 8 5 5 2748 2254 1 0 1 452.2126 1353.616 3 1353.6161 0 1 44.37 0.00022 K DSYVGDEAQSKR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2217.2217.3.dta 3 IPI00645534.1 "Actin, alpha 2, smooth muscle, aorta" 219 16919 8 8 5 5 6161 3564 1 0 1 784.3683 2350.083 3 2350.0682 0.0148 1 22.1 0.0085 R HQGVMVGMGQKDSYVGDEAQSK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3718.3718.3.dta 3 IPI00738655.2 "similar to Prostate, ovary, testis expressed protein on chromosome 2" 154 118740 4 4 4 4 101 4891 1 0 1 322.7205 643.4264 2 643.4268 -0.0004 0 32.07 0.0039 R GILTLK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5217.5217.2.dta 3 IPI00738655.2 "similar to Prostate, ovary, testis expressed protein on chromosome 2" 154 118740 4 4 4 4 1117 3001 1 0 1 488.7275 975.4405 2 975.441 -0.0005 0 71.36 6.50E-07 K AGFAGDDAPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3047.3047.2.dta 3 IPI00738655.2 "similar to Prostate, ovary, testis expressed protein on chromosome 2" 154 118740 4 4 4 4 3451 4300 1 0 1 505.9207 1514.7401 3 1514.7419 -0.0017 0 54.34 6.40E-05 K IWHHTFYNELR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4532.4532.3.dta 3 IPI00738655.2 "similar to Prostate, ovary, testis expressed protein on chromosome 2" 154 118740 4 4 4 4 3455 3341 1 0 1 758.8536 1515.6926 2 1515.6954 -0.0028 0 59.46 2.70E-06 K QEYDESGPSIVHR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3449.3449.2.dta 3 IPI00555733.1 Actin-like protein (Fragment) 73 11861 2 2 2 2 3451 4300 1 0 1 505.9207 1514.7401 3 1514.7419 -0.0017 0 54.34 6.40E-05 K IWHHTFYNELR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4532.4532.3.dta 3 IPI00555733.1 Actin-like protein (Fragment) 73 11861 2 2 2 2 5259 5130 1 0 1 652.026 1953.0562 3 1953.0571 -0.0009 0 41.78 0.0005 R VAPEEHPVLLTEAPLNPK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5505.5505.3.dta 3 IPI00807522.1 FSD1L protein (Fragment) 64 11457 3 3 2 2 1229 6144 1 0 1 499.7469 997.4792 2 997.479 0.0001 0 32.62 0.0034 R DLTDYLMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6820.6820.2.dta 3 IPI00807522.1 FSD1L protein (Fragment) 64 11457 3 3 2 2 8171 6218 1 0 1 1061.873 3182.5973 3 3182.6071 -0.0097 0 34.61 0.00057 R TTGIVMDSGDGVTHTVPIYEGYALPHAILR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6928.6928.3.dta 3 IPI00807522.1 FSD1L protein (Fragment) 64 11457 3 3 2 2 8172 6222 1 0 1 796.6592 3182.6076 4 3182.6071 0.0006 0 29.63 0.0017 R TTGIVMDSGDGVTHTVPIYEGYALPHAILR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6933.6933.4.dta 3 IPI00556300.1 Actin-like protein (Fragment) 54 11634 1 1 1 1 3451 4300 1 0 1 505.9207 1514.7401 3 1514.7419 -0.0017 0 54.34 6.40E-05 K IWHHTFYNELR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4532.4532.3.dta 3 IPI00444605.1 "CDNA FLJ45296 fis, clone BRHIP3003340, moderately similar to Actin, alpha skeletal muscle 2" 46 23821 2 2 2 2 1918 4553 1 0 1 581.3134 1160.6122 2 1160.6111 0.0011 0 39.78 0.0028 K EITALAPSTMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4807.4807.2.dta 3 IPI00444605.1 "CDNA FLJ45296 fis, clone BRHIP3003340, moderately similar to Actin, alpha skeletal muscle 2" 46 23821 2 2 2 2 3575 4268 1 0 1 516.9421 1547.8046 3 1547.8051 -0.0005 1 29.8 0.0066 R MQKEITALAPSTMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4496.4496.3.dta 3 IPI00739998.1 "Similar to Actin, cytoplasmic 1" 35 22865 1 1 1 1 829 2153 1 0 1 453.2289 904.4432 2 904.4436 -0.0004 1 35.01 0.0085 K CDVDIRK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2106.2106.2.dta 4 1 IPI00011654.2 Tubulin beta chain 534 50095 16 16 13 13 1410 6277 1 1 0 520.3001 1038.5857 2 1038.5862 -0.0005 0 78.42 4.60E-08 R YLTVAAVFR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7002.7002.2.dta 4 1 IPI00011654.2 Tubulin beta chain 534 50095 16 16 13 13 1864 6053 1 1 0 572.3204 1142.6262 2 1142.627 -0.0008 0 62.79 6.90E-06 K LAVNMVPFPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6704.6704.2.dta 4 1 IPI00011654.2 Tubulin beta chain 534 50095 16 16 13 13 2207 6089 1 1 0 615.3033 1228.592 2 1228.591 0.001 0 44.63 7.50E-05 R ISEQFTAMFR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6755.6755.2.dta 4 1 IPI00011654.2 Tubulin beta chain 534 50095 16 16 13 13 2514 4050 1 1 1 651.321 1300.6275 2 1300.6299 -0.0024 0 57.61 4.30E-06 R ISVYYNEATGGK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4258.4258.2.dta 4 1 IPI00011654.2 Tubulin beta chain 534 50095 16 16 13 13 3185 4209 1 1 0 723.8473 1445.68 2 1445.682 -0.002 0 67.44 2.70E-06 K EVDEQMLNVQNK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4431.4431.2.dta 4 1 IPI00011654.2 Tubulin beta chain 534 50095 16 16 13 13 3856 6199 1 1 1 808.4209 1614.8272 2 1614.8287 -0.0015 0 55.96 8.10E-06 R AILVDLEPGTMDSVR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6900.6900.2.dta 4 1 IPI00011654.2 Tubulin beta chain 534 50095 16 16 13 13 4149 6791 1 1 1 830.4515 1658.8885 2 1658.8879 0.0006 0 62.44 1.60E-06 R ALTVPELTQQVFDAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7676.7676.2.dta 4 1 IPI00011654.2 Tubulin beta chain 534 50095 16 16 13 13 4150 6784 1 1 1 553.9703 1658.889 3 1658.8879 0.0011 0 48.76 2.70E-05 R ALTVPELTQQVFDAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7669.7669.3.dta 4 1 IPI00011654.2 Tubulin beta chain 534 50095 16 16 13 13 4373 6543 1 1 0 848.9202 1695.8258 2 1695.8257 0.0001 0 50.79 0.00014 K NSSYFVEWIPNNVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7363.7363.2.dta 4 1 IPI00011654.2 Tubulin beta chain 534 50095 16 16 13 13 4774 4390 1 1 1 606.3135 1815.9186 3 1815.9155 0.0031 1 19.64 0.022 R ISVYYNEATGGKYVPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4632.4632.3.dta 4 1 IPI00011654.2 Tubulin beta chain 534 50095 16 16 13 13 5195 5117 1 1 0 641.9703 1922.8892 3 1922.89 -0.0008 1 44.45 0.00021 R MSMKEVDEQMLNVQNK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5484.5484.3.dta 4 1 IPI00011654.2 Tubulin beta chain 534 50095 16 16 13 13 5268 7166 1 1 0 653.6667 1957.9782 3 1957.9745 0.0037 0 35.69 0.00053 K GHYTEGAELVDSVLDVVR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8135.8135.3.dta 4 1 IPI00011654.2 Tubulin beta chain 534 50095 16 16 13 13 5535 6709 1 1 0 696.3636 2086.0689 3 2086.0695 -0.0006 1 63.71 2.00E-06 K GHYTEGAELVDSVLDVVRK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7584.7584.3.dta 4 1 IPI00011654.2 Tubulin beta chain 534 50095 16 16 13 13 5536 6712 1 1 0 522.5248 2086.0703 4 2086.0695 0.0008 1 44.18 0.00048 K GHYTEGAELVDSVLDVVRK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7587.7587.4.dta 4 1 IPI00011654.2 Tubulin beta chain 534 50095 16 16 13 13 5580 3729 1 1 1 704.0252 2109.0538 3 2109.0571 -0.0034 1 45.81 5.10E-05 - MREIVHIQAGQCGNQIGAK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3905.3905.3.dta 4 1 IPI00011654.2 Tubulin beta chain 534 50095 16 16 13 13 5581 3737 1 1 1 528.2709 2109.0544 4 2109.0571 -0.0028 1 31.88 0.0019 - MREIVHIQAGQCGNQIGAK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3914.3914.4.dta 4 2 IPI00007752.1 Tubulin beta-2C chain 435 50255 14 14 12 12 1410 6277 1 0 0 520.3001 1038.5857 2 1038.5862 -0.0005 0 78.42 4.60E-08 R YLTVAAVFR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7002.7002.2.dta 4 2 IPI00007752.1 Tubulin beta-2C chain 435 50255 14 14 12 12 1864 6053 1 0 0 572.3204 1142.6262 2 1142.627 -0.0008 0 62.79 6.90E-06 K LAVNMVPFPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6704.6704.2.dta 4 2 IPI00007752.1 Tubulin beta-2C chain 435 50255 14 14 12 12 2207 6089 1 0 0 615.3033 1228.592 2 1228.591 0.001 0 44.63 7.50E-05 R ISEQFTAMFR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6755.6755.2.dta 4 2 IPI00007752.1 Tubulin beta-2C chain 435 50255 14 14 12 12 2644 4052 1 0 1 664.8263 1327.638 2 1327.6408 -0.0028 0 47.48 3.50E-05 R INVYYNEATGGK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4260.4260.2.dta 4 2 IPI00007752.1 Tubulin beta-2C chain 435 50255 14 14 12 12 3185 4209 1 0 0 723.8473 1445.68 2 1445.682 -0.002 0 67.44 2.70E-06 K EVDEQMLNVQNK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4431.4431.2.dta 4 2 IPI00007752.1 Tubulin beta-2C chain 435 50255 14 14 12 12 3805 5956 1 0 1 801.4138 1600.8131 2 1600.8131 0 0 48.19 0.00029 R AVLVDLEPGTMDSVR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6578.6578.2.dta 4 2 IPI00007752.1 Tubulin beta-2C chain 435 50255 14 14 12 12 4373 6543 1 0 0 848.9202 1695.8258 2 1695.8257 0.0001 0 50.79 0.00014 K NSSYFVEWIPNNVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7363.7363.2.dta 4 2 IPI00007752.1 Tubulin beta-2C chain 435 50255 14 14 12 12 4869 4405 1 0 1 615.3158 1842.9256 3 1842.9264 -0.0009 1 24.12 0.013 R INVYYNEATGGKYVPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4648.4648.3.dta 4 2 IPI00007752.1 Tubulin beta-2C chain 435 50255 14 14 12 12 5195 5117 1 0 0 641.9703 1922.8892 3 1922.89 -0.0008 1 44.45 0.00021 R MSMKEVDEQMLNVQNK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5484.5484.3.dta 4 2 IPI00007752.1 Tubulin beta-2C chain 435 50255 14 14 12 12 5268 7166 1 0 0 653.6667 1957.9782 3 1957.9745 0.0037 0 35.69 0.00053 K GHYTEGAELVDSVLDVVR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8135.8135.3.dta 4 2 IPI00007752.1 Tubulin beta-2C chain 435 50255 14 14 12 12 5535 6709 1 0 0 696.3636 2086.0689 3 2086.0695 -0.0006 1 63.71 2.00E-06 K GHYTEGAELVDSVLDVVRK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7584.7584.3.dta 4 2 IPI00007752.1 Tubulin beta-2C chain 435 50255 14 14 12 12 5536 6712 1 0 0 522.5248 2086.0703 4 2086.0695 0.0008 1 44.18 0.00048 K GHYTEGAELVDSVLDVVRK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7587.7587.4.dta 4 2 IPI00007752.1 Tubulin beta-2C chain 435 50255 14 14 12 12 5580 3729 1 0 1 704.0252 2109.0538 3 2109.0571 -0.0034 1 45.81 5.10E-05 - MREIVHLQAGQCGNQIGAK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3905.3905.3.dta 4 2 IPI00007752.1 Tubulin beta-2C chain 435 50255 14 14 12 12 5581 3737 1 0 1 528.2709 2109.0544 4 2109.0571 -0.0028 1 31.88 0.0019 - MREIVHLQAGQCGNQIGAK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3914.3914.4.dta 4 IPI00645452.1 "Tubulin, beta polypeptide" 489 48135 14 14 12 12 1410 6277 1 0 0 520.3001 1038.5857 2 1038.5862 -0.0005 0 78.42 4.60E-08 R YLTVAAVFR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7002.7002.2.dta 4 IPI00645452.1 "Tubulin, beta polypeptide" 489 48135 14 14 12 12 1864 6053 1 0 0 572.3204 1142.6262 2 1142.627 -0.0008 0 62.79 6.90E-06 K LAVNMVPFPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6704.6704.2.dta 4 IPI00645452.1 "Tubulin, beta polypeptide" 489 48135 14 14 12 12 2207 6089 1 0 0 615.3033 1228.592 2 1228.591 0.001 0 44.63 7.50E-05 R ISEQFTAMFR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6755.6755.2.dta 4 IPI00645452.1 "Tubulin, beta polypeptide" 489 48135 14 14 12 12 2514 4050 1 0 1 651.321 1300.6275 2 1300.6299 -0.0024 0 57.61 4.30E-06 R ISVYYNEATGGK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4258.4258.2.dta 4 IPI00645452.1 "Tubulin, beta polypeptide" 489 48135 14 14 12 12 3185 4209 1 0 0 723.8473 1445.68 2 1445.682 -0.002 0 67.44 2.70E-06 K EVDEQMLNVQNK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4431.4431.2.dta 4 IPI00645452.1 "Tubulin, beta polypeptide" 489 48135 14 14 12 12 3856 6199 1 0 1 808.4209 1614.8272 2 1614.8287 -0.0015 0 55.96 8.10E-06 R AILVDLEPGTMDSVR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6900.6900.2.dta 4 IPI00645452.1 "Tubulin, beta polypeptide" 489 48135 14 14 12 12 4149 6791 1 0 1 830.4515 1658.8885 2 1658.8879 0.0006 0 62.44 1.60E-06 R ALTVPELTQQVFDAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7676.7676.2.dta 4 IPI00645452.1 "Tubulin, beta polypeptide" 489 48135 14 14 12 12 4150 6784 1 0 1 553.9703 1658.889 3 1658.8879 0.0011 0 48.76 2.70E-05 R ALTVPELTQQVFDAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7669.7669.3.dta 4 IPI00645452.1 "Tubulin, beta polypeptide" 489 48135 14 14 12 12 4373 6543 1 0 0 848.9202 1695.8258 2 1695.8257 0.0001 0 50.79 0.00014 K NSSYFVEWIPNNVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7363.7363.2.dta 4 IPI00645452.1 "Tubulin, beta polypeptide" 489 48135 14 14 12 12 4774 4390 1 0 1 606.3135 1815.9186 3 1815.9155 0.0031 1 19.64 0.022 R ISVYYNEATGGKYVPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4632.4632.3.dta 4 IPI00645452.1 "Tubulin, beta polypeptide" 489 48135 14 14 12 12 5195 5117 1 0 0 641.9703 1922.8892 3 1922.89 -0.0008 1 44.45 0.00021 R MSMKEVDEQMLNVQNK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5484.5484.3.dta 4 IPI00645452.1 "Tubulin, beta polypeptide" 489 48135 14 14 12 12 5268 7166 1 0 0 653.6667 1957.9782 3 1957.9745 0.0037 0 35.69 0.00053 K GHYTEGAELVDSVLDVVR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8135.8135.3.dta 4 IPI00645452.1 "Tubulin, beta polypeptide" 489 48135 14 14 12 12 5535 6709 1 0 0 696.3636 2086.0689 3 2086.0695 -0.0006 1 63.71 2.00E-06 K GHYTEGAELVDSVLDVVRK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7584.7584.3.dta 4 IPI00645452.1 "Tubulin, beta polypeptide" 489 48135 14 14 12 12 5536 6712 1 0 0 522.5248 2086.0703 4 2086.0695 0.0008 1 44.18 0.00048 K GHYTEGAELVDSVLDVVRK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7587.7587.4.dta 4 IPI00647896.1 "Tubulin, beta" 406 42114 11 11 9 9 1410 6277 1 0 0 520.3001 1038.5857 2 1038.5862 -0.0005 0 78.42 4.60E-08 R YLTVAAVFR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7002.7002.2.dta 4 IPI00647896.1 "Tubulin, beta" 406 42114 11 11 9 9 1864 6053 1 0 0 572.3204 1142.6262 2 1142.627 -0.0008 0 62.79 6.90E-06 K LAVNMVPFPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6704.6704.2.dta 4 IPI00647896.1 "Tubulin, beta" 406 42114 11 11 9 9 2207 6089 1 0 0 615.3033 1228.592 2 1228.591 0.001 0 44.63 7.50E-05 R ISEQFTAMFR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6755.6755.2.dta 4 IPI00647896.1 "Tubulin, beta" 406 42114 11 11 9 9 3185 4209 1 0 0 723.8473 1445.68 2 1445.682 -0.002 0 67.44 2.70E-06 K EVDEQMLNVQNK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4431.4431.2.dta 4 IPI00647896.1 "Tubulin, beta" 406 42114 11 11 9 9 4149 6791 1 0 1 830.4515 1658.8885 2 1658.8879 0.0006 0 62.44 1.60E-06 R ALTVPELTQQVFDAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7676.7676.2.dta 4 IPI00647896.1 "Tubulin, beta" 406 42114 11 11 9 9 4150 6784 1 0 1 553.9703 1658.889 3 1658.8879 0.0011 0 48.76 2.70E-05 R ALTVPELTQQVFDAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7669.7669.3.dta 4 IPI00647896.1 "Tubulin, beta" 406 42114 11 11 9 9 4373 6543 1 0 0 848.9202 1695.8258 2 1695.8257 0.0001 0 50.79 0.00014 K NSSYFVEWIPNNVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7363.7363.2.dta 4 IPI00647896.1 "Tubulin, beta" 406 42114 11 11 9 9 5195 5117 1 0 0 641.9703 1922.8892 3 1922.89 -0.0008 1 44.45 0.00021 R MSMKEVDEQMLNVQNK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5484.5484.3.dta 4 IPI00647896.1 "Tubulin, beta" 406 42114 11 11 9 9 5268 7166 1 0 0 653.6667 1957.9782 3 1957.9745 0.0037 0 35.69 0.00053 K GHYTEGAELVDSVLDVVR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8135.8135.3.dta 4 IPI00647896.1 "Tubulin, beta" 406 42114 11 11 9 9 5535 6709 1 0 0 696.3636 2086.0689 3 2086.0695 -0.0006 1 63.71 2.00E-06 K GHYTEGAELVDSVLDVVRK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7584.7584.3.dta 4 IPI00647896.1 "Tubulin, beta" 406 42114 11 11 9 9 5536 6712 1 0 0 522.5248 2086.0703 4 2086.0695 0.0008 1 44.18 0.00048 K GHYTEGAELVDSVLDVVRK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7587.7587.4.dta 4 IPI00013475.1 Tubulin beta-2A chain 351 50274 11 11 9 9 1864 6053 1 0 0 572.3204 1142.6262 2 1142.627 -0.0008 0 62.79 6.90E-06 K LAVNMVPFPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6704.6704.2.dta 4 IPI00013475.1 Tubulin beta-2A chain 351 50274 11 11 9 9 2207 6089 1 0 0 615.3033 1228.592 2 1228.591 0.001 0 44.63 7.50E-05 R ISEQFTAMFR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6755.6755.2.dta 4 IPI00013475.1 Tubulin beta-2A chain 351 50274 11 11 9 9 3185 4209 1 0 0 723.8473 1445.68 2 1445.682 -0.002 0 67.44 2.70E-06 K EVDEQMLNVQNK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4431.4431.2.dta 4 IPI00013475.1 Tubulin beta-2A chain 351 50274 11 11 9 9 3856 6199 1 0 1 808.4209 1614.8272 2 1614.8287 -0.0015 0 55.96 8.10E-06 R AILVDLEPGTMDSVR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6900.6900.2.dta 4 IPI00013475.1 Tubulin beta-2A chain 351 50274 11 11 9 9 4373 6543 1 0 0 848.9202 1695.8258 2 1695.8257 0.0001 0 50.79 0.00014 K NSSYFVEWIPNNVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7363.7363.2.dta 4 IPI00013475.1 Tubulin beta-2A chain 351 50274 11 11 9 9 5195 5117 1 0 0 641.9703 1922.8892 3 1922.89 -0.0008 1 44.45 0.00021 R MSMKEVDEQMLNVQNK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5484.5484.3.dta 4 IPI00013475.1 Tubulin beta-2A chain 351 50274 11 11 9 9 5268 7166 1 0 0 653.6667 1957.9782 3 1957.9745 0.0037 0 35.69 0.00053 K GHYTEGAELVDSVLDVVR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8135.8135.3.dta 4 IPI00013475.1 Tubulin beta-2A chain 351 50274 11 11 9 9 5535 6709 1 0 0 696.3636 2086.0689 3 2086.0695 -0.0006 1 63.71 2.00E-06 K GHYTEGAELVDSVLDVVRK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7584.7584.3.dta 4 IPI00013475.1 Tubulin beta-2A chain 351 50274 11 11 9 9 5536 6712 1 0 0 522.5248 2086.0703 4 2086.0695 0.0008 1 44.18 0.00048 K GHYTEGAELVDSVLDVVRK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7587.7587.4.dta 4 IPI00013475.1 Tubulin beta-2A chain 351 50274 11 11 9 9 5580 3729 1 0 1 704.0252 2109.0538 3 2109.0571 -0.0034 1 45.81 5.10E-05 - MREIVHIQAGQCGNQIGAK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3905.3905.3.dta 4 IPI00013475.1 Tubulin beta-2A chain 351 50274 11 11 9 9 5581 3737 1 0 1 528.2709 2109.0544 4 2109.0571 -0.0028 1 31.88 0.0019 - MREIVHIQAGQCGNQIGAK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3914.3914.4.dta 4 IPI00013683.2 Tubulin beta-3 chain 283 50856 9 9 7 7 1864 6053 1 0 0 572.3204 1142.6262 2 1142.627 -0.0008 0 62.79 6.90E-06 K LAVNMVPFPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6704.6704.2.dta 4 IPI00013683.2 Tubulin beta-3 chain 283 50856 9 9 7 7 2207 6089 1 0 0 615.3033 1228.592 2 1228.591 0.001 0 44.63 7.50E-05 R ISEQFTAMFR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6755.6755.2.dta 4 IPI00013683.2 Tubulin beta-3 chain 283 50856 9 9 7 7 3856 6199 1 0 1 808.4209 1614.8272 2 1614.8287 -0.0015 0 55.96 8.10E-06 R AILVDLEPGTMDSVR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6900.6900.2.dta 4 IPI00013683.2 Tubulin beta-3 chain 283 50856 9 9 7 7 4373 6543 1 0 0 848.9202 1695.8258 2 1695.8257 0.0001 0 50.79 0.00014 K NSSYFVEWIPNNVK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7363.7363.2.dta 4 IPI00013683.2 Tubulin beta-3 chain 283 50856 9 9 7 7 5268 7166 1 0 0 653.6667 1957.9782 3 1957.9745 0.0037 0 35.69 0.00053 K GHYTEGAELVDSVLDVVR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8135.8135.3.dta 4 IPI00013683.2 Tubulin beta-3 chain 283 50856 9 9 7 7 5535 6709 1 0 0 696.3636 2086.0689 3 2086.0695 -0.0006 1 63.71 2.00E-06 K GHYTEGAELVDSVLDVVRK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7584.7584.3.dta 4 IPI00013683.2 Tubulin beta-3 chain 283 50856 9 9 7 7 5536 6712 1 0 0 522.5248 2086.0703 4 2086.0695 0.0008 1 44.18 0.00048 K GHYTEGAELVDSVLDVVRK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7587.7587.4.dta 4 IPI00013683.2 Tubulin beta-3 chain 283 50856 9 9 7 7 5580 3729 1 0 1 704.0252 2109.0538 3 2109.0571 -0.0034 1 45.81 5.10E-05 - MREIVHIQAGQCGNQIGAK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3905.3905.3.dta 4 IPI00013683.2 Tubulin beta-3 chain 283 50856 9 9 7 7 5581 3737 1 0 1 528.2709 2109.0544 4 2109.0571 -0.0028 1 31.88 0.0019 - MREIVHIQAGQCGNQIGAK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3914.3914.4.dta 4 IPI00023598.2 Tubulin beta-4 chain 243 50010 7 7 6 6 1410 6277 1 0 0 520.3001 1038.5857 2 1038.5862 -0.0005 0 78.42 4.60E-08 R YLTVAAVFR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7002.7002.2.dta 4 IPI00023598.2 Tubulin beta-4 chain 243 50010 7 7 6 6 1864 6053 1 0 0 572.3204 1142.6262 2 1142.627 -0.0008 0 62.79 6.90E-06 K LAVNMVPFPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6704.6704.2.dta 4 IPI00023598.2 Tubulin beta-4 chain 243 50010 7 7 6 6 2207 6089 1 0 0 615.3033 1228.592 2 1228.591 0.001 0 44.63 7.50E-05 R ISEQFTAMFR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6755.6755.2.dta 4 IPI00023598.2 Tubulin beta-4 chain 243 50010 7 7 6 6 3805 5956 1 0 1 801.4138 1600.8131 2 1600.8131 0 0 48.19 0.00029 R AVLVDLEPGTMDSVR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6578.6578.2.dta 4 IPI00023598.2 Tubulin beta-4 chain 243 50010 7 7 6 6 4373 6543 1 0 0 848.9202 1695.8258 2 1695.8257 0.0001 0 50.79 0.00014 K NSSYFVEWIPNNVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7363.7363.2.dta 4 IPI00023598.2 Tubulin beta-4 chain 243 50010 7 7 6 6 5580 3729 1 0 1 704.0252 2109.0538 3 2109.0571 -0.0034 1 45.81 5.10E-05 - MREIVHLQAGQCGNQIGAK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3905.3905.3.dta 4 IPI00023598.2 Tubulin beta-4 chain 243 50010 7 7 6 6 5581 3737 1 0 1 528.2709 2109.0544 4 2109.0571 -0.0028 1 31.88 0.0019 - MREIVHLQAGQCGNQIGAK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3914.3914.4.dta 4 IPI00152453.1 "Tubulin, beta, 4" 238 89693 7 7 6 6 1864 6053 1 0 0 572.3204 1142.6262 2 1142.627 -0.0008 0 62.79 6.90E-06 K LAVNMVPFPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6704.6704.2.dta 4 IPI00152453.1 "Tubulin, beta, 4" 238 89693 7 7 6 6 2207 6089 1 0 0 615.3033 1228.592 2 1228.591 0.001 0 44.63 7.50E-05 R ISEQFTAMFR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6755.6755.2.dta 4 IPI00152453.1 "Tubulin, beta, 4" 238 89693 7 7 6 6 3856 6199 1 0 1 808.4209 1614.8272 2 1614.8287 -0.0015 0 55.96 8.10E-06 R AILVDLEPGTMDSVR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6900.6900.2.dta 4 IPI00152453.1 "Tubulin, beta, 4" 238 89693 7 7 6 6 4373 6543 1 0 0 848.9202 1695.8258 2 1695.8257 0.0001 0 50.79 0.00014 K NSSYFVEWIPNNVK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7363.7363.2.dta 4 IPI00152453.1 "Tubulin, beta, 4" 238 89693 7 7 6 6 5268 7166 1 0 0 653.6667 1957.9782 3 1957.9745 0.0037 0 35.69 0.00053 K GHYTEGAELVDSVLDVVR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8135.8135.3.dta 4 IPI00152453.1 "Tubulin, beta, 4" 238 89693 7 7 6 6 5535 6709 1 0 0 696.3636 2086.0689 3 2086.0695 -0.0006 1 63.71 2.00E-06 K GHYTEGAELVDSVLDVVRK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7584.7584.3.dta 4 IPI00152453.1 "Tubulin, beta, 4" 238 89693 7 7 6 6 5536 6712 1 0 0 522.5248 2086.0703 4 2086.0695 0.0008 1 44.18 0.00048 K GHYTEGAELVDSVLDVVRK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7587.7587.4.dta 4 IPI00640115.1 TUBB3 protein 200 42804 6 6 5 5 1864 6053 1 0 0 572.3204 1142.6262 2 1142.627 -0.0008 0 62.79 6.90E-06 K LAVNMVPFPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6704.6704.2.dta 4 IPI00640115.1 TUBB3 protein 200 42804 6 6 5 5 2207 6089 1 0 0 615.3033 1228.592 2 1228.591 0.001 0 44.63 7.50E-05 R ISEQFTAMFR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6755.6755.2.dta 4 IPI00640115.1 TUBB3 protein 200 42804 6 6 5 5 4373 6543 1 0 0 848.9202 1695.8258 2 1695.8257 0.0001 0 50.79 0.00014 K NSSYFVEWIPNNVK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7363.7363.2.dta 4 IPI00640115.1 TUBB3 protein 200 42804 6 6 5 5 5268 7166 1 0 0 653.6667 1957.9782 3 1957.9745 0.0037 0 35.69 0.00053 K GHYTEGAELVDSVLDVVR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8135.8135.3.dta 4 IPI00640115.1 TUBB3 protein 200 42804 6 6 5 5 5535 6709 1 0 0 696.3636 2086.0689 3 2086.0695 -0.0006 1 63.71 2.00E-06 K GHYTEGAELVDSVLDVVRK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7584.7584.3.dta 4 IPI00640115.1 TUBB3 protein 200 42804 6 6 5 5 5536 6712 1 0 0 522.5248 2086.0703 4 2086.0695 0.0008 1 44.18 0.00048 K GHYTEGAELVDSVLDVVRK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7587.7587.4.dta 4 IPI00646779.2 TUBB6 protein 172 50514 5 5 4 4 1864 6053 1 0 0 572.3204 1142.6262 2 1142.627 -0.0008 0 62.79 6.90E-06 K LAVNMVPFPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6704.6704.2.dta 4 IPI00646779.2 TUBB6 protein 172 50514 5 5 4 4 4373 6543 1 0 0 848.9202 1695.8258 2 1695.8257 0.0001 0 50.79 0.00014 K NSSYFVEWIPNNVK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7363.7363.2.dta 4 IPI00646779.2 TUBB6 protein 172 50514 5 5 4 4 5268 7166 1 0 0 653.6667 1957.9782 3 1957.9745 0.0037 0 35.69 0.00053 K GHYTEGAELVDSVLDVVR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8135.8135.3.dta 4 IPI00646779.2 TUBB6 protein 172 50514 5 5 4 4 5535 6709 1 0 0 696.3636 2086.0689 3 2086.0695 -0.0006 1 63.71 2.00E-06 K GHYTEGAELVDSVLDVVRK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7584.7584.3.dta 4 IPI00646779.2 TUBB6 protein 172 50514 5 5 4 4 5536 6712 1 0 0 522.5248 2086.0703 4 2086.0695 0.0008 1 44.18 0.00048 K GHYTEGAELVDSVLDVVRK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7587.7587.4.dta 4 IPI00644620.1 35 kDa protein 115 34807 3 3 3 3 1864 6053 1 0 0 572.3204 1142.6262 2 1142.627 -0.0008 0 62.79 6.90E-06 K LAVNMVPFPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6704.6704.2.dta 4 IPI00644620.1 35 kDa protein 115 34807 3 3 3 3 2207 6089 1 0 0 615.3033 1228.592 2 1228.591 0.001 0 44.63 7.50E-05 R ISEQFTAMFR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6755.6755.2.dta 4 IPI00644620.1 35 kDa protein 115 34807 3 3 3 3 4373 6543 1 0 0 848.9202 1695.8258 2 1695.8257 0.0001 0 50.79 0.00014 K NSSYFVEWIPNNVK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7363.7363.2.dta 4 IPI00398982.1 "similar to tubulin, beta 5" 94 12210 2 2 2 2 3185 4209 1 0 0 723.8473 1445.68 2 1445.682 -0.002 0 67.44 2.70E-06 K EVDEQMLNVQNK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4431.4431.2.dta 4 IPI00398982.1 "similar to tubulin, beta 5" 94 12210 2 2 2 2 4373 6543 1 0 0 848.9202 1695.8258 2 1695.8257 0.0001 0 50.79 0.00014 K NSSYFVEWIPNNVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7363.7363.2.dta 4 IPI00641706.1 46 kDa protein 89 46248 2 2 2 2 1864 6053 1 0 0 572.3204 1142.6262 2 1142.627 -0.0008 0 62.79 6.90E-06 K LAVNMVPFPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6704.6704.2.dta 4 IPI00641706.1 46 kDa protein 89 46248 2 2 2 2 4373 6543 1 0 0 848.9202 1695.8258 2 1695.8257 0.0001 0 50.79 0.00014 K NSSYFVEWIPNNVK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7363.7363.2.dta 4 IPI00018511.1 Tubulin beta-4q chain 86 48917 2 2 2 2 1864 6053 1 0 0 572.3204 1142.6262 2 1142.627 -0.0008 0 62.79 6.90E-06 K LAVNMVPFPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6704.6704.2.dta 4 IPI00018511.1 Tubulin beta-4q chain 86 48917 2 2 2 2 3805 5956 1 0 1 801.4138 1600.8131 2 1600.8131 0 0 48.19 0.00029 R AVLVDLEPGTMDSVR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6578.6578.2.dta 4 IPI00006510.1 Tubulin beta-1 chain 63 50865 1 1 1 1 1864 6053 1 0 0 572.3204 1142.6262 2 1142.627 -0.0008 0 62.79 6.90E-06 K LAVNMVPFPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6704.6704.2.dta 5 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 484 62320 16 16 12 12 440 1349 1 1 1 399.1799 796.3452 2 796.3464 -0.0012 0 29.75 0.0046 R GGSGGSYGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1226.1226.2.dta 5 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 484 62320 16 16 12 12 791 5232 1 1 1 449.2101 896.4057 2 896.4062 -0.0005 0 37.76 0.0006 R MTLDDFR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5624.5624.2.dta 5 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 484 62320 16 16 12 12 1058 1478 1 1 1 481.7484 961.4822 2 961.4828 -0.0007 1 36.91 0.0047 K SLEDTKNR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1367.1367.2.dta 5 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 484 62320 16 16 12 12 1600 1955 1 1 1 541.2507 1080.4869 2 1080.487 0 0 45.89 0.00018 K STMQELNSR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1891.1891.2.dta 5 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 484 62320 16 16 12 12 2225 2875 1 1 1 616.8015 1231.5884 2 1231.5906 -0.0022 0 93.13 2.00E-09 R SGGGGGGGLGSGGSIR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2905.2905.2.dta 5 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 484 62320 16 16 12 12 2241 2338 1 1 1 618.2686 1234.5227 2 1234.5215 0.0012 0 86.2 1.20E-08 R FSSSSGYGGGSSR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2318.2318.2.dta 5 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 484 62320 16 16 12 12 2543 4655 1 1 1 654.3409 1306.6672 2 1306.6703 -0.0031 1 27.79 0.0043 R IKFEMEQNLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4936.4936.2.dta 5 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 484 62320 16 16 12 12 2544 4649 1 1 1 436.5638 1306.6697 3 1306.6703 -0.0006 1 43.72 0.00073 R IKFEMEQNLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4927.4927.3.dta 5 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 484 62320 16 16 12 12 2619 3569 1 1 1 441.8958 1322.6656 3 1322.6652 0.0004 1 25.92 0.0094 R IKFEMEQNLR Q Oxidation (M) 0.0000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3723.3723.3.dta 5 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 484 62320 16 16 12 12 2620 3551 1 1 1 441.896 1322.6662 3 1322.6652 0.0009 1 39.32 0.0022 R IKFEMEQNLR Q Oxidation (M) 0.0000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3704.3704.3.dta 5 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 484 62320 16 16 12 12 4701 2135 1 1 1 597.9136 1790.7191 3 1790.7205 -0.0014 0 24.55 0.0058 R GGSGGSYGGGGSGGGYGGGSGSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2086.2086.3.dta 5 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 484 62320 16 16 12 12 4853 6097 1 1 1 613.3256 1836.955 3 1836.9581 -0.0031 0 62.61 1.40E-06 R HGVQELEIELQSQLSK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6766.6766.3.dta 5 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 484 62320 16 16 12 12 4854 6112 1 1 1 919.487 1836.9594 2 1836.9581 0.0013 0 87.24 6.60E-09 R HGVQELEIELQSQLSK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6783.6783.2.dta 5 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 484 62320 16 16 12 12 4896 5886 1 1 1 617.9797 1850.9172 3 1850.9196 -0.0024 1 36.12 0.00059 K TLNDMRQEYEQLIAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6480.6480.3.dta 5 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 484 62320 16 16 12 12 6632 5441 1 1 1 837.3812 2509.1218 3 2509.1245 -0.0026 0 58.37 3.40E-06 K EIETYHNLLEGGQEDFESSGAGK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5870.5870.3.dta 5 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 484 62320 16 16 12 12 7837 7539 1 1 1 726.3574 2901.4006 4 2901.4032 -0.0026 1 35.8 0.00077 K NYSPYYNTIDDLKDQIVDLTVGNNK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8602.8602.4.dta 6 1 IPI00465248.5 Isoform alpha-enolase of Alpha-enolase 417 47481 18 18 17 17 466 3719 1 1 1 403.7306 805.4466 2 805.4446 0.002 0 26.95 0.021 K YNQLLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3892.3892.2.dta 6 1 IPI00465248.5 Isoform alpha-enolase of Alpha-enolase 417 47481 18 18 17 17 489 1454 1 1 1 405.727 809.4394 2 809.4395 -0.0001 0 41.62 0.00064 K AVEHINK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1341.1341.2.dta 6 1 IPI00465248.5 Isoform alpha-enolase of Alpha-enolase 417 47481 18 18 17 17 799 4037 1 1 1 450.2817 898.5489 2 898.5488 0.0002 0 30.07 0.0044 K TIAPALVSK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4244.4244.2.dta 6 1 IPI00465248.5 Isoform alpha-enolase of Alpha-enolase 417 47481 18 18 17 17 1046 3887 1 1 1 480.2743 958.534 2 958.5348 -0.0008 1 36.76 0.003 R NFRNPLAK - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4080.4080.2.dta 6 1 IPI00465248.5 Isoform alpha-enolase of Alpha-enolase 417 47481 18 18 17 17 1268 4562 1 1 1 504.2544 1006.4942 2 1006.494 0.0003 0 48.64 0.00023 K SCNCLLLK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4817.4817.2.dta 6 1 IPI00465248.5 Isoform alpha-enolase of Alpha-enolase 417 47481 18 18 17 17 1739 4021 1 1 1 373.561 1117.6613 3 1117.6607 0.0005 1 25.47 0.016 R LAKYNQLLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4225.4225.3.dta 6 1 IPI00465248.5 Isoform alpha-enolase of Alpha-enolase 417 47481 18 18 17 17 1863 3413 1 1 1 381.8772 1142.6099 3 1142.6084 0.0015 0 37.42 0.0037 R IGAEVYHNLK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3531.3531.3.dta 6 1 IPI00465248.5 Isoform alpha-enolase of Alpha-enolase 417 47481 18 18 17 17 3005 5805 1 1 1 703.8599 1405.7053 2 1405.7089 -0.0036 0 75.84 5.00E-07 R GNPTVEVDLFTSK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6359.6359.2.dta 6 1 IPI00465248.5 Isoform alpha-enolase of Alpha-enolase 417 47481 18 18 17 17 3963 4746 1 1 1 817.4136 1632.8126 2 1632.8141 -0.0015 0 82.31 1.90E-08 K VNQIGSVTESLQACK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5045.5045.2.dta 6 1 IPI00465248.5 Isoform alpha-enolase of Alpha-enolase 417 47481 18 18 17 17 4318 3773 1 1 1 564.331 1689.9712 3 1689.9777 -0.0066 1 29.24 0.0032 K AVEHINKTIAPALVSK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3954.3954.3.dta 6 1 IPI00465248.5 Isoform alpha-enolase of Alpha-enolase 417 47481 18 18 17 17 4323 6026 1 1 1 564.6378 1690.8914 3 1690.8889 0.0025 1 28.47 0.02 K YNQLLRIEEELGSK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6660.6660.3.dta 6 1 IPI00465248.5 Isoform alpha-enolase of Alpha-enolase 417 47481 18 18 17 17 5093 7735 1 1 1 954.4963 1906.978 2 1906.9797 -0.0017 0 32.69 0.00086 K LAMQEFMILPVGAANFR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8839.8839.2.dta 6 1 IPI00465248.5 Isoform alpha-enolase of Alpha-enolase 417 47481 18 18 17 17 5094 7731 1 1 1 636.6679 1906.9819 3 1906.9797 0.0022 0 19.76 0.014 K LAMQEFMILPVGAANFR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8834.8834.3.dta 6 1 IPI00465248.5 Isoform alpha-enolase of Alpha-enolase 417 47481 18 18 17 17 5635 6185 1 1 1 718.6962 2153.0669 3 2153.0641 0.0028 1 46.69 4.20E-05 R EIFDSRGNPTVEVDLFTSK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6882.6882.3.dta 6 1 IPI00465248.5 Isoform alpha-enolase of Alpha-enolase 417 47481 18 18 17 17 5658 7412 1 1 1 726.0303 2175.069 3 2175.067 0.0019 1 41.77 0.00012 K AGYTDKVVIGMDVAASEFFR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8441.8441.3.dta 6 1 IPI00465248.5 Isoform alpha-enolase of Alpha-enolase 417 47481 18 18 17 17 6169 8274 1 1 1 1177.0834 2352.1522 2 2352.1519 0.0003 0 46.99 4.30E-05 R SGETEDTFIADLVVGLCTGQIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9495.9495.2.dta 6 1 IPI00465248.5 Isoform alpha-enolase of Alpha-enolase 417 47481 18 18 17 17 7366 6652 1 1 1 915.1306 2742.3698 3 2742.3712 -0.0013 1 16.39 0.029 K DATNVGDEGGFAPNILENKEGLELLK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7509.7509.3.dta 6 1 IPI00465248.5 Isoform alpha-enolase of Alpha-enolase 417 47481 18 18 17 17 7965 7290 1 1 1 995.8024 2984.3853 3 2984.3869 -0.0016 1 79.44 3.60E-08 K SFIKDYPVVSIEDPFDQDDWGAWQK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8280.8280.3.dta 6 IPI00759806.1 Isoform MBP-1 of Alpha-enolase 291 37247 13 13 12 12 466 3719 1 0 1 403.7306 805.4466 2 805.4446 0.002 0 26.95 0.021 K YNQLLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3892.3892.2.dta 6 IPI00759806.1 Isoform MBP-1 of Alpha-enolase 291 37247 13 13 12 12 1046 3887 1 0 1 480.2743 958.534 2 958.5348 -0.0008 1 36.76 0.003 R NFRNPLAK - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4080.4080.2.dta 6 IPI00759806.1 Isoform MBP-1 of Alpha-enolase 291 37247 13 13 12 12 1268 4562 1 0 1 504.2544 1006.4942 2 1006.494 0.0003 0 48.64 0.00023 K SCNCLLLK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4817.4817.2.dta 6 IPI00759806.1 Isoform MBP-1 of Alpha-enolase 291 37247 13 13 12 12 1739 4021 1 0 1 373.561 1117.6613 3 1117.6607 0.0005 1 25.47 0.016 R LAKYNQLLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4225.4225.3.dta 6 IPI00759806.1 Isoform MBP-1 of Alpha-enolase 291 37247 13 13 12 12 1863 3413 1 0 1 381.8772 1142.6099 3 1142.6084 0.0015 0 37.42 0.0037 R IGAEVYHNLK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3531.3531.3.dta 6 IPI00759806.1 Isoform MBP-1 of Alpha-enolase 291 37247 13 13 12 12 3963 4746 1 0 1 817.4136 1632.8126 2 1632.8141 -0.0015 0 82.31 1.90E-08 K VNQIGSVTESLQACK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5045.5045.2.dta 6 IPI00759806.1 Isoform MBP-1 of Alpha-enolase 291 37247 13 13 12 12 4323 6026 1 0 1 564.6378 1690.8914 3 1690.8889 0.0025 1 28.47 0.02 K YNQLLRIEEELGSK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6660.6660.3.dta 6 IPI00759806.1 Isoform MBP-1 of Alpha-enolase 291 37247 13 13 12 12 5093 7735 1 0 1 954.4963 1906.978 2 1906.9797 -0.0017 0 32.69 0.00086 K LAMQEFMILPVGAANFR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8839.8839.2.dta 6 IPI00759806.1 Isoform MBP-1 of Alpha-enolase 291 37247 13 13 12 12 5094 7731 1 0 1 636.6679 1906.9819 3 1906.9797 0.0022 0 19.76 0.014 K LAMQEFMILPVGAANFR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8834.8834.3.dta 6 IPI00759806.1 Isoform MBP-1 of Alpha-enolase 291 37247 13 13 12 12 5658 7412 1 0 1 726.0303 2175.069 3 2175.067 0.0019 1 41.77 0.00012 K AGYTDKVVIGMDVAASEFFR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8441.8441.3.dta 6 IPI00759806.1 Isoform MBP-1 of Alpha-enolase 291 37247 13 13 12 12 6169 8274 1 0 1 1177.0834 2352.1522 2 2352.1519 0.0003 0 46.99 4.30E-05 R SGETEDTFIADLVVGLCTGQIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9495.9495.2.dta 6 IPI00759806.1 Isoform MBP-1 of Alpha-enolase 291 37247 13 13 12 12 7366 6652 1 0 1 915.1306 2742.3698 3 2742.3712 -0.0013 1 16.39 0.029 K DATNVGDEGGFAPNILENKEGLELLK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7509.7509.3.dta 6 IPI00759806.1 Isoform MBP-1 of Alpha-enolase 291 37247 13 13 12 12 7965 7290 1 0 1 995.8024 2984.3853 3 2984.3869 -0.0016 1 79.44 3.60E-08 K SFIKDYPVVSIEDPFDQDDWGAWQK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8280.8280.3.dta 6 IPI00218474.5 Beta-enolase 112 47299 2 2 2 2 3963 4746 1 0 1 817.4136 1632.8126 2 1632.8141 -0.0015 0 82.31 1.90E-08 K VNQIGSVTESIQACK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5045.5045.2.dta 6 IPI00218474.5 Beta-enolase 112 47299 2 2 2 2 6169 8274 1 0 1 1177.0834 2352.1522 2 2352.1519 0.0003 0 46.99 4.30E-05 R SGETEDTFIADLVVGLCTGQIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9495.9495.2.dta 6 IPI00013769.1 "Alpha-enolase, lung specific" 107 49845 4 4 4 4 466 3719 1 0 1 403.7306 805.4466 2 805.4446 0.002 0 26.95 0.021 K YNQLLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3892.3892.2.dta 6 IPI00013769.1 "Alpha-enolase, lung specific" 107 49845 4 4 4 4 1739 4021 1 0 1 373.561 1117.6613 3 1117.6607 0.0005 1 25.47 0.016 R LAKYNQLLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4225.4225.3.dta 6 IPI00013769.1 "Alpha-enolase, lung specific" 107 49845 4 4 4 4 1863 3413 1 0 1 381.8772 1142.6099 3 1142.6084 0.0015 0 37.42 0.0037 R IGAEVYHNLK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3531.3531.3.dta 6 IPI00013769.1 "Alpha-enolase, lung specific" 107 49845 4 4 4 4 3963 4746 1 0 1 817.4136 1632.8126 2 1632.8141 -0.0015 0 82.31 1.90E-08 K VNQIGSVTESLQACK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5045.5045.2.dta 6 IPI00216171.3 Gamma-enolase 75 47581 2 2 2 2 3005 5805 2 0 1 703.8599 1405.7053 2 1405.7089 -0.0036 0 48.59 0.00026 R GNPTVEVDLYTAK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6359.6359.2.dta 6 IPI00216171.3 Gamma-enolase 75 47581 2 2 2 2 6169 8274 1 0 1 1177.0834 2352.1522 2 2352.1519 0.0003 0 46.99 4.30E-05 R SGETEDTFIADLVVGLCTGQIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9495.9495.2.dta 7 1 IPI00387144.4 Tubulin alpha-ubiquitous chain 415 50804 14 14 11 11 395 3349 1 1 0 391.2086 780.4027 2 780.4018 0.0009 0 31.81 0.013 R LSVDYGK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3459.3459.2.dta 7 1 IPI00387144.4 Tubulin alpha-ubiquitous chain 415 50804 14 14 11 11 1310 4707 1 1 0 508.2927 1014.5709 2 1014.5709 0 0 71.65 1.50E-06 K DVNAAIATIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4996.4996.2.dta 7 1 IPI00387144.4 Tubulin alpha-ubiquitous chain 415 50804 14 14 11 11 2890 4605 1 1 0 460.9042 1379.6909 3 1379.6907 0.0001 1 25.2 0.0074 R LDHKFDLMYAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4876.4876.3.dta 7 1 IPI00387144.4 Tubulin alpha-ubiquitous chain 415 50804 14 14 11 11 3728 6646 1 1 1 792.8795 1583.7444 2 1583.7443 0.0001 0 69.09 3.30E-07 R SIQFVDWCPTGFK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7500.7500.2.dta 7 1 IPI00387144.4 Tubulin alpha-ubiquitous chain 415 50804 14 14 11 11 4391 6744 1 1 0 851.4562 1700.8979 2 1700.8985 -0.0006 0 70.98 2.20E-07 R AVFVDLEPTVIDEVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7625.7625.2.dta 7 1 IPI00387144.4 Tubulin alpha-ubiquitous chain 415 50804 14 14 11 11 4392 6753 1 1 0 567.9738 1700.8994 3 1700.8985 0.0009 0 43.92 0.00063 R AVFVDLEPTVIDEVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7636.7636.3.dta 7 1 IPI00387144.4 Tubulin alpha-ubiquitous chain 415 50804 14 14 11 11 4468 4497 1 1 0 859.9419 1717.8692 2 1717.8747 -0.0055 0 40.57 0.00016 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4746.4746.2.dta 7 1 IPI00387144.4 Tubulin alpha-ubiquitous chain 415 50804 14 14 11 11 4469 4477 1 1 0 573.6317 1717.8731 3 1717.8747 -0.0016 0 31.2 0.0017 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4725.4725.3.dta 7 1 IPI00387144.4 Tubulin alpha-ubiquitous chain 415 50804 14 14 11 11 4606 6138 1 1 0 586.3262 1755.9569 3 1755.9559 0.0009 0 44.31 0.00042 R IHFPLATYAPVISAEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6811.6811.3.dta 7 1 IPI00387144.4 Tubulin alpha-ubiquitous chain 415 50804 14 14 11 11 4801 5481 1 1 0 912.9963 1823.9781 2 1823.9782 0 0 50.05 2.00E-05 K VGINYQPPTVVPGGDLAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5920.5920.2.dta 7 1 IPI00387144.4 Tubulin alpha-ubiquitous chain 415 50804 14 14 11 11 4863 7060 1 1 0 614.676 1841.0062 3 1841.0047 0.0016 1 39.88 0.00033 R GHYTIGKEIIDLVLDR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8005.8005.3.dta 7 1 IPI00387144.4 Tubulin alpha-ubiquitous chain 415 50804 14 14 11 11 5382 6384 1 1 0 1004.4478 2006.8811 2 2006.8858 -0.0047 0 67.15 5.10E-07 K TIGGGDDSFNTFFSETGAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7135.7135.2.dta 7 1 IPI00387144.4 Tubulin alpha-ubiquitous chain 415 50804 14 14 11 11 6399 5107 1 1 0 805.7404 2414.1994 3 2414.1978 0.0016 1 33.54 0.00072 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5471.5471.3.dta 7 1 IPI00387144.4 Tubulin alpha-ubiquitous chain 415 50804 14 14 11 11 6400 5103 1 1 0 604.5572 2414.1997 4 2414.1978 0.0018 1 41.26 0.00033 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5467.5467.4.dta 7 2 IPI00180675.4 Tubulin alpha-3 chain 400 50788 14 14 11 11 395 3349 1 0 0 391.2086 780.4027 2 780.4018 0.0009 0 31.81 0.013 R LSVDYGK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3459.3459.2.dta 7 2 IPI00180675.4 Tubulin alpha-3 chain 400 50788 14 14 11 11 1310 4707 1 0 0 508.2927 1014.5709 2 1014.5709 0 0 71.65 1.50E-06 K DVNAAIATIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4996.4996.2.dta 7 2 IPI00180675.4 Tubulin alpha-3 chain 400 50788 14 14 11 11 2890 4605 1 0 0 460.9042 1379.6909 3 1379.6907 0.0001 1 25.2 0.0074 R LDHKFDLMYAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4876.4876.3.dta 7 2 IPI00180675.4 Tubulin alpha-3 chain 400 50788 14 14 11 11 3793 6694 1 0 1 799.8875 1597.7605 2 1597.7599 0.0005 0 52.84 1.10E-05 R TIQFVDWCPTGFK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7565.7565.2.dta 7 2 IPI00180675.4 Tubulin alpha-3 chain 400 50788 14 14 11 11 4391 6744 1 0 0 851.4562 1700.8979 2 1700.8985 -0.0006 0 70.98 2.20E-07 R AVFVDLEPTVIDEVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7625.7625.2.dta 7 2 IPI00180675.4 Tubulin alpha-3 chain 400 50788 14 14 11 11 4392 6753 1 0 0 567.9738 1700.8994 3 1700.8985 0.0009 0 43.92 0.00063 R AVFVDLEPTVIDEVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7636.7636.3.dta 7 2 IPI00180675.4 Tubulin alpha-3 chain 400 50788 14 14 11 11 4468 4497 1 0 0 859.9419 1717.8692 2 1717.8747 -0.0055 0 40.57 0.00016 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4746.4746.2.dta 7 2 IPI00180675.4 Tubulin alpha-3 chain 400 50788 14 14 11 11 4469 4477 1 0 0 573.6317 1717.8731 3 1717.8747 -0.0016 0 31.2 0.0017 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4725.4725.3.dta 7 2 IPI00180675.4 Tubulin alpha-3 chain 400 50788 14 14 11 11 4606 6138 1 0 0 586.3262 1755.9569 3 1755.9559 0.0009 0 44.31 0.00042 R IHFPLATYAPVISAEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6811.6811.3.dta 7 2 IPI00180675.4 Tubulin alpha-3 chain 400 50788 14 14 11 11 4801 5481 1 0 0 912.9963 1823.9781 2 1823.9782 0 0 50.05 2.00E-05 K VGINYQPPTVVPGGDLAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5920.5920.2.dta 7 2 IPI00180675.4 Tubulin alpha-3 chain 400 50788 14 14 11 11 4863 7060 1 0 0 614.676 1841.0062 3 1841.0047 0.0016 1 39.88 0.00033 R GHYTIGKEIIDLVLDR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8005.8005.3.dta 7 2 IPI00180675.4 Tubulin alpha-3 chain 400 50788 14 14 11 11 5382 6384 1 0 0 1004.4478 2006.8811 2 2006.8858 -0.0047 0 67.15 5.10E-07 K TIGGGDDSFNTFFSETGAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7135.7135.2.dta 7 2 IPI00180675.4 Tubulin alpha-3 chain 400 50788 14 14 11 11 6399 5107 1 0 0 805.7404 2414.1994 3 2414.1978 0.0016 1 33.54 0.00072 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5471.5471.3.dta 7 2 IPI00180675.4 Tubulin alpha-3 chain 400 50788 14 14 11 11 6400 5103 1 0 0 604.5572 2414.1997 4 2414.1978 0.0018 1 41.26 0.00033 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5467.5467.4.dta 7 IPI00793930.1 K-ALPHA-1 protein 346 37707 10 10 8 8 1310 4707 1 0 0 508.2927 1014.5709 2 1014.5709 0 0 71.65 1.50E-06 K DVNAAIATIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4996.4996.2.dta 7 IPI00793930.1 K-ALPHA-1 protein 346 37707 10 10 8 8 2890 4605 1 0 0 460.9042 1379.6909 3 1379.6907 0.0001 1 25.2 0.0074 R LDHKFDLMYAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4876.4876.3.dta 7 IPI00793930.1 K-ALPHA-1 protein 346 37707 10 10 8 8 3728 6646 1 0 1 792.8795 1583.7444 2 1583.7443 0.0001 0 69.09 3.30E-07 R SIQFVDWCPTGFK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7500.7500.2.dta 7 IPI00793930.1 K-ALPHA-1 protein 346 37707 10 10 8 8 4391 6744 1 0 0 851.4562 1700.8979 2 1700.8985 -0.0006 0 70.98 2.20E-07 R AVFVDLEPTVIDEVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7625.7625.2.dta 7 IPI00793930.1 K-ALPHA-1 protein 346 37707 10 10 8 8 4392 6753 1 0 0 567.9738 1700.8994 3 1700.8985 0.0009 0 43.92 0.00063 R AVFVDLEPTVIDEVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7636.7636.3.dta 7 IPI00793930.1 K-ALPHA-1 protein 346 37707 10 10 8 8 4606 6138 1 0 0 586.3262 1755.9569 3 1755.9559 0.0009 0 44.31 0.00042 R IHFPLATYAPVISAEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6811.6811.3.dta 7 IPI00793930.1 K-ALPHA-1 protein 346 37707 10 10 8 8 4801 5481 1 0 0 912.9963 1823.9781 2 1823.9782 0 0 50.05 2.00E-05 K VGINYQPPTVVPGGDLAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5920.5920.2.dta 7 IPI00793930.1 K-ALPHA-1 protein 346 37707 10 10 8 8 5382 6384 1 0 0 1004.4478 2006.8811 2 2006.8858 -0.0047 0 67.15 5.10E-07 K TIGGGDDSFNTFFSETGAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7135.7135.2.dta 7 IPI00793930.1 K-ALPHA-1 protein 346 37707 10 10 8 8 6399 5107 1 0 0 805.7404 2414.1994 3 2414.1978 0.0016 1 33.54 0.00072 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5471.5471.3.dta 7 IPI00793930.1 K-ALPHA-1 protein 346 37707 10 10 8 8 6400 5103 1 0 0 604.5572 2414.1997 4 2414.1978 0.0018 1 41.26 0.00033 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5467.5467.4.dta 7 IPI00166768.2 TUBA6 protein 344 37681 10 10 8 8 1310 4707 1 0 0 508.2927 1014.5709 2 1014.5709 0 0 71.65 1.50E-06 K DVNAAIATIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4996.4996.2.dta 7 IPI00166768.2 TUBA6 protein 344 37681 10 10 8 8 3793 6694 1 0 1 799.8875 1597.7605 2 1597.7599 0.0005 0 52.84 1.10E-05 R TIQFVDWCPTGFK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7565.7565.2.dta 7 IPI00166768.2 TUBA6 protein 344 37681 10 10 8 8 4391 6744 1 0 0 851.4562 1700.8979 2 1700.8985 -0.0006 0 70.98 2.20E-07 R AVFVDLEPTVIDEVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7625.7625.2.dta 7 IPI00166768.2 TUBA6 protein 344 37681 10 10 8 8 4392 6753 1 0 0 567.9738 1700.8994 3 1700.8985 0.0009 0 43.92 0.00063 R AVFVDLEPTVIDEVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7636.7636.3.dta 7 IPI00166768.2 TUBA6 protein 344 37681 10 10 8 8 4606 6138 1 0 0 586.3262 1755.9569 3 1755.9559 0.0009 0 44.31 0.00042 R IHFPLATYAPVISAEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6811.6811.3.dta 7 IPI00166768.2 TUBA6 protein 344 37681 10 10 8 8 4801 5481 1 0 0 912.9963 1823.9781 2 1823.9782 0 0 50.05 2.00E-05 K VGINYQPPTVVPGGDLAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5920.5920.2.dta 7 IPI00166768.2 TUBA6 protein 344 37681 10 10 8 8 4863 7060 1 0 0 614.676 1841.0062 3 1841.0047 0.0016 1 39.88 0.00033 R GHYTIGKEIIDLVLDR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8005.8005.3.dta 7 IPI00166768.2 TUBA6 protein 344 37681 10 10 8 8 5382 6384 1 0 0 1004.4478 2006.8811 2 2006.8858 -0.0047 0 67.15 5.10E-07 K TIGGGDDSFNTFFSETGAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7135.7135.2.dta 7 IPI00166768.2 TUBA6 protein 344 37681 10 10 8 8 6399 5107 1 0 0 805.7404 2414.1994 3 2414.1978 0.0016 1 33.54 0.00072 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5471.5471.3.dta 7 IPI00166768.2 TUBA6 protein 344 37681 10 10 8 8 6400 5103 1 0 0 604.5572 2414.1997 4 2414.1978 0.0018 1 41.26 0.00033 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5467.5467.4.dta 7 IPI00179709.4 Isoform 1 of Tubulin alpha-2 chain 304 50612 11 11 9 9 395 3349 1 0 0 391.2086 780.4027 2 780.4018 0.0009 0 31.81 0.013 R LSVDYGK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3459.3459.2.dta 7 IPI00179709.4 Isoform 1 of Tubulin alpha-2 chain 304 50612 11 11 9 9 1310 4707 1 0 0 508.2927 1014.5709 2 1014.5709 0 0 71.65 1.50E-06 K DVNAAIATIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4996.4996.2.dta 7 IPI00179709.4 Isoform 1 of Tubulin alpha-2 chain 304 50612 11 11 9 9 2890 4605 1 0 0 460.9042 1379.6909 3 1379.6907 0.0001 1 25.2 0.0074 R LDHKFDLMYAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4876.4876.3.dta 7 IPI00179709.4 Isoform 1 of Tubulin alpha-2 chain 304 50612 11 11 9 9 3793 6694 1 0 1 799.8875 1597.7605 2 1597.7599 0.0005 0 52.84 1.10E-05 R TIQFVDWCPTGFK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7565.7565.2.dta 7 IPI00179709.4 Isoform 1 of Tubulin alpha-2 chain 304 50612 11 11 9 9 4468 4497 1 0 0 859.9419 1717.8692 2 1717.8747 -0.0055 0 40.57 0.00016 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4746.4746.2.dta 7 IPI00179709.4 Isoform 1 of Tubulin alpha-2 chain 304 50612 11 11 9 9 4469 4477 1 0 0 573.6317 1717.8731 3 1717.8747 -0.0016 0 31.2 0.0017 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4725.4725.3.dta 7 IPI00179709.4 Isoform 1 of Tubulin alpha-2 chain 304 50612 11 11 9 9 4606 6138 1 0 0 586.3262 1755.9569 3 1755.9559 0.0009 0 44.31 0.00042 R IHFPLATYAPVISAEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6811.6811.3.dta 7 IPI00179709.4 Isoform 1 of Tubulin alpha-2 chain 304 50612 11 11 9 9 4801 5481 1 0 0 912.9963 1823.9781 2 1823.9782 0 0 50.05 2.00E-05 K VGINYQPPTVVPGGDLAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5920.5920.2.dta 7 IPI00179709.4 Isoform 1 of Tubulin alpha-2 chain 304 50612 11 11 9 9 5382 6384 1 0 0 1004.4478 2006.8811 2 2006.8858 -0.0047 0 67.15 5.10E-07 K TIGGGDDSFNTFFSETGAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7135.7135.2.dta 7 IPI00179709.4 Isoform 1 of Tubulin alpha-2 chain 304 50612 11 11 9 9 6399 5107 1 0 0 805.7404 2414.1994 3 2414.1978 0.0016 1 33.54 0.00072 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5471.5471.3.dta 7 IPI00179709.4 Isoform 1 of Tubulin alpha-2 chain 304 50612 11 11 9 9 6400 5103 1 0 0 604.5572 2414.1997 4 2414.1978 0.0018 1 41.26 0.00033 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5467.5467.4.dta 7 IPI00218345.4 Isoform 2 of Tubulin alpha-2 chain 295 46935 10 10 8 8 395 3349 1 0 0 391.2086 780.4027 2 780.4018 0.0009 0 31.81 0.013 R LSVDYGK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3459.3459.2.dta 7 IPI00218345.4 Isoform 2 of Tubulin alpha-2 chain 295 46935 10 10 8 8 1310 4707 1 0 0 508.2927 1014.5709 2 1014.5709 0 0 71.65 1.50E-06 K DVNAAIATIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4996.4996.2.dta 7 IPI00218345.4 Isoform 2 of Tubulin alpha-2 chain 295 46935 10 10 8 8 3793 6694 1 0 1 799.8875 1597.7605 2 1597.7599 0.0005 0 52.84 1.10E-05 R TIQFVDWCPTGFK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7565.7565.2.dta 7 IPI00218345.4 Isoform 2 of Tubulin alpha-2 chain 295 46935 10 10 8 8 4468 4497 1 0 0 859.9419 1717.8692 2 1717.8747 -0.0055 0 40.57 0.00016 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4746.4746.2.dta 7 IPI00218345.4 Isoform 2 of Tubulin alpha-2 chain 295 46935 10 10 8 8 4469 4477 1 0 0 573.6317 1717.8731 3 1717.8747 -0.0016 0 31.2 0.0017 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4725.4725.3.dta 7 IPI00218345.4 Isoform 2 of Tubulin alpha-2 chain 295 46935 10 10 8 8 4606 6138 1 0 0 586.3262 1755.9569 3 1755.9559 0.0009 0 44.31 0.00042 R IHFPLATYAPVISAEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6811.6811.3.dta 7 IPI00218345.4 Isoform 2 of Tubulin alpha-2 chain 295 46935 10 10 8 8 4801 5481 1 0 0 912.9963 1823.9781 2 1823.9782 0 0 50.05 2.00E-05 K VGINYQPPTVVPGGDLAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5920.5920.2.dta 7 IPI00218345.4 Isoform 2 of Tubulin alpha-2 chain 295 46935 10 10 8 8 5382 6384 1 0 0 1004.4478 2006.8811 2 2006.8858 -0.0047 0 67.15 5.10E-07 K TIGGGDDSFNTFFSETGAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7135.7135.2.dta 7 IPI00218345.4 Isoform 2 of Tubulin alpha-2 chain 295 46935 10 10 8 8 6399 5107 1 0 0 805.7404 2414.1994 3 2414.1978 0.0016 1 33.54 0.00072 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5471.5471.3.dta 7 IPI00218345.4 Isoform 2 of Tubulin alpha-2 chain 295 46935 10 10 8 8 6400 5103 1 0 0 604.5572 2414.1997 4 2414.1978 0.0018 1 41.26 0.00033 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5467.5467.4.dta 7 IPI00478908.3 29 kDa protein 275 28716 10 10 7 7 395 3349 1 0 0 391.2086 780.4027 2 780.4018 0.0009 0 31.81 0.013 R LSVDYGK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3459.3459.2.dta 7 IPI00478908.3 29 kDa protein 275 28716 10 10 7 7 4391 6744 1 0 0 851.4562 1700.8979 2 1700.8985 -0.0006 0 70.98 2.20E-07 R AVFVDLEPTVIDEVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7625.7625.2.dta 7 IPI00478908.3 29 kDa protein 275 28716 10 10 7 7 4392 6753 1 0 0 567.9738 1700.8994 3 1700.8985 0.0009 0 43.92 0.00063 R AVFVDLEPTVIDEVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7636.7636.3.dta 7 IPI00478908.3 29 kDa protein 275 28716 10 10 7 7 4468 4497 1 0 0 859.9419 1717.8692 2 1717.8747 -0.0055 0 40.57 0.00016 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4746.4746.2.dta 7 IPI00478908.3 29 kDa protein 275 28716 10 10 7 7 4469 4477 1 0 0 573.6317 1717.8731 3 1717.8747 -0.0016 0 31.2 0.0017 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4725.4725.3.dta 7 IPI00478908.3 29 kDa protein 275 28716 10 10 7 7 4606 6138 1 0 0 586.3262 1755.9569 3 1755.9559 0.0009 0 44.31 0.00042 R IHFPLATYAPVISAEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6811.6811.3.dta 7 IPI00478908.3 29 kDa protein 275 28716 10 10 7 7 4863 7060 1 0 0 614.676 1841.0062 3 1841.0047 0.0016 1 39.88 0.00033 R GHYTIGKEIIDLVLDR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8005.8005.3.dta 7 IPI00478908.3 29 kDa protein 275 28716 10 10 7 7 5382 6384 1 0 0 1004.4478 2006.8811 2 2006.8858 -0.0047 0 67.15 5.10E-07 K TIGGGDDSFNTFFSETGAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7135.7135.2.dta 7 IPI00478908.3 29 kDa protein 275 28716 10 10 7 7 6399 5107 1 0 0 805.7404 2414.1994 3 2414.1978 0.0016 1 33.54 0.00072 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5471.5471.3.dta 7 IPI00478908.3 29 kDa protein 275 28716 10 10 7 7 6400 5103 1 0 0 604.5572 2414.1997 4 2414.1978 0.0018 1 41.26 0.00033 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5467.5467.4.dta 7 IPI00410402.2 Similar to alpha tubulin 247 50568 7 7 6 6 1310 4707 1 0 0 508.2927 1014.5709 2 1014.5709 0 0 71.65 1.50E-06 K DVNAAIATIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4996.4996.2.dta 7 IPI00410402.2 Similar to alpha tubulin 247 50568 7 7 6 6 3793 6694 1 0 1 799.8875 1597.7605 2 1597.7599 0.0005 0 52.84 1.10E-05 R TIQFVDWCPTGFK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7565.7565.2.dta 7 IPI00410402.2 Similar to alpha tubulin 247 50568 7 7 6 6 4468 4497 1 0 0 859.9419 1717.8692 2 1717.8747 -0.0055 0 40.57 0.00016 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4746.4746.2.dta 7 IPI00410402.2 Similar to alpha tubulin 247 50568 7 7 6 6 4469 4477 1 0 0 573.6317 1717.8731 3 1717.8747 -0.0016 0 31.2 0.0017 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4725.4725.3.dta 7 IPI00410402.2 Similar to alpha tubulin 247 50568 7 7 6 6 4606 6138 1 0 0 586.3262 1755.9569 3 1755.9559 0.0009 0 44.31 0.00042 R IHFPLATYAPVISAEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6811.6811.3.dta 7 IPI00410402.2 Similar to alpha tubulin 247 50568 7 7 6 6 4801 5481 1 0 0 912.9963 1823.9781 2 1823.9782 0 0 50.05 2.00E-05 K VGINYQPPTVVPGGDLAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5920.5920.2.dta 7 IPI00410402.2 Similar to alpha tubulin 247 50568 7 7 6 6 5382 6384 1 0 0 1004.4478 2006.8811 2 2006.8858 -0.0047 0 67.15 5.10E-07 K TIGGGDDSFNTFFSETGAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7135.7135.2.dta 7 IPI00007750.1 Tubulin alpha-1 chain 223 50634 9 9 7 7 395 3349 1 0 0 391.2086 780.4027 2 780.4018 0.0009 0 31.81 0.013 R LSVDYGK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3459.3459.2.dta 7 IPI00007750.1 Tubulin alpha-1 chain 223 50634 9 9 7 7 2890 4605 1 0 0 460.9042 1379.6909 3 1379.6907 0.0001 1 25.2 0.0074 R LDHKFDLMYAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4876.4876.3.dta 7 IPI00007750.1 Tubulin alpha-1 chain 223 50634 9 9 7 7 3728 6646 1 0 1 792.8795 1583.7444 2 1583.7443 0.0001 0 69.09 3.30E-07 R SIQFVDWCPTGFK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7500.7500.2.dta 7 IPI00007750.1 Tubulin alpha-1 chain 223 50634 9 9 7 7 4468 4497 1 0 0 859.9419 1717.8692 2 1717.8747 -0.0055 0 40.57 0.00016 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4746.4746.2.dta 7 IPI00007750.1 Tubulin alpha-1 chain 223 50634 9 9 7 7 4469 4477 1 0 0 573.6317 1717.8731 3 1717.8747 -0.0016 0 31.2 0.0017 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4725.4725.3.dta 7 IPI00007750.1 Tubulin alpha-1 chain 223 50634 9 9 7 7 4606 6138 1 0 0 586.3262 1755.9569 3 1755.9559 0.0009 0 44.31 0.00042 R IHFPLATYAPVISAEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6811.6811.3.dta 7 IPI00007750.1 Tubulin alpha-1 chain 223 50634 9 9 7 7 4801 5481 1 0 0 912.9963 1823.9781 2 1823.9782 0 0 50.05 2.00E-05 K VGINYQPPTVVPGGDLAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5920.5920.2.dta 7 IPI00007750.1 Tubulin alpha-1 chain 223 50634 9 9 7 7 6399 5107 1 0 0 805.7404 2414.1994 3 2414.1978 0.0016 1 33.54 0.00072 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5471.5471.3.dta 7 IPI00007750.1 Tubulin alpha-1 chain 223 50634 9 9 7 7 6400 5103 1 0 0 604.5572 2414.1997 4 2414.1978 0.0018 1 41.26 0.00033 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5467.5467.4.dta 7 IPI00795002.1 19 kDa protein 213 19479 7 7 5 5 395 3349 1 0 0 391.2086 780.4027 2 780.4018 0.0009 0 31.81 0.013 R LSVDYGK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3459.3459.2.dta 7 IPI00795002.1 19 kDa protein 213 19479 7 7 5 5 4391 6744 1 0 0 851.4562 1700.8979 2 1700.8985 -0.0006 0 70.98 2.20E-07 R AVFVDLEPTVIDEVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7625.7625.2.dta 7 IPI00795002.1 19 kDa protein 213 19479 7 7 5 5 4392 6753 1 0 0 567.9738 1700.8994 3 1700.8985 0.0009 0 43.92 0.00063 R AVFVDLEPTVIDEVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7636.7636.3.dta 7 IPI00795002.1 19 kDa protein 213 19479 7 7 5 5 4863 7060 1 0 0 614.676 1841.0062 3 1841.0047 0.0016 1 39.88 0.00033 R GHYTIGKEIIDLVLDR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8005.8005.3.dta 7 IPI00795002.1 19 kDa protein 213 19479 7 7 5 5 5382 6384 1 0 0 1004.4478 2006.8811 2 2006.8858 -0.0047 0 67.15 5.10E-07 K TIGGGDDSFNTFFSETGAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7135.7135.2.dta 7 IPI00795002.1 19 kDa protein 213 19479 7 7 5 5 6399 5107 1 0 0 805.7404 2414.1994 3 2414.1978 0.0016 1 33.54 0.00072 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5471.5471.3.dta 7 IPI00795002.1 19 kDa protein 213 19479 7 7 5 5 6400 5103 1 0 0 604.5572 2414.1997 4 2414.1978 0.0018 1 41.26 0.00033 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5467.5467.4.dta 7 IPI00646909.2 Tubulin alpha-8 chain 178 50746 7 7 5 5 2890 4605 1 0 0 460.9042 1379.6909 3 1379.6907 0.0001 1 25.2 0.0074 R LDHKFDLMYAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4876.4876.3.dta 7 IPI00646909.2 Tubulin alpha-8 chain 178 50746 7 7 5 5 3793 6694 1 0 1 799.8875 1597.7605 2 1597.7599 0.0005 0 52.84 1.10E-05 R TIQFVDWCPTGFK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7565.7565.2.dta 7 IPI00646909.2 Tubulin alpha-8 chain 178 50746 7 7 5 5 4468 4497 1 0 0 859.9419 1717.8692 2 1717.8747 -0.0055 0 40.57 0.00016 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4746.4746.2.dta 7 IPI00646909.2 Tubulin alpha-8 chain 178 50746 7 7 5 5 4469 4477 1 0 0 573.6317 1717.8731 3 1717.8747 -0.0016 0 31.2 0.0017 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4725.4725.3.dta 7 IPI00646909.2 Tubulin alpha-8 chain 178 50746 7 7 5 5 4801 5481 1 0 0 912.9963 1823.9781 2 1823.9782 0 0 50.05 2.00E-05 K VGINYQPPTVVPGGDLAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5920.5920.2.dta 7 IPI00646909.2 Tubulin alpha-8 chain 178 50746 7 7 5 5 6399 5107 1 0 0 805.7404 2414.1994 3 2414.1978 0.0016 1 33.54 0.00072 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5471.5471.3.dta 7 IPI00646909.2 Tubulin alpha-8 chain 178 50746 7 7 5 5 6400 5103 1 0 0 604.5572 2414.1997 4 2414.1978 0.0018 1 41.26 0.00033 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5467.5467.4.dta 7 IPI00414274.3 similar to Tubulin alpha-3 chain 172 23560 6 6 5 5 395 3349 1 0 0 391.2086 780.4027 2 780.4018 0.0009 0 31.81 0.013 R LSVDYGK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3459.3459.2.dta 7 IPI00414274.3 similar to Tubulin alpha-3 chain 172 23560 6 6 5 5 1310 4707 1 0 0 508.2927 1014.5709 2 1014.5709 0 0 71.65 1.50E-06 K DVNAAIATIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4996.4996.2.dta 7 IPI00414274.3 similar to Tubulin alpha-3 chain 172 23560 6 6 5 5 3793 6694 1 0 1 799.8875 1597.7605 2 1597.7599 0.0005 0 52.84 1.10E-05 R TIQFVDWCPTGFK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7565.7565.2.dta 7 IPI00414274.3 similar to Tubulin alpha-3 chain 172 23560 6 6 5 5 4468 4497 1 0 0 859.9419 1717.8692 2 1717.8747 -0.0055 0 40.57 0.00016 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4746.4746.2.dta 7 IPI00414274.3 similar to Tubulin alpha-3 chain 172 23560 6 6 5 5 4469 4477 1 0 0 573.6317 1717.8731 3 1717.8747 -0.0016 0 31.2 0.0017 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4725.4725.3.dta 7 IPI00414274.3 similar to Tubulin alpha-3 chain 172 23560 6 6 5 5 4606 6138 1 0 0 586.3262 1755.9569 3 1755.9559 0.0009 0 44.31 0.00042 R IHFPLATYAPVISAEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6811.6811.3.dta 7 IPI00784332.1 Similar to Tubulin alpha-2 chain 144 17148 4 4 4 4 1310 4707 1 0 0 508.2927 1014.5709 2 1014.5709 0 0 71.65 1.50E-06 K DVNAAIATIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4996.4996.2.dta 7 IPI00784332.1 Similar to Tubulin alpha-2 chain 144 17148 4 4 4 4 2890 4605 1 0 0 460.9042 1379.6909 3 1379.6907 0.0001 1 25.2 0.0074 R LDHKFDLMYAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4876.4876.3.dta 7 IPI00784332.1 Similar to Tubulin alpha-2 chain 144 17148 4 4 4 4 3793 6694 1 0 1 799.8875 1597.7605 2 1597.7599 0.0005 0 52.84 1.10E-05 R TIQFVDWCPTGFK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7565.7565.2.dta 7 IPI00784332.1 Similar to Tubulin alpha-2 chain 144 17148 4 4 4 4 4801 5481 1 0 0 912.9963 1823.9781 2 1823.9782 0 0 50.05 2.00E-05 K VGINYQPPTVVPGGDLAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5920.5920.2.dta 7 IPI00335314.3 30 kDa protein 106 30008 5 5 3 3 395 3349 1 0 0 391.2086 780.4027 2 780.4018 0.0009 0 31.81 0.013 R LSVDYGK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3459.3459.2.dta 7 IPI00335314.3 30 kDa protein 106 30008 5 5 3 3 4468 4497 1 0 0 859.9419 1717.8692 2 1717.8747 -0.0055 0 40.57 0.00016 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4746.4746.2.dta 7 IPI00335314.3 30 kDa protein 106 30008 5 5 3 3 4469 4477 1 0 0 573.6317 1717.8731 3 1717.8747 -0.0016 0 31.2 0.0017 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4725.4725.3.dta 7 IPI00335314.3 30 kDa protein 106 30008 5 5 3 3 6399 5107 1 0 0 805.7404 2414.1994 3 2414.1978 0.0016 1 33.54 0.00072 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5471.5471.3.dta 7 IPI00335314.3 30 kDa protein 106 30008 5 5 3 3 6400 5103 1 0 0 604.5572 2414.1997 4 2414.1978 0.0018 1 41.26 0.00033 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5467.5467.4.dta 7 IPI00794009.1 22 kDa protein 67 21949 3 3 2 2 395 3349 1 0 0 391.2086 780.4027 2 780.4018 0.0009 0 31.81 0.013 R LSVDYGK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3459.3459.2.dta 7 IPI00794009.1 22 kDa protein 67 21949 3 3 2 2 6399 5107 1 0 0 805.7404 2414.1994 3 2414.1978 0.0016 1 33.54 0.00072 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5471.5471.3.dta 7 IPI00794009.1 22 kDa protein 67 21949 3 3 2 2 6400 5103 1 0 0 604.5572 2414.1997 4 2414.1978 0.0018 1 41.26 0.00033 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5467.5467.4.dta 7 IPI00017454.3 Tubulin alpha-4 chain 56 27757 2 2 1 1 4468 4497 1 0 0 859.9419 1717.8692 2 1717.8747 -0.0055 0 40.57 0.00016 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4746.4746.2.dta 7 IPI00017454.3 Tubulin alpha-4 chain 56 27757 2 2 1 1 4469 4477 1 0 0 573.6317 1717.8731 3 1717.8747 -0.0016 0 31.2 0.0017 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4725.4725.3.dta 7 IPI00062209.5 Alpha tubulin-like 32 16843 1 1 1 1 395 3349 1 0 0 391.2086 780.4027 2 780.4018 0.0009 0 31.81 0.013 R LSVDYGK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3459.3459.2.dta 7 IPI00015671.3 "tubulin, alpha-like 3" 25 50675 1 1 1 1 2890 4605 1 0 0 460.9042 1379.6909 3 1379.6907 0.0001 1 25.2 0.0074 R LDHKFDLMYAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4876.4876.3.dta 8 1 IPI00169383.3 Phosphoglycerate kinase 1 407 44985 18 18 14 14 486 2234 1 1 1 405.2114 808.4082 2 808.4079 0.0003 0 39.43 0.00086 K YAEAVTR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2193.2193.2.dta 8 1 IPI00169383.3 Phosphoglycerate kinase 1 407 44985 18 18 14 14 755 4578 1 1 1 442.7293 883.4441 2 883.4439 0.0001 0 23.32 0.011 K ELNYFAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4834.4834.2.dta 8 1 IPI00169383.3 Phosphoglycerate kinase 1 407 44985 18 18 14 14 756 4594 1 1 1 442.7294 883.4443 2 883.4439 0.0004 0 19.01 0.048 K ELNYFAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4863.4863.2.dta 8 1 IPI00169383.3 Phosphoglycerate kinase 1 407 44985 18 18 14 14 966 1927 1 1 1 469.2586 936.5026 2 936.5029 -0.0003 1 22.93 0.011 K KYAEAVTR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1854.1854.2.dta 8 1 IPI00169383.3 Phosphoglycerate kinase 1 407 44985 18 18 14 14 1434 4587 1 1 1 522.8184 1043.6223 2 1043.6226 -0.0004 1 17.73 0.027 K LTLDKLDVK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4851.4851.2.dta 8 1 IPI00169383.3 Phosphoglycerate kinase 1 407 44985 18 18 14 14 1435 4573 1 1 1 348.8815 1043.6227 3 1043.6226 0 1 22.71 0.038 K LTLDKLDVK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4829.4829.3.dta 8 1 IPI00169383.3 Phosphoglycerate kinase 1 407 44985 18 18 14 14 1676 6925 1 1 1 549.3139 1096.6133 2 1096.6128 0.0004 0 60.62 3.00E-06 K VLPGVDALSNI - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7838.7838.2.dta 8 1 IPI00169383.3 Phosphoglycerate kinase 1 407 44985 18 18 14 14 1686 1597 1 1 1 551.273 1100.5315 2 1100.5323 -0.0008 0 31.99 0.001 K NNQITNNQR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1498.1498.2.dta 8 1 IPI00169383.3 Phosphoglycerate kinase 1 407 44985 18 18 14 14 1804 3625 1 1 1 566.3101 1130.6057 2 1130.6084 -0.0027 1 33.36 0.0019 K AEPAKIEAFR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3786.3786.2.dta 8 1 IPI00169383.3 Phosphoglycerate kinase 1 407 44985 18 18 14 14 3967 4978 1 1 1 545.603 1633.7873 3 1633.7849 0.0024 0 42.12 0.00021 K LGDVYVNDAFGTAHR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5321.5321.3.dta 8 1 IPI00169383.3 Phosphoglycerate kinase 1 407 44985 18 18 14 14 4547 5011 1 1 1 580.9759 1739.9058 3 1739.9054 0.0005 0 15.44 0.036 K VSHVSTGGGASLELLEGK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5366.5366.3.dta 8 1 IPI00169383.3 Phosphoglycerate kinase 1 407 44985 18 18 14 14 4599 4634 1 1 1 877.8939 1753.7733 2 1753.7798 -0.0065 0 81.17 3.60E-08 R GCITIIGGGDTATCCAK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4911.4911.2.dta 8 1 IPI00169383.3 Phosphoglycerate kinase 1 407 44985 18 18 14 14 4650 6760 1 1 1 884.9716 1767.9286 2 1767.9301 -0.0016 0 96.95 8.10E-10 K ACANPAAGSVILLENLR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7642.7642.2.dta 8 1 IPI00169383.3 Phosphoglycerate kinase 1 407 44985 18 18 14 14 4651 6761 1 1 1 590.3171 1767.9296 3 1767.9301 -0.0005 0 68.3 3.90E-07 K ACANPAAGSVILLENLR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7643.7643.3.dta 8 1 IPI00169383.3 Phosphoglycerate kinase 1 407 44985 18 18 14 14 4652 6622 1 1 1 590.3369 1767.9889 3 1767.9883 0.0006 0 34.44 0.00059 K ALESPERPFLAILGGAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7467.7467.3.dta 8 1 IPI00169383.3 Phosphoglycerate kinase 1 407 44985 18 18 14 14 5573 8030 1 1 1 1053.0319 2104.0492 2 2104.0531 -0.0039 0 34.94 0.0029 K QIVWNGPVGVFEWEAFAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9193.9193.2.dta 8 1 IPI00169383.3 Phosphoglycerate kinase 1 407 44985 18 18 14 14 5574 8037 1 1 1 702.359 2104.0552 3 2104.0531 0.0021 0 35.25 0.00049 K QIVWNGPVGVFEWEAFAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9200.9200.3.dta 8 1 IPI00169383.3 Phosphoglycerate kinase 1 407 44985 18 18 14 14 6653 5148 1 1 1 838.7526 2513.2359 3 2513.2398 -0.0039 1 19.77 0.014 K WNTEDKVSHVSTGGGASLELLEGK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5526.5526.3.dta 8 IPI00219568.4 "Phosphoglycerate kinase, testis specific" 47 45166 3 3 3 3 3967 4978 1 0 1 545.603 1633.7873 3 1633.7849 0.0024 0 42.12 0.00021 K LGDVYVNDAFGTAHR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5321.5321.3.dta 8 IPI00219568.4 "Phosphoglycerate kinase, testis specific" 47 45166 3 3 3 3 4547 5011 1 0 1 580.9759 1739.9058 3 1739.9054 0.0005 0 15.44 0.036 K VSHVSTGGGASLELLEGK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5366.5366.3.dta 8 IPI00219568.4 "Phosphoglycerate kinase, testis specific" 47 45166 3 3 3 3 6653 5148 1 0 1 838.7526 2513.2359 3 2513.2398 -0.0039 1 19.77 0.014 K WNTEDKVSHVSTGGGASLELLEGK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5526.5526.3.dta 9 1 IPI00013881.6 Heterogeneous nuclear ribonucleoprotein H 348 49484 12 12 11 11 459 3383 1 1 1 402.1734 802.3323 2 802.332 0.0003 0 15.01 0.043 R FFSDCK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3498.3498.2.dta 9 1 IPI00013881.6 Heterogeneous nuclear ribonucleoprotein H 348 49484 12 12 11 11 1032 2277 1 1 1 478.7673 955.5201 2 955.5199 0.0002 0 26.17 0.033 K IQNGAQGIR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2242.2242.2.dta 9 1 IPI00013881.6 Heterogeneous nuclear ribonucleoprotein H 348 49484 12 12 11 11 1234 6740 1 1 1 500.2427 998.4708 2 998.4716 -0.0008 1 41.64 0.00012 K DKANMQHR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.762.762.2.dta 9 1 IPI00013881.6 Heterogeneous nuclear ribonucleoprotein H 348 49484 12 12 11 11 1245 87 1 1 1 334.4911 1000.4515 3 1000.4509 0.0007 1 14.44 0.044 K DRETMGHR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1011.1011.3.dta 9 1 IPI00013881.6 Heterogeneous nuclear ribonucleoprotein H 348 49484 12 12 11 11 1295 1422 1 1 1 507.2611 1012.5076 2 1012.509 -0.0014 1 16.61 0.041 R THYDPPRK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1306.1306.2.dta 9 1 IPI00013881.6 Heterogeneous nuclear ribonucleoprotein H 348 49484 12 12 11 11 1654 3800 1 1 0 364.8643 1091.5711 3 1091.5724 -0.0012 0 27.49 0.0026 R VHIEIGPDGR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3986.3986.3.dta 9 1 IPI00013881.6 Heterogeneous nuclear ribonucleoprotein H 348 49484 12 12 11 11 3410 5101 1 1 1 752.8455 1503.6764 2 1503.6776 -0.0013 0 70.97 2.20E-07 R GLPWSCSADEVQR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5465.5465.2.dta 9 1 IPI00013881.6 Heterogeneous nuclear ribonucleoprotein H 348 49484 12 12 11 11 4293 3218 1 1 1 562.261 1683.7613 3 1683.7601 0.0012 0 91.47 7.70E-09 K HTGPNSPDTANDGFVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3289.3289.3.dta 9 1 IPI00013881.6 Heterogeneous nuclear ribonucleoprotein H 348 49484 12 12 11 11 4862 6421 1 1 1 921.4495 1840.8844 2 1840.8843 0.0001 0 86.11 9.80E-09 R STGEAFVQFASQEIAEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7181.7181.2.dta 9 1 IPI00013881.6 Heterogeneous nuclear ribonucleoprotein H 348 49484 12 12 11 11 5343 7450 1 1 0 998.9903 1995.966 2 1995.969 -0.003 0 61.77 1.60E-06 R ATENDIYNFFSPLNPVR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8494.8494.2.dta 9 1 IPI00013881.6 Heterogeneous nuclear ribonucleoprotein H 348 49484 12 12 11 11 5344 7449 1 1 0 666.3312 1995.9717 3 1995.969 0.0027 0 40.24 0.00017 R ATENDIYNFFSPLNPVR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8493.8493.3.dta 9 1 IPI00013881.6 Heterogeneous nuclear ribonucleoprotein H 348 49484 12 12 11 11 5577 5061 1 1 1 702.9988 2105.9747 3 2105.9753 -0.0006 0 39.07 0.00022 R EGRPSGEAFVELESEDEVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5419.5419.3.dta 9 2 IPI00003881.5 Heterogeneous nuclear ribonucleoprotein F 261 45985 8 8 6 6 179 4120 1 0 1 346.7209 691.4272 2 691.4268 0.0003 0 28.25 0.0046 R YIGIVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4336.4336.2.dta 9 2 IPI00003881.5 Heterogeneous nuclear ribonucleoprotein F 261 45985 8 8 6 6 1654 3800 1 0 0 364.8643 1091.5711 3 1091.5724 -0.0012 0 27.49 0.0026 R VHIEIGPDGR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3986.3986.3.dta 9 2 IPI00003881.5 Heterogeneous nuclear ribonucleoprotein F 261 45985 8 8 6 6 3940 2957 1 0 1 815.8641 1629.7136 2 1629.7132 0.0004 0 61.72 1.60E-06 K HSGPNSADSANDGFVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2993.2993.2.dta 9 2 IPI00003881.5 Heterogeneous nuclear ribonucleoprotein F 261 45985 8 8 6 6 4980 7087 1 0 1 934.4743 1866.9341 2 1866.9363 -0.0023 0 66.13 1.40E-06 K ITGEAFVQFASQELAEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8039.8039.2.dta 9 2 IPI00003881.5 Heterogeneous nuclear ribonucleoprotein F 261 45985 8 8 6 6 4981 7089 1 0 1 623.3195 1866.9365 3 1866.9363 0.0002 0 44.68 0.00029 K ITGEAFVQFASQELAEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8042.8042.3.dta 9 2 IPI00003881.5 Heterogeneous nuclear ribonucleoprotein F 261 45985 8 8 6 6 5343 7450 1 0 0 998.9903 1995.966 2 1995.969 -0.003 0 61.77 1.60E-06 K ATENDIYNFFSPLNPVR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8494.8494.2.dta 9 2 IPI00003881.5 Heterogeneous nuclear ribonucleoprotein F 261 45985 8 8 6 6 5344 7449 1 0 0 666.3312 1995.9717 3 1995.969 0.0027 0 40.24 0.00017 K ATENDIYNFFSPLNPVR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8493.8493.3.dta 9 2 IPI00003881.5 Heterogeneous nuclear ribonucleoprotein F 261 45985 8 8 6 6 6730 7288 1 0 1 852.4355 2554.2846 3 2554.2856 -0.001 1 50.75 2.50E-05 R GLPYKATENDIYNFFSPLNPVR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8278.8278.3.dta 9 IPI00026230.1 Heterogeneous nuclear ribonucleoprotein H~ 196 49517 7 7 7 7 459 3383 1 0 1 402.1734 802.3323 2 802.332 0.0003 0 15.01 0.043 R FFSDCK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3498.3498.2.dta 9 IPI00026230.1 Heterogeneous nuclear ribonucleoprotein H~ 196 49517 7 7 7 7 1234 6740 1 0 1 500.2427 998.4708 2 998.4716 -0.0008 1 41.64 0.00012 K DKANMQHR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.762.762.2.dta 9 IPI00026230.1 Heterogeneous nuclear ribonucleoprotein H~ 196 49517 7 7 7 7 1245 87 1 0 1 334.4911 1000.4515 3 1000.4509 0.0007 1 14.44 0.044 K DRETMGHR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1011.1011.3.dta 9 IPI00026230.1 Heterogeneous nuclear ribonucleoprotein H~ 196 49517 7 7 7 7 1295 1422 1 0 1 507.2611 1012.5076 2 1012.509 -0.0014 1 16.61 0.041 R THYDPPRK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1306.1306.2.dta 9 IPI00026230.1 Heterogeneous nuclear ribonucleoprotein H~ 196 49517 7 7 7 7 1654 3800 1 0 0 364.8643 1091.5711 3 1091.5724 -0.0012 0 27.49 0.0026 R VHIEIGPDGR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3986.3986.3.dta 9 IPI00026230.1 Heterogeneous nuclear ribonucleoprotein H~ 196 49517 7 7 7 7 4293 3218 1 0 1 562.261 1683.7613 3 1683.7601 0.0012 0 91.47 7.70E-09 K HTGPNSPDTANDGFVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3289.3289.3.dta 9 IPI00026230.1 Heterogeneous nuclear ribonucleoprotein H~ 196 49517 7 7 7 7 4862 6421 1 0 1 921.4495 1840.8844 2 1840.8843 0.0001 0 86.11 9.80E-09 R STGEAFVQFASQEIAEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7181.7181.2.dta 10 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 320 57510 13 13 10 10 565 2912 1 1 1 417.7502 833.4859 2 833.4858 0.0001 0 43.34 0.00039 K VTSVSTLK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2945.2945.2.dta 10 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 320 57510 13 13 10 10 1002 1449 1 1 1 316.1826 945.5258 3 945.5243 0.0015 1 42.55 0.00098 K IRQDSVTK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1335.1335.3.dta 10 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 320 57510 13 13 10 10 1433 4343 1 1 1 522.7499 1043.4853 2 1043.4858 -0.0005 0 33.13 0.00078 R QLNMYGFR K Oxidation (M) 0.00010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4578.4578.2.dta 10 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 320 57510 13 13 10 10 1482 3635 1 1 1 527.7564 1053.4983 2 1053.4992 -0.0009 0 44.51 6.70E-05 K HENEALWR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3797.3797.2.dta 10 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 320 57510 13 13 10 10 1507 5563 1 1 1 530.8078 1059.601 2 1059.5998 0.0012 0 56.07 3.50E-05 K LLTDVQLMK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6013.6013.2.dta 10 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 320 57510 13 13 10 10 1559 3524 1 1 1 538.2583 1074.502 2 1074.5029 -0.0008 0 38.89 0.00023 K HNNMASFVR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3671.3671.2.dta 10 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 320 57510 13 13 10 10 1568 4662 1 1 1 538.8049 1075.5953 2 1075.5947 0.0006 0 40.71 0.0018 K LLTDVQLMK G Oxidation (M) 0.000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4945.4945.2.dta 10 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 320 57510 13 13 10 10 1644 2484 1 1 1 546.2554 1090.4963 2 1090.4978 -0.0015 0 63.87 1.90E-06 K HNNMASFVR Q Oxidation (M) 0.000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2476.2476.2.dta 10 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 320 57510 13 13 10 10 1957 4855 1 1 1 586.3224 1170.6302 2 1170.6244 0.0058 0 57.3 2.90E-05 R GQEQLLENIK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5175.5175.2.dta 10 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 320 57510 13 13 10 10 2641 4188 1 1 1 664.3681 1326.7217 2 1326.7255 -0.0039 1 56.86 4.70E-06 R GQEQLLENIKR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4408.4408.2.dta 10 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 320 57510 13 13 10 10 2642 4178 1 1 1 443.2489 1326.7248 3 1326.7255 -0.0007 1 33.18 0.008 R GQEQLLENIKR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4399.4399.3.dta 10 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 320 57510 13 13 10 10 3622 5144 1 1 1 522.2333 1563.6782 3 1563.6776 0.0005 0 16.37 0.044 R DDTEFQHPCFLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5521.5521.3.dta 10 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 320 57510 13 13 10 10 7642 8261 1 1 1 941.8408 2822.5006 3 2822.5025 -0.0019 0 32.74 0.0022 R VEEASPGRPSSVDTLLSPTALIDSILR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9474.9474.3.dta 10 IPI00012878.1 Heat shock factor protein 2 103 60482 3 3 2 2 1433 4343 1 0 1 522.7499 1043.4853 2 1043.4858 -0.0005 0 33.13 0.00078 R QLNMYGFR K Oxidation (M) 0.00010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4578.4578.2.dta 10 IPI00012878.1 Heat shock factor protein 2 103 60482 3 3 2 2 1559 3524 1 0 1 538.2583 1074.502 2 1074.5029 -0.0008 0 38.89 0.00023 K HNNMASFVR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3671.3671.2.dta 10 IPI00012878.1 Heat shock factor protein 2 103 60482 3 3 2 2 1644 2484 1 0 1 546.2554 1090.4963 2 1090.4978 -0.0015 0 63.87 1.90E-06 K HNNMASFVR Q Oxidation (M) 0.000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2476.2476.2.dta 10 IPI00008456.1 Isoform HSF4B of Heat shock factor protein 4 33 53362 1 1 1 1 1433 4343 1 0 1 522.7499 1043.4853 2 1043.4858 -0.0005 0 33.13 0.00078 R QLNMYGFR K Oxidation (M) 0.00010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4578.4578.2.dta 11 1 IPI00465439.5 Fructose-bisphosphate aldolase A 279 39851 9 9 8 8 455 3189 1 1 1 401.2449 800.4753 2 800.4756 -0.0003 0 69.1 2.80E-06 R ALQASALK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3258.3258.2.dta 11 1 IPI00465439.5 Fructose-bisphosphate aldolase A 279 39851 9 9 8 8 984 2876 1 1 1 470.7458 939.4771 2 939.4774 -0.0003 0 47.71 0.00031 K ELSDIAHR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2906.2906.2.dta 11 1 IPI00465439.5 Fructose-bisphosphate aldolase A 279 39851 9 9 8 8 1658 1956 1 1 1 547.285 1092.5554 2 1092.5563 -0.0009 1 61.57 1.20E-05 K AAQEEYVKR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1892.1892.2.dta 11 1 IPI00465439.5 Fructose-bisphosphate aldolase A 279 39851 9 9 8 8 2662 4326 1 1 1 666.8522 1331.6899 2 1331.6932 -0.0033 0 75.25 2.00E-07 K GILAADESTGSIAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4560.4560.2.dta 11 1 IPI00465439.5 Fructose-bisphosphate aldolase A 279 39851 9 9 8 8 2694 4485 1 1 1 671.8586 1341.7027 2 1341.7041 -0.0014 0 28.41 0.027 K ADDGRPFPQVIK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4733.4733.2.dta 11 1 IPI00465439.5 Fructose-bisphosphate aldolase A 279 39851 9 9 8 8 3359 3812 1 1 1 496.9384 1487.7935 3 1487.7943 -0.0008 1 16.51 0.04 K GILAADESTGSIAKR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3999.3999.3.dta 11 1 IPI00465439.5 Fructose-bisphosphate aldolase A 279 39851 9 9 8 8 5578 6412 1 1 1 703.0367 2106.0882 3 2106.0891 -0.0009 0 68.06 4.20E-07 K IGEHTPSALAIMENANVLAR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7171.7171.3.dta 11 1 IPI00465439.5 Fructose-bisphosphate aldolase A 279 39851 9 9 8 8 5602 5149 1 1 1 708.3691 2122.0854 3 2122.084 0.0014 0 56.75 4.80E-06 K IGEHTPSALAIMENANVLAR Y Oxidation (M) 0.00000000000100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5527.5527.3.dta 11 1 IPI00465439.5 Fructose-bisphosphate aldolase A 279 39851 9 9 8 8 5737 5627 1 1 1 743.3458 2227.0155 3 2227.0182 -0.0027 0 18.85 0.017 K YTPSGQAGAAASESLFVSNHAY - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6107.6107.3.dta 11 IPI00791070.1 23 kDa protein 194 23062 6 6 5 5 984 2876 1 0 1 470.7458 939.4771 2 939.4774 -0.0003 0 47.71 0.00031 K ELSDIAHR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2906.2906.2.dta 11 IPI00791070.1 23 kDa protein 194 23062 6 6 5 5 2662 4326 1 0 1 666.8522 1331.6899 2 1331.6932 -0.0033 0 75.25 2.00E-07 K GILAADESTGSIAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4560.4560.2.dta 11 IPI00791070.1 23 kDa protein 194 23062 6 6 5 5 2694 4485 1 0 1 671.8586 1341.7027 2 1341.7041 -0.0014 0 28.41 0.027 K ADDGRPFPQVIK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4733.4733.2.dta 11 IPI00791070.1 23 kDa protein 194 23062 6 6 5 5 3359 3812 1 0 1 496.9384 1487.7935 3 1487.7943 -0.0008 1 16.51 0.04 K GILAADESTGSIAKR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3999.3999.3.dta 11 IPI00791070.1 23 kDa protein 194 23062 6 6 5 5 5578 6412 1 0 1 703.0367 2106.0882 3 2106.0891 -0.0009 0 68.06 4.20E-07 K IGEHTPSALAIMENANVLAR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7171.7171.3.dta 11 IPI00791070.1 23 kDa protein 194 23062 6 6 5 5 5602 5149 1 0 1 708.3691 2122.0854 3 2122.084 0.0014 0 56.75 4.80E-06 K IGEHTPSALAIMENANVLAR Y Oxidation (M) 0.00000000000100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5527.5527.3.dta 11 IPI00789118.1 Protein 192 23121 4 4 3 3 455 3189 1 0 1 401.2449 800.4753 2 800.4756 -0.0003 0 69.1 2.80E-06 R ALQASALK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3258.3258.2.dta 11 IPI00789118.1 Protein 192 23121 4 4 3 3 1658 1956 1 0 1 547.285 1092.5554 2 1092.5563 -0.0009 1 61.57 1.20E-05 K AAQEEYVKR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1892.1892.2.dta 11 IPI00789118.1 Protein 192 23121 4 4 3 3 5578 6412 1 0 1 703.0367 2106.0882 3 2106.0891 -0.0009 0 68.06 4.20E-07 K IGEHTPSALAIMENANVLAR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7171.7171.3.dta 11 IPI00789118.1 Protein 192 23121 4 4 3 3 5602 5149 1 0 1 708.3691 2122.0854 3 2122.084 0.0014 0 56.75 4.80E-06 K IGEHTPSALAIMENANVLAR Y Oxidation (M) 0.00000000000100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5527.5527.3.dta 11 IPI00797597.1 18 kDa protein 139 17953 4 4 3 3 984 2876 1 0 1 470.7458 939.4771 2 939.4774 -0.0003 0 47.71 0.00031 K ELSDIAHR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2906.2906.2.dta 11 IPI00797597.1 18 kDa protein 139 17953 4 4 3 3 2694 4485 1 0 1 671.8586 1341.7027 2 1341.7041 -0.0014 0 28.41 0.027 K ADDGRPFPQVIK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4733.4733.2.dta 11 IPI00797597.1 18 kDa protein 139 17953 4 4 3 3 5578 6412 1 0 1 703.0367 2106.0882 3 2106.0891 -0.0009 0 68.06 4.20E-07 K IGEHTPSALAIMENANVLAR - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7171.7171.3.dta 11 IPI00797597.1 18 kDa protein 139 17953 4 4 3 3 5602 5149 1 0 1 708.3691 2122.0854 3 2122.084 0.0014 0 56.75 4.80E-06 K IGEHTPSALAIMENANVLAR - Oxidation (M) 0.00000000000100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5527.5527.3.dta 11 IPI00791830.1 20 kDa protein 103 19592 4 4 4 4 984 2876 1 0 1 470.7458 939.4771 2 939.4774 -0.0003 0 47.71 0.00031 K ELSDIAHR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2906.2906.2.dta 11 IPI00791830.1 20 kDa protein 103 19592 4 4 4 4 2662 4326 1 0 1 666.8522 1331.6899 2 1331.6932 -0.0033 0 75.25 2.00E-07 K GILAADESTGSIAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4560.4560.2.dta 11 IPI00791830.1 20 kDa protein 103 19592 4 4 4 4 2694 4485 1 0 1 671.8586 1341.7027 2 1341.7041 -0.0014 0 28.41 0.027 K ADDGRPFPQVIK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4733.4733.2.dta 11 IPI00791830.1 20 kDa protein 103 19592 4 4 4 4 3359 3812 1 0 1 496.9384 1487.7935 3 1487.7943 -0.0008 1 16.51 0.04 K GILAADESTGSIAKR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3999.3999.3.dta 11 IPI00798237.1 15 kDa protein 51 15624 2 2 2 2 984 2876 1 0 1 470.7458 939.4771 2 939.4774 -0.0003 0 47.71 0.00031 K ELSDIAHR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2906.2906.2.dta 11 IPI00798237.1 15 kDa protein 51 15624 2 2 2 2 2694 4485 1 0 1 671.8586 1341.7027 2 1341.7041 -0.0014 0 28.41 0.027 K ADDGRPFPQVIK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4733.4733.2.dta 12 1 IPI00384938.1 Hypothetical protein DKFZp686N02209 267 53503 16 16 4 4 568 5109 1 1 1 418.2206 834.4267 2 834.4269 -0.0003 0 40.69 0.0026 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5475.5475.2.dta 12 1 IPI00384938.1 Hypothetical protein DKFZp686N02209 267 53503 16 16 4 4 569 4674 1 1 1 418.2208 834.4271 2 834.4269 0.0002 0 33.79 0.013 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4959.4959.2.dta 12 1 IPI00384938.1 Hypothetical protein DKFZp686N02209 267 53503 16 16 4 4 571 4904 1 1 1 418.221 834.4275 2 834.4269 0.0006 0 49.95 0.00031 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5232.5232.2.dta 12 1 IPI00384938.1 Hypothetical protein DKFZp686N02209 267 53503 16 16 4 4 572 4403 1 1 1 418.2212 834.4278 2 834.4269 0.0009 0 38.89 0.0039 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4646.4646.2.dta 12 1 IPI00384938.1 Hypothetical protein DKFZp686N02209 267 53503 16 16 4 4 573 4261 1 1 1 418.2213 834.428 2 834.4269 0.0011 0 41.26 0.0021 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4489.4489.2.dta 12 1 IPI00384938.1 Hypothetical protein DKFZp686N02209 267 53503 16 16 4 4 578 3013 1 1 1 418.7411 835.4676 2 835.4664 0.0012 1 42.13 0.00082 K GRFTISR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3060.3060.2.dta 12 1 IPI00384938.1 Hypothetical protein DKFZp686N02209 267 53503 16 16 4 4 655 3752 1 1 1 426.2172 850.4198 2 850.4218 -0.002 0 36.43 0.0043 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3931.3931.2.dta 12 1 IPI00384938.1 Hypothetical protein DKFZp686N02209 267 53503 16 16 4 4 656 4051 1 1 1 426.2177 850.4208 2 850.4218 -0.001 0 46.41 0.00041 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4259.4259.2.dta 12 1 IPI00384938.1 Hypothetical protein DKFZp686N02209 267 53503 16 16 4 4 658 4180 1 1 1 426.2178 850.4211 2 850.4218 -0.0008 0 36.38 0.0041 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4400.4400.2.dta 12 1 IPI00384938.1 Hypothetical protein DKFZp686N02209 267 53503 16 16 4 4 659 133 2 1 1 426.2179 850.4213 2 850.4218 -0.0005 0 24.17 0.021 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.10174.10174.2.dta 12 1 IPI00384938.1 Hypothetical protein DKFZp686N02209 267 53503 16 16 4 4 660 3495 1 1 1 426.218 850.4214 2 850.4218 -0.0005 0 35.87 0.0069 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3635.3635.2.dta 12 1 IPI00384938.1 Hypothetical protein DKFZp686N02209 267 53503 16 16 4 4 662 4472 1 1 1 426.218 850.4215 2 850.4218 -0.0004 0 35.7 0.0071 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4719.4719.2.dta 12 1 IPI00384938.1 Hypothetical protein DKFZp686N02209 267 53503 16 16 4 4 667 3908 1 1 1 426.2181 850.4217 2 850.4218 -0.0001 0 36.4 0.0061 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4103.4103.2.dta 12 1 IPI00384938.1 Hypothetical protein DKFZp686N02209 267 53503 16 16 4 4 2382 4684 1 1 1 634.3831 1266.7517 2 1266.7547 -0.003 1 48.69 5.70E-05 K ALPAPIEKTISK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4971.4971.2.dta 12 1 IPI00384938.1 Hypothetical protein DKFZp686N02209 267 53503 16 16 4 4 2383 4274 1 1 1 634.3834 1266.7523 2 1266.7547 -0.0024 1 64.39 1.50E-06 K ALPAPIEKTISK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4503.4503.2.dta 12 1 IPI00384938.1 Hypothetical protein DKFZp686N02209 267 53503 16 16 4 4 8413 6687 1 1 1 834.4093 3333.6081 4 3333.6349 -0.0268 1 18.74 0.02 K SCDKTHTCPPCPAPELLGGPSVFLFPPKPK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7559.7559.4.dta 12 IPI00827754.1 C gamma 3 263 58194 15 15 3 3 568 5109 1 0 1 418.2206 834.4267 2 834.4269 -0.0003 0 40.69 0.0026 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5475.5475.2.dta 12 IPI00827754.1 C gamma 3 263 58194 15 15 3 3 569 4674 1 0 1 418.2208 834.4271 2 834.4269 0.0002 0 33.79 0.013 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4959.4959.2.dta 12 IPI00827754.1 C gamma 3 263 58194 15 15 3 3 571 4904 1 0 1 418.221 834.4275 2 834.4269 0.0006 0 49.95 0.00031 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5232.5232.2.dta 12 IPI00827754.1 C gamma 3 263 58194 15 15 3 3 572 4403 1 0 1 418.2212 834.4278 2 834.4269 0.0009 0 38.89 0.0039 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4646.4646.2.dta 12 IPI00827754.1 C gamma 3 263 58194 15 15 3 3 573 4261 1 0 1 418.2213 834.428 2 834.4269 0.0011 0 41.26 0.0021 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4489.4489.2.dta 12 IPI00827754.1 C gamma 3 263 58194 15 15 3 3 578 3013 1 0 1 418.7411 835.4676 2 835.4664 0.0012 1 42.13 0.00082 K GRFTISR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3060.3060.2.dta 12 IPI00827754.1 C gamma 3 263 58194 15 15 3 3 655 3752 1 0 1 426.2172 850.4198 2 850.4218 -0.002 0 36.43 0.0043 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3931.3931.2.dta 12 IPI00827754.1 C gamma 3 263 58194 15 15 3 3 656 4051 1 0 1 426.2177 850.4208 2 850.4218 -0.001 0 46.41 0.00041 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4259.4259.2.dta 12 IPI00827754.1 C gamma 3 263 58194 15 15 3 3 658 4180 1 0 1 426.2178 850.4211 2 850.4218 -0.0008 0 36.38 0.0041 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4400.4400.2.dta 12 IPI00827754.1 C gamma 3 263 58194 15 15 3 3 659 133 2 0 1 426.2179 850.4213 2 850.4218 -0.0005 0 24.17 0.021 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.10174.10174.2.dta 12 IPI00827754.1 C gamma 3 263 58194 15 15 3 3 660 3495 1 0 1 426.218 850.4214 2 850.4218 -0.0005 0 35.87 0.0069 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3635.3635.2.dta 12 IPI00827754.1 C gamma 3 263 58194 15 15 3 3 662 4472 1 0 1 426.218 850.4215 2 850.4218 -0.0004 0 35.7 0.0071 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4719.4719.2.dta 12 IPI00827754.1 C gamma 3 263 58194 15 15 3 3 667 3908 1 0 1 426.2181 850.4217 2 850.4218 -0.0001 0 36.4 0.0061 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4103.4103.2.dta 12 IPI00827754.1 C gamma 3 263 58194 15 15 3 3 2382 4684 1 0 1 634.3831 1266.7517 2 1266.7547 -0.003 1 48.69 5.70E-05 K ALPAPIEKTISK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4971.4971.2.dta 12 IPI00827754.1 C gamma 3 263 58194 15 15 3 3 2383 4274 1 0 1 634.3834 1266.7523 2 1266.7547 -0.0024 1 64.39 1.50E-06 K ALPAPIEKTISK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4503.4503.2.dta 12 IPI00382606.1 Factor VII active site mutant immunoconjugate 249 77386 15 15 3 3 568 5109 1 0 1 418.2206 834.4267 2 834.4269 -0.0003 0 40.69 0.0026 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5475.5475.2.dta 12 IPI00382606.1 Factor VII active site mutant immunoconjugate 249 77386 15 15 3 3 569 4674 1 0 1 418.2208 834.4271 2 834.4269 0.0002 0 33.79 0.013 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4959.4959.2.dta 12 IPI00382606.1 Factor VII active site mutant immunoconjugate 249 77386 15 15 3 3 571 4904 1 0 1 418.221 834.4275 2 834.4269 0.0006 0 49.95 0.00031 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5232.5232.2.dta 12 IPI00382606.1 Factor VII active site mutant immunoconjugate 249 77386 15 15 3 3 572 4403 1 0 1 418.2212 834.4278 2 834.4269 0.0009 0 38.89 0.0039 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4646.4646.2.dta 12 IPI00382606.1 Factor VII active site mutant immunoconjugate 249 77386 15 15 3 3 573 4261 1 0 1 418.2213 834.428 2 834.4269 0.0011 0 41.26 0.0021 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4489.4489.2.dta 12 IPI00382606.1 Factor VII active site mutant immunoconjugate 249 77386 15 15 3 3 655 3752 1 0 1 426.2172 850.4198 2 850.4218 -0.002 0 36.43 0.0043 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3931.3931.2.dta 12 IPI00382606.1 Factor VII active site mutant immunoconjugate 249 77386 15 15 3 3 656 4051 1 0 1 426.2177 850.4208 2 850.4218 -0.001 0 46.41 0.00041 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4259.4259.2.dta 12 IPI00382606.1 Factor VII active site mutant immunoconjugate 249 77386 15 15 3 3 658 4180 1 0 1 426.2178 850.4211 2 850.4218 -0.0008 0 36.38 0.0041 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4400.4400.2.dta 12 IPI00382606.1 Factor VII active site mutant immunoconjugate 249 77386 15 15 3 3 659 133 2 0 1 426.2179 850.4213 2 850.4218 -0.0005 0 24.17 0.021 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.10174.10174.2.dta 12 IPI00382606.1 Factor VII active site mutant immunoconjugate 249 77386 15 15 3 3 660 3495 1 0 1 426.218 850.4214 2 850.4218 -0.0005 0 35.87 0.0069 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3635.3635.2.dta 12 IPI00382606.1 Factor VII active site mutant immunoconjugate 249 77386 15 15 3 3 662 4472 1 0 1 426.218 850.4215 2 850.4218 -0.0004 0 35.7 0.0071 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4719.4719.2.dta 12 IPI00382606.1 Factor VII active site mutant immunoconjugate 249 77386 15 15 3 3 667 3908 1 0 1 426.2181 850.4217 2 850.4218 -0.0001 0 36.4 0.0061 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4103.4103.2.dta 12 IPI00382606.1 Factor VII active site mutant immunoconjugate 249 77386 15 15 3 3 2382 4684 1 0 1 634.3831 1266.7517 2 1266.7547 -0.003 1 48.69 5.70E-05 K ALPAPIEKTISK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4971.4971.2.dta 12 IPI00382606.1 Factor VII active site mutant immunoconjugate 249 77386 15 15 3 3 2383 4274 1 0 1 634.3834 1266.7523 2 1266.7547 -0.0024 1 64.39 1.50E-06 K ALPAPIEKTISK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4503.4503.2.dta 12 IPI00382606.1 Factor VII active site mutant immunoconjugate 249 77386 15 15 3 3 8413 6687 1 0 1 834.4093 3333.6081 4 3333.6349 -0.0268 1 18.74 0.02 K SCDKTHTCPPCPAPELLGGPSVFLFPPKPK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7559.7559.4.dta 12 IPI00168728.1 FLJ00385 protein (Fragment) 245 57272 14 14 2 2 568 5109 1 0 1 418.2206 834.4267 2 834.4269 -0.0003 0 40.69 0.0026 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5475.5475.2.dta 12 IPI00168728.1 FLJ00385 protein (Fragment) 245 57272 14 14 2 2 569 4674 1 0 1 418.2208 834.4271 2 834.4269 0.0002 0 33.79 0.013 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4959.4959.2.dta 12 IPI00168728.1 FLJ00385 protein (Fragment) 245 57272 14 14 2 2 571 4904 1 0 1 418.221 834.4275 2 834.4269 0.0006 0 49.95 0.00031 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5232.5232.2.dta 12 IPI00168728.1 FLJ00385 protein (Fragment) 245 57272 14 14 2 2 572 4403 1 0 1 418.2212 834.4278 2 834.4269 0.0009 0 38.89 0.0039 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4646.4646.2.dta 12 IPI00168728.1 FLJ00385 protein (Fragment) 245 57272 14 14 2 2 573 4261 1 0 1 418.2213 834.428 2 834.4269 0.0011 0 41.26 0.0021 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4489.4489.2.dta 12 IPI00168728.1 FLJ00385 protein (Fragment) 245 57272 14 14 2 2 655 3752 1 0 1 426.2172 850.4198 2 850.4218 -0.002 0 36.43 0.0043 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3931.3931.2.dta 12 IPI00168728.1 FLJ00385 protein (Fragment) 245 57272 14 14 2 2 656 4051 1 0 1 426.2177 850.4208 2 850.4218 -0.001 0 46.41 0.00041 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4259.4259.2.dta 12 IPI00168728.1 FLJ00385 protein (Fragment) 245 57272 14 14 2 2 658 4180 1 0 1 426.2178 850.4211 2 850.4218 -0.0008 0 36.38 0.0041 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4400.4400.2.dta 12 IPI00168728.1 FLJ00385 protein (Fragment) 245 57272 14 14 2 2 659 133 2 0 1 426.2179 850.4213 2 850.4218 -0.0005 0 24.17 0.021 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.10174.10174.2.dta 12 IPI00168728.1 FLJ00385 protein (Fragment) 245 57272 14 14 2 2 660 3495 1 0 1 426.218 850.4214 2 850.4218 -0.0005 0 35.87 0.0069 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3635.3635.2.dta 12 IPI00168728.1 FLJ00385 protein (Fragment) 245 57272 14 14 2 2 662 4472 1 0 1 426.218 850.4215 2 850.4218 -0.0004 0 35.7 0.0071 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4719.4719.2.dta 12 IPI00168728.1 FLJ00385 protein (Fragment) 245 57272 14 14 2 2 667 3908 1 0 1 426.2181 850.4217 2 850.4218 -0.0001 0 36.4 0.0061 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4103.4103.2.dta 12 IPI00168728.1 FLJ00385 protein (Fragment) 245 57272 14 14 2 2 2382 4684 1 0 1 634.3831 1266.7517 2 1266.7547 -0.003 1 48.69 5.70E-05 K ALPAPIEKTISK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4971.4971.2.dta 12 IPI00168728.1 FLJ00385 protein (Fragment) 245 57272 14 14 2 2 2383 4274 1 0 1 634.3834 1266.7523 2 1266.7547 -0.0024 1 64.39 1.50E-06 K ALPAPIEKTISK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4503.4503.2.dta 12 IPI00426051.3 Hypothetical protein DKFZp686C15213 189 51864 13 13 2 2 568 5109 1 0 1 418.2206 834.4267 2 834.4269 -0.0003 0 40.69 0.0026 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5475.5475.2.dta 12 IPI00426051.3 Hypothetical protein DKFZp686C15213 189 51864 13 13 2 2 569 4674 1 0 1 418.2208 834.4271 2 834.4269 0.0002 0 33.79 0.013 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4959.4959.2.dta 12 IPI00426051.3 Hypothetical protein DKFZp686C15213 189 51864 13 13 2 2 571 4904 1 0 1 418.221 834.4275 2 834.4269 0.0006 0 49.95 0.00031 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5232.5232.2.dta 12 IPI00426051.3 Hypothetical protein DKFZp686C15213 189 51864 13 13 2 2 572 4403 1 0 1 418.2212 834.4278 2 834.4269 0.0009 0 38.89 0.0039 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4646.4646.2.dta 12 IPI00426051.3 Hypothetical protein DKFZp686C15213 189 51864 13 13 2 2 573 4261 1 0 1 418.2213 834.428 2 834.4269 0.0011 0 41.26 0.0021 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4489.4489.2.dta 12 IPI00426051.3 Hypothetical protein DKFZp686C15213 189 51864 13 13 2 2 578 3013 1 0 1 418.7411 835.4676 2 835.4664 0.0012 1 42.13 0.00082 K GRFTISR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3060.3060.2.dta 12 IPI00426051.3 Hypothetical protein DKFZp686C15213 189 51864 13 13 2 2 655 3752 1 0 1 426.2172 850.4198 2 850.4218 -0.002 0 36.43 0.0043 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3931.3931.2.dta 12 IPI00426051.3 Hypothetical protein DKFZp686C15213 189 51864 13 13 2 2 656 4051 1 0 1 426.2177 850.4208 2 850.4218 -0.001 0 46.41 0.00041 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4259.4259.2.dta 12 IPI00426051.3 Hypothetical protein DKFZp686C15213 189 51864 13 13 2 2 658 4180 1 0 1 426.2178 850.4211 2 850.4218 -0.0008 0 36.38 0.0041 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4400.4400.2.dta 12 IPI00426051.3 Hypothetical protein DKFZp686C15213 189 51864 13 13 2 2 659 133 2 0 1 426.2179 850.4213 2 850.4218 -0.0005 0 24.17 0.021 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.10174.10174.2.dta 12 IPI00426051.3 Hypothetical protein DKFZp686C15213 189 51864 13 13 2 2 660 3495 1 0 1 426.218 850.4214 2 850.4218 -0.0005 0 35.87 0.0069 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3635.3635.2.dta 12 IPI00426051.3 Hypothetical protein DKFZp686C15213 189 51864 13 13 2 2 662 4472 1 0 1 426.218 850.4215 2 850.4218 -0.0004 0 35.7 0.0071 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4719.4719.2.dta 12 IPI00426051.3 Hypothetical protein DKFZp686C15213 189 51864 13 13 2 2 667 3908 1 0 1 426.2181 850.4217 2 850.4218 -0.0001 0 36.4 0.0061 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4103.4103.2.dta 12 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 171 46716 12 12 1 1 568 5109 1 0 1 418.2206 834.4267 2 834.4269 -0.0003 0 40.69 0.0026 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5475.5475.2.dta 12 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 171 46716 12 12 1 1 569 4674 1 0 1 418.2208 834.4271 2 834.4269 0.0002 0 33.79 0.013 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4959.4959.2.dta 12 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 171 46716 12 12 1 1 571 4904 1 0 1 418.221 834.4275 2 834.4269 0.0006 0 49.95 0.00031 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5232.5232.2.dta 12 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 171 46716 12 12 1 1 572 4403 1 0 1 418.2212 834.4278 2 834.4269 0.0009 0 38.89 0.0039 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4646.4646.2.dta 12 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 171 46716 12 12 1 1 573 4261 1 0 1 418.2213 834.428 2 834.4269 0.0011 0 41.26 0.0021 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4489.4489.2.dta 12 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 171 46716 12 12 1 1 655 3752 1 0 1 426.2172 850.4198 2 850.4218 -0.002 0 36.43 0.0043 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3931.3931.2.dta 12 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 171 46716 12 12 1 1 656 4051 1 0 1 426.2177 850.4208 2 850.4218 -0.001 0 46.41 0.00041 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4259.4259.2.dta 12 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 171 46716 12 12 1 1 658 4180 1 0 1 426.2178 850.4211 2 850.4218 -0.0008 0 36.38 0.0041 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4400.4400.2.dta 12 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 171 46716 12 12 1 1 659 133 2 0 1 426.2179 850.4213 2 850.4218 -0.0005 0 24.17 0.021 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.10174.10174.2.dta 12 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 171 46716 12 12 1 1 660 3495 1 0 1 426.218 850.4214 2 850.4218 -0.0005 0 35.87 0.0069 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3635.3635.2.dta 12 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 171 46716 12 12 1 1 662 4472 1 0 1 426.218 850.4215 2 850.4218 -0.0004 0 35.7 0.0071 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4719.4719.2.dta 12 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 171 46716 12 12 1 1 667 3908 1 0 1 426.2181 850.4217 2 850.4218 -0.0001 0 36.4 0.0061 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4103.4103.2.dta 12 IPI00748998.1 Single-chain Fv (Fragment) 47 25782 2 2 2 2 109 4454 1 0 1 325.2175 648.4204 2 648.421 -0.0006 0 25.19 0.0074 K LLIYK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4700.4700.2.dta 12 IPI00748998.1 Single-chain Fv (Fragment) 47 25782 2 2 2 2 578 3013 1 0 1 418.7411 835.4676 2 835.4664 0.0012 1 42.13 0.00082 K GRFTISR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3060.3060.2.dta 13 1 IPI00000875.6 Elongation factor 1-gamma 266 50429 9 9 8 8 345 4452 1 1 1 381.7108 761.4071 2 761.4072 -0.0001 0 41.13 0.0019 R TPEFLR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4699.4699.2.dta 13 1 IPI00000875.6 Elongation factor 1-gamma 266 50429 9 9 8 8 1740 7317 1 1 1 559.8447 1117.6749 2 1117.6747 0.0002 0 49.04 3.40E-05 R ILGLLDAYLK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8313.8313.2.dta 13 1 IPI00000875.6 Elongation factor 1-gamma 266 50429 9 9 8 8 1765 3709 1 1 1 562.3158 1122.617 2 1122.6186 -0.0015 1 37.1 0.0024 K AKDPFAHLPK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3879.3879.2.dta 13 1 IPI00000875.6 Elongation factor 1-gamma 266 50429 9 9 8 8 1766 3700 1 1 1 375.214 1122.6202 3 1122.6186 0.0017 1 43.8 0.00016 K AKDPFAHLPK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3870.3870.3.dta 13 1 IPI00000875.6 Elongation factor 1-gamma 266 50429 9 9 8 8 2265 5378 1 1 1 621.329 1240.6434 2 1240.6452 -0.0018 1 49.21 2.40E-05 K STFVLDEFKR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5797.5797.2.dta 13 1 IPI00000875.6 Elongation factor 1-gamma 266 50429 9 9 8 8 2724 4426 1 1 1 674.3718 1346.7291 2 1346.7306 -0.0015 0 61.41 1.90E-06 K ALIAAQYSGAQVR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4671.4671.2.dta 13 1 IPI00000875.6 Elongation factor 1-gamma 266 50429 9 9 8 8 3181 4172 1 1 1 722.8674 1443.7203 2 1443.7205 -0.0002 0 48.54 2.80E-05 K LDPGSEETQTLVR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4392.4392.2.dta 13 1 IPI00000875.6 Elongation factor 1-gamma 266 50429 9 9 8 8 3647 3706 1 1 1 786.9163 1571.818 2 1571.8155 0.0025 1 33.06 0.00092 R KLDPGSEETQTLVR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3876.3876.2.dta 13 1 IPI00000875.6 Elongation factor 1-gamma 266 50429 9 9 8 8 8183 7996 1 1 1 1066.8158 3197.4256 3 3197.4288 -0.0032 0 51.28 3.10E-05 K VPAFEGDDGFCVFESNAIAYYVSNEELR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9159.9159.3.dta 13 IPI00738381.2 similar to Elongation factor 1-gamma 156 50612 5 5 4 4 1740 7317 1 0 1 559.8447 1117.6749 2 1117.6747 0.0002 0 49.04 3.40E-05 R ILGLLDAYLK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8313.8313.2.dta 13 IPI00738381.2 similar to Elongation factor 1-gamma 156 50612 5 5 4 4 1765 3709 1 0 1 562.3158 1122.617 2 1122.6186 -0.0015 1 37.1 0.0024 K AKDPFAHLPK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3879.3879.2.dta 13 IPI00738381.2 similar to Elongation factor 1-gamma 156 50612 5 5 4 4 1766 3700 1 0 1 375.214 1122.6202 3 1122.6186 0.0017 1 43.8 0.00016 K AKDPFAHLPK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3870.3870.3.dta 13 IPI00738381.2 similar to Elongation factor 1-gamma 156 50612 5 5 4 4 2265 5378 1 0 1 621.329 1240.6434 2 1240.6452 -0.0018 1 49.21 2.40E-05 K STFVLDEFKR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5797.5797.2.dta 13 IPI00738381.2 similar to Elongation factor 1-gamma 156 50612 5 5 4 4 8183 7996 1 0 1 1066.8158 3197.4256 3 3197.4288 -0.0032 0 51.28 3.10E-05 K VPAFEGDDGFCVFESNAIAYYVSNEELR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9159.9159.3.dta 13 IPI00744181.1 "Glutathione S-transferase, N-terminal domain containing protein" 60 36806 2 2 1 1 1765 3709 1 0 1 562.3158 1122.617 2 1122.6186 -0.0015 1 37.1 0.0024 K AKDPFAHLPK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3879.3879.2.dta 13 IPI00744181.1 "Glutathione S-transferase, N-terminal domain containing protein" 60 36806 2 2 1 1 1766 3700 1 0 1 375.214 1122.6202 3 1122.6186 0.0017 1 43.8 0.00016 K AKDPFAHLPK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3870.3870.3.dta 14 1 IPI00396485.3 Elongation factor 1-alpha 1 260 50451 12 12 10 10 392 3197 1 1 1 390.7106 779.4067 2 779.4065 0.0002 0 33.78 0.005 R YEEIVK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3266.3266.2.dta 14 1 IPI00396485.3 Elongation factor 1-alpha 1 260 50451 12 12 10 10 409 1471 1 1 1 393.7214 785.4282 2 785.4283 -0.0001 1 28.34 0.017 K KLEDGPK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1359.1359.2.dta 14 1 IPI00396485.3 Elongation factor 1-alpha 1 260 50451 12 12 10 10 614 3400 1 1 1 420.2289 838.4433 2 838.4436 -0.0003 0 29.01 0.02 K EVSTYIK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3517.3517.2.dta 14 1 IPI00396485.3 Elongation factor 1-alpha 1 260 50451 12 12 10 10 709 4003 1 1 1 435.7736 869.5327 2 869.5334 -0.0008 0 43 0.0003 K QLIVGVNK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4206.4206.2.dta 14 1 IPI00396485.3 Elongation factor 1-alpha 1 260 50451 12 12 10 10 782 2478 1 1 1 447.7498 893.4851 2 893.4858 -0.0007 1 33.44 0.0049 R TIEKFEK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2470.2470.2.dta 14 1 IPI00396485.3 Elongation factor 1-alpha 1 260 50451 12 12 10 10 1116 4793 1 1 1 488.2788 974.5431 2 974.5437 -0.0006 0 49.81 0.00017 R LPLQDVYK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5104.5104.2.dta 14 1 IPI00396485.3 Elongation factor 1-alpha 1 260 50451 12 12 10 10 1743 3004 1 1 1 560.8022 1119.5898 2 1119.5924 -0.0026 0 46.34 0.00019 K STTTGHLIYK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3050.3050.2.dta 14 1 IPI00396485.3 Elongation factor 1-alpha 1 260 50451 12 12 10 10 2574 5516 1 1 1 657.8745 1313.7345 2 1313.7343 0.0002 0 50.79 1.70E-05 R EHALLAYTLGVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5960.5960.2.dta 14 1 IPI00396485.3 Elongation factor 1-alpha 1 260 50451 12 12 10 10 2575 5519 1 1 1 438.9191 1313.7354 3 1313.7343 0.0011 0 39.25 0.00021 R EHALLAYTLGVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5963.5963.3.dta 14 1 IPI00396485.3 Elongation factor 1-alpha 1 260 50451 12 12 10 10 3759 4523 1 1 1 530.2982 1587.8728 3 1587.8733 -0.0005 0 47.47 3.50E-05 K THINIVVIGHVDSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4775.4775.3.dta 14 1 IPI00396485.3 Elongation factor 1-alpha 1 260 50451 12 12 10 10 7846 8631 1 1 1 970.4836 2908.4291 3 2908.431 -0.002 0 29.86 0.0016 K NMITGTSQADCAVLIVAAGVGEFEAGISK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9964.9964.3.dta 14 1 IPI00396485.3 Elongation factor 1-alpha 1 260 50451 12 12 10 10 7874 8431 1 1 1 975.8157 2924.4252 3 2924.426 -0.0008 0 45.58 5.30E-05 K NMITGTSQADCAVLIVAAGVGEFEAGISK N Oxidation (M) 0.01000000000000000000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9696.9696.3.dta 14 IPI00014424.1 Elongation factor 1-alpha 2 239 50780 9 9 7 7 709 4003 1 0 1 435.7736 869.5327 2 869.5334 -0.0008 0 43 0.0003 K QLIVGVNK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4206.4206.2.dta 14 IPI00014424.1 Elongation factor 1-alpha 2 239 50780 9 9 7 7 782 2478 1 0 1 447.7498 893.4851 2 893.4858 -0.0007 1 33.44 0.0049 R TIEKFEK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2470.2470.2.dta 14 IPI00014424.1 Elongation factor 1-alpha 2 239 50780 9 9 7 7 1116 4793 1 0 1 488.2788 974.5431 2 974.5437 -0.0006 0 49.81 0.00017 R LPLQDVYK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5104.5104.2.dta 14 IPI00014424.1 Elongation factor 1-alpha 2 239 50780 9 9 7 7 1743 3004 1 0 1 560.8022 1119.5898 2 1119.5924 -0.0026 0 46.34 0.00019 K STTTGHLIYK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3050.3050.2.dta 14 IPI00014424.1 Elongation factor 1-alpha 2 239 50780 9 9 7 7 2574 5516 1 0 1 657.8745 1313.7345 2 1313.7343 0.0002 0 50.79 1.70E-05 R EHALLAYTLGVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5960.5960.2.dta 14 IPI00014424.1 Elongation factor 1-alpha 2 239 50780 9 9 7 7 2575 5519 1 0 1 438.9191 1313.7354 3 1313.7343 0.0011 0 39.25 0.00021 R EHALLAYTLGVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5963.5963.3.dta 14 IPI00014424.1 Elongation factor 1-alpha 2 239 50780 9 9 7 7 3759 4523 1 0 1 530.2982 1587.8728 3 1587.8733 -0.0005 0 47.47 3.50E-05 K THINIVVIGHVDSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4775.4775.3.dta 14 IPI00014424.1 Elongation factor 1-alpha 2 239 50780 9 9 7 7 7846 8631 1 0 1 970.4836 2908.4291 3 2908.431 -0.002 0 29.86 0.0016 K NMITGTSQADCAVLIVAAGVGEFEAGISK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9964.9964.3.dta 14 IPI00014424.1 Elongation factor 1-alpha 2 239 50780 9 9 7 7 7874 8431 1 0 1 975.8157 2924.4252 3 2924.426 -0.0008 0 45.58 5.30E-05 K NMITGTSQADCAVLIVAAGVGEFEAGISK N Oxidation (M) 0.01000000000000000000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9696.9696.3.dta 14 IPI00180730.1 Similar to Elongation factor 1-alpha 1 215 50464 10 10 9 9 392 3197 1 0 1 390.7106 779.4067 2 779.4065 0.0002 0 33.78 0.005 R YEEIVK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3266.3266.2.dta 14 IPI00180730.1 Similar to Elongation factor 1-alpha 1 215 50464 10 10 9 9 409 1471 1 0 1 393.7214 785.4282 2 785.4283 -0.0001 1 28.34 0.017 K KLEDGPK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1359.1359.2.dta 14 IPI00180730.1 Similar to Elongation factor 1-alpha 1 215 50464 10 10 9 9 614 3400 1 0 1 420.2289 838.4433 2 838.4436 -0.0003 0 29.01 0.02 K EVSTYIK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3517.3517.2.dta 14 IPI00180730.1 Similar to Elongation factor 1-alpha 1 215 50464 10 10 9 9 709 4003 1 0 1 435.7736 869.5327 2 869.5334 -0.0008 0 43 0.0003 K QLIVGVNK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4206.4206.2.dta 14 IPI00180730.1 Similar to Elongation factor 1-alpha 1 215 50464 10 10 9 9 782 2478 1 0 1 447.7498 893.4851 2 893.4858 -0.0007 1 33.44 0.0049 R TIEKFEK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2470.2470.2.dta 14 IPI00180730.1 Similar to Elongation factor 1-alpha 1 215 50464 10 10 9 9 1116 4793 1 0 1 488.2788 974.5431 2 974.5437 -0.0006 0 49.81 0.00017 R LPLQDVYK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5104.5104.2.dta 14 IPI00180730.1 Similar to Elongation factor 1-alpha 1 215 50464 10 10 9 9 1743 3004 1 0 1 560.8022 1119.5898 2 1119.5924 -0.0026 0 46.34 0.00019 K STTTGHLIYK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3050.3050.2.dta 14 IPI00180730.1 Similar to Elongation factor 1-alpha 1 215 50464 10 10 9 9 2574 5516 1 0 1 657.8745 1313.7345 2 1313.7343 0.0002 0 50.79 1.70E-05 R EHALLAYTLGVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5960.5960.2.dta 14 IPI00180730.1 Similar to Elongation factor 1-alpha 1 215 50464 10 10 9 9 2575 5519 1 0 1 438.9191 1313.7354 3 1313.7343 0.0011 0 39.25 0.00021 R EHALLAYTLGVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5963.5963.3.dta 14 IPI00180730.1 Similar to Elongation factor 1-alpha 1 215 50464 10 10 9 9 3759 4523 1 0 1 530.2982 1587.8728 3 1587.8733 -0.0005 0 47.47 3.50E-05 K THINIVVIGHVDSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4775.4775.3.dta 14 IPI00793363.1 42 kDa protein 209 42081 9 9 8 8 392 3197 1 0 1 390.7106 779.4067 2 779.4065 0.0002 0 33.78 0.005 R YEEIVK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3266.3266.2.dta 14 IPI00793363.1 42 kDa protein 209 42081 9 9 8 8 614 3400 1 0 1 420.2289 838.4433 2 838.4436 -0.0003 0 29.01 0.02 K EVSTYIK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3517.3517.2.dta 14 IPI00793363.1 42 kDa protein 209 42081 9 9 8 8 709 4003 1 0 1 435.7736 869.5327 2 869.5334 -0.0008 0 43 0.0003 K QLIVGVNK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4206.4206.2.dta 14 IPI00793363.1 42 kDa protein 209 42081 9 9 8 8 782 2478 1 0 1 447.7498 893.4851 2 893.4858 -0.0007 1 33.44 0.0049 R TIEKFEK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2470.2470.2.dta 14 IPI00793363.1 42 kDa protein 209 42081 9 9 8 8 1116 4793 1 0 1 488.2788 974.5431 2 974.5437 -0.0006 0 49.81 0.00017 R LPLQDVYK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5104.5104.2.dta 14 IPI00793363.1 42 kDa protein 209 42081 9 9 8 8 1743 3004 1 0 1 560.8022 1119.5898 2 1119.5924 -0.0026 0 46.34 0.00019 K STTTGHLIYK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3050.3050.2.dta 14 IPI00793363.1 42 kDa protein 209 42081 9 9 8 8 2574 5516 1 0 1 657.8745 1313.7345 2 1313.7343 0.0002 0 50.79 1.70E-05 R EHALLAYTLGVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5960.5960.2.dta 14 IPI00793363.1 42 kDa protein 209 42081 9 9 8 8 2575 5519 1 0 1 438.9191 1313.7354 3 1313.7343 0.0011 0 39.25 0.00021 R EHALLAYTLGVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5963.5963.3.dta 14 IPI00793363.1 42 kDa protein 209 42081 9 9 8 8 3759 4523 1 0 1 530.2982 1587.8728 3 1587.8733 -0.0005 0 47.47 3.50E-05 K THINIVVIGHVDSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4775.4775.3.dta 14 IPI00556204.1 Eukaryotic translation elongation factor 1 alpha 2 variant (Fragment) 171 37116 6 6 4 4 709 4003 1 0 1 435.7736 869.5327 2 869.5334 -0.0008 0 43 0.0003 K QLIVGVNK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4206.4206.2.dta 14 IPI00556204.1 Eukaryotic translation elongation factor 1 alpha 2 variant (Fragment) 171 37116 6 6 4 4 1116 4793 1 0 1 488.2788 974.5431 2 974.5437 -0.0006 0 49.81 0.00017 R LPLQDVYK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5104.5104.2.dta 14 IPI00556204.1 Eukaryotic translation elongation factor 1 alpha 2 variant (Fragment) 171 37116 6 6 4 4 2574 5516 1 0 1 657.8745 1313.7345 2 1313.7343 0.0002 0 50.79 1.70E-05 R EHALLAYTLGVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5960.5960.2.dta 14 IPI00556204.1 Eukaryotic translation elongation factor 1 alpha 2 variant (Fragment) 171 37116 6 6 4 4 2575 5519 1 0 1 438.9191 1313.7354 3 1313.7343 0.0011 0 39.25 0.00021 R EHALLAYTLGVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5963.5963.3.dta 14 IPI00556204.1 Eukaryotic translation elongation factor 1 alpha 2 variant (Fragment) 171 37116 6 6 4 4 7846 8631 1 0 1 970.4836 2908.4291 3 2908.431 -0.002 0 29.86 0.0016 K NMITGTSQADCAVLIVAAGVGEFEAGISK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9964.9964.3.dta 14 IPI00556204.1 Eukaryotic translation elongation factor 1 alpha 2 variant (Fragment) 171 37116 6 6 4 4 7874 8431 1 0 1 975.8157 2924.4252 3 2924.426 -0.0008 0 45.58 5.30E-05 K NMITGTSQADCAVLIVAAGVGEFEAGISK N Oxidation (M) 0.01000000000000000000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9696.9696.3.dta 14 IPI00641459.2 Eukaryotic translation elongation factor 1 alpha 1 131 16040 5 5 4 4 782 2478 1 0 1 447.7498 893.4851 2 893.4858 -0.0007 1 33.44 0.0049 R TIEKFEK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2470.2470.2.dta 14 IPI00641459.2 Eukaryotic translation elongation factor 1 alpha 1 131 16040 5 5 4 4 1743 3004 1 0 1 560.8022 1119.5898 2 1119.5924 -0.0026 0 46.34 0.00019 K STTTGHLIYK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3050.3050.2.dta 14 IPI00641459.2 Eukaryotic translation elongation factor 1 alpha 1 131 16040 5 5 4 4 3759 4523 1 0 1 530.2982 1587.8728 3 1587.8733 -0.0005 0 47.47 3.50E-05 K THINIVVIGHVDSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4775.4775.3.dta 14 IPI00641459.2 Eukaryotic translation elongation factor 1 alpha 1 131 16040 5 5 4 4 7846 8631 1 0 1 970.4836 2908.4291 3 2908.431 -0.002 0 29.86 0.0016 K NMITGTSQADCAVLIVAAGVGEFEAGISK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9964.9964.3.dta 14 IPI00641459.2 Eukaryotic translation elongation factor 1 alpha 1 131 16040 5 5 4 4 7874 8431 1 0 1 975.8157 2924.4252 3 2924.426 -0.0008 0 45.58 5.30E-05 K NMITGTSQADCAVLIVAAGVGEFEAGISK N Oxidation (M) 0.01000000000000000000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9696.9696.3.dta 14 IPI00431441.1 EEF1A1 protein 87 7639 3 3 3 3 782 2478 1 0 1 447.7498 893.4851 2 893.4858 -0.0007 1 33.44 0.0049 R TIEKFEK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2470.2470.2.dta 14 IPI00431441.1 EEF1A1 protein 87 7639 3 3 3 3 1743 3004 1 0 1 560.8022 1119.5898 2 1119.5924 -0.0026 0 46.34 0.00019 K STTTGHLIYK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3050.3050.2.dta 14 IPI00431441.1 EEF1A1 protein 87 7639 3 3 3 3 3759 4523 1 0 1 530.2982 1587.8728 3 1587.8733 -0.0005 0 47.47 3.50E-05 K THINIVVIGHVDSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4775.4775.3.dta 14 IPI00025447.7 EEF1A1 protein 69 33449 4 4 4 4 392 3197 1 0 1 390.7106 779.4067 2 779.4065 0.0002 0 33.78 0.005 R YEEIVK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3266.3266.2.dta 14 IPI00025447.7 EEF1A1 protein 69 33449 4 4 4 4 409 1471 1 0 1 393.7214 785.4282 2 785.4283 -0.0001 1 28.34 0.017 K KLEDGPK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1359.1359.2.dta 14 IPI00025447.7 EEF1A1 protein 69 33449 4 4 4 4 614 3400 1 0 1 420.2289 838.4433 2 838.4436 -0.0003 0 29.01 0.02 K EVSTYIK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3517.3517.2.dta 14 IPI00025447.7 EEF1A1 protein 69 33449 4 4 4 4 1116 4793 1 0 1 488.2788 974.5431 2 974.5437 -0.0006 0 49.81 0.00017 R LPLQDVYK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5104.5104.2.dta 14 IPI00455434.1 28 kDa protein 54 28270 2 2 2 2 409 1471 1 0 1 393.7214 785.4282 2 785.4283 -0.0001 1 28.34 0.017 K KLEDGPK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1359.1359.2.dta 14 IPI00455434.1 28 kDa protein 54 28270 2 2 2 2 1116 4793 1 0 1 488.2788 974.5431 2 974.5437 -0.0006 0 49.81 0.00017 R LPLQDVYK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5104.5104.2.dta 14 IPI00011757.1 RNA polymerase II elongation factor ELL2 29 72766 1 1 1 1 614 3400 1 0 1 420.2289 838.4433 2 838.4436 -0.0003 0 29.01 0.02 K DLSYTLK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3517.3517.2.dta 15 1 IPI00021405.3 Isoform A of Lamin-A/C 242 74380 7 7 7 7 883 1577 1 1 1 460.2225 918.4304 2 918.4308 -0.0004 0 50.19 0.00016 R SSFSQHAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1475.1475.2.dta 15 1 IPI00021405.3 Isoform A of Lamin-A/C 242 74380 7 7 7 7 1369 5125 1 1 1 514.7902 1027.5659 2 1027.5662 -0.0003 0 78.88 2.20E-07 R LADALQELR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5499.5499.2.dta 15 1 IPI00021405.3 Isoform A of Lamin-A/C 242 74380 7 7 7 7 2777 3023 1 1 1 680.3461 1358.6777 2 1358.679 -0.0013 0 56.24 5.30E-06 R SGAQASSTPLSPTR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3070.3070.2.dta 15 1 IPI00021405.3 Isoform A of Lamin-A/C 242 74380 7 7 7 7 2804 3828 1 1 1 682.3116 1362.6087 2 1362.6099 -0.0011 0 51.37 1.50E-05 K AQNTWGCGNSLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4016.4016.2.dta 15 1 IPI00021405.3 Isoform A of Lamin-A/C 242 74380 7 7 7 7 3404 1765 1 1 1 501.5789 1501.7147 3 1501.7161 -0.0014 1 15.84 0.033 R AQHEDQVEQYKK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1679.1679.3.dta 15 1 IPI00021405.3 Isoform A of Lamin-A/C 242 74380 7 7 7 7 3464 8504 1 1 1 759.8608 1517.707 2 1517.707 0 0 45.08 5.90E-05 R ASSHSSQTQGGGSVTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.980.980.2.dta 15 1 IPI00021405.3 Isoform A of Lamin-A/C 242 74380 7 7 7 7 4594 4106 1 1 1 584.959 1751.8551 3 1751.855 0.0001 0 53.18 1.30E-05 R NSNLVGAAHEELQQSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4321.4321.3.dta 15 IPI00514204.3 Lamin A/C 207 53219 6 6 6 6 883 1577 1 0 1 460.2225 918.4304 2 918.4308 -0.0004 0 50.19 0.00016 R SSFSQHAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1475.1475.2.dta 15 IPI00514204.3 Lamin A/C 207 53219 6 6 6 6 1369 5125 1 0 1 514.7902 1027.5659 2 1027.5662 -0.0003 0 78.88 2.20E-07 R LADALQELR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5499.5499.2.dta 15 IPI00514204.3 Lamin A/C 207 53219 6 6 6 6 2777 3023 1 0 1 680.3461 1358.6777 2 1358.679 -0.0013 0 56.24 5.30E-06 R SGAQASSTPLSPTR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3070.3070.2.dta 15 IPI00514204.3 Lamin A/C 207 53219 6 6 6 6 3404 1765 1 0 1 501.5789 1501.7147 3 1501.7161 -0.0014 1 15.84 0.033 R AQHEDQVEQYKK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1679.1679.3.dta 15 IPI00514204.3 Lamin A/C 207 53219 6 6 6 6 3464 8504 1 0 1 759.8608 1517.707 2 1517.707 0 0 45.08 5.90E-05 R ASSHSSQTQGGGSVTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.980.980.2.dta 15 IPI00514204.3 Lamin A/C 207 53219 6 6 6 6 4594 4106 1 0 1 584.959 1751.8551 3 1751.855 0.0001 0 53.18 1.30E-05 R NSNLVGAAHEELQQSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4321.4321.3.dta 15 IPI00514320.3 Lamin A/C 202 57897 6 6 6 6 883 1577 1 0 1 460.2225 918.4304 2 918.4308 -0.0004 0 50.19 0.00016 R SSFSQHAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1475.1475.2.dta 15 IPI00514320.3 Lamin A/C 202 57897 6 6 6 6 1369 5125 1 0 1 514.7902 1027.5659 2 1027.5662 -0.0003 0 78.88 2.20E-07 R LADALQELR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5499.5499.2.dta 15 IPI00514320.3 Lamin A/C 202 57897 6 6 6 6 2804 3828 1 0 1 682.3116 1362.6087 2 1362.6099 -0.0011 0 51.37 1.50E-05 K AQNTWGCGNSLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4016.4016.2.dta 15 IPI00514320.3 Lamin A/C 202 57897 6 6 6 6 3404 1765 1 0 1 501.5789 1501.7147 3 1501.7161 -0.0014 1 15.84 0.033 R AQHEDQVEQYKK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1679.1679.3.dta 15 IPI00514320.3 Lamin A/C 202 57897 6 6 6 6 3464 8504 1 0 1 759.8608 1517.707 2 1517.707 0 0 45.08 5.90E-05 R ASSHSSQTQGGGSVTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.980.980.2.dta 15 IPI00514320.3 Lamin A/C 202 57897 6 6 6 6 4594 4106 1 0 1 584.959 1751.8551 3 1751.855 0.0001 0 53.18 1.30E-05 R NSNLVGAAHEELQQSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4321.4321.3.dta 16 1 IPI00163187.10 Fascin 231 55123 9 9 9 9 1000 2398 1 1 1 473.7509 945.4872 2 945.488 -0.0007 0 44.79 0.00062 K VTGTLDANR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2383.2383.2.dta 16 1 IPI00163187.10 Fascin 231 55123 9 9 9 9 1565 2103 1 1 1 359.5094 1075.5063 3 1075.5047 0.0016 0 23.09 0.029 R YSVQTADHR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2052.2052.3.dta 16 1 IPI00163187.10 Fascin 231 55123 9 9 9 9 2019 3846 1 1 1 595.8238 1189.633 2 1189.6343 -0.0012 0 35.99 0.0034 R YLAPSGPSGTLK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4036.4036.2.dta 16 1 IPI00163187.10 Fascin 231 55123 9 9 9 9 2064 2557 1 1 1 400.8958 1199.6654 3 1199.6662 -0.0008 1 26.18 0.0086 R YLKGDHAGVLK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2558.2558.3.dta 16 1 IPI00163187.10 Fascin 231 55123 9 9 9 9 3157 4233 1 1 1 719.3554 1436.6963 2 1436.697 -0.0007 0 51.68 1.40E-05 R LSCFAQTVSPAEK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4458.4458.2.dta 16 1 IPI00163187.10 Fascin 231 55123 9 9 9 9 3242 6394 1 1 1 730.8182 1459.6218 2 1459.619 0.0028 0 58.99 6.40E-06 K NASCYFDIEWR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7148.7148.2.dta 16 1 IPI00163187.10 Fascin 231 55123 9 9 9 9 3844 2829 1 1 1 537.9186 1610.7341 3 1610.7359 -0.0018 1 26.5 0.0095 R YLAADKDGNVTCER E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2855.2855.3.dta 16 1 IPI00163187.10 Fascin 231 55123 9 9 9 9 4786 5150 1 1 1 607.3283 1818.9631 3 1818.9628 0.0003 0 40.69 0.00022 R LVARPEPATGYTLEFR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5529.5529.3.dta 16 1 IPI00163187.10 Fascin 231 55123 9 9 9 9 7150 6767 1 1 1 892.4532 2674.3377 3 2674.3384 -0.0007 1 80.7 2.70E-08 K VGKDELFALEQSCAQVVLQAANER N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7650.7650.3.dta 17 1 IPI00009328.4 Probable ATP-dependent RNA helicase DDX48 189 47126 6 6 5 5 1328 4322 1 1 0 509.7813 1017.548 2 1017.5495 -0.0015 1 41.37 0.0021 R KVDWLTEK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4556.4556.2.dta 17 1 IPI00009328.4 Probable ATP-dependent RNA helicase DDX48 189 47126 6 6 5 5 2018 2368 1 1 1 595.804 1189.5935 2 1189.5939 -0.0004 0 73.52 2.20E-07 R DVIAQSQSGTGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2351.2351.2.dta 17 1 IPI00009328.4 Probable ATP-dependent RNA helicase DDX48 189 47126 6 6 5 5 2992 2032 1 1 1 702.3646 1402.7146 2 1402.7165 -0.0019 1 63.78 1.00E-06 K GRDVIAQSQSGTGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1976.1976.2.dta 17 1 IPI00009328.4 Probable ATP-dependent RNA helicase DDX48 189 47126 6 6 5 5 2993 2031 1 1 1 468.5791 1402.7154 3 1402.7165 -0.0011 1 39.52 0.00053 K GRDVIAQSQSGTGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1975.1975.3.dta 17 1 IPI00009328.4 Probable ATP-dependent RNA helicase DDX48 189 47126 6 6 5 5 3282 3452 1 1 1 490.5873 1468.7402 3 1468.7423 -0.0021 0 46.99 0.00036 K LDYGQHVVAGTPGR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3576.3576.3.dta 17 1 IPI00009328.4 Probable ATP-dependent RNA helicase DDX48 189 47126 6 6 5 5 3784 3113 1 1 1 533.2852 1596.8336 3 1596.8372 -0.0036 1 29.26 0.0069 R KLDYGQHVVAGTPGR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3172.3172.3.dta 17 2 IPI00025491.1 Eukaryotic initiation factor 4A-I 184 46353 5 5 5 5 1328 4322 1 0 0 509.7813 1017.548 2 1017.5495 -0.0015 1 41.37 0.0021 R KVDWLTEK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4556.4556.2.dta 17 2 IPI00025491.1 Eukaryotic initiation factor 4A-I 184 46353 5 5 5 5 1730 6086 1 0 1 557.845 1113.6755 2 1113.6758 -0.0002 0 61.32 4.70E-06 R VLITTDLLAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6752.6752.2.dta 17 2 IPI00025491.1 Eukaryotic initiation factor 4A-I 184 46353 5 5 5 5 2949 4089 1 0 1 697.8472 1393.6799 2 1393.6838 -0.0039 0 90.37 4.70E-09 K GYDVIAQAQSGTGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4301.4301.2.dta 17 2 IPI00025491.1 Eukaryotic initiation factor 4A-I 184 46353 5 5 5 5 3867 5136 1 0 1 540.2965 1617.8677 3 1617.8661 0.0016 0 34.49 0.00061 K LQMEAPHIIVGTPGR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5511.5511.3.dta 17 2 IPI00025491.1 Eukaryotic initiation factor 4A-I 184 46353 5 5 5 5 7929 6311 1 0 1 739.8886 2955.5253 4 2955.5202 0.0051 1 36.88 0.00063 R GIDVQQVSLVINYDLPTNRENYIHR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7044.7044.4.dta 17 IPI00328328.3 Isoform 1 of Eukaryotic initiation factor 4A-II 166 46601 4 4 4 4 1328 4322 1 0 0 509.7813 1017.548 2 1017.5495 -0.0015 1 41.37 0.0021 R KVDWLTEK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4556.4556.2.dta 17 IPI00328328.3 Isoform 1 of Eukaryotic initiation factor 4A-II 166 46601 4 4 4 4 1730 6086 1 0 1 557.845 1113.6755 2 1113.6758 -0.0002 0 61.32 4.70E-06 R VLITTDLLAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6752.6752.2.dta 17 IPI00328328.3 Isoform 1 of Eukaryotic initiation factor 4A-II 166 46601 4 4 4 4 2949 4089 1 0 1 697.8472 1393.6799 2 1393.6838 -0.0039 0 90.37 4.70E-09 K GYDVIAQAQSGTGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4301.4301.2.dta 17 IPI00328328.3 Isoform 1 of Eukaryotic initiation factor 4A-II 166 46601 4 4 4 4 7929 6311 1 0 1 739.8886 2955.5253 4 2955.5202 0.0051 1 36.88 0.00063 R GIDVQQVSLVINYDLPTNRENYIHR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7044.7044.4.dta 17 IPI00555602.1 CD68 antigen variant (Fragment) 125 42846 3 3 3 3 1328 4322 1 0 0 509.7813 1017.548 2 1017.5495 -0.0015 1 41.37 0.0021 R KVDWLTEK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4556.4556.2.dta 17 IPI00555602.1 CD68 antigen variant (Fragment) 125 42846 3 3 3 3 2949 4089 1 0 1 697.8472 1393.6799 2 1393.6838 -0.0039 0 90.37 4.70E-09 K GYDVIAQAQSGTGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4301.4301.2.dta 17 IPI00555602.1 CD68 antigen variant (Fragment) 125 42846 3 3 3 3 3867 5136 1 0 1 540.2965 1617.8677 3 1617.8661 0.0016 0 34.49 0.00061 K LQMEAPHIIVGTPGR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5511.5511.3.dta 17 IPI00386604.1 Hypothetical protein (Fragment) 114 51913 4 4 4 4 1328 4322 1 0 0 509.7813 1017.548 2 1017.5495 -0.0015 1 41.37 0.0021 R KVDWLTEK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4556.4556.2.dta 17 IPI00386604.1 Hypothetical protein (Fragment) 114 51913 4 4 4 4 1730 6086 1 0 1 557.845 1113.6755 2 1113.6758 -0.0002 0 61.32 4.70E-06 R VLITTDLLAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6752.6752.2.dta 17 IPI00386604.1 Hypothetical protein (Fragment) 114 51913 4 4 4 4 3867 5136 1 0 1 540.2965 1617.8677 3 1617.8661 0.0016 0 34.49 0.00061 K LQMEAPHIIVGTPGR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5511.5511.3.dta 17 IPI00386604.1 Hypothetical protein (Fragment) 114 51913 4 4 4 4 7929 6311 1 0 1 739.8886 2955.5253 4 2955.5202 0.0051 1 36.88 0.00063 R GIDVQQVSLVINYDLPTNRENYIHR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7044.7044.4.dta 17 IPI00030296.6 BM-010 96 36301 3 3 3 3 1328 4322 1 0 0 509.7813 1017.548 2 1017.5495 -0.0015 1 41.37 0.0021 R KVDWLTEK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4556.4556.2.dta 17 IPI00030296.6 BM-010 96 36301 3 3 3 3 1730 6086 1 0 1 557.845 1113.6755 2 1113.6758 -0.0002 0 61.32 4.70E-06 R VLITTDLLAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6752.6752.2.dta 17 IPI00030296.6 BM-010 96 36301 3 3 3 3 7929 6311 1 0 1 739.8886 2955.5253 4 2955.5202 0.0051 1 36.88 0.00063 R GIDVQQVSLVINYDLPTNRENYIHR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7044.7044.4.dta 17 IPI00790077.1 25 kDa protein 90 24740 1 1 1 1 2949 4089 1 0 1 697.8472 1393.6799 2 1393.6838 -0.0039 0 90.37 4.70E-09 K GYDVIAQAQSGTGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4301.4301.2.dta 17 IPI00790597.1 6 kDa protein 79 6359 2 2 2 2 1730 6086 1 0 1 557.845 1113.6755 2 1113.6758 -0.0002 0 61.32 4.70E-06 R VLITTDLLAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6752.6752.2.dta 17 IPI00790597.1 6 kDa protein 79 6359 2 2 2 2 7929 6311 1 0 1 739.8886 2955.5253 4 2955.5202 0.0051 1 36.88 0.00063 R GIDVQQVSLVINYDLPTNRENYIHR - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7044.7044.4.dta 17 IPI00788730.1 25 kDa protein 79 25496 2 2 2 2 1328 4322 1 0 0 509.7813 1017.548 2 1017.5495 -0.0015 1 41.37 0.0021 R KVDWLTEK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4556.4556.2.dta 17 IPI00788730.1 25 kDa protein 79 25496 2 2 2 2 1730 6086 1 0 1 557.845 1113.6755 2 1113.6758 -0.0002 0 61.32 4.70E-06 R VLITTDLLAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6752.6752.2.dta 17 IPI00794607.1 21 kDa protein 41 21019 1 1 1 1 1328 4322 1 0 0 509.7813 1017.548 2 1017.5495 -0.0015 1 41.37 0.0021 R KVDWLTEK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4556.4556.2.dta 18 1 IPI00012066.2 poly(rC)-binding protein 2 isoform b 184 38597 5 5 5 5 679 2347 1 1 0 431.7261 861.4377 2 861.4378 -0.0001 0 29.87 0.033 R QMSGAQIK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2328.2328.2.dta 18 1 IPI00012066.2 poly(rC)-binding protein 2 isoform b 184 38597 5 5 5 5 2464 3208 1 1 0 644.7986 1287.5826 2 1287.5877 -0.0051 0 67.44 1.20E-06 R INISEGNCPER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3278.3278.2.dta 18 1 IPI00012066.2 poly(rC)-binding protein 2 isoform b 184 38597 5 5 5 5 3094 4871 1 1 1 714.8962 1427.7778 2 1427.7806 -0.0028 0 64.58 8.80E-07 R LVVPASQCGSLIGK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5193.5193.2.dta 18 1 IPI00012066.2 poly(rC)-binding protein 2 isoform b 184 38597 5 5 5 5 3333 4135 1 1 0 494.6215 1480.8426 3 1480.8436 -0.001 1 49.3 2.40E-05 R LLMHGKEVGSIIGK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4352.4352.3.dta 18 1 IPI00012066.2 poly(rC)-binding protein 2 isoform b 184 38597 5 5 5 5 4433 7020 1 1 1 856.9858 1711.9571 2 1711.9542 0.0029 0 51.53 1.60E-05 R AITIAGIPQSIIECVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7955.7955.2.dta 18 2 IPI00016610.2 Poly(rC)-binding protein 1 176 37987 6 6 6 6 196 1773 1 0 1 350.7091 699.4037 2 699.4028 0.0009 0 40.93 0.00086 K LNQVAR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1688.1688.2.dta 18 2 IPI00016610.2 Poly(rC)-binding protein 1 176 37987 6 6 6 6 679 2347 1 0 0 431.7261 861.4377 2 861.4378 -0.0001 0 29.87 0.033 R QMSGAQIK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2328.2328.2.dta 18 2 IPI00016610.2 Poly(rC)-binding protein 1 176 37987 6 6 6 6 1300 3303 1 0 1 507.7699 1013.5252 2 1013.5254 -0.0001 0 48.81 0.00016 R QGANINEIR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3404.3404.2.dta 18 2 IPI00016610.2 Poly(rC)-binding protein 1 176 37987 6 6 6 6 2464 3208 1 0 0 644.7986 1287.5826 2 1287.5877 -0.0051 0 67.44 1.20E-06 R INISEGNCPER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3278.3278.2.dta 18 2 IPI00016610.2 Poly(rC)-binding protein 1 176 37987 6 6 6 6 2921 6355 1 0 1 694.9104 1387.8062 2 1387.8075 -0.0013 0 46.71 6.80E-05 R IITLTGPTNAIFK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7097.7097.2.dta 18 2 IPI00016610.2 Poly(rC)-binding protein 1 176 37987 6 6 6 6 3333 4135 1 0 0 494.6215 1480.8426 3 1480.8436 -0.001 1 49.3 2.40E-05 R LLMHGKEVGSIIGK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4352.4352.3.dta 18 IPI00027970.4 Isoform 1 of Poly(rC)-binding protein 3 150 36201 4 4 4 4 679 2347 1 0 0 431.7261 861.4377 2 861.4378 -0.0001 0 29.87 0.033 R QMSGAQIK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2328.2328.2.dta 18 IPI00027970.4 Isoform 1 of Poly(rC)-binding protein 3 150 36201 4 4 4 4 2464 3208 1 0 0 644.7986 1287.5826 2 1287.5877 -0.0051 0 67.44 1.20E-06 R INISEGNCPER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3278.3278.2.dta 18 IPI00027970.4 Isoform 1 of Poly(rC)-binding protein 3 150 36201 4 4 4 4 3094 4871 1 0 1 714.8962 1427.7778 2 1427.7806 -0.0028 0 64.58 8.80E-07 R LVVPASQCGSLIGK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5193.5193.2.dta 18 IPI00027970.4 Isoform 1 of Poly(rC)-binding protein 3 150 36201 4 4 4 4 3333 4135 1 0 0 494.6215 1480.8426 3 1480.8436 -0.001 1 49.3 2.40E-05 R LLMHGKEVGSIIGK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4352.4352.3.dta 18 IPI00790019.1 20 kDa protein 59 20384 2 2 2 2 679 2347 1 0 0 431.7261 861.4377 2 861.4378 -0.0001 0 29.87 0.033 R QMSGAQIK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2328.2328.2.dta 18 IPI00790019.1 20 kDa protein 59 20384 2 2 2 2 4433 7020 1 0 1 856.9858 1711.9571 2 1711.9542 0.0029 0 51.53 1.60E-05 R AITIAGIPQSIIECVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7955.7955.2.dta 18 IPI00790627.1 14 kDa protein 52 13953 1 1 1 1 4433 7020 1 0 1 856.9858 1711.9571 2 1711.9542 0.0029 0 51.53 1.60E-05 R AITIAGIPQSIIECVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7955.7955.2.dta 18 IPI00788837.1 16 kDa protein 30 16028 1 1 1 1 679 2347 1 0 0 431.7261 861.4377 2 861.4378 -0.0001 0 29.87 0.033 R QMSGAQIK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2328.2328.2.dta 19 1 IPI00012007.6 Adenosylhomocysteinase 184 48255 7 7 6 6 385 1991 1 1 1 388.1942 774.3739 2 774.3806 -0.0067 0 31.04 0.018 K GCAQALR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1931.1931.2.dta 19 1 IPI00012007.6 Adenosylhomocysteinase 184 48255 7 7 6 6 757 5211 1 1 1 442.7817 883.5489 2 883.5491 -0.0002 0 48.31 8.00E-05 R IILLAEGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5601.5601.2.dta 19 1 IPI00012007.6 Adenosylhomocysteinase 184 48255 7 7 6 6 2327 4112 1 1 1 628.8448 1255.675 2 1255.6772 -0.0022 0 69.85 2.80E-07 K VPAINVNDSVTK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4327.4327.2.dta 19 1 IPI00012007.6 Adenosylhomocysteinase 184 48255 7 7 6 6 2892 3460 1 1 1 460.9212 1379.7417 3 1379.7408 0.0008 1 55.94 5.70E-06 K KLDEAVAEAHLGK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3587.3587.3.dta 19 1 IPI00012007.6 Adenosylhomocysteinase 184 48255 7 7 6 6 4095 3981 1 1 1 550.2764 1647.8075 3 1647.8104 -0.003 0 35.57 0.00046 R GISEETTTGVHNLYK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4182.4182.3.dta 19 1 IPI00012007.6 Adenosylhomocysteinase 184 48255 7 7 6 6 4096 3997 1 1 1 824.9114 1647.8083 2 1647.8104 -0.0021 0 31.8 0.016 R GISEETTTGVHNLYK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4199.4199.2.dta 19 1 IPI00012007.6 Adenosylhomocysteinase 184 48255 7 7 6 6 5044 4312 1 1 1 630.9995 1889.9767 3 1889.9782 -0.0015 1 34.36 0.0039 K VAVVAGYGDVGKGCAQALR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4545.4545.3.dta 19 IPI00827743.1 31 kDa protein 117 31251 5 5 4 4 385 1991 1 0 1 388.1942 774.3739 2 774.3806 -0.0067 0 31.04 0.018 K GCAQALR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1931.1931.2.dta 19 IPI00827743.1 31 kDa protein 117 31251 5 5 4 4 2327 4112 1 0 1 628.8448 1255.675 2 1255.6772 -0.0022 0 69.85 2.80E-07 K VPAINVNDSVTK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4327.4327.2.dta 19 IPI00827743.1 31 kDa protein 117 31251 5 5 4 4 4095 3981 1 0 1 550.2764 1647.8075 3 1647.8104 -0.003 0 35.57 0.00046 R GISEETTTGVHNLYK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4182.4182.3.dta 19 IPI00827743.1 31 kDa protein 117 31251 5 5 4 4 4096 3997 1 0 1 824.9114 1647.8083 2 1647.8104 -0.0021 0 31.8 0.016 R GISEETTTGVHNLYK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4199.4199.2.dta 19 IPI00827743.1 31 kDa protein 117 31251 5 5 4 4 5044 4312 1 0 1 630.9995 1889.9767 3 1889.9782 -0.0015 1 34.36 0.0039 K VAVVAGYGDVGKGCAQALR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4545.4545.3.dta 20 1 IPI00011200.5 D-3-phosphoglycerate dehydrogenase 172 57356 3 3 3 3 1157 7718 1 1 1 493.8051 985.5957 2 985.596 -0.0004 0 33.68 0.0021 R DLPLLLFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8819.8819.2.dta 20 1 IPI00011200.5 D-3-phosphoglycerate dehydrogenase 172 57356 3 3 3 3 2710 4901 1 1 1 673.386 1344.7575 2 1344.7613 -0.0037 0 72.93 4.10E-07 K GTIQVITQGTSLK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5228.5228.2.dta 20 1 IPI00011200.5 D-3-phosphoglycerate dehydrogenase 172 57356 3 3 3 3 3355 4398 1 1 1 744.8664 1487.7182 2 1487.7216 -0.0034 0 108.84 1.70E-10 R AGTGVDNVDLEAATR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4640.4640.2.dta 21 1 IPI00297779.7 T-complex protein 1 subunit beta 160 57794 5 5 5 5 728 1438 1 1 1 438.2508 874.487 2 874.4872 -0.0003 1 40.93 0.0015 R VRVDSTAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1323.1323.2.dta 21 1 IPI00297779.7 T-complex protein 1 subunit beta 160 57794 5 5 5 5 2652 4551 1 1 1 665.8326 1329.6506 2 1329.6524 -0.0018 0 70.48 2.50E-07 R GATQQILDEAER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4805.4805.2.dta 21 1 IPI00297779.7 T-complex protein 1 subunit beta 160 57794 5 5 5 5 5453 6494 1 1 1 681.0203 2040.0391 3 2040.0415 -0.0024 1 32.01 0.001 K LGGSLADSYLDEGFLLDKK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7279.7279.3.dta 21 1 IPI00297779.7 T-complex protein 1 subunit beta 160 57794 5 5 5 5 5556 6390 1 1 1 699.7111 2096.1115 3 2096.1154 -0.0038 0 25.17 0.0044 R LALVTGGEIASTFDHPELVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7143.7143.3.dta 21 1 IPI00297779.7 T-complex protein 1 subunit beta 160 57794 5 5 5 5 5945 7810 1 1 1 1144.5859 2287.1573 2 2287.1544 0.003 0 61.03 1.90E-06 R VQDDEVGDGTTSVTVLAAELLR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8927.8927.2.dta 21 IPI00796761.1 27 kDa protein 61 26841 1 1 1 1 5945 7810 1 0 1 1144.5859 2287.1573 2 2287.1544 0.003 0 61.03 1.90E-06 R VQDDEVGDGTTSVTVLAAELLR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8927.8927.2.dta 21 IPI00791487.1 14 kDa protein 53 14453 2 2 2 2 728 1438 1 0 1 438.2508 874.487 2 874.4872 -0.0003 1 40.93 0.0015 R VRVDSTAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1323.1323.2.dta 21 IPI00791487.1 14 kDa protein 53 14453 2 2 2 2 5453 6494 1 0 1 681.0203 2040.0391 3 2040.0415 -0.0024 1 32.01 0.001 K LGGSLADSYLDEGFLLDKK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7279.7279.3.dta 21 IPI00795634.1 8 kDa protein 32 8292 1 1 1 1 5453 6494 1 0 1 681.0203 2040.0391 3 2040.0415 -0.0024 1 32.01 0.001 K LGGSLADSYLDEGFLLDKK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7279.7279.3.dta 22 1 IPI00022977.1 Creatine kinase B-type 134 42902 3 3 3 3 2525 5983 1 1 1 652.3663 1302.7181 2 1302.7183 -0.0002 0 60.96 8.30E-06 K VLTPELYAELR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6611.6611.2.dta 22 1 IPI00022977.1 Creatine kinase B-type 134 42902 3 3 3 3 3601 7374 1 1 1 779.403 1556.7915 2 1556.7909 0.0006 0 80.78 6.60E-08 R FCTGLTQIETLFK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8391.8391.2.dta 22 1 IPI00022977.1 Creatine kinase B-type 134 42902 3 3 3 3 4888 8203 1 1 1 616.9966 1847.9681 3 1847.9703 -0.0022 0 33.17 0.0017 R LGFSEVELVQMVVDGVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9407.9407.3.dta 22 IPI00794730.1 15 kDa protein 61 15139 1 1 1 1 2525 5983 1 0 1 652.3663 1302.7181 2 1302.7183 -0.0002 0 60.96 8.30E-06 K VLTPELYAELR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6611.6611.2.dta 23 1 IPI00025815.1 TAR DNA-binding protein 43 128 45053 3 3 3 3 215 2286 1 1 0 353.225 704.4354 2 704.4334 0.002 1 21.78 0.011 R KVFVGR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2252.2252.2.dta 23 1 IPI00025815.1 TAR DNA-binding protein 43 128 45053 3 3 3 3 1865 3458 1 1 1 572.7792 1143.5439 2 1143.5448 -0.0009 0 47.06 0.00019 R FTEYETQVK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3585.3585.2.dta 23 1 IPI00025815.1 TAR DNA-binding protein 43 128 45053 3 3 3 3 4502 4645 1 1 1 863.8871 1725.7597 2 1725.7608 -0.0011 0 97.38 1.20E-09 R FGGNPGGFGNQGGFGNSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4923.4923.2.dta 23 IPI00639819.1 TAR DNA binding protein 50 33783 2 2 2 2 215 2286 1 0 0 353.225 704.4354 2 704.4334 0.002 1 21.78 0.011 R KVFVGR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2252.2252.2.dta 23 IPI00639819.1 TAR DNA binding protein 50 33783 2 2 2 2 1865 3458 1 0 1 572.7792 1143.5439 2 1143.5448 -0.0009 0 47.06 0.00019 R FTEYETQVK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3585.3585.2.dta 24 1 IPI00021187.4 Isoform 1 of RuvB-like 1 127 50538 5 5 5 5 742 6666 1 1 1 439.7457 877.4769 2 877.477 -0.0001 0 20.02 0.013 R IASHSHVK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.753.753.2.dta 24 1 IPI00021187.4 Isoform 1 of RuvB-like 1 127 50538 5 5 5 5 1503 4699 1 1 1 530.2878 1058.5611 2 1058.5608 0.0004 0 53.34 5.70E-05 K GLGLDESGLAK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4987.4987.2.dta 24 1 IPI00021187.4 Isoform 1 of RuvB-like 1 127 50538 5 5 5 5 2511 2975 1 1 1 650.8349 1299.6552 2 1299.6531 0.0021 0 55.98 5.60E-06 K QAASGLVGQENAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3013.3013.2.dta 24 1 IPI00021187.4 Isoform 1 of RuvB-like 1 127 50538 5 5 5 5 4306 7106 1 1 1 563.3175 1686.9307 3 1686.9304 0.0002 0 46.54 4.40E-05 R ALESSIAPIVIFASNR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8062.8062.3.dta 24 1 IPI00021187.4 Isoform 1 of RuvB-like 1 127 50538 5 5 5 5 6069 6116 1 1 1 775.3956 2323.1651 3 2323.1655 -0.0005 0 22.93 0.041 R AQTEGINISEEALNHLGEIGTK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6787.6787.3.dta 24 IPI00788942.1 Isoform 2 of RuvB-like 1 125 42499 4 4 4 4 742 6666 1 0 1 439.7457 877.4769 2 877.477 -0.0001 0 20.02 0.013 R IASHSHVK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.753.753.2.dta 24 IPI00788942.1 Isoform 2 of RuvB-like 1 125 42499 4 4 4 4 1503 4699 1 0 1 530.2878 1058.5611 2 1058.5608 0.0004 0 53.34 5.70E-05 K GLGLDESGLAK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4987.4987.2.dta 24 IPI00788942.1 Isoform 2 of RuvB-like 1 125 42499 4 4 4 4 2511 2975 1 0 1 650.8349 1299.6552 2 1299.6531 0.0021 0 55.98 5.60E-06 K QAASGLVGQENAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3013.3013.2.dta 24 IPI00788942.1 Isoform 2 of RuvB-like 1 125 42499 4 4 4 4 4306 7106 1 0 1 563.3175 1686.9307 3 1686.9304 0.0002 0 46.54 4.40E-05 R ALESSIAPIVIFASNR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8062.8062.3.dta 24 IPI00796459.1 20 kDa protein 94 20699 3 3 3 3 742 6666 1 0 1 439.7457 877.4769 2 877.477 -0.0001 0 20.02 0.013 R IASHSHVK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.753.753.2.dta 24 IPI00796459.1 20 kDa protein 94 20699 3 3 3 3 1503 4699 1 0 1 530.2878 1058.5611 2 1058.5608 0.0004 0 53.34 5.70E-05 K GLGLDESGLAK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4987.4987.2.dta 24 IPI00796459.1 20 kDa protein 94 20699 3 3 3 3 2511 2975 1 0 1 650.8349 1299.6552 2 1299.6531 0.0021 0 55.98 5.60E-06 K QAASGLVGQENAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3013.3013.2.dta 24 IPI00798367.1 17 kDa protein 51 17238 2 2 2 2 4306 7106 1 0 1 563.3175 1686.9307 3 1686.9304 0.0002 0 46.54 4.40E-05 R ALESSIAPIVIFASNR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8062.8062.3.dta 24 IPI00798367.1 17 kDa protein 51 17238 2 2 2 2 6069 6116 1 0 1 775.3956 2323.1651 3 2323.1655 -0.0005 0 22.93 0.041 R AQTEGINISEEALNHLGEIGTK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6787.6787.3.dta 24 IPI00797004.1 16 kDa protein 47 16437 1 1 1 1 4306 7106 1 0 1 563.3175 1686.9307 3 1686.9304 0.0002 0 46.54 4.40E-05 R ALESSIAPIVIFASNR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8062.8062.3.dta 25 1 IPI00334587.1 Isoform 2 of Heterogeneous nuclear ribonucleoprotein A/B 126 36059 3 3 3 3 1941 4568 1 1 1 584.2894 1166.5643 2 1166.5642 0.0001 0 41.48 0.00013 K FGEVVDCTIK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4823.4823.2.dta 25 1 IPI00334587.1 Isoform 2 of Heterogeneous nuclear ribonucleoprotein A/B 126 36059 3 3 3 3 3399 2608 1 1 1 750.3456 1498.6767 2 1498.6801 -0.0033 0 61.37 8.70E-06 K EVYQQQQYGSGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2614.2614.2.dta 25 1 IPI00334587.1 Isoform 2 of Heterogeneous nuclear ribonucleoprotein A/B 126 36059 3 3 3 3 3409 5213 1 1 1 752.3874 1502.7602 2 1502.7617 -0.0014 0 65.45 5.50E-06 K IFVGGLNPEATEEK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5603.5603.2.dta 25 2 IPI00028888.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein D0 125 38581 5 5 5 5 863 7133 1 0 1 457.7602 913.5058 2 913.5062 -0.0004 0 35.36 0.00083 R GFGFVLFK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8097.8097.2.dta 25 2 IPI00028888.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein D0 125 38581 5 5 5 5 1941 4568 1 0 1 584.2894 1166.5643 2 1166.5642 0.0001 0 41.48 0.00013 K FGEVVDCTLK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4823.4823.2.dta 25 2 IPI00028888.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein D0 125 38581 5 5 5 5 3356 5124 1 0 1 744.8819 1487.7492 2 1487.7508 -0.0015 0 64.26 3.20E-06 K IFVGGLSPDTPEEK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5497.5497.2.dta 25 2 IPI00028888.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein D0 125 38581 5 5 5 5 3558 2228 1 0 1 514.9141 1541.7204 3 1541.7222 -0.0019 1 20.13 0.027 R HSEAATAQREEWK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2187.2187.3.dta 25 2 IPI00028888.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein D0 125 38581 5 5 5 5 4608 5035 1 0 1 586.6529 1756.9369 3 1756.9359 0.0009 1 32.83 0.00087 K IFVGGLSPDTPEEKIR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5391.5391.3.dta 25 IPI00220683.1 Isoform 2 of Heterogeneous nuclear ribonucleoprotein D0 122 36420 4 4 4 4 863 7133 1 0 1 457.7602 913.5058 2 913.5062 -0.0004 0 35.36 0.00083 R GFGFVLFK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8097.8097.2.dta 25 IPI00220683.1 Isoform 2 of Heterogeneous nuclear ribonucleoprotein D0 122 36420 4 4 4 4 1941 4568 1 0 1 584.2894 1166.5643 2 1166.5642 0.0001 0 41.48 0.00013 K FGEVVDCTLK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4823.4823.2.dta 25 IPI00220683.1 Isoform 2 of Heterogeneous nuclear ribonucleoprotein D0 122 36420 4 4 4 4 3356 5124 1 0 1 744.8819 1487.7492 2 1487.7508 -0.0015 0 64.26 3.20E-06 K IFVGGLSPDTPEEK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5497.5497.2.dta 25 IPI00220683.1 Isoform 2 of Heterogeneous nuclear ribonucleoprotein D0 122 36420 4 4 4 4 4608 5035 1 0 1 586.6529 1756.9369 3 1756.9359 0.0009 1 32.83 0.00087 K IFVGGLSPDTPEEKIR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5391.5391.3.dta 25 IPI00106509.2 Isoform 4 of Heterogeneous nuclear ribonucleoprotein A/B 84 31328 2 2 2 2 1941 4568 1 0 1 584.2894 1166.5643 2 1166.5642 0.0001 0 41.48 0.00013 K FGEVVDCTIK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4823.4823.2.dta 25 IPI00106509.2 Isoform 4 of Heterogeneous nuclear ribonucleoprotein A/B 84 31328 2 2 2 2 3399 2608 1 0 1 750.3456 1498.6767 2 1498.6801 -0.0033 0 61.37 8.70E-06 K EVYQQQQYGSGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2614.2614.2.dta 25 IPI00011274.2 heterogeneous nuclear ribonucleoprotein D-like 61 46580 2 2 2 2 863 7133 1 0 1 457.7602 913.5058 2 913.5062 -0.0004 0 35.36 0.00083 R GFGFVLFK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8097.8097.2.dta 25 IPI00011274.2 heterogeneous nuclear ribonucleoprotein D-like 61 46580 2 2 2 2 1941 4568 1 0 1 584.2894 1166.5643 2 1166.5642 0.0001 0 41.48 0.00013 R FGEVVDCTIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4823.4823.2.dta 26 1 IPI00216592.2 Isoform C1 of Heterogeneous nuclear ribonucleoproteins C1/C2 121 32375 6 6 5 5 795 1786 1 1 1 300.4972 898.4698 3 898.4695 0.0004 0 24.85 0.038 K IVGCSVHK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1702.1702.3.dta 26 1 IPI00216592.2 Isoform C1 of Heterogeneous nuclear ribonucleoproteins C1/C2 121 32375 6 6 5 5 989 3480 1 1 1 472.2899 942.5652 2 942.5651 0.0001 0 37.35 0.00069 R VPPPPPIAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3615.3615.2.dta 26 1 IPI00216592.2 Isoform C1 of Heterogeneous nuclear ribonucleoproteins C1/C2 121 32375 6 6 5 5 990 3511 1 1 1 472.2901 942.5656 2 942.5651 0.0006 0 18.46 0.035 R VPPPPPIAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3655.3655.2.dta 26 1 IPI00216592.2 Isoform C1 of Heterogeneous nuclear ribonucleoproteins C1/C2 121 32375 6 6 5 5 1763 4545 1 1 1 375.2043 1122.591 3 1122.5921 -0.001 1 32.01 0.0097 K KSDVEAIFSK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4798.4798.3.dta 26 1 IPI00216592.2 Isoform C1 of Heterogeneous nuclear ribonucleoproteins C1/C2 121 32375 6 6 5 5 2589 6318 1 1 1 658.9015 1315.7884 2 1315.7864 0.002 0 67.22 5.80E-07 R VFIGNLNTLVVK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7053.7053.2.dta 26 1 IPI00216592.2 Isoform C1 of Heterogeneous nuclear ribonucleoproteins C1/C2 121 32375 6 6 5 5 2699 5248 1 1 1 672.3447 1342.6748 2 1342.6769 -0.0021 1 41.12 0.00068 K SDVEAIFSKYGK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5641.5641.2.dta 26 IPI00027569.1 Heterogeneous nuclear ribonucleoprotein C-like 1 98 32180 3 3 3 3 1763 4545 1 0 1 375.2043 1122.591 3 1122.5921 -0.001 1 32.01 0.0097 K KSDVEAIFSK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4798.4798.3.dta 26 IPI00027569.1 Heterogeneous nuclear ribonucleoprotein C-like 1 98 32180 3 3 3 3 2589 6318 1 0 1 658.9015 1315.7884 2 1315.7864 0.002 0 67.22 5.80E-07 R VFIGNLNTLVVK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7053.7053.2.dta 26 IPI00027569.1 Heterogeneous nuclear ribonucleoprotein C-like 1 98 32180 3 3 3 3 2699 5248 1 0 1 672.3447 1342.6748 2 1342.6769 -0.0021 1 41.12 0.00068 K SDVEAIFSKYGK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5641.5641.2.dta 26 IPI00759822.1 Isoform 3 of Heterogeneous nuclear ribonucleoproteins C1/C2 89 25215 3 3 2 2 989 3480 1 0 1 472.2899 942.5652 2 942.5651 0.0001 0 37.35 0.00069 R VPPPPPIAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3615.3615.2.dta 26 IPI00759822.1 Isoform 3 of Heterogeneous nuclear ribonucleoproteins C1/C2 89 25215 3 3 2 2 990 3511 1 0 1 472.2901 942.5656 2 942.5651 0.0006 0 18.46 0.035 R VPPPPPIAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3655.3655.2.dta 26 IPI00759822.1 Isoform 3 of Heterogeneous nuclear ribonucleoproteins C1/C2 89 25215 3 3 2 2 2589 6318 1 0 1 658.9015 1315.7884 2 1315.7864 0.002 0 67.22 5.80E-07 R VFIGNLNTLVVK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7053.7053.2.dta 26 IPI00411624.2 11 kDa protein 67 11368 1 1 1 1 2589 6318 1 0 1 658.9015 1315.7884 2 1315.7864 0.002 0 67.22 5.80E-07 R VFIGNLNTLVVK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7053.7053.2.dta 26 IPI00166137.5 RALY-like protein isoform 1 25 32425 1 1 1 1 795 1786 1 0 1 300.4972 898.4698 3 898.4695 0.0004 0 24.85 0.038 K IVGCSVHK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1702.1702.3.dta 27 1 IPI00398958.3 similar to 40S ribosomal protein SA 119 32951 3 3 3 3 860 4489 1 1 1 456.7793 911.544 2 911.544 0 0 61.5 3.50E-06 R LLVVTDPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4738.4738.2.dta 27 1 IPI00398958.3 similar to 40S ribosomal protein SA 119 32951 3 3 3 3 2126 3764 1 1 1 602.3269 1202.6393 2 1202.6408 -0.0015 0 64.59 2.50E-06 K FAAATGATPIAGR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3945.3945.2.dta 27 1 IPI00398958.3 similar to 40S ribosomal protein SA 119 32951 3 3 3 3 2537 4778 1 1 1 653.8245 1305.6344 2 1305.6387 -0.0043 0 32.67 0.0024 R YVDIAIPCNNK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5085.5085.2.dta 27 IPI00790580.1 16 kDa protein 106 16106 2 2 2 2 860 4489 1 0 1 456.7793 911.544 2 911.544 0 0 61.5 3.50E-06 R LLVVTDPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4738.4738.2.dta 27 IPI00790580.1 16 kDa protein 106 16106 2 2 2 2 2126 3764 1 0 1 602.3269 1202.6393 2 1202.6408 -0.0015 0 64.59 2.50E-06 K FAAATGATPIAGR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3945.3945.2.dta 27 IPI00411639.1 Laminin receptor-like protein LAMRL5 65 33089 1 1 1 1 2126 3764 1 0 1 602.3269 1202.6393 2 1202.6408 -0.0015 0 64.59 2.50E-06 K FAAATGATPIAGR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3945.3945.2.dta 27 IPI00399036.1 similar to 40S ribosomal protein SA (p40) (34/67 kDa laminin receptor) (Colon carcinoma laminin-binding protein) (NEM/1CHD4) (Multidrug resistance-associated protein MGr1-Ag) isoform 1 62 33028 1 1 1 1 860 4489 1 0 1 456.7793 911.544 2 911.544 0 0 61.5 3.50E-06 R LLVVTDPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4738.4738.2.dta 27 IPI00399077.4 similar to 40S ribosomal protein SA 33 32731 1 1 1 1 2537 4778 1 0 1 653.8245 1305.6344 2 1305.6387 -0.0043 0 32.67 0.0024 R YVDIAIPCNNK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5085.5085.2.dta 28 1 IPI00419373.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein A3 118 39799 3 3 3 3 273 1369 1 1 0 364.227 726.4394 2 726.4388 0.0006 1 30.92 0.0086 R VVEPKR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1247.1247.2.dta 28 1 IPI00419373.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein A3 118 39799 3 3 3 3 4711 2605 1 1 1 449.2516 1792.9775 4 1792.9795 -0.0021 1 19.32 0.015 R AVSREDSVKPGAHLTVK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2611.2611.4.dta 28 1 IPI00419373.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein A3 118 39799 3 3 3 3 5112 3220 1 1 1 955.8975 1909.7804 2 1909.7827 -0.0024 0 104.77 1.10E-10 R SSGSPYGGGYGSGGGSGGYGSR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3291.3291.2.dta 28 IPI00738668.1 OTTHUMP00000018488 115 28190 2 2 2 2 273 1369 1 0 0 364.227 726.4394 2 726.4388 0.0006 1 30.92 0.0086 - VVEPKR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1247.1247.2.dta 28 IPI00738668.1 OTTHUMP00000018488 115 28190 2 2 2 2 5112 3220 1 0 1 955.8975 1909.7804 2 1909.7827 -0.0024 0 104.77 1.10E-10 R SSGSPYGGGYGSGGGSGGYGSR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3291.3291.2.dta 28 IPI00470658.1 FBRNP 32 29623 2 2 2 2 273 1369 1 0 0 364.227 726.4394 2 726.4388 0.0006 1 30.92 0.0086 R VVEPKR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1247.1247.2.dta 28 IPI00470658.1 FBRNP 32 29623 2 2 2 2 4711 2605 1 0 1 449.2516 1792.9775 4 1792.9795 -0.0021 1 19.32 0.015 R AVSREDSVKPGAHLTVK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2611.2611.4.dta 29 1 IPI00004968.1 Pre-mRNA-processing factor 19 116 55603 6 6 6 6 726 1787 1 1 1 437.7407 873.4668 2 873.4668 -0.0001 0 26.43 0.0068 R QQLQTTR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1703.1703.2.dta 29 1 IPI00004968.1 Pre-mRNA-processing factor 19 116 55603 6 6 6 6 772 3000 1 1 1 445.7505 889.4865 2 889.4869 -0.0003 0 44.46 0.00053 K ATVLTTER K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3043.3043.2.dta 29 1 IPI00004968.1 Pre-mRNA-processing factor 19 116 55603 6 6 6 6 1166 1861 1 1 1 494.7929 987.5712 2 987.5713 -0.0001 1 35.15 0.0043 R LTKEVTAAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1783.1783.2.dta 29 1 IPI00004968.1 Pre-mRNA-processing factor 19 116 55603 6 6 6 6 3854 5672 1 1 1 807.9243 1613.8341 2 1613.8348 -0.0007 0 51.22 0.00012 R IWSVPNASCVQVVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6163.6163.2.dta 29 1 IPI00004968.1 Pre-mRNA-processing factor 19 116 55603 6 6 6 6 4690 4123 1 1 1 594.9992 1781.9758 3 1781.9774 -0.0017 1 17.25 0.028 R GKTVPEELVKPEELSK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4339.4339.3.dta 29 1 IPI00004968.1 Pre-mRNA-processing factor 19 116 55603 6 6 6 6 6918 5617 1 1 1 651.0966 2600.3571 4 2600.3599 -0.0028 1 41.1 0.00018 K KVTSVVFHPSQDLVFSASPDATIR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6094.6094.4.dta 30 1 IPI00410693.3 Isoform 1 of Plasminogen activator inhibitor 1 RNA-binding protein 115 44995 5 5 4 4 634 6903 1 1 1 422.7352 843.4559 2 843.4562 -0.0003 1 26.75 0.041 K AIQNKDR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.781.781.2.dta 30 1 IPI00410693.3 Isoform 1 of Plasminogen activator inhibitor 1 RNA-binding protein 115 44995 5 5 4 4 1968 2337 1 1 1 392.5516 1174.6329 3 1174.6346 -0.0017 1 24.64 0.02 R RFEKPLEEK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2317.2317.3.dta 30 1 IPI00410693.3 Isoform 1 of Plasminogen activator inhibitor 1 RNA-binding protein 115 44995 5 5 4 4 2321 1848 1 1 1 628.3224 1254.6302 2 1254.6317 -0.0014 0 43.83 0.00048 R RPDQQLQGEGK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1769.1769.2.dta 30 1 IPI00410693.3 Isoform 1 of Plasminogen activator inhibitor 1 RNA-binding protein 115 44995 5 5 4 4 2322 1852 1 1 1 419.2178 1254.6315 3 1254.6317 -0.0002 0 23.15 0.016 R RPDQQLQGEGK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1773.1773.3.dta 30 1 IPI00410693.3 Isoform 1 of Plasminogen activator inhibitor 1 RNA-binding protein 115 44995 5 5 4 4 3245 1653 1 1 1 730.8581 1459.7016 2 1459.7015 0.0001 0 80.79 3.90E-08 K SAAQAAAQTNSNAAGK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1559.1559.2.dta 31 1 IPI00186290.6 Elongation factor 2 103 96246 6 6 6 6 773 4579 1 1 1 445.7588 889.503 2 889.5022 0.0008 0 21.37 0.016 K FSVSPVVR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4837.4837.2.dta 31 1 IPI00186290.6 Elongation factor 2 103 96246 6 6 6 6 3182 8160 1 1 1 722.8883 1443.7621 2 1443.7609 0.0011 1 36.34 0.00077 K EGIPALDNFLDKL - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9357.9357.2.dta 31 1 IPI00186290.6 Elongation factor 2 103 96246 6 6 6 6 5696 8370 1 1 1 735.3748 2203.1026 3 2203.1048 -0.0022 0 32.22 0.0038 K STAISLFYELSENDLNFIK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9614.9614.3.dta 31 1 IPI00186290.6 Elongation factor 2 103 96246 6 6 6 6 5718 7633 1 1 1 740.7241 2219.1504 3 2219.1474 0.003 0 38.53 0.00024 R ALLELQLEPEELYQTFQR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8719.8719.3.dta 31 1 IPI00186290.6 Elongation factor 2 103 96246 6 6 6 6 7422 7792 1 1 1 920.4818 2758.4234 3 2758.4252 -0.0018 0 40.41 0.00016 R YVEPIEDVPCGNIVGLVGVDQFLVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8903.8903.3.dta 31 1 IPI00186290.6 Elongation factor 2 103 96246 6 6 6 6 7972 8447 1 1 1 997.1891 2988.5454 3 2988.5453 0.0002 0 15.79 0.033 R LMEPIYLVEIQCPEQVVGGIYGVLNR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9720.9720.3.dta 32 1 IPI00220644.8 Isoform M1 of Pyruvate kinase isozymes M1/M2 100 58538 4 4 4 4 1413 1255 1 1 1 347.5214 1039.5424 3 1039.541 0.0014 1 28.23 0.026 R KASDVHEVR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1160.1160.3.dta 32 1 IPI00220644.8 Isoform M1 of Pyruvate kinase isozymes M1/M2 100 58538 4 4 4 4 2778 4741 1 1 1 680.3552 1358.6958 2 1358.6976 -0.0019 0 72.05 5.30E-07 R NTGIICTIGPASR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5040.5040.2.dta 32 1 IPI00220644.8 Isoform M1 of Pyruvate kinase isozymes M1/M2 100 58538 4 4 4 4 2953 2490 1 1 1 465.5963 1393.7669 3 1393.7677 -0.0008 1 31.61 0.0011 K IISKIENHEGVR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2483.2483.3.dta 32 1 IPI00220644.8 Isoform M1 of Pyruvate kinase isozymes M1/M2 100 58538 4 4 4 4 4925 8605 1 1 1 620.6381 1858.8925 3 1858.8924 0.0001 0 26.46 0.0058 K FGVEQDVDMVFASFIR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9933.9933.3.dta 32 IPI00783061.1 58 kDa protein 84 58542 3 3 3 3 1413 1255 1 0 1 347.5214 1039.5424 3 1039.541 0.0014 1 28.23 0.026 R KASDVHEVR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1160.1160.3.dta 32 IPI00783061.1 58 kDa protein 84 58542 3 3 3 3 2778 4741 1 0 1 680.3552 1358.6958 2 1358.6976 -0.0019 0 72.05 5.30E-07 R NTGIICTIGPASR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5040.5040.2.dta 32 IPI00783061.1 58 kDa protein 84 58542 3 3 3 3 4925 8605 1 0 1 620.6381 1858.8925 3 1858.8924 0.0001 0 26.46 0.0058 K FGVEQDVDMVFASFIR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9933.9933.3.dta 32 IPI00607698.1 PKM2 protein 79 30540 2 2 2 2 2778 4741 1 0 1 680.3552 1358.6958 2 1358.6976 -0.0019 0 72.05 5.30E-07 R NTGIICTIGPASR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5040.5040.2.dta 32 IPI00607698.1 PKM2 protein 79 30540 2 2 2 2 4925 8605 1 0 1 620.6381 1858.8925 3 1858.8924 0.0001 0 26.46 0.0058 K FGVEQDVDMVFASFIR - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9933.9933.3.dta 32 IPI00788663.1 26 kDa protein 72 26594 1 1 1 1 2778 4741 1 0 1 680.3552 1358.6958 2 1358.6976 -0.0019 0 72.05 5.30E-07 R NTGIICTIGPASR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5040.5040.2.dta 32 IPI00604528.2 PKM2 protein 34 40882 2 2 2 2 1413 1255 1 0 1 347.5214 1039.5424 3 1039.541 0.0014 1 28.23 0.026 R KASDVHEVR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1160.1160.3.dta 32 IPI00604528.2 PKM2 protein 34 40882 2 2 2 2 4925 8605 1 0 1 620.6381 1858.8925 3 1858.8924 0.0001 0 26.46 0.0058 K FGVEQDVDMVFASFIR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9933.9933.3.dta 33 1 IPI00183526.5 NCL protein 94 51667 3 3 3 3 2028 1565 1 1 1 596.8123 1191.6101 2 1191.6095 0.0006 1 75.74 2.10E-07 R IVTDRETGSSK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1461.1461.2.dta 33 1 IPI00183526.5 NCL protein 94 51667 3 3 3 3 5687 5456 1 1 1 734.0115 2199.0128 3 2199.0179 -0.0051 1 15.28 0.037 K GLSEDTTEETLKESFDGSVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5887.5887.3.dta 33 1 IPI00183526.5 NCL protein 94 51667 3 3 3 3 6614 7825 1 1 1 834.4271 2500.2594 3 2500.2584 0.0009 0 35.24 0.0005 K TLVLSNLSYSATEETLQEVFEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8949.8949.3.dta 34 1 IPI00217223.1 Multifunctional protein ADE2 92 50389 5 5 5 5 1315 2241 1 1 1 508.7592 1015.5039 2 1015.5047 -0.0007 0 53.97 8.40E-05 K DQITAGNAAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2202.2202.2.dta 34 1 IPI00217223.1 Multifunctional protein ADE2 92 50389 5 5 5 5 2941 5422 1 1 1 697.3213 1392.628 2 1392.6278 0.0002 0 31.17 0.0029 K ACGNFGIPCELR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5849.5849.2.dta 34 1 IPI00217223.1 Multifunctional protein ADE2 92 50389 5 5 5 5 3024 1946 1 1 1 705.87 1409.7254 2 1409.7263 -0.0009 1 19.27 0.025 R VTSAHKGPDETLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1876.1876.2.dta 34 1 IPI00217223.1 Multifunctional protein ADE2 92 50389 5 5 5 5 4294 3554 1 1 1 562.3159 1683.9257 3 1683.9268 -0.001 1 29.31 0.0019 K VLLQSKDQITAGNAAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3707.3707.3.dta 34 1 IPI00217223.1 Multifunctional protein ADE2 92 50389 5 5 5 5 5547 6254 1 1 1 698.04 2091.0981 3 2091.1001 -0.0019 1 33.83 0.0017 R IKAEYEGDGIPTVFVAVAGR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6970.6970.3.dta 35 1 IPI00304692.1 Heterogeneous nuclear ribonucleoprotein G 92 42306 5 5 5 5 245 1775 1 1 1 359.206 716.3974 2 716.397 0.0005 0 17.85 0.027 R GPPPPPR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1690.1690.2.dta 35 1 IPI00304692.1 Heterogeneous nuclear ribonucleoprotein G 92 42306 5 5 5 5 754 2643 1 1 1 442.7083 883.402 2 883.4035 -0.0015 0 21.04 0.047 R SDLYSSGR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2652.2652.2.dta 35 1 IPI00304692.1 Heterogeneous nuclear ribonucleoprotein G 92 42306 5 5 5 5 1508 2036 1 1 1 531.2533 1060.492 2 1060.4938 -0.0017 0 44.91 8.90E-05 R GPPPSYGGSSR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1980.1980.2.dta 35 1 IPI00304692.1 Heterogeneous nuclear ribonucleoprotein G 92 42306 5 5 5 5 4215 2296 1 1 1 557.6143 1669.8209 3 1669.8172 0.0037 1 16.52 0.047 R SAPPTRGPPPSYGGSSR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2263.2263.3.dta 35 1 IPI00304692.1 Heterogeneous nuclear ribonucleoprotein G 92 42306 5 5 5 5 5076 6033 1 1 1 633.9789 1898.915 3 1898.9163 -0.0013 1 60.4 3.10E-06 R GFAFVTFESPADAKDAAR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6670.6670.3.dta 35 IPI00061178.1 "RNA binding motif protein, X-linked-like 1" 88 42173 2 2 2 2 1508 2036 1 0 1 531.2533 1060.492 2 1060.4938 -0.0017 0 44.91 8.90E-05 R GPPPSYGGSSR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1980.1980.2.dta 35 IPI00061178.1 "RNA binding motif protein, X-linked-like 1" 88 42173 2 2 2 2 5076 6033 1 0 1 633.9789 1898.915 3 1898.9163 -0.0013 1 60.4 3.10E-06 R GFAFVTFESPADAKDAAR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6670.6670.3.dta 35 IPI00643486.1 "RNA binding motif protein, X-linked-like 1" 60 16840 1 1 1 1 5076 6033 1 0 1 633.9789 1898.915 3 1898.9163 -0.0013 1 60.4 3.10E-06 R GFAFVTFESPADAKDAAR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6670.6670.3.dta 35 IPI00816796.1 "CDNA FLJ38696 fis, clone KIDNE2001931, highly similar to HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN G" 49 40822 4 4 4 4 245 1775 1 0 1 359.206 716.3974 2 716.397 0.0005 0 17.85 0.027 R GPPPPPR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1690.1690.2.dta 35 IPI00816796.1 "CDNA FLJ38696 fis, clone KIDNE2001931, highly similar to HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN G" 49 40822 4 4 4 4 754 2643 1 0 1 442.7083 883.402 2 883.4035 -0.0015 0 21.04 0.047 R SDLYSSGR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2652.2652.2.dta 35 IPI00816796.1 "CDNA FLJ38696 fis, clone KIDNE2001931, highly similar to HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN G" 49 40822 4 4 4 4 1508 2036 1 0 1 531.2533 1060.492 2 1060.4938 -0.0017 0 44.91 8.90E-05 R GPPPSYGGSSR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1980.1980.2.dta 35 IPI00816796.1 "CDNA FLJ38696 fis, clone KIDNE2001931, highly similar to HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN G" 49 40822 4 4 4 4 4215 2296 1 0 1 557.6143 1669.8209 3 1669.8172 0.0037 1 16.52 0.047 R SAPPTRGPPPSYGGSSR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2263.2263.3.dta 35 IPI00290429.7 Hypothetical protein HAKAI 18 55111 1 1 1 1 245 1775 1 0 1 359.206 716.3974 2 716.397 0.0005 0 17.85 0.027 R GPPPPPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1690.1690.2.dta 36 1 IPI00216106.3 Isoform 3 of Putative GTP-binding protein 9 87 31649 1 1 1 1 3637 8141 1 1 1 784.9733 1567.9321 2 1567.9338 -0.0017 0 87.27 5.50E-09 K IPAFLNVVDIAGLVK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9332.9332.2.dta 37 1 IPI00179452.1 Isoform 1 of Protein CBFA2T2 84 67889 2 2 2 2 681 2785 1 1 1 431.7347 861.4549 2 861.4556 -0.0007 0 50.95 0.00019 K TGTELVSR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2806.2806.2.dta 37 1 IPI00179452.1 Isoform 1 of Protein CBFA2T2 84 67889 2 2 2 2 4934 5657 1 1 1 621.3264 1860.9572 3 1860.9581 -0.0009 1 56.13 1.90E-05 K AVAEAEQKAFEVIATER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6144.6144.3.dta 38 1 IPI00215965.2 Isoform A1-B of Heterogeneous nuclear ribonucleoprotein A1 83 38936 3 3 3 3 273 1369 1 0 0 364.227 726.4394 2 726.4388 0.0006 1 30.92 0.0086 R VVEPKR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1247.1247.2.dta 38 1 IPI00215965.2 Isoform A1-B of Heterogeneous nuclear ribonucleoprotein A1 83 38936 3 3 3 3 3934 3722 1 1 1 543.5986 1627.7741 3 1627.7743 -0.0002 0 19.82 0.025 R SSGPYGGGGQYFAKPR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3895.3895.3.dta 38 1 IPI00215965.2 Isoform A1-B of Heterogeneous nuclear ribonucleoprotein A1 83 38936 3 3 3 3 4354 2213 1 1 1 847.8534 1693.6922 2 1693.6928 -0.0006 0 67.81 3.20E-07 R NQGGYGGSSSSSSYGSGR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2171.2171.2.dta 38 IPI00399037.4 similar to Heterogeneous nuclear ribonucleoprotein A1 80 30004 2 2 2 2 273 1369 1 0 0 364.227 726.4394 2 726.4388 0.0006 1 30.92 0.0086 R VVEPKR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1247.1247.2.dta 38 IPI00399037.4 similar to Heterogeneous nuclear ribonucleoprotein A1 80 30004 2 2 2 2 4354 2213 1 0 1 847.8534 1693.6922 2 1693.6928 -0.0006 0 67.81 3.20E-07 R NQGGYGGSSSSSSYGSGR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2171.2171.2.dta 38 IPI00478539.2 similar to Heterogeneous nuclear ribonucleoprotein A1 31 32532 2 2 2 2 273 1369 1 0 0 364.227 726.4394 2 726.4388 0.0006 1 30.92 0.0086 R VVEPKR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1247.1247.2.dta 38 IPI00478539.2 similar to Heterogeneous nuclear ribonucleoprotein A1 31 32532 2 2 2 2 3934 3722 1 0 1 543.5986 1627.7741 3 1627.7743 -0.0002 0 19.82 0.025 R SSGPYGGGGQYFAKPR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3895.3895.3.dta 39 1 IPI00647650.3 Eukaryotic translation initiation factor 3 subunit 3 80 41726 1 1 1 1 3932 1575 1 1 1 814.3748 1626.735 2 1626.7333 0.0017 0 80.33 4.10E-08 K EGTGSTATSSSSTAGAAGK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1473.1473.2.dta 40 1 IPI00031420.3 UDP-glucose 6-dehydrogenase 78 55674 1 1 1 1 1557 5001 1 1 1 537.8063 1073.598 2 1073.5981 -0.0002 0 77.79 1.40E-07 K LAANAFLAQR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5354.5354.2.dta 41 1 IPI00216008.4 Isoform Long of Glucose-6-phosphate 1-dehydrogenase 78 64299 1 1 1 1 4748 3896 1 1 1 904.3969 1806.7793 2 1806.7809 -0.0016 0 77.5 5.40E-08 R NSYVAGQYDDAASYQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4090.4090.2.dta 42 1 IPI00304596.3 Non-POU domain-containing octamer-binding protein 76 54311 3 3 3 3 760 3644 1 1 0 443.7543 885.4941 2 885.492 0.0021 0 36.98 0.00078 R AVVIVDDR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3807.3807.2.dta 42 1 IPI00304596.3 Non-POU domain-containing octamer-binding protein 76 54311 3 3 3 3 1622 8525 1 1 1 543.775 1085.5355 2 1085.5366 -0.0011 1 48.24 0.00019 K NQQFHKER E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.983.983.2.dta 42 1 IPI00304596.3 Non-POU domain-containing octamer-binding protein 76 54311 3 3 3 3 3548 2130 1 1 1 514.2557 1539.7452 3 1539.7463 -0.0011 1 29.61 0.0026 R RMEELHNQEVQK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2081.2081.3.dta 42 2 IPI00010740.1 "Isoform Long of Splicing factor, proline- and glutamine-rich" 60 76216 3 3 3 3 760 3644 1 0 0 443.7543 885.4941 2 885.492 0.0021 0 36.98 0.00078 R AVVIVDDR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3807.3807.2.dta 42 2 IPI00010740.1 "Isoform Long of Splicing factor, proline- and glutamine-rich" 60 76216 3 3 3 3 2685 3184 1 0 1 671.336 1340.6574 2 1340.6586 -0.0011 0 30.53 0.0079 R FGQGGAGPVGGQGPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3252.3252.2.dta 42 2 IPI00010740.1 "Isoform Long of Splicing factor, proline- and glutamine-rich" 60 76216 3 3 3 3 7031 8134 1 0 1 880.4392 2638.2958 3 2638.2915 0.0043 0 28.48 0.0021 R NLSPYVSNELLEEAFSQFGPIER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9325.9325.3.dta 42 IPI00216613.1 "Isoform Short of Splicing factor, proline- and glutamine-rich" 49 72332 2 2 2 2 760 3644 1 0 0 443.7543 885.4941 2 885.492 0.0021 0 36.98 0.00078 R AVVIVDDR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3807.3807.2.dta 42 IPI00216613.1 "Isoform Short of Splicing factor, proline- and glutamine-rich" 49 72332 2 2 2 2 7031 8134 1 0 1 880.4392 2638.2958 3 2638.2915 0.0043 0 28.48 0.0021 R NLSPYVSNELLEEAFSQFGPIER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9325.9325.3.dta 42 IPI00645966.1 24 kDa protein 37 23715 1 1 1 1 760 3644 1 0 0 443.7543 885.4941 2 885.492 0.0021 0 36.98 0.00078 R AVVIVDDR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3807.3807.2.dta 42 IPI00645010.1 30 kDa protein 30 29660 1 1 1 1 3548 2130 1 0 1 514.2557 1539.7452 3 1539.7463 -0.0011 1 29.61 0.0026 R RMEELHNQEVQK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2081.2081.3.dta 43 1 IPI00032406.1 DnaJ homolog subfamily A member 2 70 46344 1 1 1 1 2674 2882 1 1 1 669.3005 1336.5864 2 1336.5864 0 0 70.44 2.50E-07 K NVLCSACSGQGGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2912.2912.2.dta 44 1 IPI00185374.4 26S proteasome non-ATPase regulatory subunit 12 68 53270 2 2 2 2 3448 7651 1 1 1 757.9382 1513.8619 2 1513.8603 0.0016 0 68.36 4.40E-07 R LQEVIETLLSLEK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8737.8737.2.dta 44 1 IPI00185374.4 26S proteasome non-ATPase regulatory subunit 12 68 53270 2 2 2 2 6689 153 1 1 1 845.7717 2534.2934 3 2534.2938 -0.0004 0 14.98 0.039 R MAQLLDLSVDESEAFLSNLVVNK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.10201.10201.3.dta 44 IPI00335069.2 similar to proteasome 26S non-ATPase subunit 12 isoform 2 15 50945 1 1 1 1 6689 153 1 0 1 845.7717 2534.2934 3 2534.2938 -0.0004 0 14.98 0.039 R MAQLLDLSVDESEAFLSNLVVNK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.10201.10201.3.dta 45 1 IPI00550069.3 Ribonuclease inhibitor 68 51766 2 2 2 2 1877 3609 1 1 1 575.2643 1148.5141 2 1148.5132 0.001 0 68.34 1.60E-06 R LDDCGLTEAR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3769.3769.2.dta 45 1 IPI00550069.3 Ribonuclease inhibitor 68 51766 2 2 2 2 5947 7733 1 1 1 763.3942 2287.1608 3 2287.1592 0.0016 0 20.47 0.045 R LLCETLLEPGCQLESLWVK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8836.8836.3.dta 46 1 IPI00328550.3 Thrombospondin-4 precursor 65 108482 2 2 2 2 1355 4258 1 1 1 513.3032 1024.5919 2 1024.5917 0.0002 0 41.6 0.00047 R AVAEPGIQLK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4485.4485.2.dta 46 1 IPI00328550.3 Thrombospondin-4 precursor 65 108482 2 2 2 2 5477 7644 1 1 1 1028.0211 2054.0277 2 2054.0295 -0.0018 0 43.65 0.0002 R LGVFCFSQENIIWSNLK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8730.8730.2.dta 46 IPI00028030.3 Cartilage oligomeric matrix protein precursor 42 85402 1 1 1 1 1355 4258 1 0 1 513.3032 1024.5919 2 1024.5917 0.0002 0 41.6 0.00047 R AVAEPGIQLK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4485.4485.2.dta 47 1 IPI00009032.1 Lupus La protein 58 46979 1 1 1 1 3577 7688 1 1 1 775.4277 1548.8409 2 1548.8399 0.001 0 58.21 3.50E-06 R LTTDFNVIVEALSK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8783.8783.2.dta 48 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 57 71082 3 3 3 3 1993 2350 1 1 1 590.8132 1179.6119 2 1179.6135 -0.0016 1 25.02 0.014 K VQVEYKGETK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2331.2331.2.dta 48 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 57 71082 3 3 3 3 3350 4922 1 1 1 744.3519 1486.6892 2 1486.694 -0.0048 0 42.5 0.0001 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5253.5253.2.dta 48 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 57 71082 3 3 3 3 4319 3437 1 1 1 564.58 1690.7182 3 1690.7183 -0.0001 0 24.44 0.014 K STAGDTHLGGEDFDNR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3557.3557.3.dta 48 IPI00792459.1 23 kDa protein 51 23238 2 2 2 2 1993 2350 1 0 1 590.8132 1179.6119 2 1179.6135 -0.0016 1 25.02 0.014 K VQVEYKGETK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2331.2331.2.dta 48 IPI00792459.1 23 kDa protein 51 23238 2 2 2 2 3350 4922 1 0 1 744.3519 1486.6892 2 1486.694 -0.0048 0 42.5 0.0001 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5253.5253.2.dta 48 IPI00011134.1 Heat shock 70 kDa protein 7 (Fragment) 42 27004 1 1 1 1 3350 4922 1 0 1 744.3519 1486.6892 2 1486.694 -0.0048 0 42.5 0.0001 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5253.5253.2.dta 48 IPI00793644.1 17 kDa protein 25 16567 1 1 1 1 1993 2350 1 0 1 590.8132 1179.6119 2 1179.6135 -0.0016 1 25.02 0.014 K VQVEYKGETK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2331.2331.2.dta 49 1 IPI00216951.2 "Aspartyl-tRNA synthetase, cytoplasmic" 57 57499 2 2 2 2 5272 5567 1 1 1 654.0215 1959.0426 3 1959.0425 0.0001 1 58.08 5.30E-06 K FAANINKESIVDVEGVVR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6017.6017.3.dta 49 1 IPI00216951.2 "Aspartyl-tRNA synthetase, cytoplasmic" 57 57499 2 2 2 2 5731 6216 1 1 1 742.3832 2224.1277 3 2224.1384 -0.0107 1 14.81 0.045 K FLEPTLRLEYCEALAMLR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6926.6926.3.dta 50 1 IPI00304267.3 nucleoredoxin 56 48761 1 1 1 1 5587 2921 1 1 1 706.0211 2115.0415 3 2115.0457 -0.0042 1 56.44 7.40E-06 R LRGDAAAGPGPGAGAGAAAEPEPR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2954.2954.3.dta 51 1 IPI00396378.3 Isoform B1 of Heterogeneous nuclear ribonucleoproteins A2/B1 56 37464 2 2 2 2 273 1369 1 0 0 364.227 726.4394 2 726.4388 0.0006 1 30.92 0.0086 R VVEPKR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1247.1247.2.dta 51 1 IPI00396378.3 Isoform B1 of Heterogeneous nuclear ribonucleoproteins A2/B1 56 37464 2 2 2 2 2873 4073 1 1 1 689.3174 1376.6202 2 1376.6222 -0.002 0 45.52 0.0001 R GGGGNFGPGPGSNFR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4284.4284.2.dta 52 1 IPI00291398.1 Isoform Long of Nucleolysin TIA-1 isoform p40 55 43276 1 1 1 1 2373 2374 1 1 1 634.3083 1266.6021 2 1266.6052 -0.003 0 55.04 2.90E-05 K DTSSSTVVSTQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2357.2357.2.dta 53 1 IPI00009104.7 RuvB-like 2 55 51296 1 1 1 1 1896 5535 1 1 1 578.3035 1154.5925 2 1154.5931 -0.0006 0 54.95 5.00E-05 R GLGLDDALEPR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5981.5981.2.dta 54 1 IPI00296374.3 Isoform 1 of Zinc finger protein-like 1 53 34833 2 2 2 2 935 4629 1 1 1 465.7615 929.5085 2 929.5083 0.0002 0 47 0.00033 K LATVNWAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4906.4906.2.dta 54 1 IPI00296374.3 Isoform 1 of Zinc finger protein-like 1 53 34833 2 2 2 2 5242 5347 1 1 1 649.6505 1945.9295 3 1945.9316 -0.0021 0 25.92 0.0037 R AAADSDPNLDPLMNPHIR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5760.5760.3.dta 55 1 IPI00299000.5 Proliferation-associated protein 2G4 52 44101 2 2 2 2 398 1813 1 1 1 391.2322 780.4498 2 780.4494 0.0004 1 27.96 0.0087 R TTIYKR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1731.1731.2.dta 55 1 IPI00299000.5 Proliferation-associated protein 2G4 52 44101 2 2 2 2 5203 3741 1 1 1 643.0052 1925.9939 3 1925.9959 -0.002 0 42.47 0.00016 R LVKPGNQNTQVTEAWNK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3919.3919.3.dta 56 1 IPI00013508.5 Alpha-actinin-1 49 103563 1 1 1 1 2913 7662 1 1 1 693.8906 1385.7667 2 1385.7667 0 0 48.95 9.80E-05 R VGWEQLLTTIAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8749.8749.2.dta 57 1 IPI00643920.2 Transketolase 49 68519 2 2 2 2 1130 2584 1 1 1 489.79 977.5655 2 977.5658 -0.0003 0 27.61 0.0026 K HQPTAIIAK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2588.2588.2.dta 57 1 IPI00643920.2 Transketolase 49 68519 2 2 2 2 5416 8519 1 1 1 675.0104 2022.0093 3 2022.0091 0.0002 0 35.81 0.00044 K NMAEQIIQEIYSQIQSK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9821.9821.3.dta 58 1 IPI00376317.3 autoantigen RCD8 48 152992 3 3 3 3 5428 5199 1 1 1 676.677 2027.0092 3 2027.0106 -0.0014 0 23.19 0.0067 R LCTQLEGLQSTVTGHVER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5587.5587.3.dta 58 1 IPI00376317.3 autoantigen RCD8 48 152992 3 3 3 3 5659 8171 1 1 1 726.3793 2176.116 3 2176.1158 0.0002 0 33.63 0.00089 R GLVSTLQSATEQMAATVAGSVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9369.9369.3.dta 58 1 IPI00376317.3 autoantigen RCD8 48 152992 3 3 3 3 7478 7591 1 1 1 692.8708 2767.454 4 2767.4576 -0.0036 1 20.79 0.011 R GGQLQEQLTQQLSQALSSAVAGRLER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8671.8671.4.dta 58 IPI00477242.1 Autoantigen 23 133202 1 1 1 1 5428 5199 1 0 1 676.677 2027.0092 3 2027.0106 -0.0014 0 23.19 0.0067 R LCTQLEGLQSTVTGHVER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5587.5587.3.dta 59 1 IPI00018398.4 26S protease regulatory subunit 6A 48 49458 2 2 2 2 4350 7747 1 1 1 846.9645 1691.9145 2 1691.9134 0.0011 0 13.89 0.05 R QTYFLPVIGLVDAEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8853.8853.2.dta 59 1 IPI00018398.4 26S protease regulatory subunit 6A 48 49458 2 2 2 2 4893 6207 1 1 1 617.3679 1849.0817 3 1849.0785 0.0032 1 48.15 2.80E-05 K VIAATNRVDILDPALLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6912.6912.3.dta 60 1 IPI00033030.2 Adhesion-regulating molecule 1 precursor 46 42412 1 1 1 1 3632 2165 1 1 1 784.3811 1566.7477 2 1566.7486 -0.0009 0 46.4 8.40E-05 R SQSAAVTPSSTTSSTR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2119.2119.2.dta 61 1 IPI00386208.1 Gastric-associated differentially-expressed protein YA61P 45 14858 1 1 1 1 3064 4136 1 1 1 710.8744 1419.7343 2 1419.7358 -0.0014 0 45.12 6.30E-05 R AAAYNIVPSSTGAAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4353.4353.2.dta 62 1 IPI00334775.6 85 kDa protein 45 85104 2 2 2 2 277 4315 1 1 0 365.7265 729.4384 2 729.4385 -0.0001 0 41.45 0.0018 R LSELLR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4548.4548.2.dta 62 1 IPI00334775.6 85 kDa protein 45 85104 2 2 2 2 1853 2421 1 1 1 381.192 1140.554 3 1140.5523 0.0017 0 25.64 0.0084 K LGIHEDSTNR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2408.2408.3.dta 63 1 IPI00017669.5 Isoform 1 of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 44 46678 1 1 1 1 1098 1718 1 1 1 486.7462 971.4779 2 971.4785 -0.0005 0 44.35 0.00023 R LGGNPGTNSR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1629.1629.2.dta 64 1 IPI00743683.2 Rheumatoid factor RF-ET11 (Fragment) 44 10316 1 1 1 1 2447 3834 1 1 1 643.34 1284.6655 2 1284.6674 -0.0019 0 44.26 0.0001 - ESGGGLVQPGGSLK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4023.4023.2.dta 65 1 IPI00550746.4 Nuclear migration protein nudC 44 38276 1 1 1 1 2118 3237 1 1 1 601.817 1201.6195 2 1201.619 0.0005 0 43.96 0.00047 R LVSSDPEINTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3310.3310.2.dta 66 1 IPI00021885.1 Isoform 1 of Fibrinogen alpha chain precursor 44 95656 1 1 1 1 394 3052 1 1 1 391.1968 780.3791 2 780.3766 0.0025 0 43.5 0.00066 R GADYSLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3105.3105.2.dta 67 1 IPI00641829.5 BAT1 protein 39 51103 2 2 2 2 838 5123 1 1 1 453.7376 905.4607 2 905.4607 0 0 32.01 0.02 R DVQEIFR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5496.5496.2.dta 67 1 IPI00641829.5 BAT1 protein 39 51103 2 2 2 2 2339 3649 1 1 1 630.3124 1258.6102 2 1258.6095 0.0007 1 27.76 0.0028 R YQQFKDFQR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3812.3812.2.dta 67 IPI00062206.1 DDX39 protein 32 35528 1 1 1 1 838 5123 1 0 1 453.7376 905.4607 2 905.4607 0 0 32.01 0.02 R DVQEIFR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5496.5496.2.dta 67 IPI00514381.1 HLA-B associated transcript 1 28 18565 1 1 1 1 2339 3649 1 0 1 630.3124 1258.6102 2 1258.6095 0.0007 1 27.76 0.0028 R YQQFKDFQR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3812.3812.2.dta 68 1 IPI00179330.6 ubiquitin and ribosomal protein S27a precursor 37 18296 2 2 2 2 108 4374 1 1 0 324.7075 647.4004 2 647.4006 -0.0003 0 28.03 0.029 R LIFAGK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4613.4613.2.dta 68 1 IPI00179330.6 ubiquitin and ribosomal protein S27a precursor 37 18296 2 2 2 2 5325 5078 1 1 1 663.0241 1986.0505 3 1986.0521 -0.0016 1 28.81 0.002 K TITLEVEPSDTIENVKAK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5440.5440.3.dta 69 1 IPI00294627.3 Isoform 2 of Splicing factor 1 37 68817 1 1 1 1 1772 2716 1 1 1 562.7837 1123.5528 2 1123.5543 -0.0015 0 36.6 0.00037 R SITNTTVCTK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2731.2731.2.dta 70 1 IPI00033034.1 Alpha-ketoglutarate dehydrogenase complex dihydrolipoyl succinyltransferase 36 48961 1 1 1 1 2031 1925 1 1 1 596.8375 1191.6605 2 1191.6611 -0.0006 0 36.32 0.00047 K AKPAEAPAAAAPK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1852.1852.2.dta 71 1 IPI00291510.3 Inosine-5~-monophosphate dehydrogenase 2 36 56226 1 1 1 1 1905 2472 1 1 1 579.8087 1157.6029 2 1157.6041 -0.0012 0 35.96 0.00042 K VAQGVSGAVQDK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2463.2463.2.dta 72 1 IPI00166612.9 cardiomyopathy associated 5 34 450760 1 1 1 1 339 1753 1 1 1 380.7294 759.4442 2 759.4491 -0.0048 0 33.84 0.0059 K QSVLVSK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1666.1666.2.dta 73 1 IPI00008830.1 Fibroblast growth factor 18 precursor 34 24316 1 1 1 1 901 1587 1 1 1 462.7263 923.438 2 923.4422 -0.0042 0 33.79 0.0066 K ECVFIEK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1487.1487.2.dta 74 1 IPI00012535.1 DnaJ homolog subfamily A member 1 33 45581 1 1 1 1 2303 2123 1 1 1 625.7836 1249.5527 2 1249.5543 -0.0016 1 33.25 0.0018 K NVICDKCEGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2073.2073.2.dta 75 1 IPI00176903.2 Isoform 1 of Polymerase I and transcript release factor 33 43450 1 1 1 1 1734 8383 1 1 1 558.7853 1115.556 2 1115.5571 -0.0011 0 33.14 0.0012 K AHATTSNTVSK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.963.963.2.dta 76 1 IPI00645300.1 46 kDa protein 33 46451 1 1 1 1 2069 1803 1 1 1 601.3237 1200.6329 2 1200.6211 0.0118 1 32.98 0.0096 K RGQTDTSLPAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1720.1720.2.dta 77 1 IPI00020042.2 Isoform 1 of 26S protease regulatory subunit 6B 33 47451 2 2 2 2 5234 43 1 1 1 972.5182 1943.0219 2 1943.0251 -0.0032 0 26.31 0.0034 K ENAPAIIFIDEIDAIATK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.10057.10057.2.dta 77 1 IPI00020042.2 Isoform 1 of 26S protease regulatory subunit 6B 33 47451 2 2 2 2 5791 8157 1 1 1 752.7545 2255.2417 3 2255.2412 0.0005 1 23.08 0.023 R LAKENAPAIIFIDEIDAIATK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9353.9353.3.dta 78 1 IPI00179964.5 Isoform 1 of Polypyrimidine tract-binding protein 1 33 57357 2 2 2 2 529 1175 1 1 1 410.7613 819.508 2 819.5079 0.0001 0 17.36 0.022 K LHGKPIR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1150.1150.2.dta 78 1 IPI00179964.5 Isoform 1 of Polypyrimidine tract-binding protein 1 33 57357 2 2 2 2 3110 4731 1 1 1 716.3697 1430.7248 2 1430.7306 -0.0058 0 28.68 0.002 R GQPIYIQFSNHK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5028.5028.2.dta 78 IPI00556157.1 Polypyrimidine tract-binding protein 1 isoform c variant (Fragment) 29 35812 1 1 1 1 3110 4731 1 0 1 716.3697 1430.7248 2 1430.7306 -0.0058 0 28.68 0.002 R GQPIYIQFSNHK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5028.5028.2.dta 78 IPI00413691.2 polypyrimidine tract-binding protein 1 isoform d 17 21899 1 1 1 1 529 1175 1 0 1 410.7613 819.508 2 819.5079 0.0001 0 17.36 0.022 K LHGKPIR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1150.1150.2.dta 79 1 IPI00440493.2 "ATP synthase subunit alpha, mitochondrial precursor" 32 59828 1 1 1 1 6111 8178 1 1 1 780.0608 2337.1605 3 2337.1601 0.0005 0 31.87 0.0044 R EVAAFAQFGSDLDAATQQLLSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9378.9378.3.dta 80 1 IPI00550689.3 UPF0027 protein C22orf28 32 55688 1 1 1 1 5622 8556 1 1 1 716.3769 2146.1088 3 2146.1092 -0.0004 1 31.66 0.0015 R NLDFQDVLDKLADMGIAIR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9871.9871.3.dta 81 1 IPI00219525.10 "6-phosphogluconate dehydrogenase, decarboxylating" 31 53619 3 3 3 3 3521 4701 1 1 1 512.9351 1535.7835 3 1535.7831 0.0004 1 28.07 0.0077 R TVSKVDDFLANEAK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4989.4989.3.dta 81 1 IPI00219525.10 "6-phosphogluconate dehydrogenase, decarboxylating" 31 53619 3 3 3 3 6004 7937 1 1 1 770.7182 2309.1328 3 2309.1328 0 1 19.42 0.015 K DAFDRNPELQNLLLDDFFK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9086.9086.3.dta 81 1 IPI00219525.10 "6-phosphogluconate dehydrogenase, decarboxylating" 31 53619 3 3 3 3 6537 235 1 1 1 821.7795 2462.3166 3 2462.3209 -0.0043 0 15.24 0.041 K WTAISALEYGVPVTLIGEAVFAR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.10315.10315.3.dta 82 1 IPI00022145.6 Isoform 1 of Nuclear ubiquitous casein and cyclin-dependent kinases substrate 31 27280 1 1 1 1 512 465 1 1 1 408.24 814.4655 2 814.4661 -0.0006 0 31.23 0.023 K VGRPTASK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1062.1062.2.dta 83 1 IPI00304885.1 Centromere protein C 1 31 107488 1 1 1 1 1827 5067 1 1 1 568.7672 1135.5199 2 1135.5219 -0.0021 1 31.19 0.0012 R STKYEMYSK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5426.5426.2.dta 84 1 IPI00150189.3 hypothetical protein LOC128861 isoform 1 31 28760 1 1 1 1 820 2587 1 1 1 452.7458 903.4771 2 903.4774 -0.0003 1 31.09 0.021 R DNKSTLAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2592.2592.2.dta 85 1 IPI00007068.1 actin-related protein 3-beta isoform 1 31 48090 1 1 1 1 3020 241 1 1 1 705.3928 1408.771 2 1408.7714 -0.0005 0 31.02 0.0074 R DITYFIQQLLR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.10322.10322.2.dta 86 1 IPI00375380.3 proteasome 26S non-ATPase subunit 13 isoform 2 31 40131 1 1 1 1 1033 4967 1 1 1 478.7923 955.5701 2 955.5702 -0.0001 0 30.98 0.0025 R VLDLQQIK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5306.5306.2.dta 87 1 IPI00782992.2 Isoform 1 of Serine/arginine repetitive matrix protein 2 31 300239 1 1 1 1 830 2548 1 1 1 453.229 904.4435 2 904.4362 0.0072 1 30.51 0.024 R RSESSSPR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2549.2549.2.dta 88 1 IPI00300221.4 Hypothetical protein DKFZp434I1916 30 14624 1 1 1 1 734 2469 1 1 1 439.2154 876.4162 2 876.4123 0.0038 1 30.13 0.019 R QGEQKCK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2460.2460.2.dta 89 1 IPI00290791.1 Isoform A of Caspase-10 precursor 30 59597 1 1 1 1 906 1595 1 0 1 462.7662 923.5179 2 923.515 0.0029 1 30.02 0.012 R MLKFLEK T Oxidation (M) 0.1000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1496.1496.2.dta 90 1 IPI00737363.2 similar to CG3173-PA isoform 7 29 259704 2 2 1 1 656 4051 2 0 1 426.2177 850.4208 2 850.4144 0.0064 1 27 0.036 R TDSAKSSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4259.4259.2.dta 90 1 IPI00737363.2 similar to CG3173-PA isoform 7 29 259704 2 2 1 1 659 133 1 0 1 426.2179 850.4213 2 850.4144 0.0069 1 24.41 0.02 R TDSAKSSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.10174.10174.2.dta 91 1 IPI00398054.7 similar to non imprinted in Prader-Willi/Angelman syndrome 2 isoform a 28 50538 1 1 1 1 203 4952 1 1 1 351.2314 700.4482 2 700.4483 -0.0001 0 27.81 0.033 K GLGITIK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5288.5288.2.dta 92 1 IPI00014151.3 26S proteasome non-ATPase regulatory subunit 6 28 45787 1 1 1 1 5281 4998 1 1 1 655.0081 1962.0023 3 1962.0058 -0.0034 1 27.73 0.005 M PLENLEEEGLPKNPDLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5351.5351.3.dta 93 1 IPI00031461.1 Rab GDP dissociation inhibitor beta 28 51087 2 2 2 2 5628 8158 1 1 1 717.7005 2150.0797 3 2150.0797 0 0 18.69 0.018 K FDLGQDVIDFTGHALALYR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9354.9354.3.dta 93 1 IPI00031461.1 Rab GDP dissociation inhibitor beta 28 51087 2 2 2 2 6310 8282 1 1 1 795.4191 2383.2356 3 2383.2345 0.0011 1 22.98 0.007 K IYKVPSTEAEALASSLMGLFEK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9503.9503.3.dta 93 IPI00513829.1 GDP dissociation inhibitor 2 23 16866 1 1 1 1 6310 8282 1 0 1 795.4191 2383.2356 3 2383.2345 0.0011 1 22.98 0.007 K IYKVPSTEAEALASSLMGLFEK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9503.9503.3.dta 93 IPI00010154.3 Rab GDP dissociation inhibitor alpha 19 51177 1 1 1 1 5628 8158 1 0 1 717.7005 2150.0797 3 2150.0797 0 0 18.69 0.018 K FDLGQDVIDFTGHALALYR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9354.9354.3.dta 94 1 IPI00012336.2 Isoform 1 of Zinc finger X-chromosomal protein 28 92288 1 1 1 1 453 1314 1 1 1 401.2039 800.3932 2 800.3963 -0.0031 1 27.63 0.015 K GANKMHK C Oxidation (M) 0.0000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1188.1188.2.dta 95 1 IPI00332362.6 Protein FAM86B1 27 13596 1 1 1 1 893 3594 1 1 1 461.7479 921.4813 2 921.4767 0.0046 0 27.29 0.017 K SSGGSVTLSK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3751.3751.2.dta 96 1 IPI00240909.1 "similar to eukaryotic translation initiation factor 3, subunit 5 epsilon, 47kDa isoform 1" 27 38064 1 1 1 1 7915 401 1 1 1 983.843 2948.5072 3 2948.5091 -0.0019 1 27.22 0.0028 R IQDALSTVLQYAEDVLSGKVSADNTVGR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.10557.10557.3.dta 97 1 IPI00827581.1 Variable immnoglobulin anti-estradiol heavy chain (Fragment) 27 14027 1 1 1 1 859 5189 1 1 1 456.7235 911.4325 2 911.4323 0.0001 0 27.07 0.02 R YAMSWVR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5573.5573.2.dta 98 1 IPI00100030.1 Isoform 1 of GPI transamidase component PIG-T precursor 27 66228 1 1 1 1 452 4062 1 1 1 400.7638 799.5131 2 799.5167 -0.0036 0 26.55 0.02 K AGLSVLLK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4271.4271.2.dta 99 1 IPI00024097.3 Isoform 1 of Testin 26 49789 1 1 1 1 2020 719 1 1 1 397.8448 1190.5126 3 1190.5138 -0.0012 0 26.44 0.0034 R HYCDSEKPR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1094.1094.3.dta 100 1 IPI00014235.2 Similar to RAB3 GTPase-activating protein 26 112355 3 3 1 1 2099 5326 1 1 1 601.8118 1201.609 2 1201.6125 -0.0035 0 16.77 0.033 K LSVSNMVHTAK K Oxidation (M) 0.00000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5738.5738.2.dta 100 1 IPI00014235.2 Similar to RAB3 GTPase-activating protein 26 112355 3 3 1 1 2101 7698 1 1 1 601.8118 1201.6091 2 1201.6125 -0.0034 0 22.62 0.0076 K LSVSNMVHTAK K Oxidation (M) 0.00000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8794.8794.2.dta 100 1 IPI00014235.2 Similar to RAB3 GTPase-activating protein 26 112355 3 3 1 1 2107 6504 1 1 1 601.8119 1201.6093 2 1201.6125 -0.0032 0 15.51 0.046 K LSVSNMVHTAK K Oxidation (M) 0.00000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7302.7302.2.dta 101 1 IPI00014177.3 Septin-2 26 41689 1 1 1 1 3445 7001 1 1 1 757.381 1512.7474 2 1512.746 0.0014 0 26.21 0.0035 K TIISYIDEQFER Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7931.7931.2.dta 102 1 IPI00011551.1 Isoform Beta of Tripartite motif-containing protein 4 26 54972 1 1 1 1 2688 5721 1 1 1 671.3635 1340.7124 2 1340.7122 0.0002 1 26.05 0.042 K KVMHLQDVEVK N Oxidation (M) 0.00100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.6233.6233.2.dta 103 1 IPI00018279.7 Collagen alpha-3(V) chain precursor 26 172631 1 1 1 1 270 2313 1 1 1 364.2097 726.4049 2 726.4024 0.0025 0 25.95 0.026 R VGPEGLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2284.2284.2.dta 104 1 IPI00103525.1 paraspeckle protein 1 25 58820 1 1 1 1 6684 7768 1 1 1 844.7717 2531.2932 3 2531.2908 0.0024 0 24.82 0.0047 K NLSPVVSNELLEQAFSQFGPVEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8878.8878.3.dta 105 1 IPI00427501.1 Isoform 1 of GH3 domain-containing protein precursor 25 58058 1 1 1 1 533 2960 1 1 1 411.7476 821.4807 2 821.4759 0.0048 0 24.63 0.028 R NHLPLTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2997.2997.2.dta 106 1 IPI00001458.1 Kinetochore-associated protein 1 24 253211 1 1 1 1 2854 7203 1 1 1 344.4384 1373.7244 4 1373.7336 -0.0092 1 23.67 0.04 R EVNLLNKEIMR V Oxidation (M) 0.00000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.818.818.4.dta 107 1 IPI00735613.2 "similar to Sucrase-isomaltase, intestinal" 23 40979 1 1 1 1 482 2950 1 1 1 404.7382 807.4618 2 807.4603 0.0016 1 23.13 0.039 K SFRIASK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2986.2986.2.dta 108 1 IPI00301923.4 Isoform 1 of Cell division protein kinase 9 23 43149 1 1 1 1 3121 1844 1 1 1 717.8499 1433.6853 2 1433.6859 -0.0006 0 22.9 0.028 K GSQITQQSTNQSR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1764.1764.2.dta 109 1 IPI00736788.2 Hypothetical protein DKFZp781G0119 23 78184 1 1 1 1 361 3404 1 1 1 384.2366 766.4587 2 766.4589 -0.0002 0 22.89 0.012 R LPAPELK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.3521.3521.2.dta 110 1 IPI00749115.1 TRNA (guanine-N1-)-meThylTransferase family proTein 22 13891 1 1 1 1 1871 1901 1 1 1 574.2917 1146.5689 2 1146.5782 -0.0092 0 22.25 0.042 R AEISGPHSPPR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1826.1826.2.dta 111 1 IPI00302927.6 T-complex protein 1 subunit delta 22 58401 1 1 1 1 240 2869 1 1 1 358.2097 714.4049 2 714.4024 0.0025 0 21.8 0.042 K AVADAIR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2898.2898.2.dta 112 1 IPI00021926.2 26S protease regulatory subunit S10B 21 44430 1 1 1 1 5677 6957 1 1 1 732.7398 2195.1976 3 2195.195 0.0026 1 21.29 0.034 R ELREVIELPLTNPELFQR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7880.7880.3.dta 113 1 IPI00295485.1 Heat shock 70 kDa protein 4L 21 95453 1 1 1 1 4451 4556 1 1 1 572.9684 1715.8835 3 1715.8923 -0.0088 1 21.17 0.01 R RSVMAAAQVAGLNCLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4810.4810.3.dta 114 1 IPI00103744.1 Isoform 1 of Polycystic kidney disease 2-like 1 protein 21 92608 1 1 1 1 806 1902 1 1 1 451.7511 901.4877 2 901.4869 0.0008 0 20.81 0.024 R SIVSSPQGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1827.1827.2.dta 115 1 IPI00026833.4 Adenylosuccinate synthetase isozyme 2 20 50465 1 1 1 1 5299 6952 1 1 1 657.7039 1970.0897 3 1970.0877 0.0021 1 19.67 0.014 R FIEDELQIPVKWIGVGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.7874.7874.3.dta 116 1 IPI00419908.3 Probable G-protein coupled receptor 179 precursor 19 260609 1 1 1 1 888 1618 1 1 1 461.2144 920.4142 2 920.4134 0.0008 0 19.47 0.041 R GSSCQGLGR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1521.1521.2.dta 117 1 IPI00018522.3 Isoform 1 of Protein arginine N-methyltransferase 1 19 42029 1 1 1 1 4498 4621 1 1 1 575.6025 1723.7856 3 1723.7842 0.0014 0 19.02 0.026 R TGFSTSPESPYTHWK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4897.4897.3.dta 118 1 IPI00220420.1 Zinc finger protein 212 18 56325 1 1 1 1 4089 5113 1 1 1 549.9565 1646.8476 3 1646.8363 0.0113 0 18.21 0.036 R STPLTSSTLPSQATEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.5480.5480.3.dta 119 1 IPI00760637.1 Metaxin 1 17 35465 1 1 1 1 3973 7685 1 1 1 545.6257 1633.8552 3 1633.8536 0.0015 0 17.45 0.023 - VEGGQDGGAHGAVLLVR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.8780.8780.3.dta 120 1 IPI00021107.5 xylulokinase homolog 17 59086 1 1 1 1 3883 7863 1 1 1 811.4008 1620.7871 2 1620.793 -0.0059 0 17.44 0.034 K VVAFTGDNPASLAGMR L Oxidation (M) 0.0000000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9000.9000.2.dta 121 1 IPI00807566.1 hypothetical protein LOC285987 17 11894 1 1 1 1 3477 4006 1 1 1 761.8676 1521.7207 2 1521.7133 0.0073 1 17.43 0.023 - MDWGKTLSSEQPK A Oxidation (M) 0.1000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4209.4209.2.dta 122 1 IPI00549822.3 Isoform 5 of Obscurin 17 479836 1 1 1 1 527 2850 1 1 1 410.7422 819.4699 2 819.4702 -0.0002 0 17.34 0.033 R TSATLTVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2878.2878.2.dta 123 1 IPI00000495.1 PNAS-125 17 23853 1 1 1 1 1342 606 1 1 1 511.2805 1020.5465 2 1020.5465 0 0 17.28 0.024 K VVVSHSTHR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1079.1079.2.dta 124 1 IPI00429191.3 Eukaryotic peptide chain release factor subunit 1 17 49228 1 1 1 1 7824 8361 1 1 1 966.1571 2895.4495 3 2895.4502 -0.0007 0 17.12 0.026 K LVDISYGGENGFNQAIELSTEVLSNVK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9602.9602.3.dta 125 1 IPI00478472.2 GREB1 protein isoform a 17 219455 1 1 1 1 1545 1986 1 1 1 357.5246 1069.5519 3 1069.5516 0.0003 0 16.95 0.041 R ASQGPPSAISR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1926.1926.3.dta 126 1 IPI00027626.3 T-complex protein 1 subunit zeta 17 58444 1 1 1 1 4647 8300 1 1 1 884.5221 1767.0296 2 1767.0294 0.0002 0 16.59 0.045 R AQLGVQAFADALLIIPK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9528.9528.2.dta 127 1 IPI00140473.7 KIAA0565 gene product 16 25228 1 1 1 1 7843 4595 1 1 1 727.5859 2906.3146 4 2906.3208 -0.0062 1 15.83 0.033 K CPSVSPSMPENQSATKELGQMNLTER E Oxidation (M) 0.00000001000000000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.4864.4864.4.dta 128 1 IPI00029751.1 Isoform 1 of Contactin-1 precursor 16 114104 1 1 1 1 672 2134 1 1 1 426.7028 851.391 2 851.3926 -0.0016 0 15.53 0.036 K NGYAYHK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.2085.2085.2.dta 129 1 IPI00029764.1 Splicing factor 3A subunit 3 15 59154 1 1 1 1 7038 8379 1 1 1 881.1224 2640.3455 3 2640.3435 0.002 1 15.45 0.041 R NKDIAFLEAQIYEYVEILGEQR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9625.9625.3.dta 130 1 IPI00465184.3 Guanine deaminase 15 51484 1 1 1 1 7014 160 1 1 1 878.7574 2633.2505 3 2633.2537 -0.0032 0 15.37 0.036 K ASDSPIDLFYGDFFGDISEAVIQK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.10213.10213.3.dta 131 1 IPI00002520.1 "Serine hydroxymethyltransferase, mitochondrial precursor" 15 56414 1 1 1 1 2183 1965 1 1 1 408.5513 1222.632 3 1222.6306 0.0014 0 14.52 0.043 K HADIVTTTTHK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.1902.1902.3.dta 132 1 IPI00383344.1 G1 phase-specific gene protein (Fragment) 14 11571 1 1 1 1 8014 8338 1 1 1 1008.8158 3023.4256 3 3023.4317 -0.0062 1 14.07 0.048 R WGRSGSHFGLMSACFGVGMVAGPVAGTVGR H Oxidation (M) 0.000000000010000000000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9576.9576.3.dta 133 1 IPI00018452.1 Copine-1 14 59649 1 1 1 1 5745 8353 1 1 1 745.739 2234.1952 3 2234.1947 0.0005 0 13.99 0.049 R EALAQTVLAEVPTQLVSYFR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9592.9592.3.dta 134 1 IPI00167023.1 Uncharacterized protein C13orf16 14 16981 1 1 1 1 4335 8549 1 1 1 564.6454 1690.9145 3 1690.9076 0.0069 0 13.9 0.05 K LGLKPASPGPPSAGPSMK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#5-5.9860.9860.3.dta