"Peptide Groups Peptide Group ID"	"Annotated Sequence"	"Modifications"	"Qvality PEP"	"Qvality q-value"	"Number of Protein Groups"	"Number of Proteins"	"Number of PSMs"	"Master Protein Accessions"	"Positions in Master Proteins"	"Modifications in Master Proteins"	"Master Protein Descriptions"	"Number of Missed Cleavages"	"Theo MHplus in Da"	"Abundance Ratio log2 NaCl_1M  NaCl_150mM"	"Abundance Ratio log2 NaCl_250mM  NaCl_150mM"	"Abundance Ratio log2 NaCl_2M  NaCl_150mM"	"Abundance Ratio log2 NaCl_4M  NaCl_150mM"	"Abundance Ratio log2 NaCl_500mM  NaCl_150mM"	"Abundance Ratio log2 NaCl_500mM  NaCl_1M"	"Abundance Ratio log2 NaCl_500mM  NaCl_250mM"	"Abundances Scaled F37 Sample NaCl_150mM"	"Abundances Scaled F40 Sample NaCl_1M"	"Abundances Scaled F38 Sample NaCl_250mM"	"Abundances Scaled F41 Sample NaCl_2M"	"Abundances Scaled F42 Sample NaCl_4M"	"Abundances Scaled F39 Sample NaCl_500mM"	"Abundance F37 Sample NaCl_150mM"	"Abundance F40 Sample NaCl_1M"	"Abundance F38 Sample NaCl_250mM"	"Abundance F41 Sample NaCl_2M"	"Abundance F42 Sample NaCl_4M"	"Abundance F39 Sample NaCl_500mM"	"Quan Info"	"Found in Sample in S37 F37 Sample NaCl_150mM"	"Found in Sample in S40 F40 Sample NaCl_1M"	"Found in Sample in S38 F38 Sample NaCl_250mM"	"Found in Sample in S41 F41 Sample NaCl_2M"	"Found in Sample in S42 F42 Sample NaCl_4M"	"Found in Sample in S39 F39 Sample NaCl_500mM"	"Confidence by Search Engine Sequest HT"	"Charge by Search Engine Sequest HT"	"mz in Da by Search Engine Sequest HT"	"Percolator q-Value by Search Engine Sequest HT"	"Percolator PEP by Search Engine Sequest HT"	"XCorr by Search Engine Sequest HT"	"Top Apex RT in min"
"13445"	"[K].LGASEKNER.[L]"	"1xBiotin [K6]"	"0.117027"	"0.00731053"	"1"	"1"	"1"	"Q61712"	"Q61712 [200-208]"	"Q61712 1xBiotin [K205]"	"DnaJ homolog subfamily C member 1 [OS=Mus musculus]"	"1"	"1229.59430"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"615.30110"	"0.001478"	"0.02459"	"1.75"	""
"16001"	"[K].LSLSEGGLIPSSKSPK.[R]"	"1xBiotin [K]"	"0.019933"	"0.000586377"	"1"	"1"	"2"	"Q8R1T1-1"	"Q8R1T1-1 [429-444]"	"Q8R1T1-1 1xBiotin [K]"	"Charged multivesicular body protein 7 [OS=Mus musculus]"	"1"	"1825.97281"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"High"	"2"	"913.49055"	"0.0001108"	"0.001734"	"2.86"	""
"15968"	"[R].LSKSGENPEQDEAQKNFMDTYR.[N]"	"2xBiotin [K3; K15]; 1xOxidation [M18]"	"0.00939743"	"0.000586377"	"1"	"1"	"3"	"Q61263"	"Q61263 [7-28]"	"Q61263 2xBiotin [K9; K21]"	"sterol O-acyltransferase 1 [OS=Mus musculus]"	"2"	"3055.32303"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"1019.11224"	"0.0001108"	"0.0005746"	"2.77"	""
"15954"	"[R].LSKFQDGSNNVMR.[T]"	"1xBiotin [K3]"	"0.0140162"	"0.000586377"	"1"	"2"	"1"	"Q9Z329-1"	"Q9Z329-1 [907-919]"	"Q9Z329-1 1xBiotin [K909]"	"Inositol 1,4,5-trisphosphate receptor type 2 [OS=Mus musculus]"	"1"	"1721.80978"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"861.40910"	"0.0001108"	"0.001031"	"1.71"	""
"15948"	"[K].LSKAIVLQK.[T]"	"1xBiotin [K3]"	"0.0402965"	"0.00104877"	"1"	"3"	"1"	"O08609"	"O08609 [171-179]"	"O08609 1xBiotin [K173]"	"MAX-like protein X [OS=Mus musculus]"	"1"	"1225.73369"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"2"	"613.37046"	"0.0001873"	"0.004903"	"1.95"	""
"15924"	"[K].ISFQPAVAGIKADK.[A]"	"1xBiotin [K11]"	"0.061122"	"0.0019826"	"1"	"1"	"1"	"Q91VK4"	"Q91VK4 [4-17]"	"Q91VK4 1xBiotin [K14]"	"Integral membrane protein 2C [OS=Mus musculus]"	"1"	"1670.89344"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"2"	"835.95044"	"0.0003442"	"0.009179"	"2.00"	""
"15807"	"[KR].LRNWQWWR.[L]"	""	"0.104051"	"0.00659446"	"1"	"6"	"1"	"O08638-1"	"O08638-1 [829-836]"	""	"Myosin-11 [OS=Mus musculus]"	"1"	"1244.64357"	"9.97"	""	""	""	""	"-9.97"	""	""	"600.0"	""	""	""	""	""	"23859.068359375"	""	""	""	""	""	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"622.82521"	"0.001278"	"0.02054"	"2.32"	"42.23"
"16016"	"[K].LSMKDVTVEK.[A]"	"1xBiotin [K4]"	"0.00794148"	"0.000586377"	"1"	"1"	"1"	"Q8R1T1-1"	"Q8R1T1-1 [334-343]"	"Q8R1T1-1 1xBiotin [K337]"	"Charged multivesicular body protein 7 [OS=Mus musculus]"	"1"	"1375.69598"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"2"	"688.35188"	"0.0001108"	"0.0004495"	"2.13"	""
"15643"	"[R].IQMKSLTNK.[W]"	"1xBiotin [K4]"	"0.0271851"	"0.00104877"	"1"	"3"	"1"	"Q8R4D1"	"Q8R4D1 [548-556]"	"Q8R4D1 1xBiotin [K551]"	"Sodium/hydrogen exchanger 8 [OS=Mus musculus]"	"1"	"1288.67519"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"2"	"644.84069"	"0.0001873"	"0.002738"	"2.05"	""
"6553"	"[K].ESKGPIVPLNVADQK.[L]"	"1xBiotin [K3]"	"0.0671862"	"0.0019826"	"1"	"1"	"4"	"P55012"	"P55012 [986-1000]"	"P55012 1xBiotin [K988]"	"Solute carrier family 12 member 2 [OS=Mus musculus]"	"1"	"1820.95750"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"2"	"910.98235"	"0.0003442"	"0.01054"	"2.42"	""
"15584"	"[K].LQGESTKPVYIPK.[I]"	"1xBiotin [K7]"	"0.00956243"	"0.000586377"	"1"	"1"	"4"	"Q61510"	"Q61510 [313-325]"	"Q61510 1xBiotin [K319]"	"E3 ubiquitin/ISG15 ligase TRIM25 [OS=Mus musculus]"	"0"	"1685.89310"	""	""	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	""	""	""	"277.3"	"156.1"	"166.5"	""	""	""	"27276.69921875"	"15356.1767578125"	"16376.9677734375"	""	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"2"	"843.45001"	"0.0001108"	"0.0005882"	"2.91"	"39.68"
"15528"	"[R].LQAAQLPDKGHFGPCFSCNR.[D]"	"1xBiotin [K9]; 2xCarbamidomethyl [C15; C18]"	"0.0343643"	"0.00104877"	"1"	"2"	"1"	"P31996-1"	"P31996-1 [269-288]"	"P31996-1 1xBiotin [K277]"	"Macrosialin [OS=Mus musculus]"	"1"	"2529.15841"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"3"	"843.72287"	"0.0001873"	"0.00388"	"1.72"	""
"15220"	"[K].LNTKLVLWDINK.[N]"	"1xBiotin [K4]"	"0.0011628"	"0.000586377"	"1"	"2"	"1"	"Q9EQ06"	"Q9EQ06 [59-70]"	"Q9EQ06 1xBiotin [K62]"	"Estradiol 17-beta-dehydrogenase 11 [OS=Mus musculus]"	"1"	"1682.92982"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"2"	"841.96777"	"0.0001108"	"2.696E-05"	"3.22"	""
"15208"	"[R].LNSEEKTK.[-]"	"1xBiotin [K6]"	"0.0710142"	"0.00241047"	"1"	"1"	"1"	"Q99KU0"	"Q99KU0 [399-406]"	"Q99KU0 1xBiotin [K404]"	"Vacuole membrane protein 1 [OS=Mus musculus]"	"1"	"1174.57725"	"9.97"	""	"9.97"	"9.97"	"9.97"	"-0.96"	"9.97"	""	"193.6"	""	"118.2"	"188.9"	"99.3"	""	"7378.72265625"	""	"4504.48828125"	"7201.228515625"	"3782.84936523438"	""	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"2"	"587.79257"	"0.000415"	"0.01141"	"1.93"	"21.58"
"15199"	"[K].LNQQMAKMMDPR.[V]"	"1xBiotin [K7]"	"0.00364297"	"0.000586377"	"1"	"1"	"1"	"P14576-1"	"P14576-1 [458-469]"	"P14576-1 1xBiotin [K464]"	"signal recognition particle 54 kDa protein [OS=Mus musculus]"	"1"	"1688.77393"	"9.97"	""	""	"9.97"	""	"-9.97"	""	""	"204.2"	""	""	"395.8"	""	""	"9156.3525390625"	""	""	"17741.892578125"	""	""	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"2"	"844.89100"	"0.0001108"	"0.0001435"	"2.63"	"40.21"
"6544"	"[K].ESGSQNKVK.[H]"	"1xBiotin [K7]"	"0.0387264"	"0.00104877"	"1"	"3"	"1"	"Q8BML1"	"Q8BML1 [706-714]"	"Q8BML1 1xBiotin [K712]"	"[F-actin]-monooxygenase MICAL2 [OS=Mus musculus]"	"1"	"1202.58340"	"9.97"	""	"9.97"	"9.97"	"9.97"	"-0.94"	"9.97"	""	"185.1"	""	"112.2"	"206.5"	"96.2"	""	"4562.6669921875"	""	"2766.56372070313"	"5089.1650390625"	"2371.04321289063"	""	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"2"	"601.79558"	"0.0001873"	"0.00462"	"2.04"	"19.80"
"6642"	"[K].ETADAISKEVK.[K]"	"1xBiotin [K8]"	"0.00846525"	"0.000586377"	"1"	"1"	"1"	"Q60870"	"Q60870 [161-171]"	"Q60870 1xBiotin [K168]"	"Receptor expression-enhancing protein 5 [OS=Mus musculus]"	"1"	"1416.70391"	""	""	""	"9.97"	""	""	""	""	""	""	""	"600.0"	""	""	""	""	""	"17646.361328125"	""	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"2"	"708.85621"	"0.0001108"	"0.000491"	"3.09"	"33.10"
"16040"	"[K].LSQAPTQELETKAELLQADEK.[N]"	"1xBiotin [K12]"	"0.00266"	"0.000586377"	"1"	"1"	"1"	"Q61672"	"Q61672 [226-246]"	"Q61672 1xBiotin [K237]"	"Equilibrative nucleoside transporter 2 [OS=Mus musculus]"	"1"	"2568.28616"	""	""	""	""	"9.97"	"9.97"	"9.97"	""	""	""	""	""	"600.0"	""	""	""	""	""	"7229.69384765625"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"3"	"856.76676"	"0.0001108"	"9.05E-05"	"3.04"	"54.21"
"6363"	"[K].EQGFLSFWR.[G]"	""	"0.0148506"	"0.000586377"	"1"	"1"	"2"	"P48962"	"P48962 [64-72]"	""	"ADP/ATP translocase 1 [OS=Mus musculus]"	"0"	"1169.57382"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"2"	"585.28952"	"0.0001108"	"0.001119"	"1.87"	""
"16471"	"[R].LVHSGPSKGSVPYDAELSFALR.[T]"	"1xBiotin [K8]"	"0.069459"	"0.0019826"	"1"	"1"	"2"	"Q61234"	"Q61234 [346-367]"	"Q61234 1xBiotin [K353]"	"Alpha-1-syntrophin [OS=Mus musculus]"	"1"	"2556.29152"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"3"	"852.76843"	"0.0003442"	"0.01111"	"2.59"	""
"16294"	"[R].ITPEEAKYK.[L]"	"1xBiotin [K7]"	"0.0565215"	"0.0019826"	"1"	"1"	"2"	"P62702"	"P62702 [114-122]"	"P62702 1xBiotin [K120]"	"40S ribosomal protein S4, X isoform [OS=Mus musculus]"	"1"	"1304.65550"	""	""	""	"9.97"	""	""	""	""	""	""	""	"600.0"	""	""	""	""	""	"10603.794921875"	""	""	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"High"	"2"	"652.83038"	"0.0003442"	"0.008154"	"1.83"	"31.46"
"5861"	"[K].ELTIGSKLQDAEIAR.[L]"	"1xBiotin [K7]"	"0.000858722"	"0.000586377"	"1"	"1"	"3"	"P14069"	"P14069 [41-55]"	"P14069 1xBiotin [K47]"	"protein S100-A6 [OS=Mus musculus]"	"1"	"1869.97387"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"High"	"High"	"2"	"935.49092"	"0.0001108"	"1.737E-05"	"3.30"	""
"16245"	"[K].ITKVFDFAGEEVR.[V]"	"1xBiotin [K3]"	"0.0734084"	"0.00241047"	"1"	"1"	"2"	"O88271"	"O88271 [161-173]"	"O88271 1xBiotin [K163]"	"Craniofacial development protein 1 [OS=Mus musculus]"	"1"	"1736.86762"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"2"	"868.93647"	"0.000415"	"0.01203"	"1.28"	""
"16240"	"[R].LTKITKPGSIDSNNQLFAPGGR.[L]"	"1xBiotin [K3]"	"0.0516681"	"0.00154748"	"1"	"2"	"1"	"Q6NZJ6"	"Q6NZJ6 [1073-1094]"	"Q6NZJ6 1xBiotin [K1075]"	"eukaryotic translation initiation factor 4 gamma 1 [OS=Mus musculus]"	"1"	"2540.32897"	""	"9.97"	""	""	""	""	"-9.97"	""	""	"600.0"	""	""	""	""	""	"5002.49853515625"	""	""	""	""	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"3"	"847.44832"	"0.0002716"	"0.007098"	"3.04"	"41.83"
"5945"	"[R].EMFGLYGQTTGKGSVSLK.[E]"	"1xBiotin [K12]"	"0.00563624"	"0.000586377"	"1"	"1"	"6"	"Q9CQC9"	"Q9CQC9 [149-166]"	"Q9CQC9 1xBiotin [K160]"	"GTP-binding protein SAR1b [OS=Mus musculus]"	"1"	"2129.04057"	""	"9.97"	""	""	""	""	"-9.97"	""	""	"600.0"	""	""	""	""	""	"16422.9184570313"	""	""	""	""	"Not Found"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"2"	"1065.02389"	"0.0001108"	"0.000271"	"2.51"	"48.93"
"16052"	"[K].LSQSTPTKQAK.[F]"	"1xBiotin [K8]"	"0.0357624"	"0.00104877"	"1"	"1"	"2"	"Q9D8U6"	"Q9D8U6 [40-50]"	"Q9D8U6 1xBiotin [K47]"	"Mast cell-expressed membrane protein 1 [OS=Mus musculus]"	"1"	"1414.73588"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"2"	"707.87161"	"0.0001873"	"0.004111"	"2.44"	""
"16228"	"[R].ITGSVGKGLAAITMDKEYQQK.[R]"	"1xBiotin [K7]; 1xOxidation [M14]"	"0.130059"	"0.00993825"	"1"	"3"	"1"	"Q8BX70-1"	"Q8BX70-1 [3476-3496]"	"Q8BX70-1 1xBiotin [K3482]"	"Vacuolar protein sorting-associated protein 13C [OS=Mus musculus]"	"2"	"2480.25236"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"3"	"827.42261"	"0.001997"	"0.02893"	"2.57"	""
"16226"	"[R].ITGSVGKGLAAITMDK.[E]"	"1xBiotin [K7]"	"0.00392936"	"0.000586377"	"1"	"3"	"1"	"Q8BX70-1"	"Q8BX70-1 [3476-3491]"	"Q8BX70-1 1xBiotin [K3482]"	"Vacuolar protein sorting-associated protein 13C [OS=Mus musculus]"	"1"	"1787.93940"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"894.47392"	"0.0001108"	"0.0001602"	"2.23"	""
"16216"	"[K].ITGKQFYK.[Q]"	"1xBiotin [K4]"	"0.0558919"	"0.0019826"	"1"	"1"	"1"	"Q8CGA3"	"Q8CGA3 [257-264]"	"Q8CGA3 1xBiotin [K260]"	"Large neutral amino acids transporter small subunit 4 [OS=Mus musculus]"	"1"	"1210.62889"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"605.81800"	"0.0003442"	"0.00797"	"1.76"	""
"6065"	"[K].ENKITITNDK.[G]"	"1xBiotin [K3]"	"0.00923527"	"0.000586377"	"1"	"2"	"2"	"P63017"	"P63017 [498-507]"	"P63017 1xBiotin [K500]"	"Heat shock cognate 71 kDa protein [OS=Mus musculus]"	"1"	"1401.70424"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"-0.46"	"0.00"	""	"135.1"	"98.2"	"140.3"	"128.3"	"98.1"	""	"23644.23046875"	"17183.84765625"	"24538.564453125"	"22452.619140625"	"17154.5"	""	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"2"	"701.35594"	"0.0001108"	"0.0005611"	"2.64"	"33.98"
"6107"	"[K].ENPKVVNEINIEDLCLTKAAYCR.[C]"	"2xBiotin [K4; K18]; 2xCarbamidomethyl [C15; C22]"	"0.001385"	"0.000586377"	"1"	"1"	"3"	"Q9CQB5"	"Q9CQB5 [78-100]"	"Q9CQB5 2xBiotin [K81; K95]"	"CDGSH iron-sulfur domain-containing protein 2 [OS=Mus musculus]"	"2"	"3201.51996"	"9.97"	""	""	""	""	"-9.97"	""	""	"600.0"	""	""	""	""	""	"10472.373046875"	""	""	""	""	""	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"1067.84715"	"0.0001108"	"3.493E-05"	"3.83"	"57.89"
"16085"	"[K].LSSLKDSVVFK.[T]"	"1xBiotin [K5]"	"0.0361719"	"0.00104877"	"1"	"1"	"1"	"Q924S8"	"Q924S8 [303-313]"	"Q924S8 1xBiotin [K307]"	"sprouty-related, EVH1 domain-containing protein 1 [OS=Mus musculus]"	"1"	"1448.78176"	"9.97"	""	""	"9.97"	""	"-9.97"	""	""	"454.0"	""	""	"146.0"	""	""	"12446.7421875"	""	""	"4003.28100585938"	""	""	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"2"	"724.89480"	"0.0001873"	"0.004174"	"1.90"	"46.82"
"6292"	"[K].EPSSTVNTEVYPKNSTLR.[T]"	"1xBiotin [K13]"	"0.013076"	"0.000586377"	"1"	"1"	"3"	"Q9ERB0"	"Q9ERB0 [181-198]"	"Q9ERB0 1xBiotin [K193]"	"Synaptosomal-associated protein 29 [OS=Mus musculus]"	"1"	"2248.09142"	""	""	"9.97"	""	"9.97"	"9.97"	"9.97"	""	""	""	"396.1"	""	"203.9"	""	""	""	"9517.025390625"	""	"4898.1875"	""	"Not Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"High"	"3"	"750.03480"	"0.0001108"	"0.0009319"	"2.79"	"37.81"
"5968"	"[K].EMLDYKR.[K]"	"1xBiotin [K6]; 1xOxidation [M2]"	"0.0985957"	"0.00472246"	"1"	"1"	"1"	"Q8VCH8"	"Q8VCH8 [233-239]"	"Q8VCH8 1xBiotin [K238]"	"UBX domain-containing protein 4 [OS=Mus musculus]"	"1"	"1196.54384"	"9.97"	""	""	""	""	"-9.97"	""	""	"600.0"	""	""	""	""	""	"7443.20654296875"	""	""	""	""	""	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"598.77518"	"0.0009666"	"0.0188"	"1.30"	"31.68"
"16488"	"[K].LVKVWNLANCK.[L]"	"1xBiotin [K3]; 1xCarbamidomethyl [C10]"	"0.0221089"	"0.00104877"	"1"	"1"	"2"	"P68040"	"P68040 [173-183]"	"P68040 1xBiotin [K175]"	"Receptor of activated protein C kinase 1 [OS=Mus musculus]"	"1"	"1570.82325"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"2"	"785.91515"	"0.0001873"	"0.002016"	"1.82"	""
"15194"	"[R].LNQLKPGLQYK.[L]"	"1xBiotin [K5]"	"0.0775674"	"0.00241047"	"1"	"3"	"1"	"Q9Z1X4"	"Q9Z1X4 [409-419]"	"Q9Z1X4 1xBiotin [K413]"	"Interleukin enhancer-binding factor 3 [OS=Mus musculus]"	"0"	"1527.83520"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"2"	"764.42038"	"0.000415"	"0.01307"	"2.43"	""
"6701"	"[R].ETMVSKMLDR.[L]"	"1xBiotin [K6]"	"0.0097303"	"0.000586377"	"1"	"1"	"2"	"Q9QZL0"	"Q9QZL0 [337-346]"	"Q9QZL0 1xBiotin [K342]"	"Receptor-interacting serine/threonine-protein kinase 3 [OS=Mus musculus]"	"1"	"1435.67420"	""	""	""	"9.97"	""	""	""	""	""	""	""	"600.0"	""	""	""	""	""	"14596.2236328125"	""	""	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"High"	"2"	"718.34002"	"0.0001108"	"0.0006043"	"2.66"	"47.39"
"14485"	"[K].LIINSLYKNK.[E]"	"1xBiotin [K]"	"0.0126296"	"0.000586377"	"1"	"1"	"3"	"P08113"	"P08113 [88-97]"	"P08113 1xBiotin [K]"	"Endoplasmin [OS=Mus musculus]"	"1"	"1431.80283"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"High"	"High"	"2"	"716.40518"	"0.0001108"	"0.0008835"	"2.11"	""
"6994"	"[K].FDAVVGYKDK.[-]"	"1xBiotin [K8]"	"0.0195914"	"0.000586377"	"1"	"1"	"2"	"Q9EQ06"	"Q9EQ06 [289-298]"	"Q9EQ06 1xBiotin [K296]"	"Estradiol 17-beta-dehydrogenase 11 [OS=Mus musculus]"	"1"	"1367.66640"	""	"9.97"	"9.97"	"9.97"	""	""	"-9.97"	""	""	"183.1"	"233.2"	"183.7"	""	""	""	"22612.373046875"	"28810.833984375"	"22691.84765625"	""	""	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"Not Found"	"High"	"2"	"684.33687"	"0.0001108"	"0.001688"	"2.73"	"38.83"
"14355"	"[K].ILKCAGNEDIITLR.[A]"	"1xBiotin [K3]; 1xCarbamidomethyl [C4]"	"0.000108356"	"0.000586377"	"1"	"1"	"2"	"P17918"	"P17918 [78-91]"	"P17918 1xBiotin [K80]"	"proliferating cell nuclear antigen [OS=Mus musculus]"	"1"	"1841.96120"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"2"	"921.48480"	"0.0001108"	"8.472E-07"	"2.68"	""
"14292"	"[K].IIGNLLYYR.[Y]"	""	"0.110959"	"0.00731053"	"1"	"1"	"1"	"Q9JKF1"	"Q9JKF1 [1186-1194]"	""	"Ras GTPase-activating-like protein IQGAP1 [OS=Mus musculus]"	"0"	"1124.64626"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"562.82653"	"0.001478"	"0.02259"	"1.76"	""
"14253"	"[R].LIGDAAKNQLTSNPENTVFDAK.[R]"	"1xBiotin [K7]"	"0.0117136"	"0.000586377"	"1"	"1"	"1"	"P20029"	"P20029 [76-97]"	"P20029 1xBiotin [K82]"	"78 kDa glucose-regulated protein [OS=Mus musculus]"	"1"	"2572.27118"	"9.97"	""	""	""	"9.97"	"0.24"	"9.97"	""	"274.7"	""	""	""	"325.3"	""	"9708.8671875"	""	""	""	"11496.51171875"	""	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"3"	"858.09504"	"0.0001108"	"0.0007912"	"2.43"	"47.75"
"14022"	"[K].IKVPVDWNR.[V]"	"1xBiotin [K2]"	"0.0326448"	"0.00104877"	"1"	"1"	"1"	"Q61233"	"Q61233 [433-441]"	"Q61233 1xBiotin [K434]"	"Plastin-2 [OS=Mus musculus]"	"1"	"1352.71435"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"2"	"676.86159"	"0.0001873"	"0.003586"	"1.88"	""
"6958"	"[R].FANYIDKVR.[F]"	"1xBiotin [K7]"	"0.00798773"	"0.000586377"	"1"	"1"	"3"	"P20152"	"P20152 [114-122]"	"P20152 1xBiotin [K120]"	"Vimentin [OS=Mus musculus]"	"1"	"1351.68272"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"High"	"2"	"676.34518"	"0.0001108"	"0.0004521"	"2.68"	""
"13990"	"[K].IKSQDFYEK.[D]"	"1xBiotin [K2]"	"0.00259874"	"0.000586377"	"1"	"1"	"3"	"Q59J78"	"Q59J78 [100-108]"	"Q59J78 1xBiotin [K101]"	"NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 2 [OS=Mus musculus]"	"1"	"1383.66131"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"0.08"	"0.10"	""	"104.7"	"103.3"	"168.3"	"112.9"	"110.8"	""	"22549.712890625"	"22258.88671875"	"36267.796875"	"24319.3359375"	"23878.5078125"	""	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"2"	"692.33416"	"0.0001108"	"8.753E-05"	"2.41"	"33.60"
"13956"	"[K].IKQLAAFTPR.[E]"	"1xBiotin [K2]"	"0.00510561"	"0.000586377"	"1"	"3"	"1"	"A2A8U2-1"	"A2A8U2-1 [132-141]"	"A2A8U2-1 1xBiotin [K133]"	"Transmembrane protein 201 [OS=Mus musculus]"	"1"	"1370.76130"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"685.88426"	"0.0001108"	"0.000234"	"2.01"	""
"13877"	"[K].IKHVQNQVDEVIDVMQENITK.[V]"	"1xBiotin [K2]; 1xOxidation [M15]"	"0.000733649"	"0.000586377"	"1"	"1"	"4"	"O70480"	"O70480 [53-73]"	"O70480 1xBiotin [K54]"	"Vesicle-associated membrane protein 4 [OS=Mus musculus]"	"1"	"2722.35386"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"908.12328"	"0.0001108"	"1.381E-05"	"3.44"	""
"7111"	"[K].FGKQWTPLIILANSR.[S]"	"1xBiotin [K3]"	"0.0149367"	"0.000586377"	"1"	"1"	"3"	"Q9R1C6"	"Q9R1C6 [210-224]"	"Q9R1C6 1xBiotin [K212]"	"Diacylglycerol kinase epsilon [OS=Mus musculus]"	"1"	"1970.06805"	""	"9.97"	""	""	"9.97"	"9.97"	"0.65"	""	""	"233.2"	""	""	"366.8"	""	""	"3419.92504882813"	""	""	"5380.55810546875"	""	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"2"	"985.53852"	"0.0001108"	"0.001132"	"2.15"	"61.28"
"13853"	"[K].IKGIHPYHSLSYTSGDTATDSPVHVGR.[A]"	"1xBiotin [K2]"	"9.09651E-05"	"0.000586377"	"1"	"5"	"1"	"A2AAE1-1"	"A2AAE1-1 [2253-2279]"	"A2AAE1-1 1xBiotin [K2254]"	"Uncharacterized protein KIAA1109 [OS=Mus musculus]"	"1"	"3121.51599"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"4"	"781.13370"	"0.0001108"	"6.56E-07"	"4.14"	""
"7126"	"[K].FGTSEMSKPFR.[I]"	"1xBiotin [K8]"	"0.00674927"	"0.000586377"	"1"	"1"	"1"	"Q9ERU9"	"Q9ERU9 [1538-1548]"	"Q9ERU9 1xBiotin [K1545]"	"E3 SUMO-protein ligase RanBP2 [OS=Mus musculus]"	"0"	"1512.69738"	""	""	""	"9.97"	""	""	""	""	""	""	""	"600.0"	""	""	""	""	""	"19647.052734375"	""	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"2"	"756.85235"	"0.0001108"	"0.0003539"	"2.35"	"42.39"
"13849"	"[K].IKGEHPGLSIGDVAK.[K]"	"1xBiotin [K2]"	"0.0326448"	"0.00104877"	"1"	"1"	"2"	"P63158"	"P63158 [113-127]"	"P63158 1xBiotin [K114]"	"High mobility group protein B1 [OS=Mus musculus]"	"1"	"1746.92072"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"3"	"582.97833"	"0.0001873"	"0.003594"	"2.35"	""
"13963"	"[R].LKQQSELQSQVR.[Y]"	"1xBiotin [K2]"	"0.000993457"	"0.000586377"	"1"	"1"	"5"	"Q61792"	"Q61792 [74-85]"	"Q61792 1xBiotin [K75]"	"LIM and SH3 domain protein 1 [OS=Mus musculus]"	"1"	"1669.86901"	""	"9.97"	""	"9.97"	"9.97"	"9.97"	"0.90"	""	""	"140.6"	""	"198.0"	"261.5"	""	""	"7602.27587890625"	""	"10705.234375"	"14139.501953125"	""	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"835.43740"	"0.0001108"	"2.15E-05"	"2.44"	"31.24"
"6683"	"[K].ETKSCICATLNK.[T]"	"1xBiotin [K3]; 2xCarbamidomethyl [C5; C7]"	"0.0416912"	"0.00104877"	"1"	"1"	"3"	"Q9CR46"	"Q9CR46 [73-84]"	"Q9CR46 1xBiotin [K75]"	"Spindle and kinetochore-associated protein 2 [OS=Mus musculus]"	"1"	"1650.76481"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"High"	"Not Found"	"High"	"Not Found"	"High"	"2"	"825.88697"	"0.0001873"	"0.005169"	"1.95"	""
"14502"	"[K].LLLQVQHASKQITADK.[Q]"	"1xBiotin [K]"	"0.00145959"	"0.000586377"	"1"	"1"	"5"	"P51881"	"P51881 [34-49]"	"P51881 1xBiotin [K]"	"ADP/ATP translocase 2 [OS=Mus musculus]"	"1"	"2019.10556"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"673.70656"	"0.0001108"	"3.775E-05"	"4.55"	""
"14662"	"[K].LLQDFFNGKELNK.[S]"	"1xBiotin [K9]"	"0.00025239"	"0.000586377"	"1"	"2"	"2"	"P63017"	"P63017 [349-361]"	"P63017 1xBiotin [K357]"	"Heat shock cognate 71 kDa protein [OS=Mus musculus]"	"1"	"1791.90982"	"9.97"	""	""	""	""	"-9.97"	""	""	"600.0"	""	""	""	""	""	"10828.1337890625"	""	""	""	""	""	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"896.45844"	"0.0001108"	"2.897E-06"	"3.61"	"51.93"
"6702"	"[R].ETMVSKMLDR.[L]"	"1xBiotin [K6]; 1xOxidation [M7]"	"0.0742232"	"0.00241047"	"1"	"1"	"1"	"Q9QZL0"	"Q9QZL0 [337-346]"	"Q9QZL0 1xBiotin [K342]"	"Receptor-interacting serine/threonine-protein kinase 3 [OS=Mus musculus]"	"1"	"1451.66912"	""	""	"9.97"	"9.97"	""	""	""	""	""	""	"342.9"	"257.1"	""	""	""	""	"11134.6220703125"	"8348.912109375"	""	""	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Not Found"	"High"	"2"	"726.33826"	"0.000415"	"0.0122"	"1.24"	"36.19"
"15155"	"[K].INILAGETAKVGDPQK.[N]"	"1xBiotin [K10]"	"0.0081281"	"0.000586377"	"1"	"1"	"1"	"Q9DC60"	"Q9DC60 [11-26]"	"Q9DC60 1xBiotin [K20]"	"UbiA prenyltransferase domain-containing protein 1 [OS=Mus musculus]"	"1"	"1879.99461"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"940.50119"	"0.0001108"	"0.0004656"	"3.06"	""
"6705"	"[R].ETNLESLPLVDTHSKR.[T]"	"1xBiotin [K15]"	"0.00573543"	"0.000586377"	"1"	"1"	"2"	"P20152"	"P20152 [425-440]"	"P20152 1xBiotin [K439]"	"Vimentin [OS=Mus musculus]"	"1"	"2065.03826"	"9.97"	""	"9.97"	""	""	"-9.97"	""	""	"313.9"	""	"286.1"	""	""	""	"7557.259765625"	""	"6889.0458984375"	""	""	""	"Not Found"	"High"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"3"	"689.01791"	"0.0001108"	"0.0002779"	"2.79"	"42.58"
"6715"	"[K].ETQKSIYYITGESK.[E]"	"1xBiotin [K4]"	"0.0618076"	"0.0019826"	"1"	"1"	"1"	"P11499"	"P11499 [478-491]"	"P11499 1xBiotin [K481]"	"Heat shock protein HSP 90-beta [OS=Mus musculus]"	"1"	"1872.90479"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"2"	"936.95679"	"0.0003442"	"0.009302"	"1.48"	""
"6743"	"[R].ETVINKLTSCCR.[R]"	"1xBiotin [K6]; 2xCarbamidomethyl [C10; C11]"	"0.0326448"	"0.00104877"	"1"	"1"	"2"	"Q07113"	"Q07113 [2323-2334]"	"Q07113 1xBiotin [K2328]"	"Cation-independent mannose-6-phosphate receptor [OS=Mus musculus]"	"1"	"1706.80226"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"2"	"853.90461"	"0.0001873"	"0.003586"	"1.73"	""
"6767"	"[K].EVDEGAWETKISHR.[E]"	"1xBiotin [K10]"	"0.00431287"	"0.000586377"	"1"	"1"	"5"	"Q80WJ7"	"Q80WJ7 [185-198]"	"Q80WJ7 1xBiotin [K194]"	"protein LYRIC [OS=Mus musculus]"	"1"	"1882.87522"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"0.60"	"-0.43"	""	"83.9"	"171.6"	"111.7"	"105.4"	"127.4"	""	"9968.396484375"	"20394.302734375"	"13271.556640625"	"12526.2451171875"	"15135.8505859375"	""	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"628.29711"	"0.0001108"	"0.0001827"	"3.26"	"41.78"
"14595"	"[K].ILPDVNLGKIIK.[S]"	"1xBiotin [K]"	"0.0166696"	"0.000586377"	"1"	"1"	"2"	"Q8BHY8"	"Q8BHY8 [714-725]"	"Q8BHY8 1xBiotin [K]"	"Sorting nexin-14 [OS=Mus musculus]"	"1"	"1548.91820"	"9.97"	"9.97"	"9.97"	""	"9.97"	"-0.42"	"-0.25"	""	"196.2"	"173.8"	"83.7"	""	"146.3"	""	"11483.3291015625"	"10172.34375"	"4896.03759765625"	""	"8562.712890625"	""	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"2"	"774.96259"	"0.0001108"	"0.00133"	"2.29"	"54.35"
"15119"	"[K].LNFAVASR.[K]"	""	"0.0730042"	"0.00241047"	"1"	"1"	"1"	"P27773"	"P27773 [297-304]"	""	"Protein disulfide-isomerase A3 [OS=Mus musculus]"	"0"	"877.48903"	"9.97"	""	"9.97"	"9.97"	""	"-9.97"	""	""	"202.0"	""	"176.0"	"222.0"	""	""	"9930.32421875"	""	"8655.6435546875"	"10916.5537109375"	""	""	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Not Found"	"High"	"2"	"439.24775"	"0.000415"	"0.01197"	"1.80"	"30.96"
"15106"	"[K].LNDMEPSKAVPLNASK.[Q]"	"1xBiotin [K8]"	"0.000175815"	"0.000586377"	"1"	"1"	"1"	"Q9WV55"	"Q9WV55 [139-154]"	"Q9WV55 1xBiotin [K146]"	"vesicle-associated membrane protein-associated protein A [OS=Mus musculus]"	"1"	"1939.96159"	""	""	""	"9.97"	""	""	""	""	""	""	""	"600.0"	""	""	""	""	""	"30414.046875"	""	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"2"	"970.48454"	"0.0001108"	"1.713E-06"	"2.61"	"39.43"
"6886"	"[K].EYCELCKHR.[F]"	"1xBiotin [K7]; 2xCarbamidomethyl [C3; C6]"	"0.00702948"	"0.000586377"	"1"	"3"	"6"	"Q6ZQ89"	"Q6ZQ89 [50-58]"	"Q6ZQ89 1xBiotin [K56]"	"E3 ubiquitin-protein ligase MARCH6 [OS=Mus musculus]"	"1"	"1520.64430"	"9.97"	"9.97"	""	"9.97"	"9.97"	"-0.43"	"-0.48"	""	"166.2"	"172.5"	""	"137.6"	"123.6"	""	"16313.935546875"	"16934.5078125"	""	"13508.64453125"	"12133.595703125"	""	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"507.55283"	"0.0001108"	"0.0003734"	"2.85"	"29.30"
"6898"	"[K].EYFSKHN.[-]"	"1xBiotin [K5]"	"0.0591084"	"0.0019826"	"1"	"1"	"1"	"Q61171"	"Q61171 [192-198]"	"Q61171 1xBiotin [K196]"	"Peroxiredoxin-2 [OS=Mus musculus]"	"1"	"1150.49861"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"2"	"575.75305"	"0.0003442"	"0.008723"	"1.41"	""
"15016"	"[R].IMKAQAYQTGK.[D]"	"1xBiotin [K3]"	"0.00418918"	"0.000586377"	"1"	"1"	"1"	"P08113"	"P08113 [661-671]"	"P08113 1xBiotin [K663]"	"Endoplasmin [OS=Mus musculus]"	"1"	"1464.73377"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"2"	"732.86959"	"0.0001108"	"0.0001761"	"1.91"	""
"14957"	"[K].LLYNNVSNFGR.[L]"	""	"0.0516681"	"0.00154748"	"1"	"1"	"3"	"Q68FD5"	"Q68FD5 [1216-1226]"	""	"Clathrin heavy chain 1 [OS=Mus musculus]"	"0"	"1296.66951"	""	"9.97"	"9.97"	"9.97"	""	""	"-9.97"	""	""	"159.5"	"288.3"	"152.2"	""	""	""	"7663.4111328125"	"13850.0146484375"	"7311.24072265625"	""	""	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"High"	"2"	"648.83811"	"0.0002716"	"0.007082"	"1.81"	"37.56"
"14827"	"[K].LISWYDNEYGYSNR.[V]"	""	"0.00390656"	"0.000586377"	"1"	"1"	"3"	"P16858"	"P16858 [308-321]"	""	"glyceraldehyde-3-phosphate dehydrogenase [OS=Mus musculus]"	"0"	"1779.79729"	""	""	"9.97"	""	"9.97"	"9.97"	"9.97"	""	""	""	"252.0"	""	"348.0"	""	""	""	"6224.90966796875"	""	"8598.8720703125"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"2"	"890.40280"	"0.0001108"	"0.0001593"	"2.25"	"42.75"
"6832"	"[K].EVPMVAVPPVGSKASSPATSSQGK.[K]"	"1xBiotin [K13]"	"0.0552689"	"0.0019826"	"1"	"9"	"2"	"Q99PL5-1"	"Q99PL5-1 [176-199]"	"Q99PL5-1 1xBiotin [K188]"	"Ribosome-binding protein 1 [OS=Mus musculus]"	"1"	"2537.27382"	""	"9.97"	"9.97"	"9.97"	""	""	"-9.97"	""	""	"170.4"	"168.9"	"260.6"	""	""	""	"8213.193359375"	"8141.8232421875"	"12559.943359375"	""	""	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"High"	"3"	"846.42989"	"0.0003442"	"0.007879"	"3.36"	"43.60"
"13818"	"[K].LKEKEDALAR.[I]"	"1xBiotin [K4]"	"0.0480209"	"0.00154748"	"1"	"1"	"3"	"Q61712"	"Q61712 [253-262]"	"Q61712 1xBiotin [K256]"	"DnaJ homolog subfamily C member 1 [OS=Mus musculus]"	"2"	"1398.74096"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"0.52"	"0.37"	""	"101.7"	"113.3"	"133.1"	"105.9"	"146.1"	""	"7012.431640625"	"7812.45703125"	"9179.189453125"	"7303.47021484375"	"10074.0576171875"	""	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"3"	"466.91812"	"0.0002716"	"0.006358"	"2.39"	"29.86"
"16524"	"[K].IVLQKYHTINGHNAEVR.[K]"	"1xBiotin [K5]"	"0.0258179"	"0.00104877"	"1"	"3"	"1"	"O88569"	"O88569 [169-185]"	"O88569 1xBiotin [K173]"	"heterogeneous nuclear ribonucleoproteins A2/B1 [OS=Mus musculus]"	"1"	"2218.15497"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"4"	"555.29424"	"0.0001873"	"0.002528"	"2.10"	""
"16581"	"[K].LVPLKETIK.[G]"	"1xBiotin [K5]"	"0.00897115"	"0.000586377"	"1"	"1"	"3"	"P56480"	"P56480 [481-489]"	"P56480 1xBiotin [K485]"	"ATP synthase subunit beta, mitochondrial [OS=Mus musculus]"	"1"	"1266.74901"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"0.16"	"0.36"	""	"123.7"	"107.6"	"126.0"	"104.3"	"138.4"	""	"14526.98046875"	"12638.3798828125"	"14792.759765625"	"12253.41796875"	"16257.3935546875"	""	"Not Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"2"	"633.87816"	"0.0001108"	"0.0005375"	"2.55"	"43.00"
"19488"	"[R].NGHITMKQLIAK.[K]"	"1xBiotin [K7]"	"0.00115604"	"0.000586377"	"1"	"1"	"2"	"Q61263"	"Q61263 [29-40]"	"Q61263 1xBiotin [K35]"	"sterol O-acyltransferase 1 [OS=Mus musculus]"	"1"	"1579.84471"	"9.97"	""	""	""	"9.97"	"-0.86"	"9.97"	""	"386.5"	""	""	""	"213.5"	""	"136455.390625"	""	""	""	"75389.1015625"	""	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"2"	"790.42592"	"0.0001108"	"2.67E-05"	"2.84"	"39.59"
"19450"	"[K].NFTDKCYYFSLEK.[E]"	"1xBiotin [K5]; 1xCarbamidomethyl [C6]"	"0.0190349"	"0.000586377"	"1"	"1"	"1"	"Q8K4Q8"	"Q8K4Q8 [613-625]"	"Q8K4Q8 1xBiotin [K617]"	"Collectin-12 [OS=Mus musculus]"	"1"	"1940.85573"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"970.93245"	"0.0001108"	"0.001622"	"2.13"	""
"4557"	"[R].EDCKQASPYSPLTK.[E]"	"1xBiotin [K4]; 1xCarbamidomethyl [C3]"	"0.107455"	"0.00731053"	"1"	"1"	"1"	"Q8BGC3"	"Q8BGC3 [217-230]"	"Q8BGC3 1xBiotin [K220]"	"Monocarboxylate transporter 12 [OS=Mus musculus]"	"1"	"1849.84590"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"2"	"925.42725"	"0.001426"	"0.02154"	"2.62"	""
"19448"	"[R].NFSPQIKVNLNYR.[K]"	"1xBiotin [K7]"	"0.0154637"	"0.000586377"	"1"	"1"	"2"	"Q9WTR1"	"Q9WTR1 [45-57]"	"Q9WTR1 1xBiotin [K51]"	"Transient receptor potential cation channel subfamily V member 2 [OS=Mus musculus]"	"1"	"1818.93195"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"2"	"909.97020"	"0.0001108"	"0.001194"	"1.41"	""
"4711"	"[R].EDSQRPGAHLTVKK.[I]"	"1xBiotin [K]"	"0.00476133"	"0.000586377"	"1"	"2"	"4"	"P49312-1"	"P49312-1 [93-106]"	"P49312-1 1xBiotin [K]"	"Heterogeneous nuclear ribonucleoprotein A1 [OS=Mus musculus]"	"1"	"1791.91703"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"-0.02"	"0.59"	""	"123.8"	"81.5"	"107.3"	"164.9"	"122.5"	""	"10180.6728515625"	"6702.2763671875"	"8822.150390625"	"13556.4970703125"	"10075.1806640625"	""	"Not Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"3"	"597.97689"	"0.0001108"	"0.0002128"	"3.07"	"25.90"
"19433"	"[R].NFLGEKYIR.[R]"	"1xBiotin [K6]"	"0.0117817"	"0.000586377"	"1"	"1"	"2"	"P51410"	"P51410 [116-124]"	"P51410 1xBiotin [K121]"	"60S ribosomal protein L9 [OS=Mus musculus]"	"1"	"1365.69837"	"9.97"	""	"9.97"	"9.97"	"9.97"	"0.00"	"9.97"	""	"189.9"	""	"139.1"	"81.3"	"189.6"	""	"26097.072265625"	""	"19119.232421875"	"11176.857421875"	"26057.44140625"	""	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"2"	"683.35237"	"0.0001108"	"0.0007998"	"2.53"	"45.86"
"4442"	"[K].EAQKSSSIASFK.[D]"	"1xBiotin [K4]"	"0.0230169"	"0.00104877"	"1"	"1"	"3"	"Q61233"	"Q61233 [531-542]"	"Q61233 1xBiotin [K534]"	"Plastin-2 [OS=Mus musculus]"	"1"	"1508.74135"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"High"	"High"	"2"	"754.87456"	"0.0001873"	"0.002133"	"1.98"	""
"19318"	"[R].NDEELNKLLGR.[V]"	"1xBiotin [K7]"	"0.000700215"	"0.000586377"	"1"	"6"	"4"	"Q8BFU2"	"Q8BFU2 [90-100]"	"Q8BFU2 1xBiotin [K96]"	"Histone H2A type 3 [OS=Mus musculus]"	"1"	"1526.76315"	"9.97"	""	"9.97"	"9.97"	"9.97"	"-0.17"	"9.97"	""	"166.4"	""	"149.6"	"135.6"	"148.3"	""	"14146.296875"	""	"12724.994140625"	"11534.5244140625"	"12614.0126953125"	""	"Not Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"2"	"763.88520"	"0.0001108"	"1.284E-05"	"3.20"	"47.14"
"19208"	"[K].NAFTEEVTKSMR.[N]"	"1xBiotin [K9]"	"0.00129144"	"0.000586377"	"1"	"1"	"3"	"Q9CXR1"	"Q9CXR1 [244-255]"	"Q9CXR1 1xBiotin [K252]"	"Dehydrogenase/reductase SDR family member 7 [OS=Mus musculus]"	"1"	"1638.76144"	""	""	""	"9.97"	""	""	""	""	""	""	""	"600.0"	""	""	""	""	""	"11412.787109375"	""	""	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"High"	"2"	"819.88473"	"0.0001108"	"3.161E-05"	"3.34"	"44.96"
"19047"	"[R].MVNKAADAVNK.[M]"	"1xBiotin [K4]"	"0.00390656"	"0.000586377"	"1"	"1"	"2"	"Q9CWK8"	"Q9CWK8 [284-294]"	"Q9CWK8 1xBiotin [K287]"	"Sorting nexin-2 [OS=Mus musculus]"	"1"	"1386.68682"	""	""	""	"9.97"	""	""	""	""	""	""	""	"600.0"	""	""	""	""	""	"9136.5537109375"	""	""	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"High"	"2"	"693.84709"	"0.0001108"	"0.0001588"	"2.55"	"30.28"
"19045"	"[R].MVNHFIAEFKR.[K]"	"1xBiotin [K10]; 1xOxidation [M1]"	"0.0407563"	"0.00104877"	"1"	"1"	"2"	"P63017"	"P63017 [237-247]"	"P63017 1xBiotin [K246]"	"Heat shock cognate 71 kDa protein [OS=Mus musculus]"	"1"	"1633.79776"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"545.27041"	"0.0001873"	"0.004977"	"2.28"	""
"4965"	"[R].EESAAPTVQKSLSSLR.[L]"	"1xBiotin [K10]"	"0.00026911"	"0.000586377"	"1"	"2"	"5"	"Q8BFW3-1"	"Q8BFW3-1 [107-122]"	"Q8BFW3-1 1xBiotin [K116]"	"Protein phosphatase 1 regulatory subunit 15B [OS=Mus musculus]"	"1"	"1928.97460"	""	""	"9.97"	"9.97"	""	""	""	""	""	""	"229.2"	"370.8"	""	""	""	""	"8769.76171875"	"14190.009765625"	""	""	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"964.99084"	"0.0001108"	"3.198E-06"	"3.08"	"42.17"
"4980"	"[R].EETPGALKR.[D]"	"1xBiotin [K8]"	"0.0231496"	"0.00104877"	"1"	"1"	"3"	"Q8BMG7"	"Q8BMG7 [27-35]"	"Q8BMG7 1xBiotin [K34]"	"Rab3 GTPase-activating protein non-catalytic subunit [OS=Mus musculus]"	"1"	"1226.61978"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"0.07"	"0.57"	""	"127.2"	"90.0"	"111.1"	"138.1"	"133.6"	""	"57062.75390625"	"40389.90625"	"49873.5078125"	"61970.6171875"	"59963.734375"	""	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"2"	"613.81365"	"0.0001873"	"0.002158"	"2.14"	"30.37"
"4990"	"[R].EEVSPSPLSSSTVEGAQHPPAAATKYDVFK.[Q]"	"1xBiotin [K25]"	"0.00678861"	"0.000586377"	"1"	"2"	"2"	"Q5SV85"	"Q5SV85 [712-741]"	"Q5SV85 1xBiotin [K736]"	"Synergin gamma [OS=Mus musculus]"	"1"	"3355.61510"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"3"	"1119.20927"	"0.0001108"	"0.0003551"	"2.09"	""
"19317"	"[R].NDEELNKLLGK.[V]"	"1xBiotin [K7]"	"0.0120579"	"0.000586377"	"1"	"2"	"1"	"Q64523"	"Q64523 [90-100]"	"Q64523 1xBiotin [K96]"	"Histone H2A type 2-C [OS=Mus musculus]"	"1"	"1498.75700"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"2"	"749.88067"	"0.0001108"	"0.0008297"	"2.34"	""
"18882"	"[R].MSYILKESSK.[S]"	"1xBiotin [K6]"	"0.00273861"	"0.000586377"	"1"	"1"	"3"	"Q8K4I3"	"Q8K4I3 [611-620]"	"Q8K4I3 1xBiotin [K616]"	"Rho guanine nucleotide exchange factor 6 [OS=Mus musculus]"	"1"	"1411.69598"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"2"	"706.35138"	"0.0001108"	"9.45E-05"	"2.58"	""
"19583"	"[K].NKEEAAEYAK.[L]"	"1xBiotin [K2]"	"0.0607819"	"0.0019826"	"1"	"1"	"1"	"P62754"	"P62754 [202-211]"	"P62754 1xBiotin [K203]"	"40S RIBOSOMAL PROTEIN S6 [OS=Mus musculus]"	"1"	"1378.63074"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"0.19"	"1.34"	""	"129.5"	"58.4"	"115.0"	"148.8"	"148.3"	""	"5702.724609375"	"2570.40747070313"	"5064.80615234375"	"6553.26220703125"	"6527.69189453125"	""	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"2"	"689.81896"	"0.0003442"	"0.009063"	"1.68"	"28.37"
"19613"	"[K].NKITITNDQNR.[L]"	"1xBiotin [K2]"	"0.0273413"	"0.00104877"	"1"	"1"	"4"	"P20029"	"P20029 [523-533]"	"P20029 1xBiotin [K524]"	"78 kDa glucose-regulated protein [OS=Mus musculus]"	"1"	"1542.76930"	""	""	"9.97"	"9.97"	""	""	""	""	""	""	"296.6"	"303.4"	""	""	""	""	"12469.2314453125"	"12751.2470703125"	""	""	"Not Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"2"	"771.88768"	"0.0001873"	"0.002761"	"1.58"	"32.79"
"20175"	"[K].NSLKEANHDGDFGITLTELR.[A]"	"1xBiotin [K4]"	"0.0686935"	"0.0019826"	"1"	"1"	"1"	"G5E829"	"G5E829 [16-35]"	"G5E829 1xBiotin [K19]"	"Plasma membrane calcium-transporting ATPase 1 [OS=Mus musculus]"	"1"	"2456.18745"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"3"	"819.40084"	"0.0003442"	"0.01091"	"2.43"	""
"19925"	"[K].NMVKSADGVIVSGVK.[D]"	"1xBiotin [K4]"	"0.00258365"	"0.000586377"	"1"	"1"	"1"	"Q6P8X1"	"Q6P8X1 [190-204]"	"Q6P8X1 1xBiotin [K193]"	"Sorting nexin-6 [OS=Mus musculus]"	"1"	"1729.89754"	""	""	""	"9.97"	""	""	""	""	""	""	""	"600.0"	""	""	""	""	""	"6239.98828125"	""	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"2"	"865.45248"	"0.0001108"	"8.704E-05"	"2.19"	"41.68"
"19867"	"[K].NLYIISVKGIK.[G]"	"1xBiotin [K8]"	"0.0287874"	"0.00104877"	"1"	"1"	"2"	"P62830"	"P62830 [36-46]"	"P62830 1xBiotin [K43]"	"60S ribosomal protein L23 [OS=Mus musculus]"	"1"	"1473.84978"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"2"	"737.42876"	"0.0001873"	"0.00297"	"2.08"	""
"19848"	"[K].NITPAKVIPTPGK.[K]"	"1xBiotin [K6]"	"0.112749"	"0.00731053"	"1"	"1"	"1"	"P09405"	"P09405 [97-109]"	"P09405 1xBiotin [K102]"	"Nucleolin [OS=Mus musculus]"	"1"	"1561.87706"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"2"	"781.44169"	"0.001478"	"0.02322"	"2.74"	""
"19845"	"[K].NLTKEAIR.[E]"	"1xBiotin [K4]"	"0.117027"	"0.00731053"	"1"	"2"	"1"	"P10711"	"P10711 [239-246]"	"P10711 1xBiotin [K242]"	"Transcription elongation factor A protein 1 [OS=Mus musculus]"	"1"	"1170.62995"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"2"	"585.81846"	"0.001478"	"0.02441"	"1.99"	""
"19813"	"[K].NLQVKCAQIEAK.[F]"	"1xBiotin [K5]; 1xCarbamidomethyl [C6]"	"0.00678861"	"0.000586377"	"1"	"1"	"1"	"P28656"	"P28656 [83-94]"	"P28656 1xBiotin [K87]"	"Nucleosome assembly protein 1-like 1 [OS=Mus musculus]"	"1"	"1627.82946"	""	""	""	"9.97"	""	""	""	""	""	""	""	"600.0"	""	""	""	""	""	"9012.841796875"	""	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"2"	"814.41859"	"0.0001108"	"0.0003562"	"2.37"	"37.17"
"19584"	"[K].NKEIFLR.[E]"	"1xBiotin [K2]"	"0.0775674"	"0.00241047"	"1"	"1"	"1"	"P08113"	"P08113 [96-102]"	"P08113 1xBiotin [K97]"	"Endoplasmin [OS=Mus musculus]"	"1"	"1145.61358"	""	"9.97"	""	"9.97"	""	""	"-9.97"	""	""	"312.9"	""	"287.1"	""	""	""	"14988.1611328125"	""	"13752.77734375"	""	""	"Not Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"Not Found"	"High"	"2"	"573.31032"	"0.000415"	"0.01309"	"1.74"	"42.38"
"19795"	"[R].NLPKSSIVSLYK.[K]"	"1xBiotin [K4]"	"0.0459009"	"0.00154748"	"1"	"1"	"3"	"Q8BUE1"	"Q8BUE1 [537-548]"	"Q8BUE1 1xBiotin [K540]"	"Sodium/hydrogen exchanger 4 [OS=Mus musculus]"	"1"	"1574.86108"	""	"9.97"	"9.97"	""	"9.97"	"9.97"	"-0.20"	""	""	"215.4"	"197.0"	""	"187.6"	""	""	"12973.0029296875"	"11866.9150390625"	""	"11302.2265625"	""	"Not Found"	"High"	"Peak Found"	"High"	"Not Found"	"High"	"High"	"2"	"787.93384"	"0.0002716"	"0.005946"	"1.74"	"47.48"
"19770"	"[R].NLLSVAYKNVVGAR.[R]"	"1xBiotin [K8]"	"0.00281954"	"0.000586377"	"1"	"5"	"1"	"P61982"	"P61982 [43-56]"	"P61982 1xBiotin [K50]"	"14-3-3 protein gamma [OS=Mus musculus]"	"1"	"1729.94179"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"865.47488"	"0.0001108"	"9.838E-05"	"2.55"	""
"19721"	"[K].NLGVSQKLVSPSR.[S]"	"1xBiotin [K7]"	"0.0980647"	"0.00472246"	"1"	"1"	"1"	"Q9DBS9"	"Q9DBS9 [6-18]"	"Q9DBS9 1xBiotin [K12]"	"Oxysterol-binding protein-related protein 3 [OS=Mus musculus]"	"1"	"1610.86829"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"2"	"805.93805"	"0.0009666"	"0.01869"	"2.16"	""
"19718"	"[K].NLGTIAKSGTSEFLNK.[M]"	"1xBiotin [K7]"	"0.102387"	"0.00612902"	"1"	"1"	"1"	"P08113"	"P08113 [162-177]"	"P08113 1xBiotin [K168]"	"Endoplasmin [OS=Mus musculus]"	"1"	"1905.97387"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"953.48853"	"0.001201"	"0.0199"	"2.30"	""
"4319"	"[K].EAEAAKAAALLTKQAGTEVK.[R]"	"2xBiotin [K6; K13]"	"0.00667128"	"0.000586377"	"1"	"1"	"1"	"Q8VCH8"	"Q8VCH8 [287-306]"	"Q8VCH8 2xBiotin [K292; K299]"	"UBX domain-containing protein 4 [OS=Mus musculus]"	"2"	"2452.25744"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"3"	"818.09110"	"0.0001108"	"0.0003487"	"2.78"	""
"19621"	"[K].NKNLDWFPR.[M]"	"1xBiotin [K2]"	"0.0562059"	"0.0019826"	"1"	"1"	"2"	"P70227"	"P70227 [2595-2603]"	"P70227 1xBiotin [K2596]"	"Inositol 1,4,5-trisphosphate receptor type 3 [OS=Mus musculus]"	"1"	"1415.68887"	"9.97"	"9.97"	""	""	""	"-9.97"	"-9.97"	""	"406.3"	"193.7"	""	""	""	""	"6725.12939453125"	"3206.03100585938"	""	""	""	""	"Not Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"2"	"708.34776"	"0.0003442"	"0.008089"	"1.53"	"49.55"
"4353"	"[K].EAGKGGAADAR.[E]"	"1xBiotin [K4]"	"0.0169608"	"0.000586377"	"1"	"2"	"2"	"Q6X893"	"Q6X893 [634-644]"	"Q6X893 1xBiotin [K637]"	"choline transporter-like protein 1 [OS=Mus musculus]"	"1"	"1228.57390"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"-0.61"	"0.26"	""	"149.3"	"81.8"	"134.5"	"136.3"	"98.0"	""	"5528.34423828125"	"3030.1103515625"	"4981.5634765625"	"5048.533203125"	"3629.21899414063"	""	"Not Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"2"	"614.79044"	"0.0001108"	"0.001369"	"1.83"	"20.65"
"19781"	"[K].NIMSSKIADR.[N]"	"1xBiotin [K6]"	"0.0996655"	"0.00519168"	"1"	"2"	"1"	"Q8C147"	"Q8C147 [922-931]"	"Q8C147 1xBiotin [K927]"	"Dedicator of cytokinesis protein 8 [OS=Mus musculus]"	"1"	"1360.67117"	""	""	""	"9.97"	""	""	""	""	""	""	""	"600.0"	""	""	""	""	""	"15489.4521484375"	""	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"2"	"680.83906"	"0.001046"	"0.01917"	"1.78"	"39.00"
"16538"	"[K].LVLVGDGGTGKTTFVK.[R]"	"1xBiotin [K11]"	"0.00891924"	"0.000586377"	"1"	"1"	"1"	"P62827"	"P62827 [13-28]"	"P62827 1xBiotin [K23]"	"GTP-binding nuclear protein RAN [OS=Mus musculus]"	"1"	"1817.98298"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"2"	"909.49555"	"0.0001108"	"0.00053"	"3.17"	""
"18868"	"[K].MSTLEKSK.[L]"	"1xBiotin [K6]; 1xOxidation [M1]"	"0.0657102"	"0.0019826"	"1"	"1"	"2"	"O88271"	"O88271 [234-241]"	"O88271 1xBiotin [K239]"	"Craniofacial development protein 1 [OS=Mus musculus]"	"1"	"1165.55916"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"2"	"583.28356"	"0.0003442"	"0.01022"	"1.63"	""
"18860"	"[K].MSSYAFFVQTCR.[E]"	"1xCarbamidomethyl [C11]"	"0.0230169"	"0.00104877"	"1"	"2"	"1"	"P63158"	"P63158 [13-24]"	""	"High mobility group protein B1 [OS=Mus musculus]"	"0"	"1496.66608"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"2"	"748.83665"	"0.0001873"	"0.002133"	"2.28"	""
"17592"	"[K].MFNYAGWK.[N]"	""	"0.0226234"	"0.00104877"	"1"	"1"	"1"	"Q924Z4"	"Q924Z4 [251-258]"	""	"Ceramide synthase 2 [OS=Mus musculus]"	"0"	"1016.46585"	""	""	""	"9.97"	""	""	""	""	""	""	""	"600.0"	""	""	""	""	""	"12466.642578125"	""	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"2"	"508.73644"	"0.0001873"	"0.002084"	"1.80"	"39.88"
"17584"	"[K].MFLKVALPSYEEALSLPPK.[T]"	"1xBiotin [K4]"	"0.0189255"	"0.000586377"	"1"	"1"	"6"	"Q61168"	"Q61168 [229-247]"	"Q61168 1xBiotin [K232]"	"Lysosomal-associated transmembrane protein 5 [OS=Mus musculus]"	"1"	"2359.24402"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"787.08649"	"0.0001108"	"0.001604"	"3.65"	""
"17499"	"[-].MEQAVHGESKR.[G]"	"1xAcetyl [N-Term]; 1xBiotin [K10]"	"0.000258346"	"0.000586377"	"1"	"1"	"3"	"Q9R1J0"	"Q9R1J0 [1-11]"	"Q9R1J0 1xAcetyl [N-Term]; 1xBiotin [K10]"	"sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating [OS=Mus musculus]"	"1"	"1539.70426"	"9.97"	""	""	"9.97"	""	"-9.97"	""	""	"160.0"	""	""	"440.0"	""	""	"8799.2158203125"	""	""	"24188.09375"	""	""	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"2"	"770.35594"	"0.0001108"	"3.012E-06"	"2.43"	"32.67"
"17328"	"[-].MEAQELGSPTPTYHLLPKANQHTVK.[E]"	"1xAcetyl [N-Term]; 1xBiotin [K18]"	"0.122093"	"0.00820514"	"1"	"1"	"2"	"Q8BGK6-1"	"Q8BGK6-1 [1-25]"	"Q8BGK6-1 1xAcetyl [N-Term]; 1xBiotin [K18]"	"Y+L amino acid transporter 2 [OS=Mus musculus]"	"1"	"3058.51249"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"3"	"1020.17712"	"0.00163"	"0.02605"	"2.99"	""
"5423"	"[K].EKPSTEEEKEVGGLR.[K]"	"1xBiotin [K2]"	"0.111552"	"0.00731053"	"1"	"1"	"1"	"Q31125"	"Q31125 [280-294]"	"Q31125 1xBiotin [K281]"	"Zinc transporter SLC39A7 [OS=Mus musculus]"	"1"	"1913.92732"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"-0.30"	"0.49"	""	"155.7"	"89.6"	"147.3"	"81.3"	"126.1"	""	"9489.8359375"	"5459.62060546875"	"8978.2490234375"	"4952.88330078125"	"7681.8212890625"	""	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"3"	"638.64613"	"0.001478"	"0.02281"	"1.92"	"31.94"
"5434"	"[K].EKQEVAQDTLR.[K]"	"1xBiotin [K2]"	"0.0985957"	"0.00472246"	"1"	"1"	"1"	"Q8BYU6"	"Q8BYU6 [230-240]"	"Q8BYU6 1xBiotin [K231]"	"Torsin-1A-interacting protein 2 [OS=Mus musculus]"	"1"	"1542.75807"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"2"	"771.88302"	"0.0009666"	"0.01883"	"1.57"	""
"17608"	"[K].MFSNCSKQSIYK.[T]"	"1xBiotin [K7]; 1xCarbamidomethyl [C5]"	"0.0913953"	"0.00334029"	"1"	"2"	"1"	"Q9Z0F8"	"Q9Z0F8 [449-460]"	"Q9Z0F8 1xBiotin [K455]"	"Disintegrin and metalloproteinase domain-containing protein 17 [OS=Mus musculus]"	"1"	"1718.76989"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"2"	"859.88849"	"0.0007348"	"0.01685"	"2.11"	""
"5448"	"[K].EKSVNPWDTQVPLETR.[N]"	"1xBiotin [K2]"	"0.115176"	"0.00731053"	"1"	"2"	"1"	"Q64281"	"Q64281 [63-78]"	"Q64281 1xBiotin [K64]"	"Leukocyte immunoglobulin-like receptor subfamily B member 4 [OS=Mus musculus]"	"1"	"2125.03826"	"9.97"	""	""	"9.97"	""	"-9.97"	""	""	"417.5"	""	""	"182.5"	""	""	"8774.9033203125"	""	""	"3836.75463867188"	""	""	"Not Found"	"High"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"3"	"709.01714"	"0.001478"	"0.02388"	"3.00"	"47.20"
"17114"	"[K].MCLFAGFQR.[K]"	"1xCarbamidomethyl [C2]"	"0.00775912"	"0.000586377"	"1"	"2"	"4"	"Q8VEK3"	"Q8VEK3 [569-577]"	""	"Heterogeneous nuclear ribonucleoprotein U [OS=Mus musculus]"	"0"	"1129.52813"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"-0.22"	"-0.13"	""	"121.5"	"114.2"	"129.4"	"130.6"	"104.2"	""	"15875.1083984375"	"14914.162109375"	"16906.509765625"	"17060.650390625"	"13617.306640625"	""	"Not Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"2"	"565.26762"	"0.0001108"	"0.0004316"	"1.90"	"46.31"
"17042"	"[R].MASVSKDGTWK.[L]"	"1xBiotin [K6]; 1xOxidation [M1]"	"0.0456423"	"0.00154748"	"1"	"1"	"1"	"Q9R099"	"Q9R099 [290-300]"	"Q9R099 1xBiotin [K295]"	"Transducin beta-like protein 2 [OS=Mus musculus]"	"1"	"1451.66575"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"726.33720"	"0.0002716"	"0.005898"	"3.21"	""
"16956"	"[R].MANEKHSK.[N]"	"1xBiotin [K5]"	"0.018601"	"0.000586377"	"1"	"3"	"5"	"Q9Z1W5"	"Q9Z1W5 [9-16]"	"Q9Z1W5 1xBiotin [K13]"	"Stress-associated endoplasmic reticulum protein 1 [OS=Mus musculus]"	"1"	"1170.53942"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"-0.14"	"0.07"	""	"97.9"	"84.9"	"67.7"	"260.4"	"89.1"	""	"8293.9169921875"	"7197.31689453125"	"5736.38525390625"	"22059.69140625"	"7547.19970703125"	""	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"585.77338"	"0.0001108"	"0.001567"	"1.97"	"15.08"
"5467"	"[K].EKYIDQEELNK.[T]"	"1xBiotin [K2]"	"0.013076"	"0.000586377"	"1"	"2"	"1"	"P11499"	"P11499 [274-284]"	"P11499 1xBiotin [K275]"	"Heat shock protein HSP 90-beta [OS=Mus musculus]"	"1"	"1634.77305"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"817.89054"	"0.0001108"	"0.0009292"	"2.11"	""
"16669"	"[K].LWNLNNYR.[T]"	""	"0.0604437"	"0.0019826"	"1"	"1"	"1"	"Q99PV0"	"Q99PV0 [1464-1471]"	""	"Pre-mRNA-processing-splicing factor 8 [OS=Mus musculus]"	"0"	"1092.55850"	""	""	"9.97"	"9.97"	""	""	""	""	""	""	"293.6"	"306.4"	""	""	""	""	"14031.041015625"	"14642.78515625"	""	""	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Not Found"	"High"	"2"	"546.78311"	"0.0003442"	"0.008969"	"2.00"	"39.89"
"16618"	"[R].LVSSGIYKAAFPLHDCR.[F]"	"1xBiotin [K8]; 1xCarbamidomethyl [C16]"	"0.0683137"	"0.0019826"	"1"	"1"	"1"	"Q6P9J9"	"Q6P9J9 [236-252]"	"Q6P9J9 1xBiotin [K243]"	"Anoctamin-6 [OS=Mus musculus]"	"1"	"2160.07288"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"3"	"720.69579"	"0.0003442"	"0.0108"	"2.38"	""
"17295"	"[K].MDSTEPPYSQKR.[Y]"	"1xBiotin [K11]"	"0.0734084"	"0.00241047"	"1"	"1"	"2"	"P10126"	"P10126 [155-166]"	"P10126 1xBiotin [K165]"	"Elongation factor 1-alpha 1 [OS=Mus musculus]"	"1"	"1664.74070"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"2"	"832.87455"	"0.000415"	"0.01202"	"1.41"	""
"18861"	"[K].MSSYAFFVQTCR.[E]"	"1xCarbamidomethyl [C11]; 1xOxidation [M1]"	"0.00131422"	"0.000586377"	"1"	"2"	"1"	"P63158"	"P63158 [13-24]"	""	"High mobility group protein B1 [OS=Mus musculus]"	"0"	"1512.66100"	""	""	"9.97"	""	""	""	""	""	""	""	"600.0"	""	""	""	""	""	"13860.677734375"	""	""	""	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"2"	"756.83440"	"0.0001108"	"3.236E-05"	"2.55"	"41.03"
"17823"	"[-].MHPPEATTKMSSVR.[F]"	"1xBiotin [K9]; 1xOxidation [M1]"	"0.00187528"	"0.000586377"	"1"	"1"	"3"	"Q924N4"	"Q924N4 [1-14]"	"Q924N4 1xBiotin [K9]"	"Solute carrier family 12 member 6 [OS=Mus musculus]"	"1"	"1813.83937"	"9.97"	"9.97"	""	"9.97"	"9.97"	"-0.04"	"0.35"	""	"169.1"	"129.3"	""	"137.2"	"164.5"	""	"11522.4267578125"	"8808.6416015625"	""	"9348.13671875"	"11211.0869140625"	""	"Not Found"	"High"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"3"	"605.28445"	"0.0001108"	"5.412E-05"	"2.84"	"30.67"
"17860"	"[-].MKDDFAEEEEVQSFGYKR.[F]"	"1xBiotin [K17]"	"0.000873873"	"0.000586377"	"1"	"1"	"1"	"Q8K4Q8"	"Q8K4Q8 [1-18]"	"Q8K4Q8 1xBiotin [K17]"	"Collectin-12 [OS=Mus musculus]"	"2"	"2434.06897"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"3"	"812.02776"	"0.0001108"	"1.78E-05"	"3.34"	""
"18814"	"[-].MSPTISHKDSSR.[Q]"	"1xAcetyl [N-Term]; 1xBiotin [K8]"	"0.0019195"	"0.000586377"	"1"	"1"	"3"	"Q99J27"	"Q99J27 [1-12]"	"Q99J27 1xAcetyl [N-Term]; 1xBiotin [K8]"	"Acetyl-coenzyme A transporter 1 [OS=Mus musculus]"	"1"	"1613.74104"	""	""	""	"9.97"	""	""	""	""	""	""	""	"600.0"	""	""	""	""	""	"24400.314453125"	""	""	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"High"	"2"	"807.37456"	"0.0001108"	"5.643E-05"	"2.91"	"34.16"
"18770"	"[K].MSLAQKK.[D]"	"1xBiotin [K6]"	"0.12274"	"0.00865053"	"1"	"1"	"1"	"P47962"	"P47962 [271-277]"	"P47962 1xBiotin [K276]"	"60S ribosomal protein L5 [OS=Mus musculus]"	"1"	"1031.53763"	"9.97"	"9.97"	"9.97"	"9.97"	""	"-9.97"	"-9.97"	""	"243.7"	"134.7"	"89.0"	"132.6"	""	""	"14872.4423828125"	"8217.6875"	"5430.03369140625"	"8090.7880859375"	""	""	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"High"	"2"	"516.27253"	"0.001706"	"0.02646"	"1.84"	"31.05"
"18594"	"[R].MQQLAKTQEER.[A]"	"1xBiotin [K6]"	"0.0806083"	"0.00241047"	"1"	"1"	"1"	"Q9CQN1"	"Q9CQN1 [626-636]"	"Q9CQN1 1xBiotin [K631]"	"heat shock protein 75 kDa, mitochondrial [OS=Mus musculus]"	"1"	"1587.76177"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"2"	"794.38348"	"0.000415"	"0.01389"	"1.73"	""
"18588"	"[-].MQNVINTVKGK.[A]"	"1xAcetyl [N-Term]; 1xBiotin [K9]"	"0.0136956"	"0.000586377"	"1"	"1"	"2"	"Q9CPX6"	"Q9CPX6 [1-11]"	"Q9CPX6 1xAcetyl [N-Term]; 1xBiotin [K9]"	"ubiquitin-like-conjugating enzyme ATG3 [OS=Mus musculus]"	"1"	"1499.77088"	"9.97"	"9.97"	"9.97"	"9.97"	""	"-9.97"	"-9.97"	""	"157.2"	"197.4"	"117.2"	"128.3"	""	""	"6218.15283203125"	"7810.7021484375"	"4636.08544921875"	"5074.84765625"	""	""	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Not Found"	"High"	"2"	"750.38897"	"0.0001108"	"0.001"	"2.41"	"55.81"
"18568"	"[R].MQKEITALAPSTMK.[I]"	"1xBiotin [K3]"	"0.000100445"	"0.000586377"	"1"	"6"	"2"	"P60710"	"P60710 [313-326]"	"P60710 1xBiotin [K315]"	"Actin, cytoplasmic 1 [OS=Mus musculus]"	"1"	"1774.89001"	""	""	""	"9.97"	"9.97"	"9.97"	"9.97"	""	""	""	""	"438.5"	"161.5"	""	""	""	""	"16008.900390625"	"5897.90234375"	""	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"2"	"887.94909"	"0.0001108"	"7.577E-07"	"3.85"	"44.32"
"18548"	"[K].MQASIEKGGSLPK.[V]"	"1xBiotin [K7]; 1xOxidation [M1]"	"0.00636818"	"0.000586377"	"1"	"1"	"1"	"Q61937"	"Q61937 [249-261]"	"Q61937 1xBiotin [K255]"	"Nucleophosmin [OS=Mus musculus]"	"1"	"1587.78692"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"2"	"794.39710"	"0.0001108"	"0.0003244"	"2.99"	""
"17824"	"[-].MHPPEATTKMSSVR.[F]"	"1xAcetyl [N-Term]; 1xBiotin [K9]"	"0.0022076"	"0.000586377"	"1"	"1"	"4"	"Q924N4"	"Q924N4 [1-14]"	"Q924N4 1xAcetyl [N-Term]; 1xBiotin [K9]"	"Solute carrier family 12 member 6 [OS=Mus musculus]"	"1"	"1839.85502"	""	"9.97"	""	"9.97"	"9.97"	"9.97"	"0.17"	""	""	"72.2"	""	"446.7"	"81.1"	""	""	"9529.015625"	""	"58954.681640625"	"10710.0771484375"	""	"Not Found"	"High"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"High"	"2"	"920.43087"	"0.0001108"	"6.892E-05"	"2.96"	"40.08"
"18547"	"[K].MQASIEKGGSLPK.[V]"	"1xBiotin [K7]"	"0.000167801"	"0.000586377"	"1"	"1"	"3"	"Q61937"	"Q61937 [249-261]"	"Q61937 1xBiotin [K255]"	"Nucleophosmin [OS=Mus musculus]"	"1"	"1571.79201"	""	""	""	"9.97"	""	""	""	""	""	""	""	"600.0"	""	""	""	""	""	"17811.1796875"	""	""	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"2"	"786.39968"	"0.0001108"	"1.608E-06"	"3.76"	"36.63"
"18170"	"[K].MITGLSKDQQIGEK.[I]"	"1xBiotin [K7]; 1xOxidation [M1]"	"0.000692098"	"0.000586377"	"1"	"1"	"4"	"P97310"	"P97310 [463-476]"	"P97310 1xBiotin [K469]"	"DNA replication licensing factor mcm2 [OS=Mus musculus]"	"1"	"1789.88228"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"2"	"895.44484"	"0.0001108"	"1.264E-05"	"2.60"	""
"18016"	"[K].MLETKWSLLQQQKTSR.[S]"	""	"0.118276"	"0.00731053"	"1"	"1"	"1"	"P11679"	"P11679 [124-139]"	""	"Keratin, type II cytoskeletal 8 [OS=Mus musculus]"	"2"	"1977.05861"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"989.03272"	"0.001478"	"0.02494"	"1.26"	""
"17955"	"[K].MKTSASVSDIIVVAK.[R]"	"1xBiotin [K2]; 1xOxidation [M1]"	"0.0441201"	"0.00104877"	"1"	"1"	"1"	"Q91X86"	"Q91X86 [119-133]"	"Q91X86 1xBiotin [K120]"	"transmembrane protein 98 [OS=Mus musculus]"	"1"	"1790.93907"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"895.97344"	"0.0001873"	"0.005613"	"2.25"	""
"17882"	"[K].MKGLALDTEAELER.[Q]"	"1xBiotin [K2]; 1xOxidation [M1]"	"0.00137695"	"0.000586377"	"1"	"1"	"4"	"Q8R570"	"Q8R570 [370-383]"	"Q8R570 1xBiotin [K371]"	"Synaptosomal-associated protein 47 [OS=Mus musculus]"	"1"	"1817.87720"	""	"9.97"	""	""	"9.97"	"9.97"	"0.55"	""	""	"243.6"	""	""	"356.4"	""	""	"7674.28076171875"	""	""	"11225.171875"	""	"Not Found"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"2"	"909.44249"	"0.0001108"	"3.457E-05"	"2.76"	"43.89"
"17872"	"[K].MKEIAEAYLGK.[T]"	"1xBiotin [K2]"	"0.00152926"	"0.000586377"	"1"	"1"	"1"	"P63017"	"P63017 [127-137]"	"P63017 1xBiotin [K128]"	"Heat shock cognate 71 kDa protein [OS=Mus musculus]"	"1"	"1478.73818"	""	"9.97"	""	"9.97"	"9.97"	"9.97"	"-0.94"	""	""	"289.8"	""	"159.2"	"150.9"	""	""	"23720.421875"	""	"13032.970703125"	"12354.751953125"	""	"Not Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"2"	"739.87305"	"0.0001108"	"4.028E-05"	"3.09"	"44.49"
"5361"	"[K].EKIADVVLLQK.[L]"	"1xBiotin [K2]"	"0.00314946"	"0.000586377"	"1"	"1"	"1"	"P70227"	"P70227 [82-92]"	"P70227 1xBiotin [K83]"	"Inositol 1,4,5-trisphosphate receptor type 3 [OS=Mus musculus]"	"1"	"1481.83961"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"741.42402"	"0.0001108"	"0.0001154"	"2.51"	""
"5206"	"[R].EGTTPKPK.[R]"	"1xBiotin [K6]"	"0.0856113"	"0.00288886"	"1"	"1"	"2"	"Q9D823"	"Q9D823 [80-87]"	"Q9D823 1xBiotin [K85]"	"60S ribosomal protein L37 [OS=Mus musculus]"	"0"	"1083.55031"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"0.20"	"0.44"	""	"123.3"	"103.9"	"109.2"	"122.5"	"141.2"	""	"6205.49853515625"	"5231.015625"	"5496.94482421875"	"6165.228515625"	"7106.5390625"	""	"Not Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"2"	"542.27896"	"0.0004957"	"0.01524"	"1.97"	"21.67"
"7191"	"[R].FKVPQQILQGLVDVR.[I]"	"1xBiotin [K2]"	"0.00236746"	"0.000586377"	"1"	"2"	"4"	"Q8R2Y0-1"	"Q8R2Y0-1 [222-236]"	"Q8R2Y0-1 1xBiotin [K223]"	"Monoacylglycerol lipase ABHD6 [OS=Mus musculus]"	"1"	"1966.09426"	"9.97"	"9.97"	""	""	"9.97"	"1.59"	"1.63"	""	"120.3"	"117.4"	""	""	"362.3"	""	"3734.49365234375"	"3643.67822265625"	""	""	"11244.74609375"	""	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"2"	"983.55031"	"0.0001108"	"7.627E-05"	"2.29"	"60.94"
"13676"	"[R].LGYIHR.[N]"	""	"0.0851449"	"0.00288886"	"1"	"3"	"2"	"O70133"	"O70133 [902-907]"	""	"Atp-dependent rna helicase a [OS=Mus musculus]"	"0"	"758.43078"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"-0.19"	"0.28"	""	"130.6"	"93.8"	"108.5"	"153.0"	"114.1"	""	"4996.62353515625"	"3589.2509765625"	"4151.98486328125"	"5853.19287109375"	"4367.57421875"	""	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"2"	"379.71897"	"0.0004957"	"0.01512"	"1.61"	"18.16"
"7207"	"[K].FLDAGHKLNFAVASR.[K]"	"1xBiotin [K7]"	"0.015917"	"0.000586377"	"1"	"1"	"2"	"P27773"	"P27773 [290-304]"	"P27773 1xBiotin [K296]"	"Protein disulfide-isomerase A3 [OS=Mus musculus]"	"1"	"1871.95850"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"3"	"624.65720"	"0.0001108"	"0.001241"	"2.74"	""
"11034"	"[K].KGVNLPGAAVDLPAVSEK.[D]"	"1xBiotin [K1]"	"0.000214369"	"0.000586377"	"1"	"2"	"5"	"P52480"	"P52480 [207-224]"	"P52480 1xBiotin [K207]"	"Pyruvate kinase PKM [OS=Mus musculus]"	"1"	"1991.06302"	"9.97"	""	""	""	""	"-9.97"	""	""	"600.0"	""	""	""	""	""	"12756.1318359375"	""	""	""	""	""	"Not Found"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"2"	"996.03599"	"0.0001108"	"2.292E-06"	"3.17"	"48.29"
"8517"	"[K].GKTGIFK.[I]"	"1xBiotin [K2]"	"0.0842191"	"0.00241047"	"1"	"2"	"2"	"Q60848-1"	"Q60848-1 [801-807]"	"Q60848-1 1xBiotin [K802]"	"Lymphocyte-specific helicase [OS=Mus musculus]"	"1"	"976.52845"	"9.97"	"9.97"	""	"9.97"	"9.97"	"0.28"	"0.46"	""	"142.6"	"125.7"	""	"158.8"	"173.0"	""	"43299.89453125"	"38162.27734375"	""	"48212.6328125"	"52521.46875"	""	"Not Found"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"High"	"High"	"2"	"488.76760"	"0.000415"	"0.01481"	"1.89"	"36.44"
"11030"	"[K].KGVEGAQNQGK.[K]"	"1xBiotin [K1]"	"0.0985957"	"0.00472246"	"1"	"4"	"1"	"Q99PL5-1"	"Q99PL5-1 [380-390]; [521-531]"	"Q99PL5-1 1xBiotin [K380]; 1xBiotin [K521]"	"Ribosome-binding protein 1 [OS=Mus musculus]"	"1"	"1341.65796"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"671.33276"	"0.0009666"	"0.0188"	"1.72"	""
"8546"	"[R].GLATFCLDKDALR.[D]"	"1xBiotin [K9]; 1xCarbamidomethyl [C6]"	"0.00267554"	"0.000586377"	"1"	"1"	"2"	"Q80UU9"	"Q80UU9 [148-160]"	"Q80UU9 1xBiotin [K156]"	"Membrane-associated progesterone receptor component 2 [OS=Mus musculus]"	"1"	"1705.84002"	"9.97"	""	""	""	""	"-9.97"	""	""	"600.0"	""	""	""	""	""	"10710.4228515625"	""	""	""	""	""	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"853.42289"	"0.0001108"	"9.121E-05"	"3.19"	"51.48"
"11015"	"[R].KGTDIMYTGTLDCWR.[K]"	"1xBiotin [K1]; 1xCarbamidomethyl [C13]; 1xOxidation [M6]"	"0.000878982"	"0.000586377"	"1"	"1"	"2"	"P51881"	"P51881 [245-259]"	"P51881 1xBiotin [K245]"	"ADP/ATP translocase 2 [OS=Mus musculus]"	"1"	"2058.90818"	""	""	""	""	"9.97"	"9.97"	"9.97"	""	""	""	""	""	"600.0"	""	""	""	""	""	"8886.0634765625"	""	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"2"	"1029.95868"	"0.0001108"	"1.79E-05"	"2.13"	"45.37"
"8573"	"[K].GLEKNLGIGK.[I]"	"1xBiotin [K4]"	"0.0125567"	"0.000586377"	"1"	"1"	"1"	"P08249"	"P08249 [298-307]"	"P08249 1xBiotin [K301]"	"Malate dehydrogenase, mitochondrial [OS=Mus musculus]"	"1"	"1254.68747"	""	""	""	"9.97"	""	""	""	""	""	""	""	"600.0"	""	""	""	""	""	"23868.62109375"	""	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"2"	"627.84728"	"0.0001108"	"0.0008808"	"2.28"	"39.71"
"11059"	"[R].KHLDEYASIASSSK.[G]"	"1xBiotin [K1]"	"0.0784252"	"0.00241047"	"1"	"2"	"1"	"Q8BYI6-1"	"Q8BYI6-1 [362-375]"	"Q8BYI6-1 1xBiotin [K362]"	"Lysophosphatidylcholine acyltransferase 2 [OS=Mus musculus]"	"1"	"1761.84761"	"9.97"	""	"9.97"	""	""	"-9.97"	""	""	"313.2"	""	"286.8"	""	""	""	"10474.4150390625"	""	"9592.669921875"	""	""	""	"Not Found"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"3"	"587.95432"	"0.000415"	"0.01331"	"2.42"	"35.52"
"8584"	"[K].GLFKGGDMSK.[N]"	"1xBiotin [K4]; 1xOxidation [M8]"	"0.0540428"	"0.0019826"	"1"	"1"	"1"	"P14576-1"	"P14576-1 [439-448]"	"P14576-1 1xBiotin [K442]"	"signal recognition particle 54 kDa protein [OS=Mus musculus]"	"1"	"1281.59660"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"2"	"641.30164"	"0.0003442"	"0.007625"	"1.18"	""
"10838"	"[K].KFMEENEK.[L]"	"1xBiotin [K1]"	"0.0145952"	"0.000586377"	"1"	"1"	"1"	"Q61334"	"Q61334 [150-157]"	"Q61334 1xBiotin [K150]"	"B-cell receptor-associated protein 29 [OS=Mus musculus]"	"1"	"1280.56497"	""	""	""	"9.97"	""	""	""	""	""	""	""	"600.0"	""	""	""	""	""	"13835.634765625"	""	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"2"	"640.78626"	"0.0001108"	"0.001097"	"1.90"	"31.64"
"8687"	"[R].GLMKPPSLSK.[R]"	"1xBiotin [K4]"	"0.0250878"	"0.00104877"	"1"	"2"	"1"	"Q8BH73"	"Q8BH73 [17-26]"	"Q8BH73 1xBiotin [K20]"	"Glutaminyl-peptide cyclotransferase-like protein [OS=Mus musculus]"	"0"	"1283.68503"	""	"9.97"	""	"9.97"	"9.97"	"9.97"	"0.56"	""	""	"123.0"	""	"295.8"	"181.2"	""	""	"9008.283203125"	""	"21666.5703125"	"13270.9443359375"	""	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"High"	"2"	"642.34592"	"0.0001873"	"0.002438"	"1.97"	"39.37"
"10784"	"[K].KETITESAGR.[Q]"	"1xBiotin [K1]"	"0.0842191"	"0.00241047"	"1"	"1"	"1"	"Q921L3"	"Q921L3 [54-63]"	"Q921L3 1xBiotin [K54]"	"Calcium load-activated calcium channel [OS=Mus musculus]"	"1"	"1317.64673"	"9.97"	""	""	"9.97"	""	"-9.97"	""	""	"319.8"	""	""	"280.2"	""	""	"12938.357421875"	""	""	"11339.8525390625"	""	""	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"2"	"659.32673"	"0.000415"	"0.01477"	"1.56"	"28.09"
"10751"	"[K].KENLNEVVSALTAQQVR.[F]"	"1xBiotin [K1]"	"0.00305907"	"0.000586377"	"1"	"1"	"2"	"Q99LE3"	"Q99LE3 [178-194]"	"Q99LE3 1xBiotin [K178]"	"LysM and putative peptidoglycan-binding domain-containing protein 3 [OS=Mus musculus]"	"1"	"2125.10701"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"3"	"709.04018"	"0.0001108"	"0.0001107"	"2.88"	""
"10730"	"[K].KELNYFAK.[A]"	"1xBiotin [K1]"	"0.031726"	"0.00104877"	"1"	"1"	"1"	"P09411"	"P09411 [192-199]"	"P09411 1xBiotin [K192]"	"phosphoglycerate kinase 1 [OS=Mus musculus]"	"1"	"1238.62381"	""	""	""	"9.97"	""	""	""	""	""	""	""	"600.0"	""	""	""	""	""	"12921.984375"	""	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"2"	"619.81530"	"0.0001873"	"0.00344"	"2.23"	"40.39"
"8770"	"[R].GLVGEIIKR.[F]"	"1xBiotin [K8]"	"0.0370047"	"0.00104877"	"1"	"2"	"1"	"Q01768"	"Q01768 [19-27]"	"Q01768 1xBiotin [K26]"	"nucleoside diphosphate kinase b [OS=Mus musculus]"	"1"	"1210.69764"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"2"	"605.85280"	"0.0001873"	"0.004337"	"2.33"	""
"10930"	"[K].KGHQLLDPYLTVSVDQVR.[V]"	"1xBiotin [K1]"	"0.0117817"	"0.000586377"	"1"	"1"	"1"	"P23298"	"P23298 [36-53]"	"P23298 1xBiotin [K36]"	"Protein kinase C eta type [OS=Mus musculus]"	"1"	"2294.19616"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"3"	"765.40290"	"0.0001108"	"0.0007995"	"2.92"	""
"10728"	"[R].KELNALIGLAGDHR.[R]"	"1xBiotin [K1]"	"0.0330195"	"0.00104877"	"1"	"2"	"1"	"Q8BGQ6-1"	"Q8BGQ6-1 [5-18]"	"Q8BGQ6-1 1xBiotin [K5]"	"EF-hand calcium-binding domain-containing protein 14 [OS=Mus musculus]"	"1"	"1732.91630"	""	"9.97"	""	""	""	""	"-9.97"	""	""	"600.0"	""	""	""	""	""	"8049.939453125"	""	""	""	""	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"3"	"578.31078"	"0.0001873"	"0.003636"	"2.79"	"47.99"
"11061"	"[K].KHLEINPDHPIVETLR.[Q]"	"1xBiotin [K1]"	"0.00177946"	"0.000586377"	"1"	"1"	"1"	"P11499"	"P11499 [624-639]"	"P11499 1xBiotin [K624]"	"Heat shock protein HSP 90-beta [OS=Mus musculus]"	"1"	"2137.12227"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"3"	"713.04518"	"0.0001108"	"5.019E-05"	"3.46"	""
"8506"	"[K].GKSGEIEPVSVK.[V]"	"1xBiotin [K2]"	"0.0158253"	"0.000586377"	"1"	"1"	"2"	"Q64433"	"Q64433 [55-66]"	"Q64433 1xBiotin [K56]"	"10 kDa heat shock protein, mitochondrial [OS=Mus musculus]"	"1"	"1455.75119"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"2"	"728.37951"	"0.0001108"	"0.001236"	"1.94"	""
"11383"	"[R].KIQVLQQQADDAEER.[A]"	"1xBiotin [K1]"	"0.0601072"	"0.0019826"	"1"	"1"	"2"	"P21107-2"	"P21107-2 [13-27]"	"P21107-2 1xBiotin [K13]"	"Isoform 2 of Tropomyosin alpha-3 chain [OS=Mus musculus]"	"1"	"1996.97566"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"2"	"998.99113"	"0.0003442"	"0.008886"	"1.73"	""
"8351"	"[K].GGVASGFKHVVPNEVVVQR.[L]"	"1xBiotin [K8]"	"0.00907589"	"0.000586377"	"1"	"2"	"2"	"P13020-1"	"P13020-1 [168-186]"	"P13020-1 1xBiotin [K175]"	"Gelsolin [OS=Mus musculus]"	"1"	"2205.15972"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"3"	"735.72536"	"0.0001108"	"0.0005446"	"2.43"	""
"11305"	"[R].KILGVGGEDDDGEVHR.[S]"	"1xBiotin [K1]"	"4.51411E-06"	"0.000586377"	"1"	"1"	"4"	"Q4QQM4"	"Q4QQM4 [26-41]"	"Q4QQM4 1xBiotin [K26]"	"Tumor protein p53-inducible protein 11 [OS=Mus musculus]"	"1"	"1921.90725"	"9.97"	""	"9.97"	"9.97"	"9.97"	"-0.41"	"9.97"	""	"174.0"	""	"144.2"	"150.4"	"131.4"	""	"17764.92578125"	""	"14720.4736328125"	"15347.3095703125"	"13413.0341796875"	""	"Not Found"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"3"	"641.30696"	"0.0001108"	"8.182E-09"	"3.75"	"35.43"
"11289"	"[K].KLLADQAEAR.[R]"	"1xBiotin [K1]"	"0.0568389"	"0.0019826"	"1"	"1"	"2"	"P84099"	"P84099 [153-162]"	"P84099 1xBiotin [K153]"	"60S ribosomal protein L19 [OS=Mus musculus]"	"1"	"1340.69910"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"High"	"2"	"670.85297"	"0.0003442"	"0.008185"	"2.14"	""
"11260"	"[K].KLGLGTAYIHGIK.[H]"	"1xBiotin [K1]"	"0.0372158"	"0.00104877"	"1"	"1"	"1"	"O70152"	"O70152 [95-107]"	"O70152 1xBiotin [K95]"	"Dolichol-phosphate mannosyltransferase subunit 1 [OS=Mus musculus]"	"1"	"1596.89304"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"3"	"532.96864"	"0.0001873"	"0.004373"	"2.51"	""
"11246"	"[R].KIFVGTK.[G]"	"1xBiotin [K1]"	"0.0646233"	"0.0019826"	"1"	"1"	"1"	"P62702"	"P62702 [128-134]"	"P62702 1xBiotin [K128]"	"40S ribosomal protein S4, X isoform [OS=Mus musculus]"	"1"	"1018.57540"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"509.79100"	"0.0003442"	"0.009924"	"1.67"	""
"11088"	"[R].KHVTEQEKPEEGLGPNIK.[S]"	"1xBiotin [K1]"	"0.00871455"	"0.000586377"	"1"	"1"	"2"	"Q3TDQ1"	"Q3TDQ1 [516-533]"	"Q3TDQ1 1xBiotin [K516]"	"Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B [OS=Mus musculus]"	"1"	"2259.14379"	"9.97"	""	""	"9.97"	""	"-9.97"	""	""	"323.2"	""	""	"276.8"	""	""	"9522.794921875"	""	""	"8157.40576171875"	""	""	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"3"	"753.71944"	"0.0001108"	"0.0005122"	"3.07"	"29.21"
"11244"	"[K].KIFVGGLNPEATEEK.[I]"	"1xBiotin [K1]"	"0.0574787"	"0.0019826"	"1"	"1"	"2"	"Q99020"	"Q99020 [160-174]"	"Q99020 1xBiotin [K160]"	"Heterogeneous nuclear ribonucleoprotein A/B [OS=Mus musculus]"	"1"	"1857.94151"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"High"	"2"	"929.47548"	"0.0003442"	"0.008315"	"2.13"	""
"8428"	"[R].GKEDISQNKDDSSLSMSK.[S]"	"1xBiotin [K2]; 1xOxidation [M16]"	"0.00375057"	"0.000586377"	"1"	"1"	"1"	"B9EJ86"	"B9EJ86 [77-94]"	"B9EJ86 1xBiotin [K78]"	"Oxysterol-binding protein-related protein 8 [OS=Mus musculus]"	"2"	"2210.99039"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"3"	"737.66796"	"0.0001108"	"0.0001498"	"2.80"	""
"11207"	"[R].KLDTTESVGIYQGFEK.[K]"	"1xBiotin [K1]"	"0.0996655"	"0.00519168"	"1"	"2"	"1"	"P28867-1"	"P28867-1 [301-316]"	"P28867-1 1xBiotin [K301]"	"protein kinase C delta type [OS=Mus musculus]"	"1"	"2040.99467"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"2"	"1021.00163"	"0.0009666"	"0.0191"	"1.64"	""
"11204"	"[R].KLDPGSEETQTLVR.[E]"	"1xBiotin [K1]"	"0.00326144"	"0.000586377"	"1"	"1"	"2"	"Q9D8N0"	"Q9D8N0 [401-414]"	"Q9D8N0 1xBiotin [K401]"	"elongation factor 1-gamma [OS=Mus musculus]"	"1"	"1798.90037"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"2"	"899.95346"	"0.0001108"	"0.0001219"	"2.90"	""
"11200"	"[R].KLDELYGTWR.[K]"	"1xBiotin [K1]"	"0.0330195"	"0.00104877"	"1"	"1"	"1"	"Q9D8E6"	"Q9D8E6 [259-268]"	"Q9D8E6 1xBiotin [K259]"	"60S ribosomal protein L4 [OS=Mus musculus]"	"1"	"1506.74096"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"2"	"753.87442"	"0.0001873"	"0.003656"	"1.93"	""
"11137"	"[R].KKPAGPSVSELIVQAVSSSK.[E]"	"1xBiotin [K1]"	"0.00154719"	"0.000586377"	"1"	"1"	"2"	"P43275"	"P43275 [35-54]"	"P43275 1xBiotin [K35]"	"Histone H1.1 [OS=Mus musculus]"	"1"	"2238.21623"	""	"9.97"	""	""	""	""	"-9.97"	""	""	"600.0"	""	""	""	""	""	"7371.40673828125"	""	""	""	""	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"746.74437"	"0.0001108"	"4.117E-05"	"4.70"	"52.66"
"11098"	"[K].KKELEEIVQPIISK.[L]"	"1xBiotin [K1]"	"0.0934018"	"0.00379267"	"1"	"1"	"1"	"P20029"	"P20029 [621-634]"	"P20029 1xBiotin [K621]"	"78 kDa glucose-regulated protein [OS=Mus musculus]"	"2"	"1880.05615"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"3"	"627.35710"	"0.0008081"	"0.01736"	"2.51"	""
"8427"	"[R].GKEDISQNKDDSSLSMSK.[S]"	"1xBiotin [K2]"	"0.0245183"	"0.00104877"	"1"	"1"	"1"	"B9EJ86"	"B9EJ86 [77-94]"	"B9EJ86 1xBiotin [K78]"	"Oxysterol-binding protein-related protein 8 [OS=Mus musculus]"	"2"	"2194.99547"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"3"	"732.33523"	"0.0001873"	"0.002359"	"2.72"	""
"11404"	"[K].KISLPGQMTGTPITPLK.[D]"	"1xBiotin [K1]; 1xOxidation [M8]"	"0.0519593"	"0.00154748"	"1"	"2"	"3"	"Q99JX3"	"Q99JX3 [212-228]"	"Q99JX3 1xBiotin [K212]"	"Golgi reassembly-stacking protein 2 [OS=Mus musculus]"	"1"	"2024.09188"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"2"	"1012.54918"	"0.0002716"	"0.00716"	"2.22"	""
"10707"	"[K].KEGSDGTLATSK.[T]"	"1xBiotin [K1]"	"0.00136895"	"0.000586377"	"1"	"1"	"4"	"Q9DBG7"	"Q9DBG7 [174-185]"	"Q9DBG7 1xBiotin [K174]"	"signal recognition particle receptor subunit alpha [OS=Mus musculus]"	"1"	"1419.67842"	""	"9.97"	""	"9.97"	"9.97"	"9.97"	"-0.08"	""	""	"183.1"	""	"243.3"	"173.6"	""	""	"5362.95068359375"	""	"7125.49609375"	"5083.6650390625"	""	"Not Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"2"	"710.34260"	"0.0001108"	"3.433E-05"	"2.02"	"24.44"
"10691"	"[K].KEELTLEGIR.[Q]"	"1xBiotin [K1]"	"0.00984384"	"0.000586377"	"1"	"1"	"2"	"P60843"	"P60843 [238-247]"	"P60843 1xBiotin [K238]"	"Eukaryotic initiation factor 4A-I [OS=Mus musculus]"	"1"	"1413.74063"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"0.09"	"0.13"	""	"123.8"	"120.0"	"102.2"	"122.4"	"131.6"	""	"8727.4267578125"	"8459.7138671875"	"7201.5478515625"	"8625.7470703125"	"9273.90234375"	""	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"2"	"707.37321"	"0.0001108"	"0.0006146"	"2.16"	"43.97"
"9263"	"[K].GSSQLDVNEEVEALIVKSPHK.[D]"	"1xBiotin [K17]"	"0.000102218"	"0.000586377"	"1"	"1"	"2"	"O35379"	"O35379 [288-308]"	"O35379 1xBiotin [K304]"	"Multidrug resistance-associated protein 1 [OS=Mus musculus]"	"1"	"2505.26536"	""	"9.97"	""	""	"9.97"	"9.97"	"1.18"	""	""	"184.1"	""	""	"415.9"	""	""	"22184.916015625"	""	""	"50125.265625"	""	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Peak Found"	"High"	"3"	"835.75945"	"0.0001108"	"7.78E-07"	"5.04"	"53.19"
"9286"	"[R].GSYNIKSR.[F]"	"1xBiotin [K6]"	"0.0954486"	"0.00379267"	"1"	"1"	"1"	"Q99PT1"	"Q99PT1 [173-180]"	"Q99PT1 1xBiotin [K178]"	"rho GDP-dissociation inhibitor 1 [OS=Mus musculus]"	"1"	"1150.56735"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"2"	"575.78751"	"0.0008081"	"0.01797"	"1.50"	""
"10285"	"[R].HYCGKCCLTYCFNKPEDK.[-]"	"1xBiotin [K5]; 4xCarbamidomethyl [C3; C6; C7; C11]"	"0.1287"	"0.00949852"	"1"	"1"	"1"	"P62983"	"P62983 [139-156]"	"P62983 1xBiotin [K143]"	"Ubiquitin-40S ribosomal protein S27a [OS=Mus musculus]"	"1"	"2606.07534"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"3"	"869.36252"	"0.001921"	"0.0283"	"1.68"	""
"10262"	"[K].HVNKDLGNMEENKK.[L]"	"1xBiotin [K4]"	"0.116407"	"0.00731053"	"1"	"1"	"1"	"Q61490"	"Q61490 [560-573]"	"Q61490 1xBiotin [K563]"	"CD166 antigen [OS=Mus musculus]"	"2"	"1881.89458"	"9.97"	"9.97"	""	"9.97"	"9.97"	"-0.46"	"0.52"	""	"165.6"	"84.0"	""	"229.6"	"120.7"	""	"8154.796875"	"4139.5419921875"	""	"11310.9541015625"	"5946.95068359375"	""	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"High"	"3"	"627.96957"	"0.001478"	"0.02435"	"2.41"	"27.69"
"10127"	"[K].HSLFDSCKMSR.[G]"	"1xBiotin [K8]; 1xCarbamidomethyl [C7]"	"0.0299637"	"0.00104877"	"1"	"1"	"1"	"Q91W98"	"Q91W98 [294-304]"	"Q91W98 1xBiotin [K301]"	"Solute carrier family 15 member 4 [OS=Mus musculus]"	"1"	"1593.69706"	"9.97"	"9.97"	"9.97"	""	""	"-9.97"	"-9.97"	""	"178.2"	"269.3"	"152.5"	""	""	""	"16303.34375"	"24639.39453125"	"13956.220703125"	""	""	""	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"3"	"531.90369"	"0.0001873"	"0.003173"	"1.86"	"37.95"
"10118"	"[K].HSKGGDMSEEKPVDPAPTTVPDGENKK.[D]"	"1xBiotin [K3]"	"0.0823954"	"0.00241047"	"1"	"1"	"1"	"Q9D710"	"Q9D710 [267-293]"	"Q9D710 1xBiotin [K269]"	"Thioredoxin-related transmembrane protein 2 [OS=Mus musculus]"	"2"	"3076.43502"	"9.97"	""	"9.97"	"9.97"	""	"-9.97"	""	""	"123.2"	""	"102.6"	"374.2"	""	""	"5704.46044921875"	""	"4750.5869140625"	"17328.556640625"	""	""	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Not Found"	"High"	"4"	"769.86384"	"0.000415"	"0.01434"	"2.60"	"28.20"
"9261"	"[K].GSSNSYAIKK.[K]"	"1xBiotin [K9]"	"0.0194788"	"0.000586377"	"1"	"1"	"3"	"P97461"	"P97461 [183-192]"	"P97461 1xBiotin [K191]"	"40S ribosomal protein S5 [OS=Mus musculus]"	"1"	"1280.63035"	"9.97"	""	"9.97"	"9.97"	""	"-9.97"	""	""	"230.5"	""	"169.6"	"199.8"	""	""	"9073.509765625"	""	"6674.92724609375"	"7865.32568359375"	""	""	"Not Found"	"High"	"Not Found"	"High"	"High"	"Not Found"	"High"	"2"	"640.81885"	"0.0001108"	"0.001667"	"2.21"	"29.35"
"9338"	"[R].GTKSLMDEVVK.[A]"	"1xBiotin [K3]"	"0.0594396"	"0.0019826"	"1"	"1"	"1"	"P09411"	"P09411 [351-361]"	"P09411 1xBiotin [K353]"	"phosphoglycerate kinase 1 [OS=Mus musculus]"	"1"	"1432.71745"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"2"	"716.86198"	"0.0003442"	"0.008765"	"2.08"	""
"10040"	"[R].HQGVMVGMGQKDSYVGDEAQSK.[R]"	"1xBiotin [K11]"	"0.000838928"	"0.000586377"	"1"	"6"	"1"	"P60710"	"P60710 [40-61]"	"P60710 1xBiotin [K50]"	"Actin, cytoplasmic 1 [OS=Mus musculus]"	"1"	"2577.15305"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"3"	"859.72230"	"0.0001108"	"1.683E-05"	"3.53"	""
"9446"	"[K].GVIVHTMAAVQALGVKANVEK.[K]"	"1xBiotin [K]"	"0.0129255"	"0.000586377"	"1"	"1"	"2"	"Q9CZW4"	"Q9CZW4 [250-270]"	"Q9CZW4 1xBiotin [K]"	"long-chain-fatty-acid--CoA ligase 3 [OS=Mus musculus]"	"1"	"2361.27812"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"787.76595"	"0.0001108"	"0.0009154"	"3.90"	""
"9935"	"[R].HLSKMQQNGYENPTYK.[F]"	"1xBiotin [K4]"	"0.00166897"	"0.000586377"	"1"	"3"	"3"	"P12023"	"P12023 [748-763]"	"P12023 1xBiotin [K751]"	"Amyloid-beta A4 protein [OS=Mus musculus]"	"1"	"2163.99502"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"-0.37"	"0.16"	""	"137.4"	"95.4"	"91.0"	"169.5"	"106.6"	""	"21576.2421875"	"14973.9990234375"	"14293.5107421875"	"26612.42578125"	"16742.0546875"	""	"Not Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"3"	"722.00307"	"0.0001108"	"4.586E-05"	"3.97"	"31.95"
"9494"	"[R].GVVGGVTGIITKPVEGAK.[K]"	"1xBiotin [K12]"	"0.00152037"	"0.000586377"	"1"	"3"	"4"	"Q8BX70-1"	"Q8BX70-1 [3522-3539]"	"Q8BX70-1 1xBiotin [K3533]"	"Vacuolar protein sorting-associated protein 13C [OS=Mus musculus]"	"0"	"1908.06229"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"2"	"954.53491"	"0.0001108"	"3.999E-05"	"3.91"	""
"9919"	"[R].HLNKMQNHGYENPTYK.[Y]"	"1xBiotin [K4]"	"0.00056106"	"0.000586377"	"1"	"2"	"3"	"Q06335"	"Q06335 [685-700]"	"Q06335 1xBiotin [K688]"	"Amyloid-like protein 2 [OS=Mus musculus]"	"1"	"2200.00625"	"9.97"	"9.97"	"9.97"	"9.97"	""	"-9.97"	"-9.97"	""	"181.2"	"162.2"	"93.7"	"163.0"	""	""	"12518.6533203125"	"11203.267578125"	"6474.1025390625"	"11258.4189453125"	""	""	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"3"	"734.00729"	"0.0001108"	"9.34E-06"	"4.52"	"28.72"
"9586"	"[K].HALKGAGTDEK.[V]"	"1xBiotin [K4]"	"0.118904"	"0.00731053"	"1"	"1"	"3"	"P48036"	"P48036 [96-106]"	"P48036 1xBiotin [K99]"	"annexin A5 [OS=Mus musculus]"	"1"	"1352.66271"	""	""	"9.97"	"9.97"	""	""	""	""	""	""	"277.7"	"322.3"	""	""	""	""	"5737.7548828125"	"6659.53076171875"	""	""	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"2"	"676.83478"	"0.001478"	"0.02514"	"2.50"	"21.08"
"9354"	"[K].GTLVQTKGTGAAGSFK.[L]"	"1xBiotin [K7]"	"0.0438712"	"0.00104877"	"1"	"1"	"3"	"P43275"	"P43275 [93-108]"	"P43275 1xBiotin [K99]"	"Histone H1.1 [OS=Mus musculus]"	"1"	"1748.89998"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"2"	"874.95317"	"0.0001873"	"0.005554"	"2.81"	""
"8812"	"[K].GMLQAEKLTSSSEK.[A]"	"1xBiotin [K7]"	"0.000297154"	"0.000586377"	"1"	"1"	"1"	"Q9CQ56"	"Q9CQ56 [81-94]"	"Q9CQ56 1xBiotin [K87]"	"Vesicle transport protein USE1 [OS=Mus musculus]"	"1"	"1734.84008"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"2"	"867.92410"	"0.0001108"	"3.686E-06"	"3.37"	""
"10319"	"[K].KAAVAK.[A]"	"1xBiotin [K1]"	"0.128026"	"0.00949852"	"1"	"1"	"3"	"Q9CR57"	"Q9CR57 [142-147]"	"Q9CR57 1xBiotin [K142]"	"60S ribosomal protein L14 [OS=Mus musculus]"	"1"	"813.46512"	"9.97"	""	"9.97"	"9.97"	"9.97"	"-0.14"	"9.97"	""	"160.7"	""	"134.6"	"159.3"	"145.5"	""	"7632.29443359375"	""	"6393.0302734375"	"7564.56982421875"	"6910.32275390625"	""	"Not Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"2"	"407.23632"	"0.001921"	"0.02814"	"1.66"	"18.72"
"10335"	"[R].KAEAMLGPSLSPGQDSEGDSSYKNIHLEK.[K]"	"1xBiotin [K23]"	"0.00267554"	"0.000586377"	"1"	"1"	"2"	"P09581"	"P09581 [676-704]"	"P09581 1xBiotin [K698]"	"Macrophage colony-stimulating factor 1 receptor [OS=Mus musculus]"	"2"	"3314.56677"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"4"	"829.39730"	"0.0001108"	"9.149E-05"	"3.34"	""
"8848"	"[R].GNFGGSFAGSFGGAGGHAPGVAR.[K]"	""	"0.000232604"	"0.000586377"	"1"	"2"	"2"	"Q9D0E1"	"Q9D0E1 [627-649]"	""	"Heterogeneous nuclear ribonucleoprotein M [OS=Mus musculus]"	"0"	"2034.95290"	""	"9.97"	"9.97"	"9.97"	""	""	"-9.97"	""	""	"142.9"	"297.0"	"160.1"	""	""	""	"5487.30078125"	"11401.7353515625"	"6145.31396484375"	""	""	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"Not Found"	"High"	"3"	"678.98903"	"0.0001108"	"2.578E-06"	"4.01"	"37.59"
"10651"	"[R].KEAESSPFVER.[L]"	"1xBiotin [K1]"	"0.0236878"	"0.00104877"	"1"	"1"	"2"	"P08113"	"P08113 [547-557]"	"P08113 1xBiotin [K547]"	"Endoplasmin [OS=Mus musculus]"	"1"	"1504.71005"	"9.97"	""	"9.97"	"9.97"	"9.97"	"0.20"	"9.97"	""	"134.4"	""	"145.4"	"166.1"	"154.2"	""	"8297.0869140625"	""	"8976.0341796875"	"10256.7861328125"	"9519.2236328125"	""	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"2"	"752.85811"	"0.0001873"	"0.00224"	"2.02"	"34.46"
"10624"	"[R].KDSVLK.[R]"	"1xBiotin [K1]"	"0.111552"	"0.00731053"	"1"	"1"	"1"	"Q921G6"	"Q921G6 [430-435]"	"Q921G6 1xBiotin [K430]"	"Leucine-rich repeat and calponin homology domain-containing protein 4 [OS=Mus musculus]"	"1"	"915.49681"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"-0.29"	"0.12"	""	"127.5"	"95.7"	"128.5"	"144.1"	"104.2"	""	"21322.2734375"	"16000.970703125"	"21485.6640625"	"24095.984375"	"17420.103515625"	""	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"2"	"458.25177"	"0.001478"	"0.02275"	"1.94"	"29.41"
"8900"	"[R].GPAGSIEQGPYDKMHASK.[R]"	"1xBiotin [K13]"	"0.00459798"	"0.000586377"	"1"	"1"	"1"	"Q99LI2"	"Q99LI2 [402-419]"	"Q99LI2 1xBiotin [K414]"	"chloride channel CLIC-like protein 1 [OS=Mus musculus]"	"1"	"2098.96847"	""	""	""	"9.97"	""	""	""	""	""	""	""	"600.0"	""	""	""	""	""	"11304.333984375"	""	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"2"	"1049.98803"	"0.0001108"	"0.0002009"	"2.76"	"35.63"
"10556"	"[R].KDFLAMFSPK.[C]"	"1xBiotin [K1]"	"0.000791416"	"0.000586377"	"1"	"1"	"3"	"Q99N69"	"Q99N69 [260-269]"	"Q99N69 1xBiotin [K260]"	"Leupaxin [OS=Mus musculus]"	"1"	"1409.69559"	"9.97"	"9.97"	"9.97"	""	""	"-9.97"	"-9.97"	""	"276.3"	"198.7"	"124.9"	""	""	""	"7696.2685546875"	"5535.7294921875"	"3479.83325195313"	""	""	""	"Not Found"	"High"	"High"	"Peak Found"	"Not Found"	"High"	"High"	"2"	"705.35128"	"0.0001108"	"1.535E-05"	"2.72"	"57.52"
"9008"	"[K].GPSSVEDIKAK.[M]"	"1xBiotin [K9]"	"0.00570217"	"0.000586377"	"1"	"1"	"4"	"Q61937"	"Q61937 [238-248]"	"Q61937 1xBiotin [K246]"	"Nucleophosmin [OS=Mus musculus]"	"1"	"1356.68278"	""	""	""	"9.97"	""	""	""	""	""	""	""	"600.0"	""	""	""	""	""	"12827.80078125"	""	""	"Not Found"	"High"	"High"	"High"	"High"	"Not Found"	"High"	"2"	"678.84487"	"0.0001108"	"0.0002751"	"2.71"	"33.26"
"10322"	"[K].KAAVPTPAK.[K]"	"1xBiotin [K1]"	"0.0099011"	"0.000586377"	"1"	"1"	"2"	"P09405"	"P09405 [71-79]"	"P09405 1xBiotin [K71]"	"Nucleolin [OS=Mus musculus]"	"1"	"1108.61833"	"9.97"	""	""	"9.97"	"9.97"	"-0.42"	"9.97"	""	"204.0"	""	""	"243.6"	"152.3"	""	"20149.3125"	""	""	"24057.841796875"	"15043.68359375"	""	"Not Found"	"High"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"2"	"554.81278"	"0.0001108"	"0.0006209"	"2.61"	"27.40"
"10481"	"[K].KATGAATPKK.[AT]"	"1xBiotin [K]"	"0.0628496"	"0.0019826"	"2"	"2"	"4"	"P15864; P43277"	"P15864 [140-149]; P43277 [141-150]"	"P15864 1xBiotin [K]; P43277 1xBiotin [K]"	"Histone H1.2 [OS=Mus musculus];Histone H1.3 [OS=Mus musculus]"	"2"	"1198.66125"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"-0.32"	"-0.68"	""	"110.5"	"141.9"	"105.2"	"154.0"	"88.3"	""	"4679.48681640625"	"6009.80126953125"	"4455.7578125"	"6518.9384765625"	"3740.43188476563"	"NotUnique"	"Not Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"2"	"599.83450"	"0.0003442"	"0.009548"	"1.93"	"15.43"
"10475"	"[K].KASSEGGAATGAGLDSLHK.[N]"	"1xBiotin [K1]"	"0.0165737"	"0.000586377"	"1"	"1"	"1"	"Q9WV32"	"Q9WV32 [308-326]"	"Q9WV32 1xBiotin [K308]"	"Actin-related protein 2/3 complex subunit 1B [OS=Mus musculus]"	"1"	"1982.96001"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"3"	"661.65835"	"0.0001108"	"0.001321"	"1.84"	""
"10440"	"[K].KAPGFGGFGSSAVSGGSTAAMITETIIETDKPK.[V]"	"1xBiotin [K1]; 1xOxidation [M21]"	"0.0149367"	"0.000586377"	"1"	"1"	"1"	"Q5XJY5"	"Q5XJY5 [179-211]"	"Q5XJY5 1xBiotin [K179]"	"Coatomer subunit delta [OS=Mus musculus]"	"1"	"3454.68688"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"3"	"1152.23607"	"0.0001108"	"0.001135"	"2.79"	""
"9166"	"[K].GSAPGETEISMPPKASVK.[L]"	"1xBiotin [K14]"	"0.0405258"	"0.00104877"	"1"	"1"	"1"	"Q60664"	"Q60664 [160-177]"	"Q60664 1xBiotin [K173]"	"Lymphoid-restricted membrane protein [OS=Mus musculus]"	"1"	"2011.98272"	""	""	""	"9.97"	""	""	""	""	""	""	""	"600.0"	""	""	""	""	""	"12142.62109375"	""	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"2"	"1006.49485"	"0.0001873"	"0.004948"	"2.27"	"39.91"
"9167"	"[K].GSAPGETEISMPPKASVK.[L]"	"1xBiotin [K14]; 1xOxidation [M11]"	"0.00912871"	"0.000586377"	"1"	"1"	"4"	"Q60664"	"Q60664 [160-177]"	"Q60664 1xBiotin [K173]"	"Lymphoid-restricted membrane protein [OS=Mus musculus]"	"1"	"2027.97764"	""	"9.97"	""	""	""	""	"-9.97"	""	""	"600.0"	""	""	""	""	""	"9724.9677734375"	""	""	""	""	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"2"	"1014.49124"	"0.0001108"	"0.0005512"	"2.39"	"33.99"
"10375"	"[R].KAGNFYVPAEPK.[L]"	"1xBiotin [K1]"	"0.000605241"	"0.000586377"	"1"	"1"	"1"	"P14148"	"P14148 [99-110]"	"P14148 1xBiotin [K99]"	"60S ribosomal protein L7 [OS=Mus musculus]"	"1"	"1546.77226"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"773.88968"	"0.0001108"	"1.04E-05"	"2.26"	""
"9208"	"[K].GSKFYGPAGPYGIFAGR.[D]"	"1xBiotin [K3]"	"6.11867E-05"	"0.000586377"	"1"	"1"	"1"	"Q80UU9"	"Q80UU9 [127-143]"	"Q80UU9 1xBiotin [K129]"	"Membrane-associated progesterone receptor component 2 [OS=Mus musculus]"	"1"	"1970.95816"	"9.97"	"9.97"	""	""	"9.97"	"0.97"	"1.67"	""	"167.5"	"103.5"	""	""	"329.0"	""	"22972.3359375"	"14189.7666015625"	""	""	"45123.08984375"	""	"Not Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"2"	"985.98254"	"0.0001108"	"3.677E-07"	"3.10"	"53.22"
"9068"	"[K].GQPLCVLSAMKMETVVTSPMEGTIR.[K]"	"1xBiotin [K11]; 1xCarbamidomethyl [C5]"	"0.0194788"	"0.000586377"	"1"	"1"	"2"	"Q05920"	"Q05920 [1134-1158]"	"Q05920 1xBiotin [K1144]"	"pyruvate carboxylase, mitochondrial [OS=Mus musculus]"	"1"	"2961.43747"	"9.97"	""	""	""	"9.97"	"-0.50"	"9.97"	""	"351.7"	""	""	""	"248.3"	""	"6305.54638671875"	""	""	""	"4451.94580078125"	""	"Not Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"987.81691"	"0.0001108"	"0.001667"	"3.09"	"62.26"
"11421"	"[K].KISSVQSIVPALEIANAHR.[K]"	"1xBiotin [K1]"	"0.00651797"	"0.000586377"	"1"	"1"	"1"	"P63038-1"	"P63038-1 [250-268]"	"P63038-1 1xBiotin [K250]"	"60 kDa heat shock protein, mitochondrial [OS=Mus musculus]"	"1"	"2259.22780"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"3"	"753.74775"	"0.0001108"	"0.0003357"	"3.32"	""
"11546"	"[R].KNAKGGGGNSSSSGSGSGSGSGSPSTGSSGSSSSPGAR.[R]"	"1xBiotin [K]"	"0.000107726"	"0.000586377"	"1"	"1"	"5"	"Q8BSY0"	"Q8BSY0 [5-42]"	"Q8BSY0 1xBiotin [K]"	"Aspartyl/Asparaginyl beta-hydroxylase [OS=Mus musculus]"	"2"	"3399.46978"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"0.12"	"-0.06"	""	"102.5"	"116.2"	"93.5"	"176.2"	"111.7"	""	"15887.3349609375"	"18010.560546875"	"14486.4033203125"	"27303.46875"	"17305.671875"	""	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"1133.82890"	"0.0001108"	"8.419E-07"	"4.38"	"16.81"
"11625"	"[R].KNPGVGNGDDEAAELMQQVK.[V]"	"1xBiotin [K1]"	"0.0376414"	"0.00104877"	"1"	"1"	"1"	"Q61166"	"Q61166 [182-201]"	"Q61166 1xBiotin [K182]"	"Microtubule-associated protein RP/EB family member 1 [OS=Mus musculus]"	"1"	"2326.08021"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"3"	"776.03131"	"0.0001873"	"0.004443"	"2.73"	""
"12928"	"[K].IDLKFIDTTSK.[F]"	"1xBiotin [K4]"	"0.00831909"	"0.000586377"	"1"	"1"	"2"	"P27659"	"P27659 [363-373]"	"P27659 1xBiotin [K366]"	"60S ribosomal protein L3 [OS=Mus musculus]"	"1"	"1506.78724"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"High"	"2"	"753.89745"	"0.0001108"	"0.000479"	"1.81"	""
"12825"	"[R].LCASCWIYWK.[K]"	"2xCarbamidomethyl [C2; C5]"	"0.0274984"	"0.00104877"	"1"	"1"	"1"	"Q9R190"	"Q9R190 [390-399]"	""	"Metastasis-associated protein MTA2 [OS=Mus musculus]"	"0"	"1386.63333"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"693.82011"	"0.0001873"	"0.002774"	"1.19"	""
"7441"	"[R].FQNVAKEGVK.[F]"	"1xBiotin [K6]"	"0.0474823"	"0.00154748"	"1"	"1"	"2"	"P08113"	"P08113 [588-597]"	"P08113 1xBiotin [K593]"	"Endoplasmin [OS=Mus musculus]"	"1"	"1345.69328"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"2"	"673.34979"	"0.0002716"	"0.006275"	"2.68"	""
"12822"	"[K].LCAPPMNTQTSLLSSEKSLALLTVEK.[T]"	"1xBiotin [K17]; 1xCarbamidomethyl [C2]; 1xOxidation [M6]"	"0.0149367"	"0.000586377"	"1"	"2"	"1"	"Q3UJD6"	"Q3UJD6 [247-272]"	"Q3UJD6 1xBiotin [K263]"	"Ubiquitin carboxyl-terminal hydrolase 19 [OS=Mus musculus]"	"1"	"3073.56181"	""	""	""	""	"9.97"	"9.97"	"9.97"	""	""	""	""	""	"600.0"	""	""	""	""	""	"8960.798828125"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"3"	"1025.19301"	"0.0001108"	"0.001128"	"2.93"	"58.91"
"12745"	"[K].LAQSNGWGVMVSHR.[S]"	"1xOxidation [M10]"	"0.00428784"	"0.000586377"	"1"	"2"	"1"	"P17182"	"P17182 [359-372]"	""	"alpha-enolase [OS=Mus musculus]"	"0"	"1557.75907"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"2"	"779.38313"	"0.0001108"	"0.0001826"	"2.04"	""
"7482"	"[R].FSGTYTCMNTFKGR.[T]"	"1xBiotin [K12]; 1xCarbamidomethyl [C7]"	"0.000587851"	"0.000586377"	"1"	"2"	"2"	"O88876-2"	"O88876-2 [222-235]"	"O88876-2 1xBiotin [K233]"	"Isoform 2 of Short-chain dehydrogenase/reductase 3 [OS=Mus musculus]"	"1"	"1895.82372"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"2"	"948.41628"	"0.0001108"	"9.998E-06"	"3.07"	""
"12952"	"[K].LDMSDLKAEK.[L]"	"1xBiotin [K7]"	"0.0382889"	"0.00104877"	"2"	"3"	"1"	"P13011; P13516"	"P13011 [199-208]; P13516 [196-205]"	"P13011 1xBiotin [K205]; P13516 1xBiotin [K202]"	"Acyl-CoA desaturase 2 [OS=Mus musculus];Acyl-CoA desaturase 1 [OS=Mus musculus]"	"1"	"1375.65960"	""	""	""	"9.97"	""	""	""	""	""	""	""	"600.0"	""	""	""	""	""	"6056.99072265625"	""	"NotUnique"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"2"	"688.33409"	"0.0001873"	"0.00454"	"2.60"	"42.27"
"12641"	"[R].LAKADGIVSK.[N]"	"1xBiotin [K3]"	"0.00961806"	"0.000586377"	"1"	"1"	"2"	"Q9CQR2"	"Q9CQR2 [72-81]"	"Q9CQR2 1xBiotin [K74]"	"40S ribosomal protein S21 [OS=Mus musculus]"	"1"	"1227.67657"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"2"	"614.34158"	"0.0001108"	"0.0005945"	"2.22"	""
"12608"	"[R].LAGKGTAEPHSASDAGMKR.[A]"	"1xBiotin [K4]"	"0.0372158"	"0.00104877"	"1"	"1"	"1"	"Q99LR1"	"Q99LR1 [42-60]"	"Q99LR1 1xBiotin [K45]"	"Monoacylglycerol lipase ABHD12 [OS=Mus musculus]"	"2"	"2110.01682"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"3"	"704.00928"	"0.0001873"	"0.004355"	"1.39"	""
"12593"	"[K].LAETLAKTQVAGGQLSFK.[G]"	"1xBiotin [K7]"	"0.013775"	"0.000586377"	"1"	"1"	"2"	"P46061"	"P46061 [9-26]"	"P46061 1xBiotin [K15]"	"Ran GTPase-activating protein 1 [OS=Mus musculus]"	"1"	"2088.11579"	"9.97"	"9.97"	"9.97"	""	"9.97"	"-0.10"	"0.33"	""	"174.9"	"129.4"	"132.6"	""	"163.1"	""	"14998.3056640625"	"11103.2529296875"	"11373.3984375"	""	"13989.07421875"	""	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"2"	"1044.56149"	"0.0001108"	"0.001008"	"2.90"	"46.96"
"12560"	"[K].LADFGVAGQLTDTMAKR.[N]"	"1xBiotin [K16]; 1xOxidation [M14]"	"0.0625004"	"0.0019826"	"1"	"3"	"2"	"Q9JI11"	"Q9JI11 [165-181]"	"Q9JI11 1xBiotin [K180]"	"serine/threonine-protein kinase 4 [OS=Mus musculus]"	"1"	"2035.99396"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"2"	"1018.50060"	"0.0003442"	"0.009427"	"2.16"	""
"12559"	"[K].LADFGVAGQLTDTMAKR.[N]"	"1xBiotin [K16]"	"0.0549599"	"0.0019826"	"1"	"3"	"1"	"Q9JI11"	"Q9JI11 [165-181]"	"Q9JI11 1xBiotin [K180]"	"serine/threonine-protein kinase 4 [OS=Mus musculus]"	"1"	"2019.99904"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"1010.49734"	"0.0003442"	"0.007794"	"2.63"	""
"12520"	"[R].LAADVGKGSSQR.[E]"	"1xBiotin [K7]"	"0.022885"	"0.00104877"	"1"	"1"	"3"	"P48962"	"P48962 [141-152]"	"P48962 1xBiotin [K147]"	"ADP/ATP translocase 1 [OS=Mus musculus]"	"1"	"1414.71072"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"2"	"707.85869"	"0.0001873"	"0.002114"	"2.14"	""
"7539"	"[R].FTLWWSPTINR.[A]"	""	"0.0273413"	"0.00104877"	"1"	"1"	"1"	"Q99PV0"	"Q99PV0 [1534-1544]"	""	"Pre-mRNA-processing-splicing factor 8 [OS=Mus musculus]"	"0"	"1420.73720"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"710.87229"	"0.0001873"	"0.002755"	"2.06"	""
"12621"	"[R].IAGQVAAANKK.[H]"	"1xBiotin [K]"	"0.0282973"	"0.00104877"	"1"	"1"	"4"	"Q9CZX8"	"Q9CZX8 [134-144]"	"Q9CZX8 1xBiotin [K]"	"40S ribosomal protein S19 [OS=Mus musculus]"	"1"	"1296.70927"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"-0.60"	"-0.10"	""	"172.7"	"122.0"	"123.2"	"68.5"	"113.6"	""	"7614.1943359375"	"5378.3115234375"	"5431.9521484375"	"3019.55419921875"	"5008.36181640625"	""	"Not Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"2"	"648.85879"	"0.0001873"	"0.002914"	"2.26"	"26.19"
"12475"	"[R].KYEEVAR.[K]"	"1xBiotin [K1]"	"0.0516681"	"0.00154748"	"1"	"7"	"1"	"P21107-2"	"P21107-2 [125-131]"	"P21107-2 1xBiotin [K125]"	"Isoform 2 of Tropomyosin alpha-3 chain [OS=Mus musculus]"	"1"	"1120.54556"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"2"	"560.77626"	"0.0002716"	"0.007123"	"1.59"	""
"13016"	"[K].LDVQFSGLAKGDAVR.[D]"	"1xBiotin [K10]"	"0.000460163"	"0.000586377"	"1"	"1"	"4"	"Q8BTM8"	"Q8BTM8 [907-921]"	"Q8BTM8 1xBiotin [K916]"	"Filamin-A [OS=Mus musculus]"	"1"	"1801.92653"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"2"	"901.46769"	"0.0001108"	"7.013E-06"	"3.14"	""
"7368"	"[K].FNSKFITTVGIDFR.[E]"	"1xBiotin [K4]"	"0.0657102"	"0.0019826"	"1"	"1"	"1"	"Q9ERI2"	"Q9ERI2 [34-47]"	"Q9ERI2 1xBiotin [K37]"	"Ras-related protein Rab-27A [OS=Mus musculus]"	"1"	"1870.95202"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"2"	"935.97986"	"0.0003442"	"0.01015"	"1.56"	""
"13666"	"[K].IGVKGSFEELCK.[N]"	"1xBiotin [K4]; 1xCarbamidomethyl [C11]"	"0.0485655"	"0.00154748"	"1"	"1"	"1"	"Q8JZR0"	"Q8JZR0 [600-611]"	"Q8JZR0 1xBiotin [K603]"	"Long-chain-fatty-acid--CoA ligase 5 [OS=Mus musculus]"	"1"	"1592.78111"	"9.97"	""	""	""	""	"-9.97"	""	""	"600.0"	""	""	""	""	""	"11308.40625"	""	""	""	""	""	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"796.89298"	"0.0002716"	"0.006499"	"1.83"	"44.81"
"13593"	"[K].IGPLGLSPKK.[V]"	"1xBiotin [K10]"	"0.0320905"	"0.00104877"	"1"	"1"	"1"	"P35979"	"P35979 [32-41]"	"P35979 1xBiotin [K41]"	"60S ribosomal protein L12 [OS=Mus musculus]"	"1"	"1235.71804"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"618.36226"	"0.0001873"	"0.003507"	"1.99"	""
"7219"	"[R].FLFSLFGQK.[H]"	""	"0.108612"	"0.00731053"	"1"	"1"	"2"	"Q8R010"	"Q8R010 [216-224]"	""	"aminoacyl tRNA synthase complex-interacting multifunctional protein 2 [OS=Mus musculus]"	"0"	"1086.59824"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"-0.06"	"-0.53"	""	"137.7"	"190.2"	"117.6"	"22.4"	"132.1"	""	"11009.5712890625"	"15213.134765625"	"9401.810546875"	"1792.03051757813"	"10565.49609375"	""	"Not Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"2"	"543.80262"	"0.001426"	"0.02179"	"1.96"	"56.35"
"13545"	"[R].IGIFGQDEDVTSKAFTGR.[E]"	"1xBiotin [K13]"	"0.0129255"	"0.000586377"	"1"	"2"	"3"	"O55143-1"	"O55143-1 [638-655]"	"O55143-1 1xBiotin [K650]"	"Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 [OS=Mus musculus]"	"1"	"2167.04883"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"High"	"High"	"3"	"723.02065"	"0.0001108"	"0.0009128"	"3.81"	""
"7234"	"[R].FLKNIGWGTDQGIGGFGEEPGIK.[S]"	"1xBiotin [K3]"	"0.0126296"	"0.000586377"	"1"	"1"	"2"	"Q9CR20"	"Q9CR20 [27-49]"	"Q9CR20 1xBiotin [K29]"	"immediate early response 3-interacting protein 1 [OS=Mus musculus]"	"1"	"2646.30208"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"882.77316"	"0.0001108"	"0.0008878"	"3.14"	""
"13531"	"[K].LGKTIVITK.[T]"	"1xBiotin [K3]"	"0.0140162"	"0.000586377"	"1"	"1"	"1"	"Q9CPW7"	"Q9CPW7 [62-70]"	"Q9CPW7 1xBiotin [K64]"	"Zinc finger matrin-type protein 2 [OS=Mus musculus]"	"1"	"1198.72279"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"599.86549"	"0.0001108"	"0.001032"	"2.55"	""
"7372"	"[K].FNVWDTAGQEKFGGLR.[D]"	"1xBiotin [K11]"	"0.00633127"	"0.000586377"	"1"	"2"	"3"	"P62827"	"P62827 [61-76]"	"P62827 1xBiotin [K71]"	"GTP-binding nuclear protein RAN [OS=Mus musculus]"	"1"	"2050.98036"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"2"	"1025.99399"	"0.0001108"	"0.0003217"	"2.08"	""
"13438"	"[R].IGAEVYHNLKNVIK.[E]"	"1xBiotin [K10]"	"0.00184278"	"0.000586377"	"1"	"1"	"2"	"P17182"	"P17182 [184-197]"	"P17182 1xBiotin [K193]"	"alpha-enolase [OS=Mus musculus]"	"1"	"1823.98365"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"3"	"608.66610"	"0.0001108"	"5.312E-05"	"3.68"	""
"7300"	"[K].FIVKGMVER.[F]"	"1xBiotin [K4]"	"0.0188167"	"0.000586377"	"1"	"1"	"2"	"Q9CY18"	"Q9CY18 [100-108]"	"Q9CY18 1xBiotin [K103]"	"sorting nexin-7 [OS=Mus musculus]"	"1"	"1304.68536"	""	""	""	"9.97"	""	""	""	""	""	""	""	"600.0"	""	""	""	""	""	"17299.220703125"	""	""	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"2"	"652.84627"	"0.0001108"	"0.001595"	"2.02"	"43.17"
"13351"	"[K].LFCEDKSSHLVFINSR.[E]"	"1xBiotin [K6]; 1xCarbamidomethyl [C3]"	"8.38336E-05"	"0.000586377"	"1"	"1"	"3"	"Q8K4Q8"	"Q8K4Q8 [633-648]"	"Q8K4Q8 1xBiotin [K638]"	"Collectin-12 [OS=Mus musculus]"	"1"	"2178.04706"	""	"9.97"	""	""	""	""	"-9.97"	""	""	"600.0"	""	""	""	""	""	"19096.52734375"	""	""	""	""	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"726.68749"	"0.0001108"	"5.822E-07"	"4.23"	"46.30"
"13251"	"[K].LEPSNKTIHAELSK.[L]"	"1xBiotin [K6]"	"0.00984384"	"0.000586377"	"1"	"2"	"2"	"O35465-1"	"O35465-1 [325-338]"	"O35465-1 1xBiotin [K330]"	"peptidyl-prolyl cis-trans isomerase FKBP8 [OS=Mus musculus]"	"1"	"1792.92619"	""	""	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	""	""	""	"196.3"	"263.7"	"140.0"	""	""	""	"9066.515625"	"12177.1513671875"	"6467.25927734375"	""	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"3"	"598.31353"	"0.0001108"	"0.0006129"	"3.02"	"33.61"
"13187"	"[R].IEIETLQKQK.[K]"	"1xBiotin [K]"	"0.0131519"	"0.000586377"	"1"	"1"	"3"	"Q61712"	"Q61712 [263-272]"	"Q61712 1xBiotin [K]"	"DnaJ homolog subfamily C member 1 [OS=Mus musculus]"	"1"	"1455.78758"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"High"	"2"	"728.39788"	"0.0001108"	"0.0009409"	"3.17"	""
"13169"	"[R].LEKPAKYDDIKK.[V]"	"1xBiotin [K6]"	"0.00300609"	"0.000586377"	"1"	"1"	"2"	"P16858"	"P16858 [247-258]"	"P16858 1xBiotin [K252]"	"glyceraldehyde-3-phosphate dehydrogenase [OS=Mus musculus]"	"2"	"1673.89310"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"0.29"	"0.08"	""	"100.4"	"115.5"	"126.1"	"135.6"	"122.4"	""	"11705.501953125"	"13469.2861328125"	"14707.1591796875"	"15816.548828125"	"14278.2978515625"	""	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"3"	"558.63598"	"0.0001108"	"0.0001084"	"2.33"	"27.75"
"13118"	"[K].LEFAPKAVLNR.[N]"	"1xBiotin [K6]"	"0.032459"	"0.00104877"	"1"	"1"	"2"	"Q78RX3"	"Q78RX3 [76-86]"	"Q78RX3 1xBiotin [K81]"	"small integral membrane protein 12 [OS=Mus musculus]"	"1"	"1483.80898"	"9.97"	"9.97"	""	""	""	"-9.97"	"-9.97"	""	"353.7"	"246.3"	""	""	""	""	"10717.158203125"	"7461.97900390625"	""	""	""	""	"Not Found"	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"High"	"2"	"742.40780"	"0.0001873"	"0.003571"	"1.81"	"48.88"
"13398"	"[K].LFNLSKEDDVR.[Q]"	"1xBiotin [K6]"	"0.00360079"	"0.000586377"	"1"	"1"	"2"	"P62754"	"P62754 [144-154]"	"P62754 1xBiotin [K149]"	"40S RIBOSOMAL PROTEIN S6 [OS=Mus musculus]"	"1"	"1561.76790"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"-0.25"	"-0.24"	""	"130.9"	"129.8"	"142.2"	"86.9"	"110.2"	""	"20039.0859375"	"19876.56640625"	"21762.6015625"	"13310.91015625"	"16866.45703125"	""	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"2"	"781.38758"	"0.0001108"	"0.0001406"	"2.79"	"44.50"
"12474"	"[K].KYEDICPSTHNMDVPNIK.[R]"	"1xBiotin [K1]; 1xCarbamidomethyl [C6]; 1xOxidation [M12]"	"0.00209482"	"0.000586377"	"1"	"2"	"4"	"Q8BGY2"	"Q8BGY2 [68-85]"	"Q8BGY2 1xBiotin [K68]"	"Eukaryotic translation initiation factor 5A-2 [OS=Mus musculus]"	"1"	"2403.07776"	"9.97"	"9.97"	""	""	""	"-9.97"	"-9.97"	""	"296.7"	"303.3"	""	""	""	""	"16976.96484375"	"17357.83984375"	""	""	""	""	"Not Found"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"801.69788"	"0.0001108"	"6.364E-05"	"2.91"	"35.84"
"12470"	"[K].KYCQVIR.[I]"	"1xBiotin [K1]; 1xCarbamidomethyl [C3]"	"0.044622"	"0.00104877"	"1"	"1"	"3"	"P27659"	"P27659 [155-161]"	"P27659 1xBiotin [K155]"	"60S ribosomal protein L3 [OS=Mus musculus]"	"1"	"1192.59655"	"9.97"	"9.97"	""	"9.97"	""	"-9.97"	"-9.97"	""	"187.9"	"224.4"	""	"187.7"	""	""	"10478.443359375"	"12515.6630859375"	""	"10465.185546875"	""	""	"Not Found"	"High"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"2"	"596.80221"	"0.0001873"	"0.005687"	"2.16"	"31.55"
"12466"	"[K].KYAEAVGR.[A]"	"1xBiotin [K1]"	"0.0265689"	"0.00104877"	"1"	"1"	"3"	"P09411"	"P09411 [323-330]"	"P09411 1xBiotin [K323]"	"phosphoglycerate kinase 1 [OS=Mus musculus]"	"1"	"1119.56154"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"0.10"	"0.07"	""	"112.0"	"114.2"	"144.6"	"109.2"	"119.9"	""	"15074.828125"	"15370.34375"	"19462.35546875"	"14698.2158203125"	"16142.43359375"	""	"Not Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"2"	"560.28443"	"0.0001873"	"0.002638"	"1.56"	"27.51"
"12100"	"[K].KSLESINSR.[L]"	"1xBiotin [K1]"	"0.0303084"	"0.00104877"	"1"	"1"	"1"	"P62889"	"P62889 [9-17]"	"P62889 1xBiotin [K9]"	"60S ribosomal protein L30 [OS=Mus musculus]"	"1"	"1259.64125"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"-0.63"	"0.59"	""	"147.8"	"63.5"	"162.2"	"131.0"	"95.5"	""	"13146.35546875"	"5649.787109375"	"14426.3076171875"	"11652.3076171875"	"8490.58984375"	""	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"2"	"630.32402"	"0.0001873"	"0.003218"	"1.42"	"33.51"
"12056"	"[K].KSEIGIAMGSGTAVAK.[T]"	"1xBiotin [K1]"	"2.04237E-06"	"0.000586377"	"1"	"2"	"1"	"O55143-1"	"O55143-1 [712-727]"	"O55143-1 1xBiotin [K712]"	"Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 [OS=Mus musculus]"	"1"	"1745.89245"	""	"9.97"	""	"9.97"	"9.97"	"9.97"	"0.35"	""	""	"129.7"	""	"304.9"	"165.3"	""	""	"19856.0078125"	""	"46671.5546875"	"25301.326171875"	""	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"High"	"2"	"873.45006"	"0.0001108"	"2.563E-09"	"4.93"	"40.11"
"7999"	"[R].GEALSALDSKANNLSSLSKK.[Y]"	"1xBiotin [K10]"	"0.000285269"	"0.000586377"	"1"	"1"	"2"	"O08547"	"O08547 [160-179]"	"O08547 1xBiotin [K169]"	"Vesicle-trafficking protein SEC22b [OS=Mus musculus]"	"2"	"2259.16492"	"9.97"	"9.97"	""	""	"9.97"	"-0.74"	"0.10"	""	"278.0"	"155.3"	""	""	"166.8"	""	"13728.1298828125"	"7668.70947265625"	""	""	"8236.72265625"	""	"Not Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"3"	"753.72689"	"0.0001108"	"3.489E-06"	"3.17"	"47.40"
"12050"	"[R].KSDGIYIINLK.[R]"	"1xBiotin [K1]"	"0.0176601"	"0.000586377"	"1"	"1"	"2"	"P14206"	"P14206 [42-52]"	"P14206 1xBiotin [K42]"	"40S ribosomal protein SA [OS=Mus musculus]"	"1"	"1489.80831"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"2"	"745.40810"	"0.0001108"	"0.001454"	"2.24"	""
"8050"	"[R].GEKALSFSYR.[S]"	"1xBiotin [K3]"	"0.0104922"	"0.000586377"	"1"	"1"	"2"	"Q8BUE1"	"Q8BUE1 [720-729]"	"Q8BUE1 1xBiotin [K722]"	"Sodium/hydrogen exchanger 4 [OS=Mus musculus]"	"1"	"1383.67255"	"9.97"	""	"9.97"	"9.97"	""	"-9.97"	""	""	"225.5"	""	"202.0"	"172.5"	""	""	"16436.29296875"	""	"14721.6201171875"	"12570.767578125"	""	""	"Not Found"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"2"	"692.33994"	"0.0001108"	"0.0006731"	"1.74"	"41.88"
"11926"	"[K].KQMADTGK.[L]"	"1xBiotin [K1]"	"0.0303084"	"0.00104877"	"1"	"2"	"1"	"Q8VEK3"	"Q8VEK3 [520-527]"	"Q8VEK3 1xBiotin [K520]"	"Heterogeneous nuclear ribonucleoprotein U [OS=Mus musculus]"	"1"	"1104.51763"	"9.97"	"9.97"	""	"9.97"	"9.97"	"-1.04"	"-0.84"	""	"170.7"	"148.2"	""	"198.2"	"82.9"	""	"4891.22412109375"	"4246.88232421875"	""	"5677.37255859375"	"2374.51098632813"	""	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"High"	"2"	"552.76261"	"0.0001873"	"0.003223"	"1.82"	"22.07"
"7966"	"[K].GDSHLNVQVSNFKSGK.[G]"	"1xBiotin [K13]"	"0.00519549"	"0.000586377"	"1"	"1"	"1"	"Q80WJ7"	"Q80WJ7 [248-263]"	"Q80WJ7 1xBiotin [K260]"	"protein LYRIC [OS=Mus musculus]"	"1"	"1942.94397"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"2"	"971.97578"	"0.0001108"	"0.000241"	"2.61"	""
"11920"	"[K].KQIQFADDMQEFTK.[F]"	"1xBiotin [K1]; 1xOxidation [M9]"	"0.0409881"	"0.00104877"	"1"	"1"	"2"	"Q80SW1"	"Q80SW1 [40-53]"	"Q80SW1 1xBiotin [K40]"	"S-adenosylhomocysteine hydrolase-like protein 1 [OS=Mus musculus]"	"1"	"1970.89866"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"2"	"985.95238"	"0.0001873"	"0.005044"	"2.05"	""
"11841"	"[K].KPTGLNCNLHWR.[F]"	"1xBiotin [K1]; 1xCarbamidomethyl [C7]"	"0.000172766"	"0.000586377"	"1"	"1"	"3"	"Q8CFE2"	"Q8CFE2 [96-107]"	"Q8CFE2 1xBiotin [K96]"	"Histone PARylation factor 1 [OS=Mus musculus]"	"0"	"1721.83627"	""	"9.97"	""	"9.97"	"9.97"	"9.97"	"0.91"	""	""	"165.0"	""	"123.9"	"311.0"	""	""	"7436.4521484375"	""	"5584.212890625"	"14016.4208984375"	""	"Not Found"	"High"	"High"	"Not Found"	"Peak Found"	"High"	"High"	"3"	"574.61667"	"0.0001108"	"1.676E-06"	"3.37"	"38.31"
"11839"	"[R].KPTAPAKLVSFHDDSDEDLLHI.[-]"	"1xBiotin [K7]"	"0.0104922"	"0.000586377"	"1"	"1"	"2"	"Q07113"	"Q07113 [2462-2483]"	"Q07113 1xBiotin [K2468]"	"Cation-independent mannose-6-phosphate receptor [OS=Mus musculus]"	"1"	"2674.31813"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"892.11128"	"0.0001108"	"0.0006735"	"3.94"	""
"11746"	"[K].KPKAAIASTNK.[R]"	"1xBiotin [K1]"	"0.015917"	"0.000586377"	"1"	"1"	"1"	"Q9D8X0"	"Q9D8X0 [65-75]"	"Q9D8X0 1xBiotin [K65]"	"Protein MANBAL [OS=Mus musculus]"	"1"	"1354.75113"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"3"	"452.25500"	"0.0001108"	"0.001241"	"2.54"	""
"11721"	"[K].KPEVSGSDILDNNGTYGKIWEGSTR.[C]"	"1xBiotin [K18]"	"0.019933"	"0.000586377"	"1"	"1"	"1"	"P28867-1"	"P28867-1 [317-341]"	"P28867-1 1xBiotin [K334]"	"protein kinase C delta type [OS=Mus musculus]"	"1"	"2949.40471"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"3"	"983.80498"	"0.0001108"	"0.001729"	"3.13"	""
"8180"	"[K].GFKMEVGQYIFVK.[C]"	"1xBiotin [K3]"	"0.0698448"	"0.0019826"	"1"	"1"	"1"	"Q61093"	"Q61093 [316-328]"	"Q61093 1xBiotin [K318]"	"Cytochrome b-245 heavy chain [OS=Mus musculus]"	"1"	"1771.89100"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"886.44900"	"0.0003442"	"0.01118"	"1.85"	""
"11668"	"[K].KPAAINWIEGR.[G]"	"1xBiotin [K1]"	"0.00766951"	"0.000586377"	"1"	"1"	"1"	"Q01237"	"Q01237 [691-701]"	"Q01237 1xBiotin [K691]"	"3-hydroxy-3-methylglutaryl-coenzyme a reductase [OS=Mus musculus]"	"0"	"1480.77293"	"9.97"	"9.97"	""	""	""	"-9.97"	"-9.97"	""	"252.9"	"347.1"	""	""	""	""	"9052.8466796875"	"12424.22265625"	""	""	""	""	"Not Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"740.89009"	"0.0001108"	"0.0004254"	"2.32"	"47.88"
"11886"	"[R].KQEEELTKR.[M]"	"1xBiotin [K8]"	"0.017357"	"0.000586377"	"1"	"1"	"3"	"Q8VCH8"	"Q8VCH8 [240-248]"	"Q8VCH8 1xBiotin [K247]"	"UBX domain-containing protein 4 [OS=Mus musculus]"	"2"	"1386.70457"	"9.97"	""	"9.97"	"9.97"	"9.97"	"0.08"	"9.97"	""	"131.6"	""	"137.8"	"191.8"	"138.8"	""	"5184.18017578125"	""	"5428.46337890625"	"7554.294921875"	"5467.205078125"	""	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"2"	"693.85603"	"0.0001108"	"0.001412"	"2.13"	"24.31"
"12196"	"[R].KTDLSSHSQTSGILLSSMPSTSKMG.[-]"	"1xBiotin [K23]; 1xOxidation [M]"	"0.00663262"	"0.000586377"	"1"	"1"	"2"	"Q61549"	"Q61549 [907-931]"	"Q61549 1xBiotin [K929]"	"Adhesion G protein-coupled receptor E1 [OS=Mus musculus]"	"2"	"2822.33689"	"9.97"	""	""	""	""	"-9.97"	""	""	"600.0"	""	""	""	""	""	"31859.083984375"	""	""	""	""	""	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"3"	"941.45052"	"0.0001108"	"0.0003449"	"4.15"	"42.10"
"12209"	"[K].KTFFEELAVEDK.[Q]"	"1xBiotin [K1]"	"0.115176"	"0.00731053"	"1"	"1"	"1"	"Q6P542"	"Q6P542 [39-50]"	"Q6P542 1xBiotin [K39]"	"ATP-binding cassette sub-family F member 1 [OS=Mus musculus]"	"1"	"1681.81418"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"2"	"841.41072"	"0.001478"	"0.02389"	"2.11"	""
"7812"	"[K].GATYGKPVHHGVNQLK.[F]"	"1xBiotin [K6]"	"0.0939097"	"0.00379267"	"1"	"1"	"1"	"Q9CZM2"	"Q9CZM2 [78-93]"	"Q9CZM2 1xBiotin [K83]"	"60S ribosomal protein L15 [OS=Mus musculus]"	"0"	"1931.99086"	"9.97"	""	""	""	"9.97"	"0.26"	"9.97"	""	"273.5"	""	""	""	"326.5"	""	"11844.3291015625"	""	""	""	"14142.8671875"	""	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"4"	"483.75316"	"0.0008081"	"0.01747"	"1.82"	"27.27"
"7607"	"[K].FYGDLEKDK.[G]"	"1xBiotin [K7]"	"0.019145"	"0.000586377"	"1"	"1"	"2"	"P14211"	"P14211 [56-64]"	"P14211 1xBiotin [K62]"	"Calreticulin [OS=Mus musculus]"	"1"	"1340.61911"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"High"	"2"	"670.81283"	"0.0001108"	"0.001637"	"2.10"	""
"7636"	"[R].FYQMTGETWKLTAGHR.[L]"	"1xBiotin [K10]"	"8.93875E-05"	"0.000586377"	"1"	"1"	"1"	"Q9QZ49"	"Q9QZ49 [118-133]"	"Q9QZ49 1xBiotin [K127]"	"UBX domain-containing protein 8 [OS=Mus musculus]"	"1"	"2152.01028"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"3"	"718.00844"	"0.0001108"	"6.384E-07"	"3.25"	""
"12420"	"[K].KVTHAVVTVPAYFNDAQR.[Q]"	"1xBiotin [K1]"	"0.00272271"	"0.000586377"	"1"	"1"	"2"	"P20029"	"P20029 [165-182]"	"P20029 1xBiotin [K165]"	"78 kDa glucose-regulated protein [OS=Mus musculus]"	"1"	"2242.14373"	""	""	""	""	"9.97"	"9.97"	"9.97"	""	""	""	""	""	"600.0"	""	""	""	""	""	"11661.798828125"	""	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"748.05377"	"0.0001108"	"9.356E-05"	"3.35"	"42.20"
"12409"	"[K].KVSKATVLAR.[I]"	"1xBiotin [K4]"	"0.00856411"	"0.000586377"	"1"	"1"	"1"	"P13516"	"P13516 [334-343]"	"P13516 1xBiotin [K337]"	"Acyl-CoA desaturase 1 [OS=Mus musculus]"	"2"	"1298.76130"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"2"	"649.88445"	"0.0001108"	"0.0005006"	"2.09"	""
"12400"	"[K].KVQILIR.[D]"	""	"0.112149"	"0.00731053"	"1"	"1"	"1"	"Q5PR68"	"Q5PR68 [317-323]"	""	"Centrosomal protein of 112 kDa [OS=Mus musculus]"	"1"	"869.59310"	"9.97"	"9.97"	"9.97"	"9.97"	""	"-9.97"	"-9.97"	""	"130.8"	"99.5"	"174.7"	"195.0"	""	""	"5082.4365234375"	"3865.72094726563"	"6787.21875"	"7577.57421875"	""	""	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"High"	"2"	"435.29997"	"0.001478"	"0.02293"	"1.46"	"29.17"
"12370"	"[R].KVLQLLR.[L]"	"1xBiotin [K1]"	"0.0499529"	"0.00154748"	"1"	"1"	"1"	"P14148"	"P14148 [129-135]"	"P14148 1xBiotin [K129]"	"60S ribosomal protein L7 [OS=Mus musculus]"	"1"	"1095.67070"	""	""	""	""	"9.97"	"9.97"	"9.97"	""	""	""	""	""	"600.0"	""	""	""	""	""	"17176.421875"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"2"	"548.33955"	"0.0002716"	"0.006769"	"1.94"	"45.55"
"7680"	"[K].GADFLVTEVENGGSLGSKK.[G]"	"1xBiotin [K19]"	"0.00473371"	"0.000586377"	"1"	"2"	"3"	"P52480"	"P52480 [189-207]"	"P52480 1xBiotin [K207]"	"Pyruvate kinase PKM [OS=Mus musculus]"	"1"	"2134.04849"	""	""	""	""	"9.97"	"9.97"	"9.97"	""	""	""	""	""	"600.0"	""	""	""	""	""	"11435.8798828125"	""	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"712.02103"	"0.0001108"	"0.0002109"	"3.14"	"50.45"
"12353"	"[R].KVLDGLTAGSSSASQQQQQQQHPPGNR.[E]"	"1xBiotin [K1]"	"0.00370715"	"0.000586377"	"1"	"1"	"1"	"Q8K400"	"Q8K400 [8-34]"	"Q8K400 1xBiotin [K8]"	"Syntaxin-binding protein 5 [OS=Mus musculus]"	"1"	"3073.48682"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"3"	"1025.16678"	"0.0001108"	"0.0001469"	"2.57"	""
"7697"	"[R].GAFGKPQGTVAR.[V]"	"1xBiotin [K5]"	"0.0319077"	"0.00104877"	"1"	"2"	"1"	"P86048"	"P86048 [117-128]"	"P86048 1xBiotin [K121]"	"60S ribosomal protein L10-like [OS=Mus musculus]"	"0"	"1414.72598"	""	""	"9.97"	"9.97"	""	""	""	""	""	""	"302.2"	"297.8"	""	""	""	""	"14399.345703125"	"14188.390625"	""	""	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Not Found"	"High"	"2"	"707.86679"	"0.0001873"	"0.003473"	"2.47"	"34.52"
"7698"	"[R].GAFGKVVQASAFGIK.[K]"	"1xBiotin [K5]"	"0.00033197"	"0.000586377"	"1"	"1"	"1"	"P35969"	"P35969 [837-851]"	"P35969 1xBiotin [K841]"	"Vascular endothelial growth factor receptor 1 [OS=Mus musculus]"	"1"	"1705.90942"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"853.45860"	"0.0001108"	"4.344E-06"	"3.46"	""
"12314"	"[R].KVAVHEDGYPVVSWVPEEGEMMDQK.[G]"	"1xBiotin [K1]; 2xOxidation [M21; M22]"	"0.0156435"	"0.000586377"	"1"	"1"	"2"	"P31651"	"P31651 [4-28]"	"P31651 1xBiotin [K4]"	"Sodium- and chloride-dependent betaine transporter [OS=Mus musculus]"	"1"	"3117.40022"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"1039.80565"	"0.0001108"	"0.001211"	"3.51"	""
"12281"	"[K].KTTHFVEGGDAGNREDQINR.[L]"	"1xBiotin [K1]"	"0.0428891"	"0.00104877"	"1"	"1"	"1"	"P14148"	"P14148 [245-264]"	"P14148 1xBiotin [K245]"	"60S ribosomal protein L7 [OS=Mus musculus]"	"2"	"2470.15279"	"9.97"	""	"9.97"	"9.97"	"9.97"	"0.83"	"9.97"	""	"105.9"	""	"130.2"	"175.8"	"188.1"	""	"3805.208984375"	""	"4676.8642578125"	"6318.27099609375"	"6759.83544921875"	""	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"3"	"824.05583"	"0.0001873"	"0.005375"	"2.35"	"28.33"
"12278"	"[R].KTSYAQHQQVR.[Q]"	"1xBiotin [K1]"	"0.00121831"	"0.000586377"	"1"	"1"	"5"	"P97351"	"P97351 [152-162]"	"P97351 1xBiotin [K152]"	"40S ribosomal protein S3a [OS=Mus musculus]"	"1"	"1571.77472"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"-0.47"	"-0.12"	""	"149.3"	"117.7"	"103.9"	"121.1"	"108.0"	""	"24206.068359375"	"19070.806640625"	"16840.58984375"	"19627.255859375"	"17509.83203125"	""	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"524.59637"	"0.0001108"	"2.904E-05"	"3.00"	"20.95"
"7784"	"[R].GAPQHYPKTAGNSEFLGK.[T]"	"1xBiotin [K8]"	"0.00146812"	"0.000586377"	"1"	"2"	"4"	"Q62448"	"Q62448 [24-41]"	"Q62448 1xBiotin [K31]"	"Eukaryotic translation initiation factor 4 gamma 2 [OS=Mus musculus]"	"1"	"2128.02803"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"-1.00"	"-0.69"	""	"165.5"	"133.8"	"117.9"	"99.8"	"83.0"	""	"15329.904296875"	"12389.3046875"	"10923.0634765625"	"9248.35546875"	"7686.3232421875"	""	"Not Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"3"	"710.01385"	"0.0001108"	"3.793E-05"	"3.35"	"34.86"
"12236"	"[R].KTLSLVK.[E]"	"1xBiotin [K1]"	"0.0469494"	"0.00154748"	"1"	"2"	"3"	"Q9CR89-1"	"Q9CR89-1 [8-14]"	"Q9CR89-1 1xBiotin [K8]"	"Endoplasmic reticulum-Golgi intermediate compartment protein 2 [OS=Mus musculus]"	"1"	"1014.60161"	"9.97"	""	"9.97"	"9.97"	"9.97"	"-0.65"	"9.97"	""	"183.8"	""	"147.8"	"151.2"	"117.3"	""	"17751.08984375"	""	"14272.83984375"	"14604.5341796875"	"11329.771484375"	""	"Not Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"2"	"507.80424"	"0.0002716"	"0.00618"	"2.34"	"38.38"
"20230"	"[R].NTDFGNKTFQDFGNR.[T]"	"1xBiotin [K7]"	"0.0136956"	"0.000586377"	"1"	"1"	"1"	"Q9ER80"	"Q9ER80 [201-215]"	"Q9ER80 1xBiotin [K207]"	"Receptor-transporting protein 4 [OS=Mus musculus]"	"1"	"1986.87628"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"993.94205"	"0.0001108"	"0.000993"	"1.20"	""
"20245"	"[K].NTGKMENYELIHSSR.[V]"	"1xBiotin [K4]; 1xOxidation [M5]"	"0.000623145"	"0.000586377"	"1"	"3"	"2"	"Q80TM9-1"	"Q80TM9-1 [1389-1403]"	"Q80TM9-1 1xBiotin [K1392]"	"Nischarin [OS=Mus musculus]"	"1"	"2020.92152"	"9.97"	""	""	""	"9.97"	"-0.63"	"9.97"	""	"364.8"	""	""	""	"235.2"	""	"13390.94921875"	""	""	""	"8631.451171875"	""	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"3"	"674.31244"	"0.0001108"	"1.091E-05"	"2.92"	"32.93"
"18023"	"[-].MLFYSFFK.[S]"	"1xOxidation [M1]"	"0.0618076"	"0.0019826"	"1"	"1"	"1"	"O35900"	"O35900 [1-8]"	""	"U6 snRNA-associated Sm-like protein LSm2 [OS=Mus musculus]"	"0"	"1098.53287"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"549.76977"	"0.0003442"	"0.009305"	"1.10"	""
"25785"	"[K].TPTGPDLDTSYKGYMK.[L]"	"1xBiotin [K12]"	"0.000538621"	"0.000586377"	"1"	"4"	"2"	"Q6ZWR6-1"	"Q6ZWR6-1 [8363-8378]"	"Q6ZWR6-1 1xBiotin [K8374]"	"Nesprin-1 [OS=Mus musculus]"	"1"	"1999.91398"	""	""	""	"9.97"	""	""	""	""	""	""	""	"600.0"	""	""	""	""	""	"10583.2783203125"	""	""	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"2"	"1000.46007"	"0.0001108"	"8.756E-06"	"2.99"	"43.32"
"25663"	"[K].TNFFEKR.[V]"	"1xBiotin [K6]"	"0.0742232"	"0.00241047"	"1"	"2"	"2"	"P11157"	"P11157 [360-366]"	"P11157 1xBiotin [K365]"	"ribonucleoside-diphosphate reductase subunit M2 [OS=Mus musculus]"	"1"	"1167.56154"	""	""	"9.97"	"9.97"	""	""	""	""	""	""	"297.7"	"302.3"	""	""	""	""	"6723.865234375"	"6825.64794921875"	""	""	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"Not Found"	"High"	"2"	"584.28463"	"0.000415"	"0.01229"	"1.51"	"41.38"
"25692"	"[R].TNSTFNQVVLKR.[L]"	"1xBiotin [K11]"	"0.00341697"	"0.000586377"	"1"	"1"	"4"	"P35980"	"P35980 [39-50]"	"P35980 1xBiotin [K49]"	"60S ribosomal protein L18 [OS=Mus musculus]"	"1"	"1632.85264"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"2"	"816.93001"	"0.0001108"	"0.0001309"	"2.64"	""
"25748"	"[K].TPLQVAKGGLGLILK.[R]"	"1xBiotin [K7]"	"0.0332084"	"0.00104877"	"1"	"1"	"2"	"Q9Z2X2"	"Q9Z2X2 [207-221]"	"Q9Z2X2 1xBiotin [K213]"	"26S proteasome non-ATPase regulatory subunit 10 [OS=Mus musculus]"	"1"	"1734.03462"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"2"	"867.52147"	"0.0001873"	"0.00367"	"3.13"	""
"4107"	"[R].DTKHTMEMR.[S]"	"1xBiotin [K3]"	"0.0402965"	"0.00104877"	"1"	"2"	"2"	"A2A8U2-1"	"A2A8U2-1 [581-589]"	"A2A8U2-1 1xBiotin [K583]"	"Transmembrane protein 201 [OS=Mus musculus]"	"1"	"1374.59629"	"9.97"	""	""	"9.97"	"9.97"	"-1.59"	"9.97"	""	"169.0"	""	""	"374.8"	"56.3"	""	"16876.06640625"	""	""	"37433.7900390625"	"5621.35302734375"	""	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"2"	"687.80229"	"0.0001873"	"0.004919"	"1.38"	"28.85"
"1381"	"[R].APQCLGKFIEIAAR.[K]"	"1xBiotin [K7]; 1xCarbamidomethyl [C4]"	"9.53093E-05"	"0.000586377"	"1"	"2"	"3"	"Q8VEK3"	"Q8VEK3 [535-548]"	"Q8VEK3 1xBiotin [K541]"	"Heterogeneous nuclear ribonucleoprotein U [OS=Mus musculus]"	"1"	"1799.92951"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"2"	"900.46754"	"0.0001108"	"6.987E-07"	"3.72"	""
"25828"	"[K].TQQLLHPVDWNFAQEEAKGSR.[Q]"	"1xBiotin [K18]"	"0.000129826"	"0.000586377"	"1"	"1"	"2"	"Q9QUK3"	"Q9QUK3 [254-274]"	"Q9QUK3 1xBiotin [K271]"	"protein CLN8 [OS=Mus musculus]"	"1"	"2680.29364"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"3"	"894.10204"	"0.0001108"	"1.1E-06"	"5.27"	""
"1327"	"[R].APGDQGEKYIDLR.[H]"	"1xBiotin [K8]"	"0.000814826"	"0.000586377"	"1"	"1"	"3"	"Q8R2Y2-1"	"Q8R2Y2-1 [635-647]"	"Q8R2Y2-1 1xBiotin [K642]"	"Cell surface glycoprotein MUC18 [OS=Mus musculus]"	"1"	"1687.81083"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"-0.10"	"0.38"	""	"104.0"	"74.4"	"126.7"	"198.1"	"96.9"	""	"17924.505859375"	"12818.3740234375"	"21830.33984375"	"34134.7421875"	"16701.45703125"	""	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"2"	"844.40851"	"0.0001108"	"1.611E-05"	"3.29"	"41.16"
"25868"	"[R].TSAAAVSSKLMQAR.[V]"	"1xBiotin [K9]"	"0.00364297"	"0.000586377"	"1"	"2"	"1"	"Q8C147"	"Q8C147 [887-900]"	"Q8C147 1xBiotin [K895]"	"Dedicator of cytokinesis protein 8 [OS=Mus musculus]"	"1"	"1646.83527"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"2"	"823.92147"	"0.0001108"	"0.0001433"	"3.06"	""
"1317"	"[K].APECSSKDGAELR.[Q]"	"1xBiotin [K7]; 1xCarbamidomethyl [C4]"	"0.0253774"	"0.00104877"	"1"	"1"	"1"	"P49070"	"P49070 [118-130]"	"P49070 1xBiotin [K124]"	"calcium signal-modulating cyclophilin ligand [OS=Mus musculus]"	"1"	"1645.73087"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"2"	"823.36833"	"0.0001873"	"0.002468"	"2.19"	""
"25906"	"[K].TSGPPVSELITKAVAASK.[E]"	"1xBiotin [K12]"	"0.00841625"	"0.000586377"	"1"	"1"	"3"	"P43274"	"P43274 [35-52]"	"P43274 1xBiotin [K46]"	"Histone H1.4 [OS=Mus musculus]"	"1"	"1982.06269"	"9.97"	"9.97"	""	""	""	"-9.97"	"-9.97"	""	"264.4"	"335.6"	""	""	""	""	"13146.7412109375"	"16687.150390625"	""	""	""	""	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"991.53647"	"0.0001108"	"0.0004871"	"3.20"	"58.28"
"25921"	"[K].TSIAIDTIINQKR.[F]"	"1xBiotin [K12]"	"0.0200481"	"0.000586377"	"1"	"1"	"2"	"Q03265"	"Q03265 [219-231]"	"Q03265 1xBiotin [K230]"	"ATP synthase subunit alpha, mitochondrial [OS=Mus musculus]"	"1"	"1698.92072"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"2"	"849.96399"	"0.0001108"	"0.001753"	"2.48"	""
"25922"	"[K].TSLCLKEPSLLPVK.[D]"	"1xBiotin [K6]; 1xCarbamidomethyl [C4]"	"0.000270684"	"0.000586377"	"1"	"1"	"2"	"Q8VE11"	"Q8VE11 [562-575]"	"Q8VE11 1xBiotin [K567]"	"Myotubularin-related protein 6 [OS=Mus musculus]"	"1"	"1810.98054"	""	""	"9.97"	""	""	""	""	""	""	""	"600.0"	""	""	""	""	""	"25612.96875"	""	""	""	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"2"	"905.99383"	"0.0001108"	"3.218E-06"	"3.01"	"51.15"
"25932"	"[K].TSLSDSTTSAYPGDAGKTGGQLGLDHLR.[D]"	"1xBiotin [K17]"	"0.000171761"	"0.000586377"	"1"	"1"	"2"	"Q80UJ7"	"Q80UJ7 [535-562]"	"Q80UJ7 1xBiotin [K551]"	"Rab3 GTPase-activating protein catalytic subunit [OS=Mus musculus]"	"1"	"3031.44255"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"3"	"1011.15154"	"0.0001108"	"1.651E-06"	"4.51"	""
"25594"	"[K].TLVKSLSTDTSR.[Q]"	"1xBiotin [K4]"	"0.0104316"	"0.000586377"	"1"	"1"	"4"	"Q6ZPJ0"	"Q6ZPJ0 [215-226]"	"Q6ZPJ0 1xBiotin [K218]"	"Testis-expressed protein 2 [OS=Mus musculus]"	"1"	"1533.79412"	""	""	"9.97"	"9.97"	""	""	""	""	""	""	"279.1"	"320.9"	""	""	""	""	"6914.18798828125"	"7947.5048828125"	""	""	"Not Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"2"	"767.40130"	"0.0001108"	"0.0006691"	"2.06"	"37.51"
"1221"	"[K].ANDKGFYSSQAIEK.[A]"	"1xBiotin [K4]"	"0.00678861"	"0.000586377"	"1"	"2"	"2"	"Q3UMB5"	"Q3UMB5 [219-232]"	"Q3UMB5 1xBiotin [K222]"	"Guanine nucleotide exchange protein SMCR8 [OS=Mus musculus]"	"1"	"1783.83196"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"2"	"892.41929"	"0.0001108"	"0.0003557"	"1.86"	""
"26051"	"[R].TVAVEKQNLER.[K]"	"1xBiotin [K6]"	"0.11765"	"0.00731053"	"1"	"1"	"1"	"P83093"	"P83093 [278-288]"	"P83093 1xBiotin [K283]"	"Stromal interaction molecule 2 [OS=Mus musculus]"	"1"	"1512.78389"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"2"	"756.89588"	"0.001478"	"0.0248"	"2.33"	""
"26070"	"[K].TVGGDKNGGTR.[V]"	"1xBiotin [K6]"	"0.0690753"	"0.0019826"	"1"	"1"	"2"	"P47911"	"P47911 [103-113]"	"P47911 1xBiotin [K108]"	"60S ribosomal protein L6 [OS=Mus musculus]"	"1"	"1287.61101"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"-0.05"	"-0.05"	""	"115.7"	"116.0"	"82.1"	"174.3"	"111.9"	""	"4193.6298828125"	"4202.64111328125"	"2974.88940429688"	"6318.57568359375"	"4055.27001953125"	""	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"2"	"644.30957"	"0.0003442"	"0.01099"	"1.27"	"20.78"
"1161"	"[K].AMEAVAAQGKVK.[K]"	"1xBiotin [K10]"	"0.0078955"	"0.000586377"	"1"	"1"	"1"	"Q9DBJ1"	"Q9DBJ1 [242-253]"	"Q9DBJ1 1xBiotin [K251]"	"Phosphoglycerate mutase 1 [OS=Mus musculus]"	"1"	"1428.73377"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"2"	"714.87062"	"0.0001108"	"0.0004445"	"2.41"	""
"1102"	"[K].AISYLATVPKYR.[I]"	"1xBiotin [K10]"	"0.0944201"	"0.00379267"	"1"	"2"	"2"	"A2ALW5"	"A2ALW5 [171-182]"	"A2ALW5 1xBiotin [K180]"	"dnaJ homolog subfamily C member 25 [OS=Mus musculus]"	"1"	"1607.86141"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"804.43398"	"0.0008081"	"0.01769"	"1.83"	""
"26091"	"[R].TVIIEQSWGSPKVTK.[D]"	"1xBiotin [K12]"	"0.0516681"	"0.00154748"	"1"	"1"	"1"	"P63038-1"	"P63038-1 [61-75]"	"P63038-1 1xBiotin [K72]"	"60 kDa heat shock protein, mitochondrial [OS=Mus musculus]"	"1"	"1899.00445"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"2"	"950.00436"	"0.0002716"	"0.007134"	"2.30"	""
"1094"	"[K].ALSSKADSLLLK.[S]"	"1xBiotin [K5]"	"0.0273413"	"0.00104877"	"1"	"3"	"3"	"A6PWY4-1"	"A6PWY4-1 [101-112]"	"A6PWY4-1 1xBiotin [K105]"	"WD repeat-containing protein 76 [OS=Mus musculus]"	"1"	"1471.81888"	"9.97"	"9.97"	""	"9.97"	"9.97"	"0.10"	"0.72"	""	"200.7"	"130.3"	""	"54.2"	"214.8"	""	"16602.939453125"	"10781.8447265625"	""	"4488.31201171875"	"17772.173828125"	""	"Not Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"2"	"736.41342"	"0.0001873"	"0.002758"	"2.16"	"47.59"
"26111"	"[K].TVPKPIALEPCFGNKAAVLSVFVR.[L]"	"1xBiotin [K15]; 1xCarbamidomethyl [C11]"	"0.00143429"	"0.000586377"	"1"	"1"	"1"	"Q9WU60"	"Q9WU60 [1350-1373]"	"Q9WU60 1xBiotin [K1364]"	"Attractin [OS=Mus musculus]"	"1"	"2839.53612"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"3"	"947.18449"	"0.0001108"	"3.673E-05"	"3.62"	""
"966"	"[R].ALLAGKDSETGENIR.[Q]"	"1xBiotin [K6]"	"0.0121983"	"0.000586377"	"1"	"1"	"1"	"P38647"	"P38647 [620-634]"	"P38647 1xBiotin [K625]"	"Stress-70 protein, mitochondrial [OS=Mus musculus]"	"1"	"1799.89562"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"900.45309"	"0.0001108"	"0.0008404"	"1.83"	""
"954"	"[K].ALKPTVFPTVPR.[L]"	"1xBiotin [K3]"	"0.0441201"	"0.00104877"	"1"	"1"	"1"	"Q8JZR0"	"Q8JZR0 [342-353]"	"Q8JZR0 1xBiotin [K344]"	"Long-chain-fatty-acid--CoA ligase 5 [OS=Mus musculus]"	"0"	"1551.87158"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"776.43976"	"0.0001873"	"0.005629"	"1.74"	""
"951"	"[R].ALKIPAMTIAK.[N]"	"1xBiotin [K3]"	"0.127354"	"0.00949852"	"1"	"2"	"1"	"P63038-1"	"P63038-1 [471-481]"	"P63038-1 1xBiotin [K473]"	"60 kDa heat shock protein, mitochondrial [OS=Mus musculus]"	"1"	"1382.78983"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"2"	"691.89919"	"0.001921"	"0.02794"	"2.10"	""
"26272"	"[R].VANELNIKR.[R]"	"1xBiotin [K8]"	"0.00590462"	"0.000586377"	"1"	"4"	"1"	"Q80XM9-1"	"Q80XM9-1 [100-108]"	"Q80XM9-1 1xBiotin [K107]"	"pq-loop repeat-containing protein 1 [OS=Mus musculus]"	"1"	"1282.69362"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"2"	"641.85033"	"0.0001108"	"0.0002912"	"2.32"	""
"851"	"[R].ALCCKGPPPARPEYDLVCIGLTGSGK.[T]"	"1xBiotin [K5]; 3xCarbamidomethyl [C3; C4; C18]"	"0.000214369"	"0.000586377"	"1"	"1"	"3"	"Q8BGR6"	"Q8BGR6 [20-45]"	"Q8BGR6 1xBiotin [K24]"	"ADP-ribosylation factor-like protein 15 [OS=Mus musculus]"	"1"	"3042.46680"	""	"9.97"	""	""	"9.97"	"9.97"	"0.45"	""	""	"253.6"	""	""	"346.4"	""	""	"15631.3896484375"	""	""	"21351.2890625"	""	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"1014.82747"	"0.0001108"	"2.284E-06"	"4.24"	"48.01"
"845"	"[R].AIATKCGILTPK.[D]"	"1xBiotin [K5]; 1xCarbamidomethyl [C6]"	"0.0534395"	"0.0019826"	"1"	"2"	"2"	"Q6Q477"	"Q6Q477 [706-717]"	"Q6Q477 1xBiotin [K710]"	"Plasma membrane calcium-transporting ATPase 4 [OS=Mus musculus]"	"1"	"1498.81202"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"High"	"2"	"749.90995"	"0.0003442"	"0.007489"	"1.93"	""
"25975"	"[K].TSVDSKSINNFEVK.[T]"	"1xBiotin [K6]"	"0.0155533"	"0.000586377"	"1"	"1"	"1"	"P70677"	"P70677 [6-19]"	"P70677 1xBiotin [K11]"	"Caspase-3 [OS=Mus musculus]"	"1"	"1793.87382"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"2"	"897.44058"	"0.0001108"	"0.001199"	"2.18"	""
"25578"	"[R].TLSSIKTATGVQGK.[E]"	"1xBiotin [K6]"	"0.00339713"	"0.000586377"	"1"	"1"	"3"	"A2AWA9"	"A2AWA9 [1048-1061]"	"A2AWA9 1xBiotin [K1053]"	"Rab GTPase-activating protein 1 [OS=Mus musculus]"	"1"	"1616.86762"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"High"	"High"	"2"	"808.93741"	"0.0001108"	"0.0001291"	"2.37"	""
"1486"	"[K].AQNDVMTMKIQSER.[L]"	"1xBiotin [K9]"	"0.00314946"	"0.000586377"	"1"	"1"	"1"	"Q61334"	"Q61334 [200-213]"	"Q61334 1xBiotin [K208]"	"B-cell receptor-associated protein 29 [OS=Mus musculus]"	"1"	"1876.87140"	""	""	""	"9.97"	""	""	""	""	""	""	""	"600.0"	""	""	""	""	""	"8129.44189453125"	""	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"2"	"938.93909"	"0.0001108"	"0.0001162"	"3.08"	"41.57"
"1487"	"[K].AQNDVMTMKIQSER.[L]"	"1xBiotin [K9]; 1xOxidation [M8]"	"0.0856113"	"0.00288886"	"1"	"1"	"2"	"Q61334"	"Q61334 [200-213]"	"Q61334 1xBiotin [K208]"	"B-cell receptor-associated protein 29 [OS=Mus musculus]"	"1"	"1892.86631"	"9.97"	""	"9.97"	""	""	"-9.97"	""	""	"329.7"	""	"270.3"	""	""	""	"5191.5517578125"	""	"4254.80712890625"	""	""	""	"Not Found"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"3"	"631.62685"	"0.0004957"	"0.01524"	"2.51"	"37.29"
"24490"	"[K].SSATVGPKAPAVGK.[K]"	"1xBiotin [K8]"	"0.0428891"	"0.00104877"	"1"	"1"	"1"	"P27661"	"P27661 [121-134]"	"P27661 1xBiotin [K128]"	"Histone H2AX [OS=Mus musculus]"	"1"	"1495.79372"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"2"	"748.40107"	"0.0001873"	"0.005375"	"2.20"	""
"24519"	"[R].SSFFVNGLTLGGQK.[C]"	""	"0.0453851"	"0.00154748"	"1"	"1"	"1"	"P62962"	"P62962 [57-70]"	""	"profilin-1 [OS=Mus musculus]"	"0"	"1454.76380"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"2"	"727.88477"	"0.0002716"	"0.005854"	"2.27"	""
"24529"	"[R].SSGSHLEAKVR.[G]"	"1xBiotin [K9]"	"0.114565"	"0.00731053"	"1"	"1"	"2"	"Q3UBX0"	"Q3UBX0 [207-217]"	"Q3UBX0 1xBiotin [K215]"	"Transmembrane protein 109 [OS=Mus musculus]"	"1"	"1396.70016"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"High"	"2"	"698.85418"	"0.001478"	"0.02363"	"1.78"	""
"24538"	"[R].SSKELLLQPVTISR.[N]"	"1xBiotin [K3]"	"0.11765"	"0.00731053"	"1"	"1"	"2"	"P59999"	"P59999 [42-55]"	"P59999 1xBiotin [K44]"	"Actin-related protein 2/3 complex subunit 4 [OS=Mus musculus]"	"1"	"1796.99388"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"2"	"898.99973"	"0.001478"	"0.02464"	"1.23"	""
"24549"	"[R].SSINDKIIELK.[D]"	"1xBiotin [K6]"	"0.00939743"	"0.000586377"	"1"	"2"	"3"	"Q3U1N2-1"	"Q3U1N2-1 [333-343]"	"Q3U1N2-1 1xBiotin [K338]"	"Sterol regulatory element-binding protein 2 [OS=Mus musculus]"	"1"	"1485.79814"	""	""	""	"9.97"	"9.97"	"9.97"	"9.97"	""	""	""	""	"328.3"	"271.7"	""	""	""	""	"9438.7099609375"	"7812.052734375"	""	"Not Found"	"High"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"2"	"743.40250"	"0.0001108"	"0.0005736"	"2.23"	"47.20"
"24550"	"[R].SSINDKIVELK.[D]"	"1xBiotin [K6]"	"0.0322742"	"0.00104877"	"1"	"4"	"3"	"Q9WTN3"	"Q9WTN3 [331-341]"	"Q9WTN3 1xBiotin [K336]"	"Sterol regulatory element-binding protein 1 [OS=Mus musculus]"	"1"	"1471.78249"	"9.97"	""	"9.97"	"9.97"	"9.97"	"-0.64"	"9.97"	""	"215.1"	""	"160.9"	"86.4"	"137.6"	""	"12522.4208984375"	""	"9371.123046875"	"5031.22021484375"	"8013.0654296875"	""	"Not Found"	"High"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"2"	"736.39557"	"0.0001873"	"0.003522"	"2.04"	"45.36"
"1926"	"[R].AVHSKSSTAVYLAEGGTATTTVSK.[D]"	"1xBiotin [K5]"	"0.0513783"	"0.00154748"	"1"	"1"	"1"	"O35607"	"O35607 [1008-1031]"	"O35607 1xBiotin [K1012]"	"Bone morphogenetic protein receptor type-2 [OS=Mus musculus]"	"1"	"2592.29739"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"3"	"864.77098"	"0.0002716"	"0.007027"	"2.67"	""
"24659"	"[K].STCGKCGYPAK.[R]"	"1xBiotin [K5]; 2xCarbamidomethyl [C3; C6]"	"0.00808104"	"0.000586377"	"1"	"1"	"1"	"Q9D823"	"Q9D823 [32-42]"	"Q9D823 1xBiotin [K36]"	"60S ribosomal protein L37 [OS=Mus musculus]"	"1"	"1454.62250"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"727.81448"	"0.0001108"	"0.0004614"	"1.52"	""
"24733"	"[K].SVAGKMAVLANGVMNSLQDR.[Y]"	"1xBiotin [K5]; 1xOxidation [M14]"	"0.0246595"	"0.00104877"	"1"	"2"	"1"	"Q99K28"	"Q99K28 [497-516]"	"Q99K28 1xBiotin [K501]"	"ADP-ribosylation factor GTPase-activating protein 2 [OS=Mus musculus]"	"1"	"2303.13047"	"9.97"	"9.97"	""	""	"9.97"	"1.11"	"0.58"	""	"130.2"	"188.1"	""	""	"281.7"	""	"4273.38623046875"	"6175.17041015625"	""	""	"9246.9521484375"	""	"Not Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Peak Found"	"High"	"3"	"768.38209"	"0.0001873"	"0.00236"	"2.60"	"59.98"
"24734"	"[K].SVAGKMAVLANGVMNSLQDR.[Y]"	"1xBiotin [K5]; 2xOxidation [M6; M14]"	"0.000878982"	"0.000586377"	"1"	"2"	"1"	"Q99K28"	"Q99K28 [497-516]"	"Q99K28 1xBiotin [K501]"	"ADP-ribosylation factor GTPase-activating protein 2 [OS=Mus musculus]"	"1"	"2319.12538"	"9.97"	""	""	""	"9.97"	"0.64"	"9.97"	""	"234.4"	""	""	""	"365.6"	""	"6474.93505859375"	""	""	""	"10101.55859375"	""	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"3"	"773.71321"	"0.0001108"	"1.8E-05"	"2.87"	"47.07"
"24745"	"[K].SVDAAKLGASEK.[N]"	"1xBiotin [K6]"	"0.0268753"	"0.00104877"	"1"	"1"	"1"	"Q61712"	"Q61712 [194-205]"	"Q61712 1xBiotin [K199]"	"DnaJ homolog subfamily C member 1 [OS=Mus musculus]"	"1"	"1401.70424"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"2"	"701.35622"	"0.0001873"	"0.002688"	"2.19"	""
"24819"	"[K].SVTAFFNWLR.[E]"	""	"0.130059"	"0.00993825"	"1"	"2"	"1"	"Q6NZJ6"	"Q6NZJ6 [1581-1590]"	""	"eukaryotic translation initiation factor 4 gamma 1 [OS=Mus musculus]"	"0"	"1240.64732"	""	"9.97"	""	""	"9.97"	"9.97"	"0.05"	""	""	"295.1"	""	""	"304.9"	""	""	"4957.08984375"	""	""	"5122.6552734375"	""	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Peak Found"	"High"	"2"	"620.82687"	"0.001921"	"0.0289"	"2.28"	"58.90"
"24913"	"[K].TAGAAAKK.[T]"	"1xBiotin [K]"	"0.0203975"	"0.000586377"	"1"	"1"	"2"	"P43275"	"P43275 [138-145]"	"P43275 1xBiotin [K]"	"Histone H1.1 [OS=Mus musculus]"	"1"	"943.50296"	"9.97"	""	"9.97"	"9.97"	"9.97"	"0.06"	"9.97"	""	"137.1"	""	"131.3"	"188.9"	"142.7"	""	"5293.8125"	""	"5066.98046875"	"7291.0986328125"	"5508.216796875"	""	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"2"	"472.25512"	"0.0001108"	"0.001785"	"1.58"	"17.13"
"25132"	"[R].TFAVTDELVFKDAK.[K]"	"1xBiotin [K11]"	"0.000356031"	"0.000586377"	"1"	"1"	"3"	"Q9JIG7"	"Q9JIG7 [535-548]"	"Q9JIG7 1xBiotin [K545]"	"Coiled-coil domain-containing protein 22 [OS=Mus musculus]"	"1"	"1809.90915"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"2"	"905.45817"	"0.0001108"	"4.799E-06"	"3.37"	""
"25133"	"[R].TFDATNPLNLCVKIVQGIR.[A]"	"1xBiotin [K13]; 1xCarbamidomethyl [C11]"	"0.0174574"	"0.000586377"	"1"	"1"	"3"	"Q8K1R7"	"Q8K1R7 [250-268]"	"Q8K1R7 1xBiotin [K262]"	"Serine/threonine-protein kinase Nek9 [OS=Mus musculus]"	"1"	"2385.24173"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"795.75219"	"0.0001108"	"0.001429"	"2.90"	""
"25147"	"[R].TFKTVFAEHISDECK.[R]"	"1xBiotin [K3]; 1xCarbamidomethyl [C14]"	"0.0121279"	"0.000586377"	"1"	"1"	"2"	"P27659"	"P27659 [101-115]"	"P27659 1xBiotin [K103]"	"60S ribosomal protein L3 [OS=Mus musculus]"	"1"	"2037.94086"	"9.97"	""	""	""	""	"-9.97"	""	""	"600.0"	""	""	""	""	""	"7623.5068359375"	""	""	""	""	""	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"3"	"679.98471"	"0.0001108"	"0.000833"	"1.87"	"46.41"
"25222"	"[R].TGLIKGSGTAEVELK.[K]"	"1xBiotin [K5]"	"0.00176912"	"0.000586377"	"1"	"2"	"3"	"P52480"	"P52480 [121-135]"	"P52480 1xBiotin [K125]"	"Pyruvate kinase PKM [OS=Mus musculus]"	"1"	"1728.92005"	"9.97"	""	""	""	""	"-9.97"	""	""	"600.0"	""	""	""	""	""	"12220.03515625"	""	""	""	""	""	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"2"	"864.96368"	"0.0001108"	"4.991E-05"	"2.20"	"41.83"
"1697"	"[K].ASMKIDLR.[I]"	"1xBiotin [K4]"	"0.111552"	"0.00731053"	"1"	"1"	"1"	"P35969"	"P35969 [1267-1274]"	"P35969 1xBiotin [K1270]"	"Vascular endothelial growth factor receptor 1 [OS=Mus musculus]"	"1"	"1159.59621"	""	""	""	"9.97"	"9.97"	"9.97"	"9.97"	""	""	""	""	"287.8"	"312.2"	""	""	""	""	"10043.0615234375"	"10893.5751953125"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"2"	"580.30098"	"0.001478"	"0.0228"	"2.04"	"39.98"
"1690"	"[R].ASLSKLGDVYVNDAFGTAHR.[A]"	"1xBiotin [K5]"	"0.00166897"	"0.000586377"	"1"	"1"	"2"	"P09411"	"P09411 [152-171]"	"P09411 1xBiotin [K156]"	"phosphoglycerate kinase 1 [OS=Mus musculus]"	"1"	"2347.14994"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"3"	"783.05498"	"0.0001108"	"4.59E-05"	"3.37"	""
"25386"	"[R].TKQTAR.[K]"	"1xBiotin [K2]"	"0.0949331"	"0.00379267"	"1"	"3"	"2"	"P68433"	"P68433 [4-9]"	"P68433 1xBiotin [K5]"	"Histone H3.1 [OS=Mus musculus]"	"1"	"930.48256"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"0.15"	"0.61"	""	"129.4"	"94.5"	"115.2"	"116.9"	"143.9"	""	"49840.19140625"	"36387.1171875"	"44357.0703125"	"45020.34375"	"55406.74609375"	""	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"2"	"465.74486"	"0.0008081"	"0.01774"	"1.69"	"15.62"
"1665"	"[K].ASGYQSSQKK.[S]"	"1xBiotin [K9]"	"0.110959"	"0.00731053"	"1"	"1"	"1"	"P51859"	"P51859 [97-106]"	"P51859 1xBiotin [K105]"	"hepatoma-derived growth factor [OS=Mus musculus]"	"1"	"1309.62051"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"655.31420"	"0.001478"	"0.02265"	"1.85"	""
"25388"	"[R].TKQYLCVADLAR.[K]"	"1xBiotin [K2]; 1xCarbamidomethyl [C6]"	"0.00411666"	"0.000586377"	"1"	"2"	"3"	"Q8CIF6"	"Q8CIF6 [425-436]"	"Q8CIF6 1xBiotin [K426]"	"SID1 transmembrane family member 2 [OS=Mus musculus]"	"1"	"1663.82946"	""	""	""	"9.97"	""	""	""	""	""	""	""	"600.0"	""	""	""	""	""	"4330.42919921875"	""	""	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"High"	"2"	"832.41768"	"0.0001108"	"0.0001718"	"2.02"	"46.81"
"1655"	"[R].ASGNYATVISHNPETKK.[T]"	"1xBiotin [K17]"	"0.0591084"	"0.0019826"	"1"	"1"	"2"	"P62918"	"P62918 [129-145]"	"P62918 1xBiotin [K145]"	"60S ribosomal protein L8 [OS=Mus musculus]"	"1"	"2042.99640"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"3"	"681.66943"	"0.0003442"	"0.008698"	"2.48"	""
"1642"	"[R].ASFAEKTAQLER.[T]"	"1xBiotin [K6]"	"0.00141767"	"0.000586377"	"1"	"16"	"4"	"Q9QXS1-1"	"Q9QXS1-1 [1728-1739]"	"Q9QXS1-1 1xBiotin [K1733]"	"plectin [OS=Mus musculus]"	"1"	"1576.77880"	"9.97"	""	"9.97"	""	"9.97"	"-0.18"	"9.97"	""	"226.6"	""	"173.9"	""	"199.5"	""	"12258.064453125"	""	"9409.478515625"	""	"10794.896484375"	""	"Not Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"2"	"788.89327"	"0.0001108"	"3.602E-05"	"2.42"	"42.65"
"25395"	"[R].TKTEATIPLVPGR.[D]"	"1xBiotin [K2]"	"0.00399858"	"0.000586377"	"1"	"1"	"3"	"Q8R0W6"	"Q8R0W6 [82-94]"	"Q8R0W6 1xBiotin [K83]"	"NEDD4 family-interacting protein 1 [OS=Mus musculus]"	"1"	"1608.87779"	""	""	"9.97"	"9.97"	""	""	""	""	""	""	"354.0"	"246.0"	""	""	""	""	"11217.3955078125"	"7797.4287109375"	""	""	"Not Found"	"High"	"High"	"Peak Found"	"High"	"Not Found"	"High"	"2"	"804.94267"	"0.0001108"	"0.000164"	"2.48"	"42.07"
"25484"	"[K].TLKYSIDPSVVNISDEMAK.[T]"	"1xBiotin [K3]; 1xOxidation [M17]"	"0.0851449"	"0.00288886"	"1"	"1"	"2"	"Q8BTY2"	"Q8BTY2 [968-986]"	"Q8BTY2 1xBiotin [K970]"	"Sodium bicarbonate cotransporter 3 [OS=Mus musculus]"	"1"	"2352.14616"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"3"	"784.72045"	"0.0004957"	"0.0151"	"2.24"	""
"25487"	"[R].TLLDANEEFKSMSGTIQLGR.[K]"	"1xBiotin [K10]; 1xOxidation [M12]"	"0.00822304"	"0.000586377"	"1"	"1"	"3"	"Q6QD59"	"Q6QD59 [169-188]"	"Q6QD59 1xBiotin [K178]"	"Vesicle transport protein SEC20 [OS=Mus musculus]"	"1"	"2452.18467"	"9.97"	""	"9.97"	""	""	"-9.97"	""	""	"295.0"	""	"305.0"	""	""	""	"8762.4921875"	""	"9057.16015625"	""	""	""	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"High"	"High"	"3"	"818.06667"	"0.0001108"	"0.0004699"	"2.22"	"49.21"
"25569"	"[R].TLSDYNIQKESTLHLVLR.[L]"	"1xBiotin [K9]"	"0.00441445"	"0.000586377"	"1"	"4"	"2"	"P62983"	"P62983 [55-72]"	"P62983 1xBiotin [K63]"	"Ubiquitin-40S ribosomal protein S27a [OS=Mus musculus]"	"1"	"2356.23294"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"786.08291"	"0.0001108"	"0.0001899"	"2.30"	""
"25575"	"[K].TLSLVKELDAFPK.[V]"	"1xBiotin [K6]"	"0.00590462"	"0.000586377"	"1"	"2"	"1"	"Q9CR89-1"	"Q9CR89-1 [9-21]"	"Q9CR89-1 1xBiotin [K14]"	"Endoplasmic reticulum-Golgi intermediate compartment protein 2 [OS=Mus musculus]"	"1"	"1686.91351"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"2"	"843.95868"	"0.0001108"	"0.0002898"	"3.00"	""
"26382"	"[K].VDKDYVKTLPAQGMGTAEVLER.[L]"	"1xBiotin [K7]; 1xOxidation [M14]"	"0.0313657"	"0.00104877"	"1"	"1"	"2"	"Q8R0X7"	"Q8R0X7 [108-129]"	"Q8R0X7 1xBiotin [K114]"	"sphingosine-1-phosphate lyase 1 [OS=Mus musculus]"	"2"	"2662.32150"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"888.11285"	"0.0001873"	"0.003386"	"3.02"	""
"818"	"[K].ALAAGGYDVEKNNSR.[I]"	"1xBiotin [K11]"	"0.0142615"	"0.000586377"	"1"	"1"	"2"	"P43276"	"P43276 [65-79]"	"P43276 1xBiotin [K75]"	"Histone H1.5 [OS=Mus musculus]"	"1"	"1790.84901"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"2"	"895.92793"	"0.0001108"	"0.001054"	"2.81"	""
"26442"	"[K].VEEIAAGKCR.[R]"	"1xBiotin [K8]; 1xCarbamidomethyl [C9]"	"0.0214821"	"0.00104877"	"1"	"1"	"4"	"P62717"	"P62717 [129-138]"	"P62717 1xBiotin [K136]"	"60S ribosomal protein L18a [OS=Mus musculus]"	"1"	"1358.65552"	"9.97"	"9.97"	"9.97"	"9.97"	""	"-9.97"	"-9.97"	""	"147.4"	"118.9"	"192.8"	"140.8"	""	""	"8281.041015625"	"6677.88720703125"	"10831.2646484375"	"7909.23193359375"	""	""	"Not Found"	"High"	"High"	"High"	"High"	"Not Found"	"High"	"2"	"679.83113"	"0.0001873"	"0.001939"	"1.39"	"30.39"
"26463"	"[K].VEKVTISNR.[L]"	"1xBiotin [K3]"	"0.013305"	"0.000586377"	"1"	"1"	"1"	"P11499"	"P11499 [575-583]"	"P11499 1xBiotin [K577]"	"Heat shock protein HSP 90-beta [OS=Mus musculus]"	"1"	"1271.67763"	"9.97"	""	"9.97"	"9.97"	"9.97"	"-0.44"	"9.97"	""	"173.3"	""	"97.5"	"201.9"	"127.3"	""	"10078.734375"	""	"5669.734375"	"11745.763671875"	"7406.0205078125"	""	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"2"	"636.34248"	"0.0001108"	"0.0009591"	"1.83"	"32.26"
"27160"	"[R].VNAAKNK.[T]"	"1xBiotin [K5]"	"0.104051"	"0.00659446"	"1"	"1"	"1"	"P14115"	"P14115 [88-94]"	"P14115 1xBiotin [K92]"	"60S ribosomal protein L27a [OS=Mus musculus]"	"1"	"970.51386"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"-0.80"	"-0.39"	""	"137.4"	"103.8"	"144.4"	"135.4"	"79.0"	""	"4622.49267578125"	"3491.537109375"	"4857.7041015625"	"4556.642578125"	"2658.96997070313"	""	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"2"	"485.76063"	"0.001278"	"0.02051"	"1.64"	"17.36"
"27205"	"[R].VNQAIWLLCTGAR.[E]"	"1xCarbamidomethyl [C9]"	"0.0258179"	"0.00104877"	"1"	"1"	"1"	"P97461"	"P97461 [147-159]"	""	"40S ribosomal protein S5 [OS=Mus musculus]"	"0"	"1501.79439"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"751.40076"	"0.0001873"	"0.002531"	"2.62"	""
"27360"	"[K].VQASKPASEVISEYSR.[K]"	"1xBiotin [K5]"	"0.113351"	"0.00731053"	"1"	"1"	"1"	"Q9CQ56"	"Q9CQ56 [59-74]"	"Q9CQ56 1xBiotin [K63]"	"Vesicle transport protein USE1 [OS=Mus musculus]"	"0"	"1976.97460"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"2"	"988.99009"	"0.001478"	"0.02329"	"1.47"	""
"398"	"[K].AEPAAATPKTATGWLTR.[F]"	"1xBiotin [K9]"	"0.00897115"	"0.000586377"	"1"	"1"	"3"	"Q8K190"	"Q8K190 [35-51]"	"Q8K190 1xBiotin [K43]"	"SAYSvFN domain-containing protein 1 [OS=Mus musculus]"	"1"	"1968.00076"	""	""	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	""	""	""	"203.8"	"123.7"	"272.5"	""	""	""	"6662.75830078125"	"4045.8583984375"	"8910.5439453125"	""	"Not Found"	"High"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"2"	"984.50387"	"0.0001108"	"0.0005373"	"1.94"	"45.31"
"27536"	"[K].VSKNLATQLDSAFIR.[K]"	"1xBiotin [K3]"	"0.00633127"	"0.000586377"	"1"	"1"	"1"	"Q80VQ0"	"Q80VQ0 [87-101]"	"Q80VQ0 1xBiotin [K89]"	"Aldehyde dehydrogenase family 3 member B1 [OS=Mus musculus]"	"1"	"1888.99494"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"945.00051"	"0.0001108"	"0.0003213"	"2.11"	""
"27585"	"[K].VSSKNSLESYAFNMK.[A]"	"1xBiotin [K4]; 1xOxidation [M14]"	"0.0683137"	"0.0019826"	"1"	"1"	"1"	"P63017"	"P63017 [536-550]"	"P63017 1xBiotin [K539]"	"Heat shock cognate 71 kDa protein [OS=Mus musculus]"	"1"	"1946.89866"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"973.94999"	"0.0003442"	"0.01085"	"1.83"	""
"330"	"[K].AEDKEWIPVTKLGR.[L]"	"1xBiotin [K11]"	"0.0828478"	"0.00241047"	"1"	"1"	"2"	"P25444"	"P25444 [55-68]"	"P25444 1xBiotin [K65]"	"40S ribosomal protein S2 [OS=Mus musculus]"	"2"	"1867.97348"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"3"	"623.32881"	"0.000415"	"0.01452"	"2.31"	""
"27598"	"[R].VSTMRPLATAYKASTSDYQVISDR.[Q]"	"1xBiotin [K12]"	"0.00012176"	"0.000586377"	"1"	"1"	"3"	"Q8R4R6"	"Q8R4R6 [282-305]"	"Q8R4R6 1xBiotin [K293]"	"Nucleoporin NUP53 [OS=Mus musculus]"	"1"	"2886.41244"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"962.80912"	"0.0001108"	"1E-06"	"4.91"	""
"27623"	"[R].VTDTPEVKWQK.[V]"	"1xBiotin [K8]"	"0.00193072"	"0.000586377"	"1"	"1"	"4"	"Q9CXR4"	"Q9CXR4 [6-16]"	"Q9CXR4 1xBiotin [K13]"	"phosphatidylinositol n-acetylglucosaminyltransferase subunit c [OS=Mus musculus]"	"1"	"1556.77774"	""	""	"9.97"	"9.97"	""	""	""	""	""	""	"327.5"	"272.5"	""	""	""	""	"12940.4912109375"	"10770.626953125"	""	""	"Not Found"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"2"	"778.89218"	"0.0001108"	"5.664E-05"	"2.64"	"37.51"
"307"	"[R].ADTKNSQVLVR.[K]"	"1xBiotin [K4]"	"0.00775912"	"0.000586377"	"1"	"1"	"2"	"Q8BYK4"	"Q8BYK4 [85-95]"	"Q8BYK4 1xBiotin [K88]"	"Retinol dehydrogenase 12 [OS=Mus musculus]"	"1"	"1456.75767"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"2"	"728.88185"	"0.0001108"	"0.0004339"	"1.96"	""
"27649"	"[K].VTKDGVTVAK.[S]"	"1xBiotin [K3]"	"0.0339747"	"0.00104877"	"1"	"1"	"1"	"P63038-1"	"P63038-1 [73-82]"	"P63038-1 1xBiotin [K75]"	"60 kDa heat shock protein, mitochondrial [OS=Mus musculus]"	"1"	"1243.67148"	""	""	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	""	""	""	"243.2"	"224.9"	"131.9"	""	""	""	"22904.4453125"	"21181.453125"	"12420.677734375"	""	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"2"	"622.33924"	"0.0001873"	"0.003796"	"2.10"	"32.05"
"27726"	"[R].VVDALGNAIDGKGPIGSK.[T]"	"1xBiotin [K12]"	"0.0176601"	"0.000586377"	"1"	"1"	"1"	"Q03265"	"Q03265 [150-167]"	"Q03265 1xBiotin [K161]"	"ATP synthase subunit alpha, mitochondrial [OS=Mus musculus]"	"1"	"1937.01607"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"2"	"969.00857"	"0.0001108"	"0.001449"	"2.92"	""
"212"	"[K].ACKTEADGR.[V]"	"1xBiotin [K3]; 1xCarbamidomethyl [C2]"	"0.0145111"	"0.000586377"	"1"	"6"	"2"	"Q9QX11"	"Q9QX11 [338-346]"	"Q9QX11 1xBiotin [K340]"	"Cytohesin-1 [OS=Mus musculus]"	"1"	"1233.53507"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"-0.45"	"-0.22"	""	"153.4"	"131.1"	"83.8"	"119.2"	"112.5"	""	"5797.73046875"	"4955.50341796875"	"3167.09912109375"	"4502.9296875"	"4250.79638671875"	""	"Not Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"2"	"617.27124"	"0.0001108"	"0.001085"	"1.18"	"20.33"
"27762"	"[K].VVHAFDMEDLGDKAVYCR.[C]"	"1xBiotin [K13]; 1xCarbamidomethyl [C17]; 1xOxidation [M7]"	"0.000926333"	"0.000586377"	"1"	"1"	"3"	"Q91WS0"	"Q91WS0 [56-73]"	"Q91WS0 1xBiotin [K68]"	"CDGSH iron-sulfur domain-containing protein 1 [OS=Mus musculus]"	"1"	"2367.05663"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"High"	"High"	"3"	"789.68986"	"0.0001108"	"1.937E-05"	"2.81"	""
"27863"	"[K].VWNLANCKLK.[T]"	"1xBiotin [K8]; 1xCarbamidomethyl [C7]"	"0.0894285"	"0.00334029"	"1"	"1"	"1"	"P68040"	"P68040 [176-185]"	"P68040 1xBiotin [K183]"	"Receptor of activated protein C kinase 1 [OS=Mus musculus]"	"1"	"1471.75484"	"9.97"	"9.97"	""	""	""	"-9.97"	"-9.97"	""	"201.8"	"398.2"	""	""	""	""	"10027.3759765625"	"19791.091796875"	""	""	""	""	"Not Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"736.38085"	"0.000655"	"0.01618"	"2.27"	"44.97"
"27865"	"[R].VWQVTIGTR.[-]"	""	"0.017059"	"0.000586377"	"1"	"1"	"2"	"P68040"	"P68040 [309-317]"	""	"Receptor of activated protein C kinase 1 [OS=Mus musculus]"	"0"	"1059.59455"	"9.97"	"9.97"	"9.97"	"9.97"	""	"-9.97"	"-9.97"	""	"131.8"	"112.1"	"201.7"	"154.4"	""	""	"8924.7861328125"	"7592.91748046875"	"13662.55859375"	"10455.5283203125"	""	""	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"2"	"530.30041"	"0.0001108"	"0.001381"	"1.94"	"37.12"
"28245"	"[K].YANEVSSHGGASKNSLK.[D]"	"1xBiotin [K]"	"0.0485655"	"0.00154748"	"1"	"1"	"2"	"Q8BMA6"	"Q8BMA6 [491-507]"	"Q8BMA6 1xBiotin [K]"	"Signal recognition particle subunit SRP68 [OS=Mus musculus]"	"1"	"1974.93380"	""	""	""	"9.97"	"9.97"	"9.97"	"9.97"	""	""	""	""	"338.0"	"262.0"	""	""	""	""	"6294.41455078125"	"4878.11328125"	""	"Not Found"	"High"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"3"	"658.98329"	"0.0002716"	"0.006493"	"1.83"	"27.53"
"28282"	"[K].YCTSLSSKLAAFDEPSK.[Y]"	"1xBiotin [K8]; 1xCarbamidomethyl [C2]"	"0.0870248"	"0.00334029"	"1"	"1"	"2"	"P21855"	"P21855 [259-275]"	"P21855 1xBiotin [K266]"	"B-cell differentiation antigen CD72 [OS=Mus musculus]"	"1"	"2129.98820"	""	"9.97"	""	""	""	""	"-9.97"	""	""	"600.0"	""	""	""	""	""	"6652.77197265625"	""	""	""	""	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"710.66743"	"0.0005759"	"0.01557"	"1.81"	"54.01"
"153"	"[K].AASFKLQR.[Q]"	"1xBiotin [K5]"	"0.0265689"	"0.00104877"	"1"	"1"	"1"	"Q9Z0F8"	"Q9Z0F8 [809-816]"	"Q9Z0F8 1xBiotin [K813]"	"Disintegrin and metalloproteinase domain-containing protein 17 [OS=Mus musculus]"	"1"	"1146.60882"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"2"	"573.80814"	"0.0001873"	"0.002655"	"2.09"	""
"28340"	"[K].YEKDIAAYR.[A]"	"1xBiotin [K3]"	"0.00611424"	"0.000586377"	"1"	"2"	"3"	"P63158"	"P63158 [155-163]"	"P63158 1xBiotin [K157]"	"High mobility group protein B1 [OS=Mus musculus]"	"1"	"1354.64600"	""	""	""	"9.97"	""	""	""	""	""	""	""	"600.0"	""	""	""	""	""	"8691.037109375"	""	""	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"2"	"677.82682"	"0.0001108"	"0.0003056"	"2.21"	"37.70"
"28448"	"[K].YGKIETIEVMEDR.[Q]"	"1xBiotin [K3]; 1xOxidation [M10]"	"0.0268753"	"0.00104877"	"1"	"2"	"1"	"Q8BG05"	"Q8BG05 [149-161]"	"Q8BG05 1xBiotin [K151]"	"Heterogeneous nuclear ribonucleoprotein A3 [OS=Mus musculus]"	"1"	"1824.85065"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"2"	"912.92740"	"0.0001873"	"0.00268"	"1.71"	""
"101"	"[R].AALAKSSYAVAAPVDFLR.[K]"	"1xBiotin [K5]"	"0.0046518"	"0.000586377"	"1"	"1"	"2"	"O35954"	"O35954 [1184-1201]"	"O35954 1xBiotin [K1188]"	"Membrane-associated phosphatidylinositol transfer protein 1 [OS=Mus musculus]"	"1"	"2076.09466"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"2"	"1038.55192"	"0.0001108"	"0.0002041"	"3.20"	""
"28461"	"[K].YGPKGYGYGQGAGTLSTDK.[G]"	"1xBiotin [K4]"	"0.0775674"	"0.00241047"	"1"	"1"	"3"	"P97315"	"P97315 [66-84]"	"P97315 1xBiotin [K69]"	"Cysteine and glycine-rich protein 1 [OS=Mus musculus]"	"1"	"2145.99098"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"High"	"2"	"1073.49793"	"0.000415"	"0.01306"	"1.47"	""
"28518"	"[K].YKPHPQISK.[V]"	"1xBiotin [K2]"	"0.0333984"	"0.00104877"	"1"	"1"	"2"	"Q9EP69"	"Q9EP69 [272-280]"	"Q9EP69 1xBiotin [K273]"	"Phosphatidylinositide phosphatase SAC1 [OS=Mus musculus]"	"0"	"1323.68780"	""	""	"9.97"	""	""	""	""	""	""	""	"600.0"	""	""	""	""	""	"12054.61328125"	""	""	""	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"2"	"662.34781"	"0.0001873"	"0.003716"	"1.59"	"26.83"
"28539"	"[K].YIDQEELNKTKPIWTR.[N]"	"1xBiotin [K9]"	"0.013775"	"0.000586377"	"1"	"2"	"2"	"P11499"	"P11499 [276-291]"	"P11499 1xBiotin [K284]"	"Heat shock protein HSP 90-beta [OS=Mus musculus]"	"1"	"2260.14306"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"3"	"754.05299"	"0.0001108"	"0.001002"	"2.53"	""
"28659"	"[K].YNTPKYR.[M]"	"1xBiotin [K5]"	"0.105741"	"0.00705524"	"1"	"1"	"3"	"P47962"	"P47962 [44-50]"	"P47962 1xBiotin [K48]"	"60S ribosomal protein L5 [OS=Mus musculus]"	"1"	"1167.56154"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"0.21"	"-0.33"	""	"109.9"	"160.8"	"114.2"	"87.6"	"127.5"	""	"6747.29345703125"	"9870.4755859375"	"7009.7744140625"	"5374.84814453125"	"7825.62255859375"	""	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"2"	"584.28427"	"0.001354"	"0.02103"	"1.46"	"28.56"
"28719"	"[R].YRENLPLVLKK.[V]"	"1xBiotin [K10]"	"0.105741"	"0.00705524"	"1"	"1"	"1"	"Q9R1X5"	"Q9R1X5 [1201-1211]"	"Q9R1X5 1xBiotin [K1210]"	"Multidrug resistance-associated protein 5 [OS=Mus musculus]"	"2"	"1598.90869"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"3"	"533.64069"	"0.001354"	"0.02101"	"1.72"	""
"28"	"[R].AAAVALPEEELKK.[S]"	"1xBiotin [K12]"	"0.0635535"	"0.0019826"	"1"	"1"	"1"	"Q80UJ7"	"Q80UJ7 [904-916]"	"Q80UJ7 1xBiotin [K915]"	"Rab3 GTPase-activating protein catalytic subunit [OS=Mus musculus]"	"1"	"1594.85090"	""	""	""	"9.97"	""	""	""	""	""	""	""	"600.0"	""	""	""	""	""	"8100.79052734375"	""	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"2"	"797.92878"	"0.0003442"	"0.009724"	"3.09"	"41.72"
"19"	"[K].AAALLTKQAGTEVKR.[E]"	"1xBiotin [K7]"	"0.0249442"	"0.00104877"	"1"	"1"	"4"	"Q8VCH8"	"Q8VCH8 [293-307]"	"Q8VCH8 1xBiotin [K299]"	"UBX domain-containing protein 4 [OS=Mus musculus]"	"2"	"1782.98946"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"-0.09"	"-0.18"	""	"110.3"	"117.2"	"104.2"	"165.0"	"103.3"	""	"30848.060546875"	"32775.38671875"	"29156.04296875"	"46149.30078125"	"28885.41796875"	""	"Not Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"3"	"595.00119"	"0.0001873"	"0.002409"	"2.42"	"34.51"
"483"	"[K].AGAKEETWK.[L]"	"1xBiotin [K4]"	"0.0412212"	"0.00104877"	"1"	"1"	"1"	"O35379"	"O35379 [934-942]"	"O35379 1xBiotin [K937]"	"Multidrug resistance-associated protein 1 [OS=Mus musculus]"	"1"	"1245.59323"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"2"	"623.30014"	"0.0001873"	"0.00507"	"1.88"	""
"24457"	"[R].SRPGESAGGDAGWPNKHTLR.[I]"	"1xBiotin [K16]"	"0.0416912"	"0.00104877"	"1"	"1"	"1"	"Q5MJS3"	"Q5MJS3 [65-84]"	"Q5MJS3 1xBiotin [K80]"	"Extracellular serine/threonine protein kinase FAM20C [OS=Mus musculus]"	"1"	"2319.10472"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"4"	"580.53168"	"0.0001873"	"0.005166"	"2.27"	""
"492"	"[R].AGASSMKLPLNK.[F]"	"1xBiotin [K7]; 1xOxidation [M6]"	"0.0179684"	"0.000586377"	"1"	"1"	"2"	"Q91VH2"	"Q91VH2 [196-207]"	"Q91VH2 1xBiotin [K202]"	"Sorting nexin-9 [OS=Mus musculus]"	"1"	"1458.74433"	""	""	"9.97"	"9.97"	""	""	""	""	""	""	"369.5"	"230.5"	""	""	""	""	"10655.6484375"	"6646.75048828125"	""	""	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"Not Found"	"High"	"2"	"729.87503"	"0.0001108"	"0.001492"	"2.42"	"33.85"
"547"	"[K].AGKGGPTPQEAIQR.[L]"	"1xBiotin [K3]"	"0.027975"	"0.00104877"	"1"	"1"	"2"	"Q9D8B3"	"Q9D8B3 [15-28]"	"Q9D8B3 1xBiotin [K17]"	"Charged multivesicular body protein 4b [OS=Mus musculus]"	"1"	"1635.82715"	"9.97"	""	""	"9.97"	"9.97"	"-0.49"	"9.97"	""	"270.0"	""	""	"137.5"	"192.4"	""	"9390.365234375"	""	""	"4781.84814453125"	"6692.177734375"	""	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"2"	"818.41679"	"0.0001873"	"0.002861"	"2.13"	"30.83"
"26465"	"[K].VEKYEISPEAYER.[R]"	"1xBiotin [K3]"	"0.0315454"	"0.00104877"	"1"	"1"	"1"	"Q9D1E6"	"Q9D1E6 [104-116]"	"Q9D1E6 1xBiotin [K106]"	"tubulin-folding cofactor B [OS=Mus musculus]"	"1"	"1838.86293"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"2"	"919.93671"	"0.0001873"	"0.003421"	"1.90"	""
"807"	"[R].AKVIAAEGEMNASR.[A]"	"1xBiotin [K2]; 1xOxidation [M10]"	"0.0964872"	"0.00379267"	"1"	"1"	"1"	"P54116"	"P54116 [219-232]"	"P54116 1xBiotin [K220]"	"erythrocyte band 7 integral membrane protein [OS=Mus musculus]"	"1"	"1688.80945"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"2"	"844.90884"	"0.0008081"	"0.0182"	"1.79"	""
"26469"	"[R].VELGEKPLR.[I]"	"1xBiotin [K6]"	"0.0100749"	"0.000586377"	"1"	"2"	"3"	"Q3U7R1"	"Q3U7R1 [174-182]"	"Q3U7R1 1xBiotin [K179]"	"Extended synaptotagmin-1 [OS=Mus musculus]"	"0"	"1266.68747"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"2"	"633.84731"	"0.0001108"	"0.0006356"	"2.10"	""
"26496"	"[K].VEQKYNK.[L]"	"1xBiotin [K4]"	"0.0706224"	"0.00241047"	"1"	"3"	"4"	"Q9EQU5"	"Q9EQU5 [68-74]"	"Q9EQU5 1xBiotin [K71]"	"Protein SET [OS=Mus musculus]"	"1"	"1134.56121"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"-0.48"	"-0.70"	""	"116.7"	"136.4"	"125.4"	"137.7"	"83.8"	""	"9364.9033203125"	"10951.67578125"	"10069.5244140625"	"11051.744140625"	"6725.0732421875"	""	"Not Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"2"	"567.78438"	"0.000415"	"0.01137"	"1.42"	"22.53"
"26529"	"[K].VFGALKGAVDGGLSIPHSTK.[R]"	"1xBiotin [K6]"	"0.0814973"	"0.00241047"	"1"	"1"	"1"	"P47962"	"P47962 [159-178]"	"P47962 1xBiotin [K164]"	"60S ribosomal protein L5 [OS=Mus musculus]"	"1"	"2180.15323"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"3"	"727.38912"	"0.000415"	"0.0141"	"1.90"	""
"761"	"[K].AKMQASIEK.[G]"	"1xBiotin [K2]"	"0.00719476"	"0.000586377"	"1"	"1"	"2"	"Q61937"	"Q61937 [247-255]"	"Q61937 1xBiotin [K248]"	"Nucleophosmin [OS=Mus musculus]"	"1"	"1231.61734"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"-0.32"	"-0.41"	""	"115.4"	"122.9"	"85.2"	"184.3"	"92.3"	""	"13020.5771484375"	"13866.26171875"	"9606.853515625"	"20790.501953125"	"10408.306640625"	""	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"2"	"616.31239"	"0.0001108"	"0.0003871"	"2.17"	"29.64"
"26542"	"[K].VFIDQNLSPGKGVVSLVAVHPSTVNTLGK.[Q]"	"1xBiotin [K11]"	"0.00553876"	"0.000586377"	"1"	"1"	"1"	"Q08639"	"Q08639 [16-44]"	"Q08639 1xBiotin [K26]"	"Transcription factor Dp-1 [OS=Mus musculus]"	"1"	"3202.72928"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"3"	"1068.24782"	"0.0001108"	"0.0002635"	"2.93"	""
"26560"	"[K].VFTAITKHPDEK.[R]"	"1xBiotin [K7]"	"0.0020111"	"0.000586377"	"1"	"1"	"2"	"Q8C172"	"Q8C172 [86-97]"	"Q8C172 1xBiotin [K92]"	"Ceramide synthase 6 [OS=Mus musculus]"	"1"	"1611.81994"	""	""	""	"9.97"	"9.97"	"9.97"	"9.97"	""	""	""	""	"309.3"	"290.7"	""	""	""	""	"8870.62109375"	"8334.72265625"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"2"	"806.41483"	"0.0001108"	"6.008E-05"	"2.48"	"34.53"
"26587"	"[R].VGFQYEGTYKWVNPHK.[L]"	"1xBiotin [K10]"	"0.000311345"	"0.000586377"	"1"	"1"	"3"	"Q00612"	"Q00612 [499-514]"	"Q00612 1xBiotin [K508]"	"Glucose-6-phosphate 1-dehydrogenase X [OS=Mus musculus]"	"1"	"2179.04296"	"9.97"	"9.97"	""	""	"9.97"	"0.12"	"0.68"	""	"216.8"	"147.6"	""	""	"235.7"	""	"16690.77734375"	"11361.85546875"	""	""	"18144.921875"	""	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"727.01881"	"0.0001108"	"3.964E-06"	"2.98"	"45.22"
"26611"	"[R].VGKVEHGSVALPAIMR.[S]"	"1xBiotin [K3]"	"2.24412E-05"	"0.000586377"	"1"	"1"	"2"	"P26039"	"P26039 [439-454]"	"P26039 1xBiotin [K441]"	"Talin-1 [OS=Mus musculus]"	"1"	"1890.00882"	"9.97"	"9.97"	""	""	"9.97"	"0.07"	"0.25"	""	"204.2"	"180.9"	""	""	"214.9"	""	"8026.40087890625"	"7113.3525390625"	""	""	"8449.5810546875"	""	"Not Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"630.67478"	"0.0001108"	"8.503E-08"	"3.81"	"43.22"
"26620"	"[R].VGLKAPGIIPR.[I]"	"1xBiotin [K4]"	"0.0240995"	"0.00104877"	"1"	"1"	"4"	"Q03265"	"Q03265 [172-182]"	"Q03265 1xBiotin [K175]"	"ATP synthase subunit alpha, mitochondrial [OS=Mus musculus]"	"1"	"1346.79769"	"9.97"	""	""	"9.97"	""	"-9.97"	""	""	"398.5"	""	""	"201.5"	""	""	"17180.798828125"	""	""	"8685.47265625"	""	""	"Not Found"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"2"	"673.90247"	"0.0001873"	"0.002296"	"2.12"	"44.45"
"26666"	"[K].VHLVGIDIFTGKK.[Y]"	"1xBiotin [K12]"	"0.0282973"	"0.00104877"	"1"	"2"	"2"	"Q8BGY2"	"Q8BGY2 [56-68]"	"Q8BGY2 1xBiotin [K67]"	"Eukaryotic translation initiation factor 5A-2 [OS=Mus musculus]"	"1"	"1652.91926"	""	""	""	""	"9.97"	"9.97"	"9.97"	""	""	""	""	""	"600.0"	""	""	""	""	""	"14229.958984375"	""	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"3"	"551.64438"	"0.0001873"	"0.002892"	"3.12"	"50.84"
"733"	"[R].AKGNGSSQAGAAR.[R]"	"1xBiotin [K2]"	"0.00961806"	"0.000586377"	"1"	"1"	"4"	"P35282"	"P35282 [188-200]"	"P35282 1xBiotin [K189]"	"Ras-related protein Rab-21 [OS=Mus musculus]"	"1"	"1400.66992"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"-0.54"	"-0.33"	""	"147.1"	"126.6"	"107.0"	"118.4"	"100.9"	""	"7003.234375"	"6026.86279296875"	"5092.4619140625"	"5634.8017578125"	"4805.3466796875"	""	"Not Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"2"	"700.83928"	"0.0001108"	"0.0005959"	"2.24"	"16.92"
"732"	"[K].AKGILFVGSGVSGGEEGAR.[Y]"	"1xBiotin [K2]"	"0.00803425"	"0.000586377"	"1"	"1"	"2"	"Q9DCD0"	"Q9DCD0 [118-136]"	"Q9DCD0 1xBiotin [K119]"	"6-phosphogluconate dehydrogenase, decarboxylating [OS=Mus musculus]"	"1"	"2017.01714"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"High"	"2"	"1009.01215"	"0.0001108"	"0.0004564"	"2.22"	""
"731"	"[K].AKGGWQQK.[N]"	"1xBiotin [K2]"	"0.0801672"	"0.00241047"	"1"	"1"	"1"	"Q8VHE0"	"Q8VHE0 [509-516]"	"Q8VHE0 1xBiotin [K510]"	"Translocation protein SEC63 homolog [OS=Mus musculus]"	"1"	"1128.56187"	"9.97"	"9.97"	""	"9.97"	"9.97"	"-0.32"	"0.18"	""	"184.4"	"130.6"	""	"137.3"	"147.7"	""	"26513.376953125"	"18769.2265625"	""	"19732.623046875"	"21239.244140625"	""	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"2"	"564.78441"	"0.000415"	"0.01376"	"1.62"	"27.36"
"726"	"[K].AKFENLCK.[L]"	"1xBiotin [K2]; 1xCarbamidomethyl [C7]"	"0.0122692"	"0.000586377"	"1"	"1"	"4"	"P11499"	"P11499 [558-565]"	"P11499 1xBiotin [K559]"	"Heat shock protein HSP 90-beta [OS=Mus musculus]"	"1"	"1235.59113"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"-0.42"	"0.13"	""	"141.1"	"95.9"	"112.7"	"145.1"	"105.3"	""	"21256.90625"	"14446.125"	"16981.150390625"	"21859.85546875"	"15861.7177734375"	""	"Not Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"2"	"618.29901"	"0.0001108"	"0.0008469"	"2.15"	"36.06"
"26715"	"[K].VKEGMNIVEAMER.[F]"	"1xBiotin [K2]"	"0.0664443"	"0.0019826"	"1"	"1"	"2"	"P17742"	"P17742 [132-144]"	"P17742 1xBiotin [K133]"	"peptidyl-prolyl cis-trans isomerase A [OS=Mus musculus]"	"1"	"1731.82266"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"2"	"866.41663"	"0.0003442"	"0.01033"	"2.16"	""
"26716"	"[K].VKEGMNIVEAMER.[F]"	"1xBiotin [K2]; 1xOxidation [M5]"	"0.0256702"	"0.00104877"	"1"	"1"	"1"	"P17742"	"P17742 [132-144]"	"P17742 1xBiotin [K133]"	"peptidyl-prolyl cis-trans isomerase A [OS=Mus musculus]"	"1"	"1747.81757"	""	"9.97"	""	""	""	""	"-9.97"	""	""	"600.0"	""	""	""	""	""	"10114.138671875"	""	""	""	""	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"874.41061"	"0.0001873"	"0.002511"	"1.97"	"43.45"
"26734"	"[R].VKGVTSISADTHK.[Y]"	"1xBiotin [K2]"	"0.00441445"	"0.000586377"	"1"	"1"	"2"	"Q8R0X7"	"Q8R0X7 [341-353]"	"Q8R0X7 1xBiotin [K342]"	"sphingosine-1-phosphate lyase 1 [OS=Mus musculus]"	"1"	"1568.81010"	"9.97"	""	"9.97"	"9.97"	"9.97"	"-0.35"	"9.97"	""	"197.1"	""	"139.0"	"109.6"	"154.3"	""	"20135.548828125"	""	"14204.6708984375"	"11198.0009765625"	"15766.5966796875"	""	"Not Found"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"3"	"523.60777"	"0.0001108"	"0.00019"	"2.70"	"30.58"
"26746"	"[R].VKLLLQVQHASK.[Q]"	"1xBiotin [K2]"	"0.0106763"	"0.000586377"	"2"	"2"	"1"	"P48962; P51881"	"P48962 [32-43]; P51881 [32-43]"	"P48962 1xBiotin [K33]; P51881 1xBiotin [K33]"	"ADP/ATP translocase 1 [OS=Mus musculus];ADP/ATP translocase 2 [OS=Mus musculus]"	"1"	"1589.91959"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"3"	"530.64464"	"0.0001108"	"0.0006934"	"3.16"	""
"26779"	"[K].VKSHVYSLEGQDCK.[Y]"	"1xBiotin [K2]; 1xCarbamidomethyl [C13]"	"0.00663262"	"0.000586377"	"1"	"5"	"3"	"Q6ZPR5-1"	"Q6ZPR5-1 [524-537]"	"Q6ZPR5-1 1xBiotin [K525]"	"Sphingomyelin phosphodiesterase 4 [OS=Mus musculus]"	"1"	"1875.87278"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"0.29"	"0.87"	""	"144.4"	"96.6"	"91.3"	"90.6"	"177.1"	""	"17067.330078125"	"11413.9296875"	"10790.5986328125"	"10701.8134765625"	"20919.37890625"	""	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"3"	"625.96221"	"0.0001108"	"0.0003435"	"2.99"	"30.66"
"26822"	"[R].VLAIKGR.[A]"	"1xBiotin [K5]"	"0.110959"	"0.00731053"	"1"	"1"	"2"	"Q9QXL1"	"Q9QXL1 [1628-1634]"	"Q9QXL1 1xBiotin [K1632]"	"Kinesin-like protein KIF21B [OS=Mus musculus]"	"1"	"982.58663"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"2"	"491.79663"	"0.001478"	"0.02254"	"1.55"	""
"26837"	"[K].VIATKVLGTVK.[W]"	"1xBiotin [K5]"	"0.00459798"	"0.000586377"	"1"	"1"	"2"	"P62960"	"P62960 [52-62]"	"P62960 1xBiotin [K56]"	"Nuclease-sensitive element-binding protein 1 [OS=Mus musculus]"	"1"	"1354.81267"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"2"	"677.90911"	"0.0001108"	"0.000201"	"2.48"	""
"26842"	"[K].VLATVTKTVGGDK.[N]"	"1xBiotin [K7]"	"0.0412212"	"0.00104877"	"1"	"1"	"1"	"P47911"	"P47911 [96-108]"	"P47911 1xBiotin [K102]"	"60S ribosomal protein L6 [OS=Mus musculus]"	"1"	"1514.82469"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"757.91582"	"0.0001873"	"0.005059"	"2.19"	""
"26970"	"[K].VLISVGSYKSSVESVLIK.[M]"	"1xBiotin [K9]"	"0.0213588"	"0.00104877"	"1"	"2"	"1"	"Q3UMB5"	"Q3UMB5 [410-427]"	"Q3UMB5 1xBiotin [K418]"	"Guanine nucleotide exchange protein SMCR8 [OS=Mus musculus]"	"1"	"2134.18280"	"9.97"	""	""	""	"9.97"	"0.68"	"9.97"	""	"231.1"	""	""	""	"368.9"	""	"6030.26611328125"	""	""	""	"9628.8662109375"	""	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"2"	"1067.59512"	"0.0001873"	"0.001909"	"3.12"	"59.27"
"26982"	"[K].VIMVTGDHPITAKAIAK.[GS]"	"1xBiotin [K13]; 1xOxidation [M3]"	"0.00196477"	"0.000586377"	"1"	"5"	"4"	"Q8VDN2"	"Q8VDN2 [613-629]"	"Q8VDN2 1xBiotin [K625]"	"Sodium/potassium-transporting ATPase subunit alpha-1 [OS=Mus musculus]"	"1"	"2007.07656"	"9.97"	"9.97"	""	""	"9.97"	"0.37"	"0.64"	""	"192.8"	"158.9"	""	""	"248.3"	""	"12794.4443359375"	"10547.544921875"	""	""	"16483.65234375"	""	"Not Found"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"669.69697"	"0.0001108"	"5.811E-05"	"3.15"	"38.51"
"562"	"[R].AGIKVTVAGLAGK.[D]"	"1xBiotin [K4]"	"0.0908999"	"0.00334029"	"1"	"1"	"1"	"Q99LX0"	"Q99LX0 [29-41]"	"Q99LX0 1xBiotin [K32]"	"protein/nucleic acid deglycase DJ-1 [OS=Mus musculus]"	"1"	"1410.81373"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"705.91102"	"0.0007348"	"0.01664"	"2.18"	""
"27018"	"[K].VIPELNGKLTGMAFR.[V]"	"1xBiotin [K8]"	"0.0784252"	"0.00241047"	"1"	"1"	"2"	"P16858"	"P16858 [218-232]"	"P16858 1xBiotin [K225]"	"glyceraldehyde-3-phosphate dehydrogenase [OS=Mus musculus]"	"1"	"1871.98702"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"2"	"936.49957"	"0.000415"	"0.01332"	"2.33"	""
"549"	"[R].AGKIVVNLTGR.[L]"	"1xBiotin [K3]"	"0.0144274"	"0.000586377"	"1"	"1"	"1"	"P62245"	"P62245 [58-68]"	"P62245 1xBiotin [K60]"	"40S ribosomal protein S15a [OS=Mus musculus]"	"1"	"1353.76712"	"9.97"	""	""	""	""	"-9.97"	""	""	"600.0"	""	""	""	""	""	"11885.66015625"	""	""	""	""	""	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"677.38744"	"0.0001108"	"0.001077"	"2.51"	"42.43"
"528"	"[K].AGGGSQDFGAGLKYNSR.[L]"	"1xBiotin [K13]"	"0.0209932"	"0.00104877"	"1"	"1"	"1"	"P56677"	"P56677 [9-25]"	"P56677 1xBiotin [K21]"	"Suppressor of tumorigenicity 14 protein homolog [OS=Mus musculus]"	"1"	"1910.88137"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"955.94450"	"0.0001873"	"0.001863"	"2.56"	""
"24307"	"[K].SPTTTQSPKSSFLASLNPK.[T]"	"1xBiotin [K9]"	"0.0177622"	"0.000586377"	"1"	"1"	"1"	"G5E870"	"G5E870 [1063-1081]"	"G5E870 1xBiotin [K1071]"	"E3 ubiquitin-protein ligase TRIP12 [OS=Mus musculus]"	"1"	"2217.12199"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"1109.06522"	"0.0001108"	"0.001455"	"2.41"	""
"9724"	"[K].HFLELKSFK.[D]"	"1xBiotin [K6]"	"0.0320905"	"0.00104877"	"1"	"1"	"1"	"Q8R092"	"Q8R092 [235-243]"	"Q8R092 1xBiotin [K240]"	"Uncharacterized protein C1orf43 homolog [OS=Mus musculus]"	"1"	"1374.72385"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"687.86569"	"0.0001873"	"0.003489"	"2.17"	""
"23069"	"[K].SADKNLEIIVTNGYK.[G]"	"1xBiotin [K4]"	"0.0482925"	"0.00154748"	"1"	"3"	"1"	"Q5XG73"	"Q5XG73 [217-231]"	"Q5XG73 1xBiotin [K220]"	"Acyl-CoA-binding domain-containing protein 5 [OS=Mus musculus]"	"1"	"1890.96297"	""	""	"9.97"	""	""	""	""	""	""	""	"600.0"	""	""	""	""	""	"9555.017578125"	""	""	""	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"2"	"945.98493"	"0.0002716"	"0.006423"	"1.96"	"48.26"
"3286"	"[K].DGQENGHITTKAVK.[A]"	"1xBiotin [K11]"	"0.00283601"	"0.000586377"	"1"	"1"	"5"	"Q07113"	"Q07113 [2374-2387]"	"Q07113 1xBiotin [K2384]"	"Cation-independent mannose-6-phosphate receptor [OS=Mus musculus]"	"1"	"1723.84319"	"9.97"	""	""	"9.97"	"9.97"	"-0.30"	"9.97"	""	"206.6"	""	""	"225.3"	"168.0"	""	"26854.1650390625"	""	""	"29282.6171875"	"21839.3334960938"	""	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"2"	"862.42608"	"0.0001108"	"9.906E-05"	"3.55"	"27.33"
"21126"	"[K].QIENVVDKTFFHQENVR.[A]"	"1xBiotin [K8]"	"0.00132963"	"0.000586377"	"1"	"2"	"1"	"Q3UM18"	"Q3UM18 [573-589]"	"Q3UM18 1xBiotin [K580]"	"Large subunit GTPase 1 homolog [OS=Mus musculus]"	"1"	"2329.13938"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"3"	"777.05003"	"0.0001108"	"3.287E-05"	"3.78"	""
"23576"	"[K].SGSASPAPGDTLPWNLPKHER.[S]"	"1xBiotin [K18]"	"0.00636818"	"0.000586377"	"1"	"1"	"3"	"Q91ZU6-6"	"Q91ZU6-6 [166-186]"	"Q91ZU6-6 1xBiotin [K183]"	"Isoform 6 of Dystonin [OS=Mus musculus]"	"1"	"2443.18230"	"9.97"	"9.97"	""	""	""	"-9.97"	"-9.97"	""	"190.8"	"409.2"	""	""	""	""	"22156.927734375"	"47533.66796875"	""	""	""	""	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"3"	"815.06594"	"0.0001108"	"0.0003239"	"2.95"	"44.53"
"3259"	"[K].DGKNNVADITGPIILQTYR.[A]"	"1xBiotin [K3]"	"0.00231293"	"0.000586377"	"1"	"1"	"3"	"Q09014"	"Q09014 [144-162]"	"Q09014 1xBiotin [K146]"	"Neutrophil cytosol factor 1 [OS=Mus musculus]"	"1"	"2314.18599"	""	"9.97"	""	""	"9.97"	"9.97"	"0.68"	""	""	"230.7"	""	""	"369.3"	""	""	"6059.1259765625"	""	""	"9701.91015625"	""	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"772.06632"	"0.0001108"	"7.382E-05"	"3.16"	"54.18"
"21042"	"[K].QKPSASAASSANVTTEEK.[Q]"	"1xBiotin [K2]"	"0.0461609"	"0.00154748"	"1"	"3"	"3"	"Q3U3D7-1"	"Q3U3D7-1 [987-1004]"	"Q3U3D7-1 1xBiotin [K988]"	"Transmembrane protein 131-like [OS=Mus musculus]"	"0"	"2031.96516"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"2"	"1016.48610"	"0.0002716"	"0.006008"	"1.43"	""
"3857"	"[K].DQGLPVWNPKLSLDEVKPEGTR.[K]"	"1xBiotin [K10]"	"0.00597369"	"0.000586377"	"1"	"1"	"1"	"Q8C0G2"	"Q8C0G2 [438-459]"	"Q8C0G2 1xBiotin [K447]"	"TRAF3-interacting JNK-activating modulator [OS=Mus musculus]"	"1"	"2704.37631"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"3"	"902.13055"	"0.0001108"	"0.0002964"	"3.18"	""
"3135"	"[K].DEVDGGPAGPPGGAAKTR.[R]"	"1xBiotin [K16]"	"0.000255351"	"0.000586377"	"1"	"1"	"6"	"Q8VEK0"	"Q8VEK0 [9-26]"	"Q8VEK0 1xBiotin [K24]"	"Cell cycle control protein 50A [OS=Mus musculus]"	"1"	"1877.88104"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"-0.34"	"0.75"	""	"182.6"	"85.8"	"103.9"	"83.9"	"143.8"	""	"9402.138671875"	"4416.1640625"	"5351.0078125"	"4317.67236328125"	"7406.37646484375"	""	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"939.44425"	"0.0001108"	"2.956E-06"	"2.58"	"30.02"
"20870"	"[R].QGKIPDEELR.[Q]"	"1xBiotin [K3]"	"0.0273413"	"0.00104877"	"1"	"2"	"1"	"Q62419"	"Q62419 [175-184]"	"Q62419 1xBiotin [K177]"	"Endophilin-A2 [OS=Mus musculus]"	"1"	"1410.70457"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"2"	"705.85664"	"0.0001873"	"0.002771"	"2.30"	""
"23628"	"[K].SHKTVFVLSENFVR.[S]"	"1xBiotin [K3]"	"0.0270297"	"0.00104877"	"1"	"1"	"3"	"Q9QUN7"	"Q9QUN7 [696-709]"	"Q9QUN7 1xBiotin [K698]"	"toll-like receptor 2 [OS=Mus musculus]"	"1"	"1888.97381"	"9.97"	"9.97"	""	""	"9.97"	"-0.79"	"-0.62"	""	"243.6"	"215.9"	""	""	"140.5"	""	"8746.65625"	"7754.77392578125"	""	""	"5045.98388671875"	""	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"630.32932"	"0.0001873"	"0.002713"	"2.84"	"49.08"
"20838"	"[R].QGAIVAVTGDGVNDSPALKK.[A]"	"1xBiotin [K20]"	"0.0197046"	"0.000586377"	"1"	"3"	"2"	"Q8VDN2"	"Q8VDN2 [708-727]"	"Q8VDN2 1xBiotin [K727]"	"Sodium/potassium-transporting ATPase subunit alpha-1 [OS=Mus musculus]"	"1"	"2166.12233"	""	""	"9.97"	"9.97"	""	""	""	""	""	""	"287.3"	"312.7"	""	""	""	""	"8581.3154296875"	"9336.9599609375"	""	""	"Not Found"	"High"	"Not Found"	"Peak Found"	"High"	"Not Found"	"High"	"3"	"722.71283"	"0.0001108"	"0.001695"	"2.93"	"40.92"
"3131"	"[R].DETEFYLGKR.[C]"	"1xBiotin [K9]"	"0.0391689"	"0.00104877"	"1"	"1"	"1"	"O55142"	"O55142 [37-46]"	"O55142 1xBiotin [K45]"	"60S ribosomal protein L35a [OS=Mus musculus]"	"1"	"1483.68859"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"2"	"742.34805"	"0.0001873"	"0.004706"	"1.45"	""
"3114"	"[R].DEQNEKGLYINR.[G]"	""	"0.0860801"	"0.00288886"	"1"	"1"	"1"	"Q8C1F5"	"Q8C1F5 [317-328]"	""	"Tetratricopeptide repeat protein 16 [OS=Mus musculus]"	"1"	"1478.72340"	""	"9.97"	""	""	""	""	"-9.97"	""	""	"600.0"	""	""	""	""	""	"11783.0849609375"	""	""	""	""	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"3"	"493.57945"	"0.0004957"	"0.0153"	"2.51"	"26.81"
"3065"	"[R].DEGSKAFFK.[G]"	"1xBiotin [K5]"	"0.0258179"	"0.00104877"	"1"	"1"	"4"	"P51881"	"P51881 [264-272]"	"P51881 1xBiotin [K268]"	"ADP/ATP translocase 2 [OS=Mus musculus]"	"1"	"1254.58233"	"9.97"	""	"9.97"	"9.97"	""	"-9.97"	""	""	"217.9"	""	"169.3"	"212.8"	""	""	"13613.3037109375"	""	"10574.837890625"	"13296.8125"	""	""	"Not Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"2"	"627.79460"	"0.0001873"	"0.002526"	"2.29"	"41.34"
"3942"	"[K].DRVDKSAVGFNEMEAPTTAYK.[K]"	"1xBiotin [K5]"	"0.0367947"	"0.00104877"	"1"	"1"	"1"	"P49710"	"P49710 [203-223]"	"P49710 1xBiotin [K207]"	"Hematopoietic lineage cell-specific protein [OS=Mus musculus]"	"2"	"2555.19048"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"3"	"852.40300"	"0.0001873"	"0.004269"	"3.82"	""
"23665"	"[R].SHSKPFSALTAK.[S]"	"1xBiotin [K4]"	"0.0505185"	"0.00154748"	"1"	"2"	"3"	"Q9WU40-1"	"Q9WU40-1 [296-307]"	"Q9WU40-1 1xBiotin [K299]"	"inner nuclear membrane protein Man1 [OS=Mus musculus]"	"0"	"1499.76751"	""	"9.97"	"9.97"	"9.97"	""	""	"-9.97"	""	""	"200.8"	"271.6"	"127.6"	""	""	""	"14287.2685546875"	"19321.98046875"	"9076.986328125"	""	""	"Not Found"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"High"	"3"	"500.59387"	"0.0002716"	"0.006872"	"2.06"	"36.43"
"23731"	"[K].SKGNYDEGFGR.[K]"	"1xBiotin [K2]"	"0.00484517"	"0.000586377"	"1"	"1"	"4"	"Q8BGB5"	"Q8BGB5 [99-109]"	"Q8BGB5 1xBiotin [K100]"	"LIM domain-containing protein 2 [OS=Mus musculus]"	"1"	"1455.63214"	""	"9.97"	""	"9.97"	"9.97"	"9.97"	"-0.12"	""	""	"219.2"	""	"178.4"	"202.4"	""	""	"20742.67578125"	""	"16875.419921875"	"19146.71875"	""	"Not Found"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"2"	"728.31986"	"0.0001108"	"0.0002168"	"2.42"	"33.84"
"20825"	"[R].QFVFKEPQLVVR.[A]"	"1xBiotin [K5]"	"0.00184278"	"0.000586377"	"1"	"1"	"4"	"Q8K1E6"	"Q8K1E6 [53-64]"	"Q8K1E6 1xBiotin [K57]"	"alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 [OS=Mus musculus]"	"1"	"1715.93016"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"2"	"858.46912"	"0.0001108"	"5.31E-05"	"2.84"	""
"20539"	"[K].QAQIVVKPR.[V]"	"1xBiotin [K7]"	"0.0899165"	"0.00334029"	"1"	"2"	"1"	"Q9CR29-1"	"Q9CR29-1 [108-116]"	"Q9CR29-1 1xBiotin [K114]"	"Coiled-coil domain-containing protein 43 [OS=Mus musculus]"	"0"	"1264.71944"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"632.86343"	"0.000655"	"0.01638"	"1.71"	""
"20510"	"[R].QALLKKPK.[K]"	"1xBiotin [K]"	"0.0088163"	"0.000586377"	"1"	"1"	"5"	"Q99JY1"	"Q99JY1 [27-34]"	"Q99JY1 1xBiotin [K]"	"Toll/interleukin-1 receptor domain-containing adapter protein [OS=Mus musculus]"	"1"	"1151.69691"	""	""	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	""	""	""	"154.7"	"267.7"	"177.6"	""	""	""	"88450.546875"	"153016.1171875"	"101514.333984375"	""	"Not Found"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"2"	"576.35179"	"0.0001108"	"0.000522"	"2.92"	"26.79"
"23537"	"[K].SGKYVLGYK.[Q]"	"1xBiotin [K3]"	"0.120809"	"0.00731053"	"1"	"1"	"1"	"P62889"	"P62889 [24-32]"	"P62889 1xBiotin [K26]"	"60S ribosomal protein L30 [OS=Mus musculus]"	"1"	"1240.63946"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"2"	"620.82280"	"0.001478"	"0.02575"	"1.59"	""
"20347"	"[R].NVMILTNPVAAKK.[N]"	"1xBiotin [K12]; 1xOxidation [M3]"	"0.0884598"	"0.00334029"	"1"	"2"	"1"	"P47226-1"	"P47226-1 [95-107]"	"P47226-1 1xBiotin [K106]"	"Testin [OS=Mus musculus]"	"1"	"1640.88624"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"820.94735"	"0.000655"	"0.016"	"2.33"	""
"23530"	"[R].SGKGTEGAAATSSSCLYR.[C]"	"1xBiotin [K3]; 1xCarbamidomethyl [C15]"	"0.0428891"	"0.00104877"	"1"	"1"	"1"	"Q9D0U9"	"Q9D0U9 [11-28]"	"Q9D0U9 1xBiotin [K13]"	"Protein arv1 [OS=Mus musculus]"	"1"	"2028.91135"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"1014.96007"	"0.0001873"	"0.005373"	"2.45"	""
"23512"	"[K].SGFNSKSGQR.[G]"	"1xBiotin [K6]"	"0.0607819"	"0.0019826"	"1"	"5"	"2"	"Q9Z204"	"Q9Z204 [171-180]"	"Q9Z204 1xBiotin [K176]"	"Heterogeneous nuclear ribonucleoproteins C1/C2 [OS=Mus musculus]"	"1"	"1293.60044"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"0.25"	"-0.35"	""	"95.0"	"144.0"	"109.8"	"138.2"	"112.9"	""	"5358.3603515625"	"8118.56689453125"	"6190.763671875"	"7793.68798828125"	"6367.92626953125"	""	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"2"	"647.30341"	"0.0003442"	"0.009098"	"1.68"	"25.85"
"3542"	"[R].DIMNDSNYVVKGNAR.[L]"	"1xBiotin [K11]"	"0.0431326"	"0.00104877"	"1"	"1"	"1"	"P09581"	"P09581 [800-814]"	"P09581 1xBiotin [K810]"	"Macrophage colony-stimulating factor 1 receptor [OS=Mus musculus]"	"1"	"1921.88949"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"2"	"961.44465"	"0.0001873"	"0.00543"	"2.57"	""
"21927"	"[K].QYDQFGDDKSQAAR.[H]"	"1xBiotin [K9]"	"0.000275461"	"0.000586377"	"1"	"1"	"5"	"Q9QYI4"	"Q9QYI4 [170-183]"	"Q9QYI4 1xBiotin [K178]"	"DnaJ homolog subfamily B member 12 [OS=Mus musculus]"	"1"	"1854.80754"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"2"	"927.90764"	"0.0001108"	"3.311E-06"	"3.32"	""
"23052"	"[R].SAAETVTKGGIMLPEK.[S]"	"1xBiotin [K8]; 1xOxidation [M12]"	"0.0120579"	"0.000586377"	"1"	"1"	"2"	"Q64433"	"Q64433 [21-36]"	"Q64433 1xBiotin [K28]"	"10 kDa heat shock protein, mitochondrial [OS=Mus musculus]"	"1"	"1873.93980"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"2"	"937.47371"	"0.0001108"	"0.0008279"	"3.01"	""
"3653"	"[K].DMDATSELKNK.[T]"	"1xBiotin [K9]"	"0.00550664"	"0.000586377"	"1"	"1"	"1"	"Q8K273"	"Q8K273 [69-79]"	"Q8K273 1xBiotin [K77]"	"Membrane magnesium transporter 1 [OS=Mus musculus]"	"1"	"1477.66614"	""	""	""	"9.97"	""	""	""	""	""	""	""	"600.0"	""	""	""	""	""	"6539.2197265625"	""	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"2"	"739.33594"	"0.0001108"	"0.000263"	"2.15"	"34.81"
"3654"	"[K].DMDATSELKNK.[T]"	"1xBiotin [K9]; 1xOxidation [M2]"	"0.00984384"	"0.000586377"	"1"	"1"	"1"	"Q8K273"	"Q8K273 [69-79]"	"Q8K273 1xBiotin [K77]"	"Membrane magnesium transporter 1 [OS=Mus musculus]"	"1"	"1493.66106"	"9.97"	""	"9.97"	""	"9.97"	"-0.05"	"9.97"	""	"184.7"	""	"237.2"	""	"178.1"	""	"8434.7392578125"	""	"10830.52734375"	""	"8132.5478515625"	""	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"2"	"747.33385"	"0.0001108"	"0.0006151"	"2.24"	"30.60"
"3448"	"[K].DLAGSIIGKGGQR.[I]"	"1xBiotin [K9]"	"0.0326448"	"0.00104877"	"1"	"3"	"1"	"P61979"	"P61979 [397-409]"	"P61979 1xBiotin [K405]"	"Heterogeneous nuclear ribonucleoprotein K [OS=Mus musculus]"	"1"	"1497.78422"	"9.97"	"9.97"	""	"9.97"	""	"-9.97"	"-9.97"	""	"307.3"	"151.9"	""	"140.8"	""	""	"15865.0771484375"	"7840.9560546875"	""	"7265.4013671875"	""	""	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"Not Found"	"High"	"2"	"749.39524"	"0.0001873"	"0.003597"	"2.80"	"44.10"
"21530"	"[R].QQCGSQPKLCDYR.[C]"	"1xBiotin [K8]; 2xCarbamidomethyl [C3; C10]"	"0.105175"	"0.00705524"	"1"	"1"	"2"	"Q9R1C6"	"Q9R1C6 [140-152]"	"Q9R1C6 1xBiotin [K147]"	"Diacylglycerol kinase epsilon [OS=Mus musculus]"	"1"	"1865.80913"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"2"	"933.40796"	"0.001278"	"0.02074"	"1.25"	""
"3701"	"[K].DMVAEIEWFGAKGIDKEEER.[M]"	"1xBiotin [K12]"	"0.00478912"	"0.000586377"	"1"	"1"	"2"	"Q8VBT6"	"Q8VBT6 [222-241]"	"Q8VBT6 1xBiotin [K233]"	"Apolipoprotein B receptor [OS=Mus musculus]"	"2"	"2578.19524"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"3"	"860.06868"	"0.0001108"	"0.0002132"	"3.00"	""
"23115"	"[K].SAIAKQAADQMK.[N]"	"1xBiotin [K5]"	"0.0347582"	"0.00104877"	"1"	"1"	"1"	"P26043"	"P26043 [401-412]"	"P26043 1xBiotin [K405]"	"radixin [OS=Mus musculus]"	"1"	"1487.73449"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"2"	"744.37146"	"0.0001873"	"0.003931"	"2.27"	""
"21259"	"[K].QLSKYDSQLSSNEEK.[V]"	"1xBiotin [K4]"	"0.0174574"	"0.000586377"	"1"	"1"	"2"	"Q8C145"	"Q8C145 [479-493]"	"Q8C145 1xBiotin [K482]"	"Zinc transporter ZIP6 [OS=Mus musculus]"	"1"	"1981.91715"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"High"	"2"	"991.46268"	"0.0001108"	"0.001427"	"1.93"	""
"23121"	"[K].SAIKTVGLQTR.[T]"	"1xBiotin [K4]"	"0.00707044"	"0.000586377"	"1"	"2"	"1"	"O70503-1"	"O70503-1 [258-268]"	"O70503-1 1xBiotin [K261]"	"Very-long-chain 3-oxoacyl-CoA reductase [OS=Mus musculus]"	"1"	"1399.77259"	"9.97"	""	""	""	"9.97"	"0.24"	"9.97"	""	"275.2"	""	""	""	"324.8"	""	"31455.95703125"	""	""	""	"37118.34375"	""	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"2"	"700.38982"	"0.0001108"	"0.0003778"	"2.42"	"36.93"
"23199"	"[K].SCEAGYSPSYKEDK.[H]"	"1xBiotin [K11]; 1xCarbamidomethyl [C2]"	"0.0671862"	"0.0019826"	"1"	"1"	"1"	"P10605"	"P10605 [210-223]"	"P10605 1xBiotin [K220]"	"Cathepsin B [OS=Mus musculus]"	"1"	"1846.76223"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"2"	"923.88573"	"0.0003442"	"0.01052"	"1.94"	""
"3736"	"[K].DNPKVVHAFDMEDLGDK.[A]"	"1xBiotin [K4]"	"0.118904"	"0.00731053"	"1"	"1"	"1"	"Q91WS0"	"Q91WS0 [52-68]"	"Q91WS0 1xBiotin [K55]"	"CDGSH iron-sulfur domain-containing protein 1 [OS=Mus musculus]"	"1"	"2155.97870"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"3"	"719.33098"	"0.001478"	"0.02505"	"1.55"	""
"21210"	"[R].QINWTVLYR.[R]"	""	"0.00803425"	"0.000586377"	"1"	"1"	"4"	"Q8BP67"	"Q8BP67 [48-56]"	""	"60S ribosomal protein L24 [OS=Mus musculus]"	"0"	"1192.64732"	""	""	""	"9.97"	"9.97"	"9.97"	"9.97"	""	""	""	""	"255.5"	"344.5"	""	""	""	""	"9121.8935546875"	"12296.45703125"	""	"Not Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"2"	"596.82714"	"0.0001108"	"0.0004576"	"2.40"	"47.12"
"3411"	"[K].DKNTNYEGLASK.[F]"	"1xBiotin [K2]"	"0.00431287"	"0.000586377"	"1"	"1"	"1"	"Q9R1C6"	"Q9R1C6 [198-209]"	"Q9R1C6 1xBiotin [K199]"	"Diacylglycerol kinase epsilon [OS=Mus musculus]"	"1"	"1565.72643"	""	""	""	"9.97"	"9.97"	"9.97"	"9.97"	""	""	""	""	"303.0"	"297.0"	""	""	""	""	"10152"	"9947.861328125"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"2"	"783.36647"	"0.0001108"	"0.0001836"	"2.09"	"33.41"
"23388"	"[K].SEKTAWTFSR.[K]"	"1xBiotin [K3]"	"0.0464223"	"0.00154748"	"1"	"1"	"2"	"Q9CPU0"	"Q9CPU0 [86-95]"	"Q9CPU0 1xBiotin [K88]"	"lactoylglutathione lyase [OS=Mus musculus]"	"1"	"1438.67836"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"2"	"719.84237"	"0.0002716"	"0.00606"	"1.46"	""
"23438"	"[K].SEVLGTQSKAFYK.[T]"	"1xBiotin [K9]"	"0.00258365"	"0.000586377"	"1"	"1"	"2"	"Q9CQW1"	"Q9CQW1 [174-186]"	"Q9CQW1 1xBiotin [K182]"	"Synaptobrevin homolog YKT6 [OS=Mus musculus]"	"1"	"1683.84107"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"842.42434"	"0.0001108"	"8.676E-05"	"2.39"	""
"23490"	"[R].SFVYAKGLSADSPASDGSK.[N]"	"1xBiotin [K6]"	"0.0443703"	"0.00104877"	"1"	"2"	"1"	"E9PVX6"	"E9PVX6 [151-169]"	"E9PVX6 1xBiotin [K156]"	"Proliferation marker protein Ki-67 [OS=Mus musculus]"	"1"	"2112.99065"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"2"	"1056.99970"	"0.0001873"	"0.005657"	"1.72"	""
"23507"	"[K].SGENPEQDEAQKNFMDTYR.[N]"	"1xBiotin [K12]"	"0.000796044"	"0.000586377"	"1"	"1"	"2"	"Q61263"	"Q61263 [10-28]"	"Q61263 1xBiotin [K21]"	"sterol O-acyltransferase 1 [OS=Mus musculus]"	"1"	"2485.03946"	""	""	"9.97"	"9.97"	""	""	""	""	""	""	"165.5"	"434.5"	""	""	""	""	"9594.546875"	"25186.20703125"	""	""	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Not Found"	"High"	"2"	"1243.02288"	"0.0001108"	"1.549E-05"	"2.05"	"42.07"
"23514"	"[K].SGGDKMFSLK.[K]"	"1xBiotin [K5]"	"0.00600852"	"0.000586377"	"1"	"1"	"1"	"Q9WTZ1"	"Q9WTZ1 [24-33]"	"Q9WTZ1 1xBiotin [K28]"	"RING-box protein 2 [OS=Mus musculus]"	"1"	"1295.61225"	"9.97"	"9.97"	"9.97"	"9.97"	""	"-9.97"	"-9.97"	""	"146.8"	"114.3"	"115.2"	"223.7"	""	""	"9198.517578125"	"7163.65869140625"	"7222.19775390625"	"14022.6796875"	""	""	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"High"	"2"	"648.30986"	"0.0001108"	"0.0002991"	"1.69"	"42.59"
"2863"	"[K].DASGNKVK.[A]"	"1xBiotin [K6]"	"0.0657102"	"0.0019826"	"1"	"1"	"2"	"P09411"	"P09411 [134-141]"	"P09411 1xBiotin [K139]"	"phosphoglycerate kinase 1 [OS=Mus musculus]"	"1"	"1044.51426"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"-0.32"	"0.24"	""	"138.9"	"94.2"	"127.4"	"128.3"	"111.1"	""	"7552.8251953125"	"5122.330078125"	"6923.9150390625"	"6976.275390625"	"6041.2421875"	""	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"2"	"522.76084"	"0.0003442"	"0.01019"	"1.50"	"21.10"
"3563"	"[R].DLPIYTTSASKAIR.[Y]"	"1xBiotin [K11]"	"0.0341689"	"0.00104877"	"1"	"2"	"1"	"Q5Y5T1"	"Q5Y5T1 [113-126]"	"Q5Y5T1 1xBiotin [K123]"	"Probable palmitoyltransferase ZDHHC20 [OS=Mus musculus]"	"1"	"1761.92038"	"9.97"	""	""	""	""	"-9.97"	""	""	"600.0"	""	""	""	""	""	"351557.71875"	""	""	""	""	""	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"881.46458"	"0.0001873"	"0.003834"	"2.33"	"45.63"
"23754"	"[K].SKNPWYIDEVAEDPAK.[S]"	"1xBiotin [K2]"	"0.0754612"	"0.00241047"	"1"	"2"	"1"	"Q80TQ2-1"	"Q80TQ2-1 [367-382]"	"Q80TQ2-1 1xBiotin [K368]"	"Ubiquitin carboxyl-terminal hydrolase CYLD [OS=Mus musculus]"	"1"	"2087.97427"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"2"	"1044.49060"	"0.000415"	"0.01257"	"2.38"	""
"20292"	"[R].NVDANNTENSTTVKNSSLLSGFR.[G]"	"1xBiotin [K14]"	"0.00267554"	"0.000586377"	"1"	"5"	"2"	"A2AAE1-1"	"A2AAE1-1 [4775-4797]"	"A2AAE1-1 1xBiotin [K4788]"	"Uncharacterized protein KIAA1109 [OS=Mus musculus]"	"1"	"2694.27878"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"3"	"898.76451"	"0.0001108"	"9.139E-05"	"3.24"	""
"4103"	"[K].DTGPSGFKDLFSLKPDQSNVR.[R]"	"1xBiotin [K8]"	"0.0671862"	"0.0019826"	"1"	"1"	"1"	"Q9WVL3"	"Q9WVL3 [995-1015]"	"Q9WVL3 1xBiotin [K1002]"	"Solute carrier family 12 member 7 [OS=Mus musculus]"	"1"	"2534.23440"	""	"9.97"	""	""	""	""	"-9.97"	""	""	"600.0"	""	""	""	""	""	"13061.7041015625"	""	""	""	""	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"3"	"845.41581"	"0.0003442"	"0.01056"	"1.90"	"54.84"
"2085"	"[R].CAPMKSISSSLK.[E]"	"1xBiotin [K5]; 1xCarbamidomethyl [C1]; 1xOxidation [M4]"	"0.00324251"	"0.000586377"	"1"	"1"	"4"	"Q8BG09"	"Q8BG09 [330-341]"	"Q8BG09 1xBiotin [K334]"	"Transmembrane protein 184B [OS=Mus musculus]"	"1"	"1550.73753"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"-0.01"	"-0.13"	""	"123.2"	"134.3"	"145.2"	"74.5"	"122.8"	""	"12602.9580078125"	"13741.0595703125"	"14848.12109375"	"7618.94189453125"	"12559.2666015625"	""	"Not Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"2"	"775.87269"	"0.0001108"	"0.0001213"	"2.43"	"34.46"
"24173"	"[R].SNWQNYR.[Q]"	""	"0.0513783"	"0.00154748"	"1"	"1"	"1"	"Q569Z6"	"Q569Z6 [109-115]"	""	"Thyroid hormone receptor-associated protein 3 [OS=Mus musculus]"	"0"	"967.43805"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"2"	"484.22256"	"0.0002716"	"0.007056"	"1.21"	""
"24142"	"[R].SNKLHFAFR.[L]"	"1xBiotin [K3]"	"0.0985957"	"0.00472246"	"1"	"1"	"1"	"P61022"	"P61022 [112-120]"	"P61022 1xBiotin [K114]"	"Calcineurin B homologous protein 1 [OS=Mus musculus]"	"1"	"1345.68339"	""	"9.97"	""	""	""	""	"-9.97"	""	""	"600.0"	""	""	""	""	""	"18318.21875"	""	""	""	""	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"3"	"449.23226"	"0.0009666"	"0.01891"	"1.77"	"42.11"
"23822"	"[K].SLALLTVEKTVSPR.[N]"	"1xBiotin [K9]"	"0.0126296"	"0.000586377"	"1"	"2"	"1"	"Q3UJD6"	"Q3UJD6 [264-277]"	"Q3UJD6 1xBiotin [K272]"	"Ubiquitin carboxyl-terminal hydrolase 19 [OS=Mus musculus]"	"1"	"1739.97242"	"9.97"	""	"9.97"	""	""	"-9.97"	""	""	"348.0"	""	"252.0"	""	""	""	"7909.00830078125"	""	"5726.8154296875"	""	""	""	"Not Found"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"2"	"870.49109"	"0.0001108"	"0.0008833"	"2.03"	"51.69"
"24301"	"[R].SPTFGKSFHFDPLSSGSR.[S]"	"1xBiotin [K6]"	"0.11579"	"0.00731053"	"1"	"2"	"1"	"Q8VDZ4"	"Q8VDZ4 [409-426]"	"Q8VDZ4 1xBiotin [K414]"	"Palmitoyltransferase ZDHHC5 [OS=Mus musculus]"	"1"	"2180.02295"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"3"	"727.34718"	"0.001478"	"0.02418"	"1.65"	""
"4052"	"[K].DSSGWSSSKDK.[D]"	"1xBiotin [K9]"	"0.036586"	"0.00104877"	"1"	"1"	"1"	"Q62167"	"Q62167 [56-66]"	"Q62167 1xBiotin [K64]"	"ATP-dependent RNA helicase DDX3X [OS=Mus musculus]"	"1"	"1409.60017"	"9.97"	"9.97"	""	"9.97"	"9.97"	"-0.57"	"-0.99"	""	"129.6"	"172.6"	""	"210.6"	"87.1"	""	"6837.427734375"	"9103.4833984375"	""	"11108.6044921875"	"4593.701171875"	""	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"High"	"2"	"705.30356"	"0.0001873"	"0.004264"	"1.93"	"29.94"
"23775"	"[K].SKSDASTPPSPK.[V]"	"1xBiotin [K2]"	"0.0203975"	"0.000586377"	"1"	"1"	"1"	"P35564"	"P35564 [47-58]"	"P35564 1xBiotin [K48]"	"Calnexin [OS=Mus musculus]"	"1"	"1427.68351"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"714.34576"	"0.0001108"	"0.001791"	"1.48"	""
"24115"	"[R].SMVKFPGGTPGR.[W]"	"1xBiotin [K4]"	"0.130059"	"0.00993825"	"1"	"1"	"1"	"Q61712"	"Q61712 [339-350]"	"Q61712 1xBiotin [K342]"	"DnaJ homolog subfamily C member 1 [OS=Mus musculus]"	"1"	"1459.71845"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"-0.45"	"-0.86"	""	"98.4"	"130.3"	"119.3"	"180.2"	"71.9"	""	"8631.490234375"	"11427.02734375"	"10465.5908203125"	"15804.7001953125"	"6307.57568359375"	""	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"2"	"730.36315"	"0.001921"	"0.0288"	"1.85"	"39.28"
"23783"	"[R].SKSYWIQMSK.[K]"	"1xBiotin [K2]; 1xOxidation [M8]"	"0.013305"	"0.000586377"	"1"	"1"	"4"	"P21855"	"P21855 [293-302]"	"P21855 1xBiotin [K294]"	"B-cell differentiation antigen CD72 [OS=Mus musculus]"	"1"	"1499.70213"	""	""	"9.97"	""	""	""	""	""	""	""	"600.0"	""	""	""	""	""	"13701.49609375"	""	""	""	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"2"	"750.35472"	"0.0001108"	"0.0009569"	"2.25"	"39.04"
"23876"	"[R].SIGSNQPFPIKPLSESK.[N]"	"1xBiotin [K11]"	"0.0313657"	"0.00104877"	"1"	"2"	"1"	"Q5Y5T1"	"Q5Y5T1 [330-346]"	"Q5Y5T1 1xBiotin [K340]"	"Probable palmitoyltransferase ZDHHC20 [OS=Mus musculus]"	"0"	"2055.05794"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"1028.03219"	"0.0001873"	"0.003383"	"2.35"	""
"23854"	"[K].SLEKVCADLIR.[G]"	"1xBiotin [K4]; 1xCarbamidomethyl [C6]"	"0.0201639"	"0.000586377"	"1"	"1"	"1"	"P60867"	"P60867 [31-41]"	"P60867 1xBiotin [K34]"	"40S ribosomal protein S20 [OS=Mus musculus]"	"1"	"1529.78145"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"2"	"765.39495"	"0.0001108"	"0.00176"	"1.73"	""
"20331"	"[K].NVLINKDIR.[C]"	"1xBiotin [K6]"	"0.013076"	"0.000586377"	"1"	"1"	"2"	"P14211"	"P14211 [154-162]"	"P14211 1xBiotin [K159]"	"Calreticulin [OS=Mus musculus]"	"1"	"1310.72492"	"9.97"	""	""	"9.97"	"9.97"	"0.03"	"9.97"	""	"204.3"	""	""	"187.5"	"208.1"	""	"11747.171875"	""	""	"10781.767578125"	"11963.7353515625"	""	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"2"	"655.86588"	"0.0001108"	"0.0009281"	"2.17"	"41.07"
"24075"	"[R].SMKGWWPCYADK.[D]"	"1xBiotin [K3]; 1xCarbamidomethyl [C8]; 1xOxidation [M2]"	"0.00137695"	"0.000586377"	"1"	"2"	"1"	"Q69ZN7-1"	"Q69ZN7-1 [1932-1943]"	"Q69ZN7-1 1xBiotin [K1934]"	"Myoferlin [OS=Mus musculus]"	"1"	"1770.74368"	"9.97"	"9.97"	""	""	"9.97"	"0.12"	"0.01"	""	"189.6"	"204.4"	""	""	"206.0"	""	"7895.03955078125"	"8510.4052734375"	""	""	"8577.2119140625"	""	"Not Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"2"	"885.87495"	"0.0001108"	"3.472E-05"	"2.00"	"46.65"
"20314"	"[K].NVKFNVWDVGGQDK.[I]"	"1xBiotin [K3]"	"0.0801672"	"0.00241047"	"1"	"1"	"1"	"P62331"	"P62331 [56-69]"	"P62331 1xBiotin [K58]"	"ADP-ribosylation factor 6 [OS=Mus musculus]"	"1"	"1831.87958"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"2"	"916.44432"	"0.000415"	"0.01375"	"1.37"	""
"27170"	"[R].VNESVIKPEQEFFTAPFEKSR.[M]"	"1xBiotin [K19]"	"0.00454478"	"0.000586377"	"1"	"1"	"1"	"Q6P9J9"	"Q6P9J9 [171-191]"	"Q6P9J9 1xBiotin [K189]"	"Anoctamin-6 [OS=Mus musculus]"	"1"	"2708.33886"	"-9.97"	"-0.16"	"-9.97"	"-9.97"	"0.05"	"9.97"	"0.21"	"204.5"	""	"183.2"	""	""	"212.3"	"13685.474609375"	""	"12259.2392578125"	""	""	"14202.6396484375"	""	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"3"	"903.45059"	"0.0001108"	"0.0001976"	"3.12"	"51.83"
"11147"	"[R].KKPSEGEEEAASAGGPQVNPMPVTDEVV.[-]"	"1xBiotin [K]; 1xOxidation [M21]"	"0.00318635"	"0.000586377"	"1"	"2"	"4"	"Q61462"	"Q61462 [165-192]"	"Q61462 1xBiotin [K]"	"Cytochrome b-245 light chain [OS=Mus musculus]"	"1"	"3094.43436"	"-9.97"	"-0.23"	"-0.20"	"-9.97"	"0.21"	"9.97"	"0.44"	"154.7"	""	"131.7"	"134.8"	""	"178.8"	"29901.66015625"	""	"25448.728515625"	"26062.87890625"	""	"34563.68359375"	""	"Peak Found"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"1032.15071"	"0.0001108"	"0.0001182"	"4.46"	"38.61"
"27369"	"[K].VQDQGKLIK.[A]"	"1xBiotin [K]"	"0.00861397"	"0.000586377"	"1"	"2"	"5"	"Q8C341-1"	"Q8C341-1 [1205-1213]"	"Q8C341-1 1xBiotin [K]"	"SUN domain-containing ossification factor [OS=Mus musculus]"	"1"	"1254.68747"	"0.47"	"0.34"	"0.54"	"0.06"	"0.16"	"-0.31"	"-0.18"	"82.6"	"114.1"	"104.5"	"120.5"	"86.2"	"92.2"	"20388.529296875"	"28175.337890625"	"25806.056640625"	"29746.978515625"	"21275.115234375"	"22756.701171875"	""	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"627.84710"	"0.0001108"	"0.0005044"	"2.79"	"32.57"
"9975"	"[R].HMYHSLYLK.[V]"	""	"0.0398418"	"0.00104877"	"1"	"1"	"1"	"P84099"	"P84099 [118-126]"	""	"60S ribosomal protein L19 [OS=Mus musculus]"	"0"	"1191.59793"	"0.90"	"0.45"	"0.77"	"1.71"	"0.73"	"-0.17"	"0.28"	"55.1"	"103.0"	"75.2"	"94.2"	"180.8"	"91.6"	"8985.6533203125"	"16790.677734375"	"12268.587890625"	"15366.40625"	"29488.818359375"	"14938.69921875"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"3"	"397.87050"	"0.0001873"	"0.004824"	"2.34"	"24.41"
"21269"	"[R].QLSYCKNDIR.[D]"	"1xBiotin [K6]; 1xCarbamidomethyl [C5]"	"0.00397538"	"0.000586377"	"1"	"3"	"1"	"Q9DBR4-1"	"Q9DBR4-1 [449-458]"	"Q9DBR4-1 1xBiotin [K454]"	"Amyloid-beta A4 precursor protein-binding family B member 2 [OS=Mus musculus]"	"1"	"1522.71409"	"0.38"	"-9.97"	"0.23"	"0.45"	"-9.97"	"-9.97"	""	"123.9"	"161.4"	""	"145.7"	"169.0"	""	"18470.4375"	"24049.9765625"	""	"21709.33203125"	"25195.380859375"	""	""	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Not Found"	"High"	"2"	"761.86118"	"0.0001108"	"0.0001622"	"2.44"	"36.03"
"9929"	"[R].HLQLAIR.[NG]"	""	"0.0301356"	"0.00104877"	"3"	"11"	"3"	"Q64523; Q8BFU2; P27661"	"Q64523 [83-89]; Q8BFU2 [83-89]; P27661 [83-89]"	""	"Histone H2A type 2-C [OS=Mus musculus];Histone H2A type 3 [OS=Mus musculus];Histone H2AX [OS=Mus musculus]"	"0"	"850.52575"	"3.91"	"-9.97"	"-9.97"	"4.67"	"4.14"	"0.23"	"9.97"	"10.2"	"152.7"	""	""	"257.9"	"179.2"	"9615.4697265625"	"144421.0625"	""	""	"243991.046875"	"169548.21875"	"NotUnique"	"Peak Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"2"	"425.76627"	"0.0001873"	"0.003197"	"2.04"	"26.84"
"27129"	"[R].VMAGKVEMTLEVLNER.[E]"	"1xBiotin [K5]; 2xOxidation [M2; M8]"	"0.000884122"	"0.000586377"	"1"	"2"	"3"	"Q69ZN7-1"	"Q69ZN7-1 [1948-1963]"	"Q69ZN7-1 1xBiotin [K1952]"	"Myoferlin [OS=Mus musculus]"	"1"	"2077.01264"	"-0.22"	"0.02"	"-9.97"	"-9.97"	"0.40"	"0.62"	"0.37"	"143.0"	"123.0"	"145.4"	""	""	"188.6"	"11770.0546875"	"10130.6962890625"	"11972.763671875"	""	""	"15526.5009765625"	""	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"693.00910"	"0.0001108"	"1.818E-05"	"3.73"	"52.68"
"19555"	"[R].NHQLYKPYTNGIIAK.[D]"	"1xBiotin [K6]"	"0.0975363"	"0.00426615"	"1"	"1"	"4"	"Q8K2C8"	"Q8K2C8 [69-83]"	"Q8K2C8 1xBiotin [K74]"	"glycerol-3-phosphate acyltransferase 4 [OS=Mus musculus]"	"0"	"1986.02658"	"1.02"	"0.19"	"0.15"	"-1.09"	"1.02"	"0.00"	"0.83"	"77.2"	"156.3"	"87.9"	"85.8"	"36.2"	"156.6"	"52576.453125"	"106376.40625"	"59813.16796875"	"58379.66796875"	"24662.919921875"	"106576.1640625"	""	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"3"	"662.68039"	"0.0008081"	"0.01856"	"2.76"	"39.61"
"27181"	"[R].VNKQASQPVK.[K]"	"1xBiotin [K3]"	"0.00366424"	"0.000586377"	"1"	"1"	"3"	"Q3UDP0"	"Q3UDP0 [375-384]"	"Q3UDP0 1xBiotin [K377]"	"WD repeat-containing protein 41 [OS=Mus musculus]"	"1"	"1324.70418"	"0.61"	"-9.97"	"0.36"	"0.14"	"0.09"	"-0.52"	"9.97"	"100.5"	"153.5"	""	"128.5"	"110.7"	"106.8"	"7028.86181640625"	"10736.8037109375"	""	"8991.240234375"	"7744.2939453125"	"7474.638671875"	""	"Peak Found"	"High"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"2"	"662.85512"	"0.0001108"	"0.0001442"	"2.45"	"23.59"
"11060"	"[K].KHLEIHTATHSQLPQPHR.[V]"	"1xBiotin [K1]"	"0.0459009"	"0.00154748"	"1"	"2"	"1"	"Q9D666-1"	"Q9D666-1 [314-331]"	"Q9D666-1 1xBiotin [K314]"	"SUN domain-containing protein 1 [OS=Mus musculus]"	"1"	"2356.20913"	"0.84"	"0.73"	"-9.97"	"-0.51"	"0.48"	"-0.36"	"-0.24"	"91.6"	"164.3"	"151.6"	""	"64.4"	"128.1"	"6117.95751953125"	"10974.4599609375"	"10120.3447265625"	""	"4297.26806640625"	"8556.892578125"	""	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"4"	"589.80791"	"0.0002716"	"0.005937"	"2.95"	"28.64"
"27147"	"[R].VMLYPSR.[I]"	"1xOxidation [M2]"	"0.110368"	"0.00731053"	"1"	"1"	"2"	"O55142"	"O55142 [103-109]"	""	"60S ribosomal protein L35a [OS=Mus musculus]"	"0"	"881.45495"	"0.28"	"0.21"	"0.79"	"-1.03"	"0.21"	"-0.07"	"-0.01"	"89.0"	"108.0"	"103.1"	"153.7"	"43.5"	"102.7"	"15547.4287109375"	"18867.81640625"	"17998.662109375"	"26839.76953125"	"7598.1318359375"	"17935.5"	""	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"2"	"441.23087"	"0.001478"	"0.02238"	"1.69"	"24.81"
"20274"	"[R].NTSTPFKGVGK.[A]"	"1xBiotin [K7]"	"0.00339713"	"0.000586377"	"1"	"3"	"5"	"Q8R092"	"Q8R092 [141-151]"	"Q8R092 1xBiotin [K147]"	"Uncharacterized protein C1orf43 homolog [OS=Mus musculus]"	"1"	"1361.68820"	"-0.04"	"0.26"	"0.45"	"0.24"	"-0.22"	"-0.17"	"-0.48"	"91.3"	"88.6"	"109.2"	"124.6"	"107.8"	"78.6"	"19178.501953125"	"18610.751953125"	"22954.767578125"	"26186.388671875"	"22653.927734375"	"16510.419921875"	""	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"2"	"681.34759"	"0.0001108"	"0.0001292"	"2.25"	"34.91"
"11024"	"[R].KGTVVAEK.[D]"	"1xBiotin [K1]"	"0.0222365"	"0.00104877"	"1"	"1"	"2"	"O89053"	"O89053 [207-214]"	"O89053 1xBiotin [K207]"	"Coronin-1A [OS=Mus musculus]"	"1"	"1057.57104"	"0.97"	"0.79"	"0.68"	"0.70"	"0.59"	"-0.38"	"-0.20"	"63.7"	"124.5"	"109.9"	"102.4"	"103.8"	"95.8"	"8916.5029296875"	"17420.05859375"	"15378.154296875"	"14326.8154296875"	"14524.7275390625"	"13404.896484375"	""	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"2"	"529.28911"	"0.0001873"	"0.002035"	"1.52"	"24.28"
"9946"	"[K].HMANQLLAKFEENTR.[N]"	"1xBiotin [K9]; 1xOxidation [M2]"	"0.00219478"	"0.000586377"	"1"	"3"	"2"	"Q8BML1"	"Q8BML1 [715-729]"	"Q8BML1 1xBiotin [K723]"	"[F-actin]-monooxygenase MICAL2 [OS=Mus musculus]"	"1"	"2043.97389"	"-0.04"	"0.24"	"-9.97"	"-9.97"	"-0.16"	"-0.12"	"-0.41"	"148.3"	"143.9"	"175.4"	""	""	"132.4"	"11916.6728515625"	"11562.810546875"	"14088.8818359375"	""	""	"10634.28125"	""	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"3"	"681.99567"	"0.0001108"	"6.847E-05"	"2.70"	"47.50"
"28852"	"[K].YWSCCR.[R]"	"2xCarbamidomethyl [C4; C5]"	"0.0387264"	"0.00104877"	"1"	"1"	"2"	"Q9D1P4"	"Q9D1P4 [191-196]"	""	"cysteine and histidine-rich domain-containing protein 1 [OS=Mus musculus]"	"0"	"931.35492"	"0.70"	"0.26"	"0.78"	"1.07"	"0.69"	"-0.01"	"0.43"	"64.8"	"105.0"	"77.7"	"111.2"	"136.6"	"104.6"	"4606.08544921875"	"7460.5283203125"	"5521.59423828125"	"7903.83154296875"	"9702.9404296875"	"7433.5634765625"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"2"	"466.18117"	"0.0001873"	"0.004615"	"0.78"	"20.14"
"27156"	"[R].VMVEKYNGK.[R]"	"1xBiotin [K5]"	"0.0140975"	"0.000586377"	"1"	"2"	"1"	"Q06180-1"	"Q06180-1 [308-316]"	"Q06180-1 1xBiotin [K312]"	"Tyrosine-protein phosphatase non-receptor type 2 [OS=Mus musculus]"	"1"	"1293.63299"	"-0.55"	"-9.97"	"-9.97"	"1.31"	"-9.97"	"-9.97"	""	"144.3"	"98.7"	""	""	"356.9"	""	"5658.02490234375"	"3870.89526367188"	""	""	"13990.673828125"	""	""	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"2"	"647.32017"	"0.0001108"	"0.001036"	"2.17"	"32.78"
"27075"	"[K].VLSKHNFGPITTDIR.[E]"	"1xBiotin [K4]"	"0.0714081"	"0.00241047"	"1"	"4"	"1"	"Q9D6Y7"	"Q9D6Y7 [180-194]"	"Q9D6Y7 1xBiotin [K183]"	"Mitochondrial peptide methionine sulfoxide reductase [OS=Mus musculus]"	"1"	"1924.01093"	"0.94"	"0.73"	"0.22"	"-9.97"	"0.70"	"-0.24"	"-0.03"	"81.4"	"156.4"	"135.1"	"95.0"	""	"132.1"	"9550.2158203125"	"18346.091796875"	"15840.95703125"	"11141.8681640625"	""	"15497.841796875"	""	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"3"	"642.00813"	"0.000415"	"0.01156"	"2.95"	"43.56"
"11167"	"[K].KKVATVPGTLK.[K]"	"1xBiotin [K2]"	"0.00939743"	"0.000586377"	"1"	"1"	"3"	"P14148"	"P14148 [9-19]"	"P14148 1xBiotin [K10]"	"60S ribosomal protein L7 [OS=Mus musculus]"	"2"	"1367.80792"	"0.05"	"-0.10"	"0.33"	"-0.28"	"0.19"	"0.14"	"0.29"	"97.1"	"100.2"	"90.6"	"121.8"	"79.7"	"110.6"	"21425.421875"	"22121.81640625"	"20009.384765625"	"26887.095703125"	"17600.494140625"	"24410.18359375"	""	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"3"	"456.60738"	"0.0001108"	"0.0005755"	"3.27"	"30.63"
"11626"	"[R].KNPGVGNGDDEAAELMQQVK.[V]"	"1xBiotin [K1]; 1xOxidation [M16]"	"0.0209932"	"0.00104877"	"1"	"1"	"2"	"Q61166"	"Q61166 [182-201]"	"Q61166 1xBiotin [K182]"	"Microtubule-associated protein RP/EB family member 1 [OS=Mus musculus]"	"1"	"2342.07512"	"-0.40"	"0.32"	"0.74"	"-0.58"	"-9.97"	"-9.97"	"-9.97"	"112.2"	"85.1"	"139.9"	"187.9"	"74.9"	""	"6629.20458984375"	"5026.68505859375"	"8264.943359375"	"11098.0400390625"	"4423.53955078125"	""	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"3"	"781.36329"	"0.0001873"	"0.001869"	"2.68"	"37.30"
"22217"	"[R].RGFVFITFK.[E]"	""	"0.0525466"	"0.00154748"	"1"	"1"	"5"	"Q99020"	"Q99020 [200-208]"	""	"Heterogeneous nuclear ribonucleoprotein A/B [OS=Mus musculus]"	"1"	"1114.64078"	"-0.23"	"-0.24"	"-0.65"	"-1.83"	"-0.41"	"-0.18"	"-0.17"	"137.3"	"117.2"	"116.1"	"87.5"	"38.5"	"103.5"	"186512.578125"	"159303.796875"	"157702.671875"	"118839.234375"	"52316.48828125"	"140623.421875"	""	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"557.82390"	"0.0002716"	"0.007304"	"2.86"	"45.59"
"11614"	"[K].KNNLPFLTHVTLPR.[F]"	"1xBiotin [K1]"	"0.000209427"	"0.000586377"	"1"	"1"	"2"	"Q91YX5"	"Q91YX5 [201-214]"	"Q91YX5 1xBiotin [K201]"	"Acyl-CoA:lysophosphatidylglycerol acyltransferase 1 [OS=Mus musculus]"	"1"	"1876.02618"	"0.72"	"0.30"	"-0.80"	"-9.97"	"0.48"	"-0.24"	"0.18"	"102.6"	"169.4"	"126.1"	"58.9"	""	"143.1"	"9780.2919921875"	"16150.296875"	"12027.50390625"	"5613.47705078125"	""	"13642.318359375"	""	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"3"	"626.01345"	"0.0001108"	"2.206E-06"	"3.62"	"50.27"
"11579"	"[R].KNKMLFSHLEGPESPR.[Y]"	"1xBiotin [K]; 1xOxidation [M4]"	"0.000601722"	"0.000586377"	"1"	"1"	"5"	"Q9JHL0-1"	"Q9JHL0-1 [82-97]"	"Q9JHL0-1 1xBiotin [K]"	"Linker for activation of T-cells family member 2 [OS=Mus musculus]"	"2"	"2112.03649"	"0.90"	"0.73"	"-0.42"	"-9.97"	"0.97"	"0.07"	"0.24"	"82.9"	"154.9"	"137.9"	"61.8"	""	"162.6"	"10756.90234375"	"20087.255859375"	"17884.07421875"	"8014.86181640625"	""	"21086.619140625"	""	"Peak Found"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"704.68449"	"0.0001108"	"1.033E-05"	"3.53"	"36.76"
"26749"	"[K].VKINHQK.[C]"	"1xBiotin [K2]"	"0.0762972"	"0.00241047"	"1"	"4"	"3"	"O35375-1"	"O35375-1 [920-926]"	"O35375-1 1xBiotin [K921]"	"Neuropilin-2 [OS=Mus musculus]"	"1"	"1092.59826"	"1.15"	"0.58"	"0.79"	"1.24"	"0.86"	"-0.28"	"0.28"	"56.4"	"125.0"	"84.5"	"97.9"	"133.5"	"102.7"	"19108.263671875"	"42305.8359375"	"28594.169921875"	"33151.9140625"	"45184.97265625"	"34781.50390625"	""	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"2"	"546.80297"	"0.000415"	"0.01282"	"2.11"	"16.19"
"11499"	"[R].KMLGNPSR.[L]"	"1xBiotin [K1]"	"0.0387264"	"0.00104877"	"1"	"2"	"1"	"O35465-1"	"O35465-1 [356-363]"	"O35465-1 1xBiotin [K356]"	"peptidyl-prolyl cis-trans isomerase FKBP8 [OS=Mus musculus]"	"1"	"1128.56524"	"1.40"	"1.08"	"0.71"	"2.14"	"1.25"	"-0.15"	"0.16"	"42.3"	"111.4"	"89.8"	"69.3"	"186.8"	"100.4"	"47417.21875"	"124833.5078125"	"100547.5859375"	"77640.1875"	"209246.921875"	"112436.8359375"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"2"	"564.78636"	"0.0001873"	"0.004636"	"2.29"	"30.24"
"28854"	"[R].YWVSGR.[T]"	""	"0.0837597"	"0.00241047"	"1"	"1"	"5"	"Q9Z1Q9"	"Q9Z1Q9 [752-757]"	""	"Valine--tRNA ligase [OS=Mus musculus]"	"0"	"767.38350"	"0.24"	"0.38"	"0.40"	"0.91"	"0.04"	"-0.20"	"-0.34"	"77.7"	"92.1"	"101.3"	"102.6"	"146.3"	"80.0"	"13191.6484375"	"15628.4326171875"	"17204.654296875"	"17422.603515625"	"24832.6875"	"13583.052734375"	""	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"384.19534"	"0.000415"	"0.0147"	"1.22"	"23.88"
"19015"	"[-].MVGKGAK.[G]"	"1xAcetyl [N-Term]; 1xBiotin [K4]"	"0.0985957"	"0.00472246"	"1"	"1"	"1"	"P28571-1"	"P28571-1 [1-7]"	"P28571-1 1xAcetyl [N-Term]; 1xBiotin [K4]"	"Isoform GlyT-1A of Sodium- and chloride-dependent glycine transporter 1 [OS=Mus musculus]"	"1"	"958.48487"	"1.15"	"0.93"	"0.82"	"0.32"	"0.44"	"-0.72"	"-0.50"	"63.1"	"140.5"	"120.6"	"111.5"	"78.7"	"85.5"	"11908.666015625"	"26498.11328125"	"22755.97265625"	"21036.34375"	"14835.416015625"	"16133.8095703125"	""	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"2"	"479.74566"	"0.0009666"	"0.01883"	"1.65"	"35.38"
"26782"	"[K].VKSMEGFQDLLNMRPDQSNVR.[R]"	"1xBiotin [K2]; 2xOxidation [M4; M13]"	"0.0176601"	"0.000586377"	"1"	"2"	"3"	"Q924N4"	"Q924N4 [1062-1082]"	"Q924N4 1xBiotin [K1063]"	"Solute carrier family 12 member 6 [OS=Mus musculus]"	"1"	"2722.27457"	"1.50"	"0.97"	"1.03"	"-0.14"	"1.08"	"-0.42"	"0.11"	"55.2"	"156.6"	"108.2"	"113.0"	"50.2"	"116.7"	"15743.666015625"	"44667.265625"	"30842.54296875"	"32230.53125"	"14326.0556640625"	"33284.1953125"	""	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"3"	"908.09612"	"0.0001108"	"0.001452"	"2.00"	"44.47"
"26785"	"[K].VKTTAPR.[R]"	"1xBiotin [K2]"	"0.0879791"	"0.00334029"	"1"	"1"	"3"	"Q9WV55"	"Q9WV55 [51-57]"	"Q9WV55 1xBiotin [K52]"	"vesicle-associated membrane protein-associated protein A [OS=Mus musculus]"	"1"	"998.54516"	"1.57"	"0.98"	"1.13"	"0.99"	"1.56"	"-0.01"	"0.59"	"45.9"	"136.3"	"90.5"	"100.4"	"91.2"	"135.8"	"3689.86865234375"	"10959.7802734375"	"7276.85009765625"	"8072.666015625"	"7331.11767578125"	"10915.6484375"	""	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"2"	"499.77624"	"0.0005759"	"0.01586"	"1.84"	"21.43"
"11323"	"[K].KLIYFQLHR.[A]"	""	"0.0289527"	"0.00104877"	"1"	"2"	"2"	"Q62318"	"Q62318 [367-375]"	""	"Transcription intermediary factor 1-beta [OS=Mus musculus]"	"1"	"1217.71534"	"-0.60"	"-0.51"	"-0.64"	"-0.66"	"-0.51"	"0.08"	"0.00"	"138.3"	"91.4"	"97.1"	"88.9"	"87.3"	"97.0"	"28717.103515625"	"18983.859375"	"20170.927734375"	"18455.771484375"	"18127.822265625"	"20135.505859375"	""	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"3"	"406.57632"	"0.0001873"	"0.002997"	"2.82"	"34.37"
"9800"	"[K].HHSENKSLDK.[V]"	"1xBiotin [K6]"	"0.0975363"	"0.00426615"	"1"	"1"	"2"	"P70280"	"P70280 [116-125]"	"P70280 1xBiotin [K121]"	"vesicle-associated membrane protein 7 [OS=Mus musculus]"	"1"	"1420.66377"	"0.42"	"0.21"	"0.32"	"0.06"	"0.43"	"0.01"	"0.23"	"84.0"	"112.8"	"96.9"	"104.9"	"87.9"	"113.5"	"7315.2568359375"	"9820.849609375"	"8432.783203125"	"9130.515625"	"7650.900390625"	"9885.30859375"	""	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"3"	"474.22591"	"0.0008081"	"0.01856"	"2.26"	"17.86"
"21911"	"[K].QWGWTQGR.[W]"	""	"0.0341689"	"0.00104877"	"1"	"1"	"1"	"Q9CPR4"	"Q9CPR4 [75-82]"	""	"60S ribosomal protein L17 [OS=Mus musculus]"	"0"	"1018.48534"	"0.70"	"0.38"	"1.05"	"0.96"	"0.62"	"-0.08"	"0.23"	"63.3"	"102.7"	"82.6"	"131.5"	"122.8"	"97.2"	"21081.419921875"	"34218.328125"	"27524.154296875"	"43799.546875"	"40916.625"	"32376.759765625"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"2"	"509.74610"	"0.0001873"	"0.003843"	"2.22"	"33.59"
"21855"	"[R].QVLKDDSLAR.[H]"	"1xBiotin [K4]"	"0.00590462"	"0.000586377"	"1"	"2"	"2"	"Q9WU40-1"	"Q9WU40-1 [281-290]"	"Q9WU40-1 1xBiotin [K284]"	"inner nuclear membrane protein Man1 [OS=Mus musculus]"	"1"	"1370.70966"	"-9.97"	"0.05"	"0.41"	"0.01"	"0.16"	"9.97"	"0.11"	"109.5"	""	"113.0"	"145.2"	"110.2"	"122.0"	"12407.9130859375"	""	"12807.841796875"	"16452.396484375"	"12490.896484375"	"13821.7626953125"	""	"Peak Found"	"Not Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"2"	"685.85874"	"0.0001108"	"0.000291"	"3.11"	"35.32"
"11277"	"[R].KLHLLSRPQDGEAE.[-]"	"1xBiotin [K1]"	"0.0130005"	"0.000586377"	"1"	"1"	"1"	"Q8VC65"	"Q8VC65 [249-262]"	"Q8VC65 1xBiotin [K249]"	"Nurim [OS=Mus musculus]"	"1"	"1818.91669"	"0.12"	"0.39"	"-0.37"	"-0.76"	"0.04"	"-0.08"	"-0.34"	"103.6"	"113.0"	"135.5"	"80.2"	"61.0"	"106.7"	"20426.68359375"	"22269.39453125"	"26702.095703125"	"15799.2373046875"	"12030.8720703125"	"21039.318359375"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"3"	"606.97690"	"0.0001108"	"0.0009236"	"3.10"	"36.01"
"19180"	"[R].MYSSYSVEPKK.[L]"	"1xBiotin [K10]; 1xOxidation [M1]"	"0.000482137"	"0.000586377"	"1"	"1"	"5"	"Q8VCB1"	"Q8VCB1 [394-404]"	"Q8VCB1 1xBiotin [K403]"	"Nucleoporin Ndc1 [OS=Mus musculus]"	"1"	"1560.70728"	"-0.13"	"0.11"	"0.15"	"-1.05"	"0.26"	"0.39"	"0.15"	"103.8"	"94.8"	"112.0"	"115.1"	"50.1"	"124.2"	"28162.6328125"	"25721.369140625"	"30376.5546875"	"31206.650390625"	"13576.4560546875"	"33689.13671875"	""	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"780.85700"	"0.0001108"	"7.458E-06"	"4.06"	"32.39"
"21801"	"[R].QTVAVGVIKAVDKK.[A]"	"1xBiotin [K9]"	"0.000716737"	"0.000586377"	"1"	"1"	"2"	"P10126"	"P10126 [431-444]"	"P10126 1xBiotin [K439]"	"Elongation factor 1-alpha 1 [OS=Mus musculus]"	"2"	"1681.96694"	"0.57"	"-9.97"	"0.89"	"0.29"	"0.53"	"-0.04"	"9.97"	"85.6"	"127.2"	""	"158.7"	"104.5"	"124.0"	"10048.005859375"	"14925.9443359375"	""	"18627.841796875"	"12262.3369140625"	"14550.9609375"	""	"Peak Found"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"3"	"561.32748"	"0.0001108"	"1.332E-05"	"3.79"	"39.32"
"21535"	"[R].QQEAQGEKASR.[Y]"	"1xBiotin [K8]"	"0.0168632"	"0.000586377"	"1"	"1"	"4"	"Q9QZ49"	"Q9QZ49 [87-97]"	"Q9QZ49 1xBiotin [K94]"	"UBX domain-containing protein 8 [OS=Mus musculus]"	"1"	"1457.68015"	"0.09"	"-0.29"	"-0.02"	"0.31"	"-0.01"	"-0.11"	"0.28"	"98.3"	"104.8"	"80.2"	"97.0"	"122.3"	"97.4"	"5925.2373046875"	"6317.59423828125"	"4835.9033203125"	"5843.4287109375"	"7369.40966796875"	"5869.74340820313"	""	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"2"	"729.34400"	"0.0001108"	"0.001348"	"1.81"	"18.87"
"27007"	"[K].VINSKNK.[M]"	"1xBiotin [K5]"	"0.0889429"	"0.00334029"	"1"	"2"	"2"	"Q06335"	"Q06335 [586-592]"	"Q06335 1xBiotin [K590]"	"Amyloid-like protein 2 [OS=Mus musculus]"	"1"	"1028.55573"	"0.72"	"0.28"	"0.93"	"1.05"	"0.88"	"0.16"	"0.61"	"62.0"	"102.4"	"75.0"	"118.0"	"128.3"	"114.3"	"3312.47778320313"	"5469.98193359375"	"4008.896484375"	"6302.8310546875"	"6853.8623046875"	"6105.3203125"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"2"	"514.78138"	"0.000655"	"0.01609"	"1.79"	"20.16"
"9810"	"[K].HKEEVYENVHSK.[S]"	"1xBiotin [K2]"	"0.00836753"	"0.000586377"	"1"	"3"	"3"	"P29351"	"P29351 [559-570]"	"P29351 1xBiotin [K560]"	"tyrosine-protein phosphatase non-receptor type 6 [OS=Mus musculus]"	"1"	"1724.80608"	"0.47"	"0.31"	"0.08"	"-0.17"	"0.50"	"0.03"	"0.19"	"85.9"	"119.1"	"106.2"	"90.9"	"76.4"	"121.6"	"8209.298828125"	"11378.779296875"	"10153.0283203125"	"8688.5458984375"	"7298.53759765625"	"11618.8173828125"	""	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"3"	"575.60729"	"0.0001108"	"0.0004852"	"3.16"	"24.16"
"11243"	"[K].KLFVGGLK.[EG]"	"1xBiotin [K1]"	"0.0106146"	"0.000586377"	"3"	"8"	"6"	"O88569; P49312-1; Q8BG05"	"O88569 [113-120]; P49312-1 [106-113]; Q8BG05 [127-134]"	"O88569 1xBiotin [K113]; P49312-1 1xBiotin [K106]; Q8BG05 1xBiotin [K127]"	"heterogeneous nuclear ribonucleoproteins A2/B1 [OS=Mus musculus];Heterogeneous nuclear ribonucleoprotein A1 [OS=Mus musculus];Heterogeneous nuclear ribonucleoprotein A3 [OS=Mus musculus]"	"1"	"1087.63325"	"2.10"	"0.21"	"1.42"	"1.79"	"1.91"	"-0.19"	"1.70"	"36.8"	"157.4"	"42.5"	"98.5"	"126.8"	"138.0"	"12229.6416015625"	"52346.435546875"	"14145.568359375"	"32751.0078125"	"42186.3759765625"	"45899.328125"	"NotUnique"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"544.32024"	"0.0001108"	"0.0006876"	"2.46"	"41.07"
"27042"	"[K].VIPTPGKK.[G]"	"1xBiotin [K7]"	"0.04884"	"0.00154748"	"1"	"1"	"2"	"P09405"	"P09405 [103-110]"	"P09405 1xBiotin [K109]"	"Nucleolin [OS=Mus musculus]"	"1"	"1065.61251"	"0.45"	"0.49"	"0.47"	"0.21"	"0.08"	"-0.37"	"-0.41"	"81.3"	"111.2"	"114.6"	"112.6"	"94.1"	"86.2"	"14639.1806640625"	"20015.96875"	"20621.783203125"	"20261.193359375"	"16932.177734375"	"15518.466796875"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"2"	"533.30975"	"0.0002716"	"0.006511"	"1.32"	"30.26"
"11203"	"[K].KIDLGKTT.[-]"	"1xBiotin [K6]"	"0.118904"	"0.00731053"	"1"	"2"	"1"	"Q9CQE7"	"Q9CQE7 [376-383]"	"Q9CQE7 1xBiotin [K381]"	"Endoplasmic reticulum-Golgi intermediate compartment protein 3 [OS=Mus musculus]"	"2"	"1101.59726"	"-9.97"	"-0.93"	"0.38"	"-0.17"	"-0.50"	"9.97"	"0.44"	"135.7"	""	"71.0"	"176.9"	"120.3"	"96.1"	"30812.658203125"	""	"16130.8544921875"	"40179.890625"	"27317.458984375"	"21833.626953125"	""	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"2"	"551.30230"	"0.001478"	"0.0252"	"2.07"	"34.77"
"11149"	"[K].KKPTTVPLPQAK.[Q]"	"1xBiotin [K]"	"0.00142596"	"0.000586377"	"1"	"1"	"3"	"Q8VHE0"	"Q8VHE0 [534-545]"	"Q8VHE0 1xBiotin [K]"	"Translocation protein SEC63 homolog [OS=Mus musculus]"	"1"	"1533.88215"	"0.36"	"0.55"	"0.09"	"0.41"	"0.55"	"0.18"	"0.00"	"78.9"	"101.5"	"115.4"	"84.1"	"105.1"	"115.1"	"35746.7890625"	"45993.59375"	"52333.4921875"	"38119.51171875"	"47625.90625"	"52174.50390625"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"2"	"767.44477"	"0.0001108"	"3.647E-05"	"2.86"	"31.54"
"27417"	"[K].VQVEYKGETK.[S]"	"1xBiotin [K6]"	"0.015917"	"0.000586377"	"1"	"1"	"4"	"P63017"	"P63017 [103-112]"	"P63017 1xBiotin [K108]"	"Heat shock cognate 71 kDa protein [OS=Mus musculus]"	"1"	"1406.69843"	"0.74"	"0.06"	"0.75"	"0.82"	"-9.97"	"-9.97"	"-9.97"	"83.8"	"139.6"	"87.4"	"141.2"	"148.1"	""	"11110.8134765625"	"18508.953125"	"11590.7958984375"	"18719.958984375"	"19637.09765625"	""	""	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"High"	"2"	"703.85264"	"0.0001108"	"0.00124"	"1.53"	"31.50"
"10904"	"[R].KGESGQSWPR.[L]"	"1xBiotin [K1]"	"0.0164782"	"0.000586377"	"1"	"1"	"2"	"Q9R0Q7"	"Q9R0Q7 [79-88]"	"Q9R0Q7 1xBiotin [K79]"	"Prostaglandin E synthase 3 [OS=Mus musculus]"	"1"	"1357.63174"	"0.00"	"0.50"	"-0.24"	"0.37"	"0.03"	"0.03"	"-0.46"	"91.3"	"91.5"	"128.8"	"77.3"	"117.8"	"93.3"	"5751.974609375"	"5760.08935546875"	"8110.54150390625"	"4866.826171875"	"7417.595703125"	"5876.3681640625"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"2"	"679.31884"	"0.0001108"	"0.00131"	"1.14"	"30.91"
"9987"	"[R].HNHFIKTAQPYRPK.[M]"	"1xBiotin [K6]"	"5.54119E-05"	"0.000586377"	"1"	"1"	"5"	"Q923J1"	"Q923J1 [577-590]"	"Q923J1 1xBiotin [K582]"	"Transient receptor potential cation channel subfamily M member 7 [OS=Mus musculus]"	"1"	"1963.01193"	"0.50"	"-0.17"	"0.68"	"0.38"	"0.49"	"-0.01"	"0.66"	"78.9"	"111.5"	"70.1"	"126.2"	"102.8"	"110.6"	"44090.7421875"	"62317.98828125"	"39166.80859375"	"70556.1328125"	"57497.48046875"	"61841.62109375"	""	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"655.00887"	"0.0001108"	"3.171E-07"	"4.29"	"27.02"
"28468"	"[R].YGSKNTDQGVYLGLSK.[T]"	"1xBiotin [K4]"	"0.00269117"	"0.000586377"	"1"	"1"	"4"	"Q8K1E0-1"	"Q8K1E0-1 [7-22]"	"Q8K1E0-1 1xBiotin [K10]"	"Syntaxin-5 [OS=Mus musculus]"	"1"	"1955.95314"	"0.60"	"0.31"	"0.07"	"0.39"	"0.50"	"-0.10"	"0.19"	"79.7"	"120.6"	"99.0"	"83.4"	"104.7"	"112.6"	"583651.625"	"882702.315429688"	"725065.022460938"	"610761.625"	"766365.8125"	"824572.3125"	""	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"2"	"978.48214"	"0.0001108"	"9.175E-05"	"2.70"	"41.74"
"20006"	"[K].NPKLMLR.[R]"	"1xBiotin [K3]; 1xOxidation [M5]"	"0.0433774"	"0.00104877"	"2"	"4"	"3"	"B2RXS4; Q3UH93"	"B2RXS4 [1389-1395]; Q3UH93 [1478-1484]"	"B2RXS4 1xBiotin [K1391]; Q3UH93 1xBiotin [K1480]"	"Plexin-B2 [OS=Mus musculus];plexin-D1 [OS=Mus musculus]"	"1"	"1113.59073"	"0.53"	"0.61"	"0.54"	"-0.96"	"0.40"	"-0.13"	"-0.21"	"82.6"	"119.4"	"126.4"	"120.0"	"42.4"	"109.2"	"17909.724609375"	"25884.513671875"	"27401.44140625"	"26021.103515625"	"9201.2236328125"	"23689.208984375"	"NotUnique"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"2"	"557.29905"	"0.0001873"	"0.005485"	"1.69"	"35.82"
"19956"	"[K].NNQPVNPKHSR.[R]"	"1xBiotin [K8]"	"0.00470625"	"0.000586377"	"1"	"1"	"3"	"Q3UUQ7-1"	"Q3UUQ7-1 [775-785]"	"Q3UUQ7-1 1xBiotin [K782]"	"GPI inositol-deacylase [OS=Mus musculus]"	"1"	"1516.74375"	"0.16"	"0.38"	"0.09"	"0.12"	"0.49"	"0.33"	"0.11"	"86.0"	"96.1"	"111.7"	"91.8"	"93.5"	"120.9"	"21646.0390625"	"24191.98828125"	"28117.6484375"	"23116.185546875"	"23545.103515625"	"30448.076171875"	""	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"3"	"506.25273"	"0.0001108"	"0.0002079"	"2.10"	"21.48"
"10314"	"[R].KAAQLPWEDGR.[A]"	"1xBiotin [K1]"	"0.0020111"	"0.000586377"	"1"	"2"	"4"	"Q8R087-1"	"Q8R087-1 [7-17]"	"Q8R087-1 1xBiotin [K7]"	"Beta-1,4-galactosyltransferase 7 [OS=Mus musculus]"	"1"	"1496.73146"	"-0.02"	"-0.57"	"-0.01"	"-0.48"	"-0.02"	"-0.01"	"0.55"	"112.0"	"110.8"	"75.5"	"111.1"	"80.2"	"110.2"	"16583.90234375"	"16405.05859375"	"11180.7353515625"	"16451.83984375"	"11873.228515625"	"16315.8330078125"	""	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"2"	"748.86949"	"0.0001108"	"6.04E-05"	"2.67"	"42.15"
"10601"	"[K].KDNQTLSHSLKMADQNLEK.[L]"	"1xBiotin [K11]; 1xOxidation [M12]"	"0.000591288"	"0.000586377"	"1"	"2"	"2"	"Q9CQ56"	"Q9CQ56 [207-225]"	"Q9CQ56 1xBiotin [K217]"	"Vesicle transport protein USE1 [OS=Mus musculus]"	"2"	"2442.17517"	"-0.14"	"-0.45"	"0.13"	"-0.97"	"-1.14"	"-0.99"	"-0.68"	"127.6"	"115.7"	"93.3"	"140.0"	"65.3"	"58.1"	"36630.341796875"	"33208.3427734375"	"26776.01953125"	"40174.0439453125"	"18726.1342773438"	"16672.3671875"	""	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"3"	"814.73015"	"0.0001108"	"1.003E-05"	"2.03"	"34.54"
"10592"	"[K].KDISENKR.[A]"	"1xBiotin [K1]"	"0.0130005"	"0.000586377"	"1"	"1"	"4"	"P63017"	"P63017 [251-258]"	"P63017 1xBiotin [K251]"	"Heat shock cognate 71 kDa protein [OS=Mus musculus]"	"2"	"1215.61503"	"0.45"	"0.75"	"0.36"	"0.34"	"0.75"	"0.30"	"0.01"	"72.4"	"99.2"	"121.5"	"93.0"	"91.8"	"122.0"	"19473.484375"	"26674.357421875"	"32650.62890625"	"25002.517578125"	"24685.42578125"	"32787.53515625"	""	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"3"	"405.87653"	"0.0001108"	"0.0009219"	"2.17"	"20.04"
"10559"	"[K].KDGADFAK.[W]"	"1xBiotin [K1]"	"0.0239615"	"0.00104877"	"1"	"2"	"3"	"P05064"	"P05064 [140-147]"	"P05064 1xBiotin [K140]"	"fructose-bisphosphate aldolase A [OS=Mus musculus]"	"1"	"1077.50336"	"0.80"	"0.78"	"0.45"	"0.71"	"0.49"	"-0.31"	"-0.29"	"67.8"	"117.6"	"116.3"	"92.7"	"110.8"	"94.9"	"11477.6943359375"	"19919.08984375"	"19698.0859375"	"15694.578125"	"18771.27734375"	"16070.1767578125"	""	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"2"	"539.25510"	"0.0001873"	"0.002268"	"2.15"	"29.37"
"10315"	"[R].KAAQQIAER.[S]"	"1xBiotin [K1]"	"0.00291982"	"0.000586377"	"1"	"1"	"5"	"Q8CIM5"	"Q8CIM5 [281-289]"	"Q8CIM5 1xBiotin [K281]"	"G-protein coupled receptor 84 [OS=Mus musculus]"	"1"	"1240.64667"	"0.41"	"0.72"	"0.52"	"0.80"	"0.91"	"0.50"	"0.19"	"66.4"	"88.2"	"109.4"	"95.3"	"115.6"	"125.1"	"18070.99609375"	"24031.22265625"	"29792.779296875"	"25945.60546875"	"31492.794921875"	"34057.65625"	""	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"620.82686"	"0.0001108"	"0.0001038"	"2.61"	"25.78"
"27746"	"[R].VVFGLFGK.[T]"	""	"0.0856113"	"0.00288886"	"1"	"1"	"2"	"P24369"	"P24369 [60-67]"	""	"peptidyl-prolyl cis-trans isomerase B [OS=Mus musculus]"	"0"	"866.51345"	"0.23"	"0.30"	"0.35"	"0.13"	"0.07"	"-0.17"	"-0.24"	"87.9"	"103.3"	"108.5"	"111.8"	"96.4"	"92.1"	"16319.07421875"	"19187.12109375"	"20134.9296875"	"20756.009765625"	"17898.28515625"	"17097.09375"	""	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"2"	"433.76007"	"0.0004957"	"0.01516"	"1.42"	"47.30"
"10316"	"[K].KAASGEAKPK.[A]"	"1xBiotin [K1]"	"0.00183207"	"0.000586377"	"3"	"3"	"9"	"P43274; P43276; P43277"	"P43274 [110-119]; P43276 [110-119]; P43277 [111-120]"	"P43274 1xBiotin [K110]; P43276 1xBiotin [K110]; P43277 1xBiotin [K111]"	"Histone H1.4 [OS=Mus musculus];Histone H1.5 [OS=Mus musculus];Histone H1.3 [OS=Mus musculus]"	"1"	"1212.64052"	"0.82"	"0.77"	"0.76"	"0.76"	"0.93"	"0.12"	"0.16"	"61.5"	"108.3"	"104.9"	"104.0"	"104.0"	"117.3"	"52508.2939453125"	"92418.314453125"	"89507.3515625"	"88758.4267578125"	"88783.296875"	"100096.299804688"	"NotUnique"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"404.88493"	"0.0001108"	"5.237E-05"	"3.17"	"14.10"
"28490"	"[K].YKAEDEK.[Q]"	"1xBiotin [K2]"	"0.12274"	"0.00865053"	"1"	"1"	"1"	"P63017"	"P63017 [525-531]"	"P63017 1xBiotin [K526]"	"Heat shock cognate 71 kDa protein [OS=Mus musculus]"	"1"	"1108.49794"	"0.59"	"0.65"	"0.52"	"0.37"	"0.37"	"-0.21"	"-0.27"	"74.2"	"111.3"	"116.3"	"106.2"	"95.9"	"96.1"	"17176.994140625"	"25769.53515625"	"26915.5234375"	"24586.650390625"	"22189.470703125"	"22250.2890625"	""	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"2"	"554.75296"	"0.001706"	"0.02641"	"1.43"	"20.59"
"28343"	"[R].YEKLDMSAK.[T]"	"1xBiotin [K3]; 1xOxidation [M6]"	"0.0219821"	"0.00104877"	"1"	"1"	"2"	"Q01965"	"Q01965 [513-521]"	"Q01965 1xBiotin [K515]"	"T-lymphocyte surface antigen Ly-9 [OS=Mus musculus]"	"1"	"1326.60684"	"0.61"	"0.16"	"0.56"	"-9.97"	"0.88"	"0.26"	"0.71"	"86.2"	"131.8"	"96.5"	"127.2"	""	"158.3"	"5855.93408203125"	"8955.5869140625"	"6557.8359375"	"8642.7294921875"	""	"10752.2236328125"	""	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"High"	"High"	"2"	"663.80728"	"0.0001873"	"0.002001"	"2.03"	"30.57"
"10488"	"[K].KAVATPAK.[K]"	"1xBiotin [K1]"	"0.037428"	"0.00104877"	"1"	"1"	"1"	"P09405"	"P09405 [88-95]"	"P09405 1xBiotin [K88]"	"Nucleolin [OS=Mus musculus]"	"1"	"1011.56556"	"0.53"	"0.28"	"-0.01"	"0.40"	"0.16"	"-0.37"	"-0.13"	"84.6"	"122.3"	"103.0"	"83.8"	"112.0"	"94.3"	"27711.712890625"	"40058.1015625"	"33734.15234375"	"27450.806640625"	"36691.80078125"	"30900.482421875"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"2"	"506.28640"	"0.0001873"	"0.004379"	"1.88"	"23.79"
"10486"	"[K].KATTTPAK.[K]"	"1xBiotin [K1]"	"0.0143442"	"0.000586377"	"1"	"1"	"5"	"P09405"	"P09405 [55-62]"	"P09405 1xBiotin [K55]"	"Nucleolin [OS=Mus musculus]"	"1"	"1043.55539"	"1.08"	"0.89"	"0.56"	"0.74"	"0.86"	"-0.22"	"-0.03"	"60.4"	"127.5"	"112.1"	"89.2"	"101.1"	"109.8"	"9570.162109375"	"20215.830078125"	"17781.06640625"	"14139.1494140625"	"16023.77734375"	"17410.619140625"	""	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"522.28129"	"0.0001108"	"0.001065"	"2.14"	"18.33"
"10482"	"[K].KATGPGK.[K]"	"1xBiotin [K1]"	"0.100204"	"0.00519168"	"1"	"1"	"3"	"Q9CR57"	"Q9CR57 [167-173]"	"Q9CR57 1xBiotin [K167]"	"60S ribosomal protein L14 [OS=Mus musculus]"	"1"	"884.46585"	"1.02"	"0.83"	"0.52"	"0.69"	"1.31"	"0.29"	"0.47"	"58.0"	"117.8"	"103.4"	"83.4"	"93.8"	"143.6"	"5618.26318359375"	"11402.9541015625"	"10011.0615234375"	"8075.109375"	"9079.76171875"	"13908.0615234375"	""	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"2"	"442.73645"	"0.001046"	"0.01927"	"1.63"	"16.66"
"27789"	"[R].VVLIGGKPDR.[V]"	"1xBiotin [K7]"	"0.0387264"	"0.00104877"	"1"	"3"	"3"	"P61979"	"P61979 [192-201]"	"P61979 1xBiotin [K198]"	"Heterogeneous nuclear ribonucleoprotein K [OS=Mus musculus]"	"0"	"1279.71910"	"-9.97"	"1.10"	"1.74"	"-9.97"	"-9.97"	""	"-9.97"	"92.7"	""	"198.2"	"309.0"	""	""	"4226.18798828125"	""	"9031.818359375"	"14082.2080078125"	""	""	""	"Peak Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"2"	"640.36321"	"0.0001873"	"0.004615"	"2.06"	"38.87"
"20330"	"[KR].NVIKEK.[YLG]"	"1xBiotin [K4]"	"0.109779"	"0.00731053"	"1"	"5"	"3"	"P17182"	"P17182 [194-199]"	"P17182 1xBiotin [K197]"	"alpha-enolase [OS=Mus musculus]"	"1"	"956.52336"	"0.40"	"0.13"	"-0.01"	"0.14"	"-0.07"	"-0.47"	"-0.20"	"92.8"	"122.7"	"101.8"	"92.0"	"102.1"	"88.6"	"37273.61328125"	"49322.203125"	"40901.96484375"	"36971.0625"	"41023.17578125"	"35624.16015625"	""	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"2"	"478.76522"	"0.001478"	"0.02222"	"1.49"	"25.10"
"10353"	"[K].KAEVEGK.[D]"	"1xBiotin [K1]"	"0.0531403"	"0.0019826"	"1"	"2"	"5"	"Q8VEK3"	"Q8VEK3 [596-602]"	"Q8VEK3 1xBiotin [K596]"	"Heterogeneous nuclear ribonucleoprotein U [OS=Mus musculus]"	"1"	"986.49754"	"0.59"	"0.42"	"0.58"	"0.74"	"0.75"	"0.16"	"0.33"	"69.0"	"103.7"	"92.2"	"103.5"	"115.5"	"116.1"	"6342.90087890625"	"9529.3369140625"	"8466.7412109375"	"9511.4482421875"	"10608.3974609375"	"10669.111328125"	""	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"493.75245"	"0.0002716"	"0.007407"	"2.20"	"20.10"
"28196"	"[R].WVESKHK.[S]"	"1xBiotin [K5]"	"0.0706224"	"0.00241047"	"1"	"1"	"4"	"P14211"	"P14211 [37-43]"	"P14211 1xBiotin [K41]"	"Calreticulin [OS=Mus musculus]"	"1"	"1139.56663"	"0.72"	"0.41"	"0.14"	"0.48"	"0.39"	"-0.33"	"-0.02"	"77.1"	"127.0"	"102.7"	"84.8"	"107.5"	"101.0"	"13452.9174804688"	"22155.8227539063"	"17925.0668945313"	"14796.0498046875"	"18754.779296875"	"17619.5478515625"	""	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"2"	"570.28692"	"0.000415"	"0.01139"	"1.53"	"24.87"
"10429"	"[R].KAMPSNSPVAALAATGK.[E]"	"1xBiotin [K1]"	"2.15436E-05"	"0.000586377"	"1"	"1"	"6"	"Q9QY76"	"Q9QY76 [200-216]"	"Q9QY76 1xBiotin [K200]"	"vesicle-associated membrane protein-associated protein B [OS=Mus musculus]"	"1"	"1839.94555"	"1.38"	"0.49"	"0.80"	"1.67"	"0.95"	"-0.43"	"0.45"	"50.6"	"131.4"	"71.2"	"88.1"	"161.2"	"97.5"	"15157.177734375"	"39377.1171875"	"21345.03515625"	"26396.2768554688"	"48313.5063476563"	"29231.998046875"	""	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"2"	"920.47660"	"0.0001108"	"7.978E-08"	"2.69"	"42.68"
"10410"	"[K].KALLLLCGGEDD.[-]"	"1xBiotin [K1]; 1xCarbamidomethyl [C7]"	"0.0985957"	"0.00472246"	"1"	"1"	"3"	"P48036"	"P48036 [308-319]"	"P48036 1xBiotin [K308]"	"annexin A5 [OS=Mus musculus]"	"1"	"1529.73383"	"0.21"	"-9.97"	"-0.38"	"-0.58"	"-0.01"	"-0.23"	"9.97"	"130.8"	"151.7"	""	"100.5"	"87.3"	"129.7"	"8567.5732421875"	"9931.8203125"	""	"6583.91552734375"	"5718.244140625"	"8490.689453125"	""	"Peak Found"	"High"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"2"	"765.37049"	"0.0009666"	"0.0189"	"1.78"	"54.65"
"28320"	"[R].YDSRPGGYGYGYGR.[S]"	""	"0.00366424"	"0.000586377"	"1"	"1"	"1"	"O89086"	"O89086 [115-128]"	""	"RNA-binding protein 3 [OS=Mus musculus]"	"0"	"1567.69243"	"0.55"	"-0.22"	"0.79"	"0.66"	"0.37"	"-0.18"	"0.59"	"75.8"	"111.1"	"64.9"	"130.9"	"119.5"	"97.8"	"8392.3876953125"	"12297.90625"	"7186.1416015625"	"14495.373046875"	"13234.0224609375"	"10829.9091796875"	""	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"3"	"523.23524"	"0.0001108"	"0.0001444"	"3.04"	"24.96"
"10497"	"[K].KAVTKVQK.[K]"	"1xBiotin [K5]"	"0.0378561"	"0.00104877"	"1"	"1"	"4"	"Q64525"	"Q64525 [17-24]"	"Q64525 1xBiotin [K21]"	"Histone H2B type 2-B [OS=Mus musculus]"	"2"	"1127.66053"	"1.08"	"0.84"	"0.62"	"1.29"	"0.92"	"-0.15"	"0.09"	"55.6"	"117.3"	"99.3"	"85.7"	"136.5"	"105.6"	"3682.84912109375"	"7764.43115234375"	"6571.73486328125"	"5670.9482421875"	"9032.341796875"	"6992.2412109375"	""	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"2"	"564.33376"	"0.0001873"	"0.004482"	"2.25"	"18.52"
"27685"	"[K].VTNGVGKK.[-]"	"1xBiotin [K]"	"0.12602"	"0.00949852"	"1"	"1"	"2"	"Q99LH2"	"Q99LH2 [466-473]"	"Q99LH2 1xBiotin [K]"	"phosphatidylserine synthase 1 [OS=Mus musculus]"	"1"	"1028.55573"	"0.60"	"0.59"	"0.39"	"0.30"	"0.47"	"-0.12"	"-0.11"	"75.5"	"114.1"	"113.3"	"99.1"	"93.1"	"104.8"	"98350.203125"	"148685.921875"	"147653.296875"	"129163.8671875"	"121322.1796875"	"136495.015625"	""	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"2"	"514.78130"	"0.001921"	"0.02752"	"1.65"	"21.50"
"27654"	"[K].VTKPKTAKPK.[A]"	"1xBiotin [K5]"	"0.0762972"	"0.00241047"	"1"	"1"	"1"	"P43276"	"P43276 [202-211]"	"P43276 1xBiotin [K206]"	"Histone H1.5 [OS=Mus musculus]"	"1"	"1323.78170"	"1.37"	"0.83"	"1.45"	"0.88"	"1.31"	"-0.06"	"0.48"	"48.4"	"125.1"	"85.8"	"131.9"	"88.9"	"120.0"	"3079.71899414063"	"7961.3017578125"	"5459.69482421875"	"8393.06640625"	"5657.8876953125"	"7636.96240234375"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"3"	"441.93185"	"0.000415"	"0.01277"	"2.08"	"13.73"
"10675"	"[K].KEECPAVR.[L]"	"1xBiotin [K1]; 1xCarbamidomethyl [C4]"	"0.0175585"	"0.000586377"	"1"	"1"	"3"	"P09103"	"P09103 [311-318]"	"P09103 1xBiotin [K311]"	"Protein disulfide-isomerase [OS=Mus musculus]"	"1"	"1214.56564"	"0.49"	"-0.05"	"0.05"	"0.43"	"0.26"	"-0.24"	"0.31"	"86.4"	"121.7"	"83.3"	"89.3"	"116.3"	"103.1"	"6600.9599609375"	"9299.6103515625"	"6366.02099609375"	"6822.130859375"	"8890.1328125"	"7882.95263671875"	""	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"2"	"607.78666"	"0.0001108"	"0.001437"	"1.64"	"24.78"
"10377"	"[K].KAGSDAAASRPR.[A]"	"1xBiotin [K1]"	"0.0276564"	"0.00104877"	"1"	"1"	"4"	"P47911"	"P47911 [18-29]"	"P47911 1xBiotin [K18]"	"60S ribosomal protein L6 [OS=Mus musculus]"	"1"	"1412.70631"	"0.80"	"0.61"	"0.37"	"0.33"	"0.86"	"0.06"	"0.25"	"69.4"	"120.7"	"106.1"	"90.1"	"87.5"	"126.1"	"8180.6494140625"	"14223.8447265625"	"12501.6962890625"	"10608.2958984375"	"10310.544921875"	"14853.29296875"	""	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"3"	"471.57334"	"0.0001873"	"0.002804"	"1.76"	"17.88"
"28700"	"[R].YQGSYWK.[A]"	""	"0.0833026"	"0.00241047"	"1"	"2"	"2"	"Q3TBT3"	"Q3TBT3 [77-83]"	""	"Stimulator of interferon genes protein [OS=Mus musculus]"	"0"	"931.43084"	"0.46"	"0.55"	"0.78"	"0.79"	"0.36"	"-0.09"	"-0.19"	"69.9"	"96.1"	"102.4"	"120.4"	"121.1"	"90.0"	"17963.564453125"	"24683.76953125"	"26300.03515625"	"30923.46875"	"31104.142578125"	"23122.751953125"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"2"	"466.21891"	"0.000415"	"0.01462"	"1.07"	"26.09"
"28663"	"[K].YNWSAK.[A]"	""	"0.124699"	"0.00909051"	"1"	"1"	"3"	"Q9D823"	"Q9D823 [47-52]"	""	"60S ribosomal protein L37 [OS=Mus musculus]"	"0"	"768.36752"	"0.49"	"0.19"	"0.91"	"1.13"	"0.83"	"0.35"	"0.65"	"64.0"	"89.7"	"72.8"	"119.8"	"139.6"	"114.1"	"14047.185546875"	"19700.001953125"	"15989.7822265625"	"26316.26953125"	"30654.53515625"	"25046.12890625"	""	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"2"	"384.68724"	"0.001855"	"0.02691"	"1.35"	"22.19"
"10891"	"[K].KGEDFVK.[N]"	"1xBiotin [K1]"	"0.0453851"	"0.00154748"	"1"	"1"	"1"	"P08249"	"P08249 [329-335]"	"P08249 1xBiotin [K329]"	"Malate dehydrogenase, mitochondrial [OS=Mus musculus]"	"1"	"1048.51319"	"-9.97"	"-9.97"	"0.02"	"0.03"	"-0.17"	"9.97"	"9.97"	"153.0"	""	""	"154.8"	"156.1"	"136.1"	"11453.1240234375"	""	""	"11589.267578125"	"11690.84375"	"10190.21875"	""	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"2"	"524.75994"	"0.0002716"	"0.005846"	"2.03"	"31.89"
"10864"	"[K].KGAATPAK.[G]"	"1xBiotin [K1]"	"0.0184941"	"0.000586377"	"1"	"1"	"5"	"P09405"	"P09405 [125-132]"	"P09405 1xBiotin [K125]"	"Nucleolin [OS=Mus musculus]"	"1"	"969.51861"	"0.69"	"0.55"	"0.67"	"0.47"	"0.58"	"-0.11"	"0.03"	"70.2"	"113.1"	"102.7"	"111.6"	"97.3"	"105.0"	"11867.1640625"	"19117.79296875"	"17353.65234375"	"18862.23828125"	"16448.69140625"	"17734.640625"	""	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"485.26256"	"0.0001108"	"0.001548"	"2.09"	"18.02"
"27517"	"[R].VSFELFADKVPK.[T]"	"1xBiotin [K9]"	"0.00231293"	"0.000586377"	"1"	"1"	"2"	"P17742"	"P17742 [20-31]"	"P17742 1xBiotin [K28]"	"peptidyl-prolyl cis-trans isomerase A [OS=Mus musculus]"	"1"	"1605.83453"	"-9.97"	"-0.26"	"-9.97"	"-9.97"	"0.56"	"9.97"	"0.82"	"181.5"	""	"151.5"	""	""	"267.0"	"12634.2119140625"	""	"10549.34765625"	""	""	"18584.265625"	""	"Peak Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"2"	"803.42232"	"0.0001108"	"7.395E-05"	"3.01"	"55.63"
"10822"	"[R].KFFVGGNWK.[M]"	""	"0.00831909"	"0.000586377"	"1"	"1"	"1"	"P17751"	"P17751 [56-64]"	""	"Triosephosphate isomerase [OS=Mus musculus]"	"1"	"1082.57818"	"-1.18"	"-0.79"	"-0.52"	"-0.22"	"-0.82"	"0.36"	"-0.03"	"144.8"	"63.8"	"83.6"	"101.1"	"124.5"	"82.1"	"65456.8203125"	"28855.83203125"	"37806.140625"	"45714.6875"	"56303.359375"	"37099.546875"	""	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"2"	"541.79249"	"0.0001108"	"0.000478"	"2.38"	"34.66"
"10819"	"[R].KFFLSHPAYR.[H]"	""	"0.0256702"	"0.00104877"	"1"	"4"	"3"	"P39054-1"	"P39054-1 [257-266]"	""	"Dynamin-2 [OS=Mus musculus]"	"1"	"1265.67895"	"-0.24"	"-9.97"	"-0.19"	"-0.18"	"-0.46"	"-0.22"	"9.97"	"138.5"	"117.0"	""	"121.4"	"122.5"	"100.7"	"17302.802734375"	"14616.5888671875"	""	"15165.8203125"	"15305.1416015625"	"12586.974609375"	""	"Peak Found"	"High"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"3"	"422.56448"	"0.0001873"	"0.002523"	"2.86"	"28.09"
"10817"	"[K].KFEDSEK.[A]"	"1xBiotin [K1]"	"0.036586"	"0.00104877"	"1"	"1"	"3"	"Q9DBG7"	"Q9DBG7 [138-144]"	"Q9DBG7 1xBiotin [K138]"	"signal recognition particle receptor subunit alpha [OS=Mus musculus]"	"1"	"1108.49794"	"0.29"	"-0.04"	"0.09"	"-0.06"	"0.14"	"-0.15"	"0.19"	"94.9"	"115.9"	"92.1"	"101.1"	"91.3"	"104.8"	"38209.94921875"	"46681.6015625"	"37098.54296875"	"40716.06640625"	"36777.796875"	"42208.95703125"	""	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"2"	"554.75296"	"0.0001873"	"0.004264"	"2.11"	"25.60"
"10804"	"[R].KEYDAQK.[A]"	"1xBiotin [K1]"	"0.0402965"	"0.00104877"	"1"	"1"	"3"	"Q922Q8"	"Q922Q8 [201-207]"	"Q922Q8 1xBiotin [K201]"	"Leucine-rich repeat-containing protein 59 [OS=Mus musculus]"	"1"	"1107.51392"	"0.67"	"0.69"	"-0.01"	"0.34"	"0.54"	"-0.13"	"-0.14"	"75.7"	"120.5"	"122.0"	"75.1"	"96.2"	"110.5"	"6500.12158203125"	"10339.1875"	"10472.5361328125"	"6445.349609375"	"8253.7880859375"	"9479.64453125"	""	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"2"	"554.26036"	"0.0001873"	"0.004897"	"2.12"	"22.48"
"27534"	"[R].VSKGTSK.[R]"	"1xBiotin [K3]"	"0.0726021"	"0.00241047"	"1"	"2"	"3"	"Q0GNC1"	"Q0GNC1 [1238-1244]"	"Q0GNC1 1xBiotin [K1240]"	"Inverted formin-2 [OS=Mus musculus]"	"1"	"932.48698"	"1.20"	"0.83"	"0.91"	"1.13"	"0.84"	"-0.36"	"0.00"	"54.9"	"125.8"	"98.0"	"103.2"	"119.9"	"98.1"	"7320.2392578125"	"16769.2890625"	"13057.2021484375"	"13750.1904296875"	"15982.3720703125"	"13072.5947265625"	""	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"2"	"466.74707"	"0.000415"	"0.01185"	"1.79"	"17.89"
"21181"	"[K].QLLPAKSVDHEETPVR.[Y]"	"1xBiotin [K6]"	"0.0226234"	"0.00104877"	"1"	"1"	"2"	"Q91ZV3"	"Q91ZV3 [576-591]"	"Q91ZV3 1xBiotin [K581]"	"Discoidin, CUB and LCCL domain-containing protein 2 [OS=Mus musculus]"	"1"	"2045.04844"	"-0.34"	"-0.66"	"-9.97"	"-0.61"	"-0.31"	"0.03"	"0.35"	"154.3"	"122.3"	"97.4"	""	"101.4"	"124.5"	"15241.4267578125"	"12077.64453125"	"9623.8349609375"	""	"10018.939453125"	"12301.8388671875"	""	"Peak Found"	"High"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"3"	"682.35466"	"0.0001873"	"0.002092"	"2.44"	"37.69"
"10043"	"[R].HQKATILAGTANVK.[V]"	"1xBiotin [K3]"	"0.00161162"	"0.000586377"	"1"	"1"	"4"	"Q9QYE6"	"Q9QYE6 [72-85]"	"Q9QYE6 1xBiotin [K74]"	"Golgin subfamily A member 5 [OS=Mus musculus]"	"1"	"1677.91049"	"0.26"	"0.39"	"0.59"	"-0.13"	"0.43"	"0.17"	"0.04"	"82.3"	"98.7"	"108.1"	"124.3"	"75.5"	"111.0"	"46713.71484375"	"56013.73828125"	"61349.73046875"	"70496.3125"	"42819.83203125"	"62984.2578125"	""	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"2"	"839.45944"	"0.0001108"	"4.359E-05"	"3.37"	"34.11"
"28598"	"[R].YLTKGSEVR.[L]"	"1xBiotin [K4]"	"0.0223647"	"0.00104877"	"1"	"2"	"1"	"O88622"	"O88622 [351-359]"	"O88622 1xBiotin [K354]"	"Poly(ADP-ribose) glycohydrolase [OS=Mus musculus]"	"1"	"1278.65108"	"-9.97"	"0.17"	"0.23"	"0.14"	"0.02"	"9.97"	"-0.15"	"110.6"	""	"124.5"	"130.1"	"122.3"	"112.5"	"9059.7109375"	""	"10197.1748046875"	"10649.9501953125"	"10016.1259765625"	"9210.884765625"	""	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"2"	"639.82939"	"0.0001873"	"0.002058"	"1.96"	"32.88"
"21061"	"[R].QKTFDWK.[R]"	"1xBiotin [K2]"	"0.0806083"	"0.00241047"	"1"	"2"	"2"	"Q60898"	"Q60898 [201-207]"	"Q60898 1xBiotin [K202]"	"SRC-like-adapter [OS=Mus musculus]"	"1"	"1178.56629"	"0.39"	"0.29"	"-0.01"	"0.08"	"0.09"	"-0.31"	"-0.20"	"90.2"	"118.5"	"110.3"	"89.6"	"95.7"	"95.8"	"22122.59765625"	"29052.849609375"	"27051.5234375"	"21967.6875"	"23461.98046875"	"23507.146484375"	""	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"2"	"589.78681"	"0.000415"	"0.01389"	"1.97"	"40.77"
"20089"	"[R].NQLTNKTLSNSSQSELESR.[L]"	"1xBiotin [K6]"	"0.0180723"	"0.000586377"	"1"	"1"	"2"	"Q9QYE6"	"Q9QYE6 [570-588]"	"Q9QYE6 1xBiotin [K575]"	"Golgin subfamily A member 5 [OS=Mus musculus]"	"1"	"2362.13033"	"-0.50"	"-9.97"	"0.20"	"-9.97"	"-9.97"	"-9.97"	""	"210.1"	"148.7"	""	"241.1"	""	""	"8676.4345703125"	"6141.1279296875"	""	"9956.5830078125"	""	""	""	"Peak Found"	"High"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"3"	"788.04845"	"0.0001108"	"0.0015"	"2.36"	"37.62"
"20026"	"[R].NPPKLVTPHDR.[M]"	"1xBiotin [K4]"	"0.000594746"	"0.000586377"	"1"	"3"	"7"	"P98083-1"	"P98083-1 [318-328]"	"P98083-1 1xBiotin [K321]"	"SHC-transforming protein 1 [OS=Mus musculus]"	"1"	"1499.77874"	"0.39"	"-0.19"	"0.07"	"-0.05"	"0.15"	"-0.23"	"0.34"	"95.0"	"124.1"	"83.4"	"99.8"	"92.0"	"105.7"	"19404.46484375"	"25339.666015625"	"17029.603515625"	"20394.119140625"	"18786.671875"	"21596.966796875"	""	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"500.59773"	"0.0001108"	"1.013E-05"	"3.22"	"30.02"
"21004"	"[R].QKFSDLK.[L]"	"1xBiotin [K2]"	"0.0552689"	"0.0019826"	"1"	"3"	"2"	"P30999-1"	"P30999-1 [78-84]"	"P30999-1 1xBiotin [K79]"	"Catenin delta-1 [OS=Mus musculus]"	"1"	"1091.55539"	"0.54"	"-9.97"	"-9.97"	"-0.07"	"-0.03"	"-0.57"	"9.97"	"136.8"	"199.0"	""	""	"130.3"	"134.0"	"9881.0517578125"	"14372.2412109375"	""	""	"9409.314453125"	"9678.0302734375"	""	"Peak Found"	"Peak Found"	"High"	"Not Found"	"High"	"Peak Found"	"High"	"2"	"546.28136"	"0.0003442"	"0.007855"	"1.96"	"35.13"
"10708"	"[K].KEGSDGTLATSKTAPAEK.[S]"	"1xBiotin [K12]"	"0.00580252"	"0.000586377"	"1"	"1"	"4"	"Q9DBG7"	"Q9DBG7 [174-191]"	"Q9DBG7 1xBiotin [K185]"	"signal recognition particle receptor subunit alpha [OS=Mus musculus]"	"2"	"2016.99065"	"0.46"	"0.60"	"-9.97"	"1.24"	"0.39"	"-0.07"	"-0.21"	"79.5"	"109.1"	"120.2"	""	"187.2"	"104.0"	"6208.94775390625"	"8523.8486328125"	"9392.47265625"	""	"14631.091796875"	"8126.99658203125"	""	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"3"	"673.00202"	"0.0001108"	"0.0002834"	"3.45"	"27.77"
"19660"	"[K].NKYNTPK.[Y]"	"1xBiotin [K2]"	"0.12145"	"0.00820514"	"1"	"1"	"2"	"P47962"	"P47962 [42-48]"	"P47962 1xBiotin [K43]"	"60S ribosomal protein L5 [OS=Mus musculus]"	"1"	"1090.53499"	"0.12"	"0.40"	"-0.31"	"0.19"	"0.61"	"0.49"	"0.22"	"87.1"	"94.7"	"114.7"	"70.5"	"99.7"	"133.3"	"6122.21044921875"	"6652.4423828125"	"8059"	"4954.91845703125"	"7004.42236328125"	"9362.6201171875"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"2"	"545.77148"	"0.001555"	"0.02596"	"1.43"	"25.02"
"11663"	"[K].KPAAAAVTKK.[V]"	"1xBiotin [K9]"	"0.000218152"	"0.000586377"	"1"	"1"	"3"	"P15864"	"P15864 [160-169]"	"P15864 1xBiotin [K168]"	"Histone H1.2 [OS=Mus musculus]"	"1"	"1210.69764"	"0.94"	"0.79"	"0.43"	"1.33"	"0.88"	"-0.05"	"0.09"	"58.0"	"110.9"	"100.6"	"78.3"	"145.3"	"106.9"	"4555.09130859375"	"8713.6376953125"	"7899.52392578125"	"6154.7265625"	"11418.068359375"	"8396.6201171875"	""	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"2"	"605.85262"	"0.0001108"	"2.355E-06"	"3.41"	"20.65"
"10696"	"[R].KEEVYK.[Q]"	"1xBiotin [K1]"	"0.0980647"	"0.00472246"	"1"	"1"	"2"	"Q9JIG7"	"Q9JIG7 [470-475]"	"Q9JIG7 1xBiotin [K470]"	"Coiled-coil domain-containing protein 22 [OS=Mus musculus]"	"1"	"1021.50229"	"0.60"	"0.44"	"0.46"	"0.09"	"0.42"	"-0.18"	"-0.02"	"78.5"	"118.8"	"106.3"	"108.0"	"83.6"	"104.9"	"19077.451171875"	"28858.669921875"	"25815.314453125"	"26234.95703125"	"20310.783203125"	"25475.34765625"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"2"	"511.25466"	"0.0009666"	"0.0187"	"1.66"	"26.14"
"19708"	"[R].NIGKTLVTR.[T]"	"1xBiotin [K4]"	"0.0642648"	"0.0019826"	"1"	"1"	"1"	"P97351"	"P97351 [43-51]"	"P97351 1xBiotin [K46]"	"40S ribosomal protein S3a [OS=Mus musculus]"	"1"	"1227.68780"	"0.14"	"0.08"	"0.07"	"0.01"	"0.23"	"0.09"	"0.15"	"93.9"	"103.8"	"99.2"	"98.6"	"94.4"	"110.2"	"43789.9375"	"48384.98046875"	"46256.1015625"	"45956.5"	"44012.59375"	"51376.1796875"	""	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"2"	"614.34763"	"0.0003442"	"0.009874"	"1.87"	"37.27"
"9981"	"[K].HNEETGDNVGPLIIKK.[K]"	"1xBiotin [K16]"	"0.019145"	"0.000586377"	"1"	"1"	"2"	"Q91WS0"	"Q91WS0 [90-105]"	"Q91WS0 1xBiotin [K105]"	"CDGSH iron-sulfur domain-containing protein 1 [OS=Mus musculus]"	"1"	"1990.00624"	"-0.85"	"-0.47"	"0.22"	"-1.63"	"-0.92"	"-0.07"	"-0.45"	"139.7"	"77.3"	"101.0"	"163.0"	"45.1"	"73.8"	"1280649.203125"	"708888.796875"	"925380.640625"	"1494385.3125"	"413788.140625"	"676532.5546875"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"3"	"664.00693"	"0.0001108"	"0.001634"	"4.00"	"39.72"
"10700"	"[K].KEGAAGFFKGIGK.[G]"	"1xBiotin [K9]"	"0.0842191"	"0.00241047"	"1"	"3"	"1"	"Q8BX70-1"	"Q8BX70-1 [3540-3552]"	"Q8BX70-1 1xBiotin [K3548]"	"Vacuolar protein sorting-associated protein 13C [OS=Mus musculus]"	"2"	"1535.80390"	"0.60"	"-0.31"	"-0.37"	"-9.97"	"-9.97"	"-9.97"	"-9.97"	"146.4"	"222.3"	"117.8"	"113.4"	""	""	"9001.6396484375"	"13668.6328125"	"7242.7734375"	"6974.3349609375"	""	""	""	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"3"	"512.60597"	"0.000415"	"0.01484"	"2.90"	"41.42"
"24304"	"[R].SPTKSSLDYR.[R]"	"1xBiotin [K4]"	"0.0339747"	"0.00104877"	"1"	"1"	"1"	"Q8C2Q3"	"Q8C2Q3 [627-636]"	"Q8C2Q3 1xBiotin [K630]"	"RNA-binding protein 14 [OS=Mus musculus]"	"1"	"1379.66238"	"-9.97"	"-9.97"	"0.33"	"0.90"	"0.98"	"9.97"	"9.97"	"98.4"	""	""	"123.9"	"183.8"	"193.9"	"4303.18310546875"	""	""	"5418.13818359375"	"8040.03662109375"	"8479.404296875"	""	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"2"	"690.33544"	"0.0001873"	"0.003798"	"1.83"	"32.93"
"11672"	"[K].KPAGATPK.[K]"	"1xBiotin [K1]"	"0.00766951"	"0.000586377"	"1"	"1"	"1"	"P43276"	"P43276 [130-137]"	"P43276 1xBiotin [K130]"	"Histone H1.5 [OS=Mus musculus]"	"0"	"995.53426"	"0.51"	"0.35"	"0.12"	"0.05"	"0.34"	"-0.18"	"-0.01"	"84.7"	"120.8"	"107.8"	"92.1"	"87.5"	"107.0"	"16919.865234375"	"24136.203125"	"21535.087890625"	"18405.275390625"	"17473.654296875"	"21372.11328125"	""	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"2"	"498.27067"	"0.0001108"	"0.0004268"	"2.01"	"20.11"
"16220"	"[K].LTGMAFR.[V]"	""	"0.0899165"	"0.00334029"	"1"	"2"	"2"	"P16858"	"P16858 [226-232]"	""	"glyceraldehyde-3-phosphate dehydrogenase [OS=Mus musculus]"	"0"	"795.41817"	"1.61"	"0.94"	"1.35"	"2.70"	"1.23"	"-0.38"	"0.29"	"34.5"	"105.5"	"66.2"	"87.8"	"224.7"	"81.2"	"23116.90625"	"70623.859375"	"44336.87890625"	"58757.1328125"	"150457.75"	"54380.3984375"	""	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"2"	"398.21244"	"0.000655"	"0.0164"	"1.57"	"29.98"
"13955"	"[K].LKQFDAYPK.[T]"	"1xBiotin [K2]"	"0.00519549"	"0.000586377"	"1"	"2"	"2"	"Q9CQE7"	"Q9CQE7 [7-15]"	"Q9CQE7 1xBiotin [K8]"	"Endoplasmic reticulum-Golgi intermediate compartment protein 3 [OS=Mus musculus]"	"1"	"1335.67657"	"0.57"	"0.32"	"0.62"	"0.40"	"0.57"	"0.00"	"0.25"	"74.3"	"110.2"	"92.9"	"114.2"	"98.3"	"110.2"	"34908.16015625"	"51799.921875"	"43650.58984375"	"53685.21484375"	"46216.9296875"	"51793.58984375"	""	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"2"	"668.34242"	"0.0001108"	"0.0002407"	"2.69"	"38.86"
"23748"	"[K].SKLVQRP.[-]"	"1xBiotin [K2]"	"0.0443703"	"0.00104877"	"1"	"1"	"4"	"Q6PGC7"	"Q6PGC7 [307-313]"	"Q6PGC7 1xBiotin [K308]"	"Solute carrier family 35 member E3 [OS=Mus musculus]"	"1"	"1053.58736"	"0.20"	"0.35"	"0.18"	"-0.35"	"0.59"	"0.39"	"0.25"	"87.6"	"100.8"	"111.4"	"99.6"	"68.6"	"132.1"	"13383.443359375"	"15392.5966796875"	"17016.275390625"	"15209.3779296875"	"10481.78515625"	"20181.806640625"	""	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"2"	"527.29711"	"0.0001873"	"0.005651"	"2.23"	"30.76"
"13876"	"[R].IKHVAGSTQTR.[H]"	"1xBiotin [K2]"	"0.0088163"	"0.000586377"	"1"	"4"	"4"	"Q80TI0-1"	"Q80TI0-1 [595-605]"	"Q80TI0-1 1xBiotin [K596]"	"GRAM domain-containing protein 1B [OS=Mus musculus]"	"1"	"1423.74744"	"1.09"	"0.22"	"0.67"	"0.59"	"0.44"	"-0.64"	"0.23"	"68.7"	"146.0"	"79.9"	"109.0"	"103.1"	"93.4"	"26716.609375"	"56782.6318359375"	"31066.896484375"	"42417.1713867188"	"40093.8154296875"	"36319.3046875"	""	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"3"	"475.25393"	"0.0001108"	"0.0005206"	"2.56"	"21.57"
"23744"	"[R].SKISQVLGNEIK.[F]"	"1xBiotin [K2]"	"0.129378"	"0.00949852"	"1"	"1"	"1"	"Q4QQM4"	"Q4QQM4 [42-53]"	"Q4QQM4 1xBiotin [K43]"	"Tumor protein p53-inducible protein 11 [OS=Mus musculus]"	"1"	"1541.83559"	"-9.97"	"0.23"	"-9.97"	"-9.97"	"-9.97"	""	"-9.97"	"276.6"	""	"323.4"	""	""	""	"6893.77734375"	""	"8058.03076171875"	""	""	""	""	"Peak Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"771.42143"	"0.001921"	"0.02849"	"1.51"	"48.51"
"25392"	"[K].TKSGLTGYIK.[G]"	"1xBiotin [K2]"	"0.00266"	"0.000586377"	"1"	"1"	"3"	"Q8BMA6"	"Q8BMA6 [609-618]"	"Q8BMA6 1xBiotin [K610]"	"Signal recognition particle subunit SRP68 [OS=Mus musculus]"	"1"	"1293.68713"	"0.73"	"0.70"	"0.70"	"0.79"	"0.62"	"-0.12"	"-0.08"	"65.3"	"108.7"	"106.3"	"106.1"	"113.3"	"100.3"	"43220.65234375"	"71895.359375"	"70346.90625"	"70152.984375"	"74924.875"	"66344.8828125"	""	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"2"	"647.34738"	"0.0001108"	"9.047E-05"	"2.92"	"39.09"
"16234"	"[K].LTKAASLPGK.[N]"	"1xBiotin [K3]"	"0.000529282"	"0.000586377"	"1"	"1"	"1"	"O70472"	"O70472 [1640-1649]"	"O70472 1xBiotin [K1642]"	"Transmembrane protein 131 [OS=Mus musculus]"	"1"	"1211.68165"	"0.64"	"0.17"	"0.27"	"0.52"	"0.49"	"-0.15"	"0.31"	"77.7"	"121.0"	"87.6"	"93.6"	"111.2"	"108.9"	"93788.359375"	"146102.625"	"105749.328125"	"112943.28125"	"134188.0625"	"131422.9375"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"2"	"606.34451"	"0.0001108"	"8.59E-06"	"3.65"	"33.42"
"13844"	"[K].LKFEMTEQEK.[Q]"	"1xBiotin [K2]; 1xOxidation [M5]"	"0.0347582"	"0.00104877"	"1"	"5"	"1"	"Q3URD3-1"	"Q3URD3-1 [783-792]"	"Q3URD3-1 1xBiotin [K784]"	"Sarcolemmal membrane-associated protein [OS=Mus musculus]"	"1"	"1524.70728"	"0.07"	"0.03"	"0.39"	"-0.61"	"-0.29"	"-0.36"	"-0.32"	"102.5"	"107.6"	"104.6"	"134.4"	"67.1"	"83.7"	"10265.3525390625"	"10775.8193359375"	"10476.2939453125"	"13459.1416015625"	"6713.62158203125"	"8378.9296875"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"2"	"762.85695"	"0.0001873"	"0.003935"	"1.51"	"34.06"
"13841"	"[R].LKEYSSMDGSWQEGK.[A]"	"1xBiotin [K2]; 1xOxidation [M7]"	"0.00016109"	"0.000586377"	"1"	"1"	"4"	"Q8R0X7"	"Q8R0X7 [130-144]"	"Q8R0X7 1xBiotin [K131]"	"sphingosine-1-phosphate lyase 1 [OS=Mus musculus]"	"1"	"1986.85719"	"0.13"	"-9.97"	"0.28"	"-9.97"	"-9.97"	"-9.97"	""	"181.2"	"198.5"	""	"220.3"	""	""	"8412.4453125"	"9218.3076171875"	""	"10227.27734375"	""	""	""	"Peak Found"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"2"	"993.93253"	"0.0001108"	"1.505E-06"	"3.37"	"35.12"
"25450"	"[K].TLFTKTHPQWYPAR.[Q]"	"1xBiotin [K5]"	"0.016289"	"0.000586377"	"1"	"1"	"2"	"Q9CY27"	"Q9CY27 [34-47]"	"Q9CY27 1xBiotin [K38]"	"Very-long-chain enoyl-CoA reductase [OS=Mus musculus]"	"1"	"1971.98980"	"0.89"	"-9.97"	"-1.14"	"-9.97"	"0.80"	"-0.09"	"9.97"	"118.8"	"220.1"	""	"54.0"	""	"207.1"	"17335.103515625"	"32102.43359375"	""	"7876.5625"	""	"30205.619140625"	""	"Peak Found"	"High"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"3"	"658.00081"	"0.0001108"	"0.00129"	"2.68"	"44.39"
"13810"	"[R].LKEAINTSK.[D]"	"1xBiotin [K2]"	"0.013538"	"0.000586377"	"1"	"1"	"1"	"Q9ERB0"	"Q9ERB0 [146-154]"	"Q9ERB0 1xBiotin [K147]"	"Synaptosomal-associated protein 29 [OS=Mus musculus]"	"1"	"1229.65583"	"0.42"	"0.03"	"-0.06"	"0.08"	"0.28"	"-0.14"	"0.25"	"91.1"	"121.8"	"93.0"	"87.2"	"96.1"	"110.9"	"15038.4365234375"	"20121.103515625"	"15351.5791015625"	"14397.708984375"	"15865.478515625"	"18313.134765625"	""	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"2"	"615.33152"	"0.0001108"	"0.0009805"	"2.33"	"29.16"
"23738"	"[R].SKLGPYNEELR.[A]"	"1xBiotin [K2]"	"0.0353574"	"0.00104877"	"1"	"1"	"2"	"Q9D1E6"	"Q9D1E6 [128-138]"	"Q9D1E6 1xBiotin [K129]"	"tubulin-folding cofactor B [OS=Mus musculus]"	"1"	"1531.75734"	"0.43"	"-0.01"	"-9.97"	"0.28"	"-9.97"	"-9.97"	"-9.97"	"131.9"	"177.2"	"130.9"	""	"159.9"	""	"20006.80078125"	"26873.125"	"19852.57421875"	""	"24253.986328125"	""	""	"Peak Found"	"Peak Found"	"High"	"Not Found"	"High"	"Not Found"	"High"	"2"	"766.38272"	"0.0001873"	"0.004056"	"2.55"	"39.40"
"23769"	"[RK].SKQEALK.[QN]"	"1xBiotin [K2]"	"0.0387264"	"0.00104877"	"1"	"4"	"3"	"F8VQB6"	"F8VQB6 [1213-1219]"	"F8VQB6 1xBiotin [K1214]"	"Unconventional myosin-X [OS=Mus musculus]"	"1"	"1029.53974"	"0.45"	"0.13"	"-0.03"	"0.48"	"0.28"	"-0.17"	"0.16"	"85.2"	"116.6"	"92.9"	"83.2"	"118.6"	"103.5"	"11256.23828125"	"15399.52734375"	"12277.7392578125"	"10997.208984375"	"15667.5"	"13675.65625"	""	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"2"	"515.27338"	"0.0001873"	"0.004622"	"2.03"	"25.17"
"13806"	"[K].LKDSLR.[Q]"	"1xBiotin [K2]"	"0.122093"	"0.00820514"	"1"	"1"	"1"	"Q8K2L8"	"Q8K2L8 [732-737]"	"Q8K2L8 1xBiotin [K733]"	"Trafficking protein particle complex subunit 12 [OS=Mus musculus]"	"1"	"957.51861"	"0.49"	"0.17"	"0.15"	"-0.10"	"0.36"	"-0.13"	"0.19"	"87.5"	"123.1"	"98.5"	"97.1"	"81.6"	"112.2"	"11982.10546875"	"16865.037109375"	"13491.4296875"	"13300.71875"	"11179.306640625"	"15372.162109375"	""	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"2"	"479.26270"	"0.00163"	"0.0262"	"1.60"	"30.70"
"16310"	"[K].LTPLVLKPFGNSVSVYNGEPEHMEKNATPYK.[D]"	"1xBiotin [K]; 1xOxidation [M23]"	"0.00280317"	"0.000586377"	"1"	"1"	"2"	"Q3U9G9"	"Q3U9G9 [127-157]"	"Q3U9G9 1xBiotin [K]"	"Lamin-B receptor [OS=Mus musculus]"	"1"	"3701.83421"	"-0.85"	"0.54"	"-9.97"	"-9.97"	"1.53"	"2.38"	"0.99"	"101.6"	"56.4"	"148.1"	""	""	"293.9"	"17111.740234375"	"9496.5322265625"	"24931.724609375"	""	""	"49498.21484375"	""	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"4"	"926.21444"	"0.0001108"	"9.814E-05"	"4.17"	"46.85"
"16485"	"[K].IVKPVKVSAPR.[V]"	"1xBiotin [K6]"	"0.00607879"	"0.000586377"	"1"	"1"	"6"	"Q8BP67"	"Q8BP67 [142-152]"	"Q8BP67 1xBiotin [K147]"	"60S ribosomal protein L24 [OS=Mus musculus]"	"1"	"1419.85045"	"0.86"	"0.13"	"0.43"	"0.50"	"0.42"	"-0.44"	"0.29"	"74.8"	"136.2"	"81.9"	"101.1"	"105.8"	"100.2"	"19718.56640625"	"35896.99609375"	"21577.865234375"	"26629.015625"	"27874.845703125"	"26387.9140625"	""	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"473.95492"	"0.0001108"	"0.0003039"	"2.54"	"29.99"
"25601"	"[K].TLVTKESCSQK.[D]"	"1xBiotin [K5]; 1xCarbamidomethyl [C8]"	"0.0088163"	"0.000586377"	"1"	"1"	"3"	"Q9JKZ2"	"Q9JKZ2 [551-561]"	"Q9JKZ2 1xBiotin [K555]"	"sodium/myo-inositol cotransporter [OS=Mus musculus]"	"1"	"1506.72908"	"0.36"	"-9.97"	"2.14"	"0.58"	"0.17"	"-0.19"	"9.97"	"64.5"	"82.6"	""	"283.8"	"96.7"	"72.4"	"7964.9541015625"	"10204.59375"	""	"35052.81640625"	"11945.6162109375"	"8938.41015625"	""	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"2"	"753.86842"	"0.0001108"	"0.0005218"	"2.21"	"30.25"
"13494"	"[K].IGGIGTVPVGR.[V]"	""	"0.0284597"	"0.00104877"	"1"	"2"	"3"	"P10126"	"P10126 [256-266]"	""	"Elongation factor 1-alpha 1 [OS=Mus musculus]"	"0"	"1025.61020"	"-0.04"	"-0.39"	"0.03"	"-0.58"	"0.09"	"0.13"	"0.49"	"109.2"	"106.5"	"83.2"	"111.4"	"73.2"	"116.5"	"19451.689453125"	"18982.30859375"	"14824.525390625"	"19857.77734375"	"13038.84375"	"20762.42578125"	""	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"2"	"513.30842"	"0.0001873"	"0.002936"	"2.39"	"31.68"
"13490"	"[R].IGGKGTAR.[R]"	"1xBiotin [K4]"	"0.0222365"	"0.00104877"	"1"	"3"	"4"	"Q9CQH7"	"Q9CQH7 [15-22]"	"Q9CQH7 1xBiotin [K18]"	"transcription factor BTF3 homolog 4 [OS=Mus musculus]"	"1"	"985.52476"	"0.62"	"0.08"	"0.60"	"0.54"	"-0.06"	"-0.67"	"-0.13"	"79.8"	"122.2"	"84.2"	"121.3"	"115.9"	"76.7"	"6232.224609375"	"9550.0966796875"	"6575.7109375"	"9475.5966796875"	"9052.6044921875"	"5993.20068359375"	""	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"2"	"493.26596"	"0.0001873"	"0.002028"	"2.18"	"22.45"
"13432"	"[K].LFYIPWR.[H]"	""	"0.0574787"	"0.0019826"	"1"	"1"	"1"	"P56477"	"P56477 [42-48]"	""	"interferon regulatory factor 5 [OS=Mus musculus]"	"0"	"994.55090"	"0.16"	"0.23"	"-0.47"	"-9.97"	"-0.38"	"-0.54"	"-0.61"	"125.5"	"140.5"	"147.0"	"90.4"	""	"96.6"	"27063.2734375"	"30290.201171875"	"31680.29296875"	"19486.60546875"	""	"20815.427734375"	""	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"2"	"497.77875"	"0.0003442"	"0.008362"	"1.93"	"52.61"
"13384"	"[K].LFLKINGSSNR.[E]"	"1xBiotin [K4]"	"0.0296229"	"0.00104877"	"1"	"1"	"2"	"Q8CGA3"	"Q8CGA3 [554-564]"	"Q8CGA3 1xBiotin [K557]"	"Large neutral amino acids transporter small subunit 4 [OS=Mus musculus]"	"1"	"1474.78349"	"1.04"	"-9.97"	"-0.06"	"-0.04"	"-9.97"	"-9.97"	""	"120.1"	"247.6"	""	"115.2"	"117.1"	""	"6833.22509765625"	"14091.748046875"	""	"6554.53076171875"	"6661.7685546875"	""	""	"Peak Found"	"High"	"Not Found"	"Peak Found"	"High"	"Not Found"	"High"	"2"	"737.89516"	"0.0001873"	"0.003096"	"1.78"	"44.36"
"13373"	"[K].LFGPYVWGR.[Y]"	""	"0.00912871"	"0.000586377"	"1"	"1"	"3"	"Q8VCT3"	"Q8VCT3 [277-285]"	""	"aminopeptidase B [OS=Mus musculus]"	"0"	"1094.57818"	"0.34"	"0.29"	"0.40"	"-1.86"	"0.44"	"0.10"	"0.14"	"93.0"	"117.9"	"114.1"	"123.2"	"25.7"	"126.1"	"18873.076171875"	"23922.947265625"	"23149.39453125"	"24981.84765625"	"5207.35302734375"	"25579.05859375"	""	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"2"	"547.79259"	"0.0001108"	"0.000551"	"2.00"	"47.51"
"16616"	"[R].IVSQKQIADR.[A]"	"1xBiotin [K5]"	"0.0200481"	"0.000586377"	"1"	"1"	"2"	"P46638"	"P46638 [175-184]"	"P46638 1xBiotin [K179]"	"Ras-related protein Rab-11B [OS=Mus musculus]"	"1"	"1383.74129"	"0.40"	"0.20"	"-9.97"	"-9.97"	"-0.03"	"-0.43"	"-0.23"	"135.1"	"178.0"	"154.7"	""	""	"132.3"	"6623.24462890625"	"8726.74609375"	"7582.486328125"	""	""	"6484.10400390625"	""	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Peak Found"	"High"	"2"	"692.37355"	"0.0001108"	"0.001752"	"1.53"	"30.57"
"25797"	"[R].TPYHTGKK.[G]"	"1xBiotin [K7]"	"0.0393919"	"0.00104877"	"1"	"1"	"5"	"Q64518"	"Q64518 [1013-1020]"	"Q64518 1xBiotin [K1019]"	"Sarcoplasmic/endoplasmic reticulum calcium atpase 3 [OS=Mus musculus]"	"1"	"1157.57719"	"0.59"	"0.58"	"0.37"	"0.39"	"0.56"	"-0.02"	"-0.01"	"74.3"	"111.7"	"110.7"	"96.3"	"97.1"	"109.9"	"27347.5180664063"	"41104.4423828125"	"40748.548828125"	"35431.9462890625"	"35753.8662109375"	"40442.0849609375"	""	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"2"	"579.29243"	"0.0001873"	"0.004754"	"1.65"	"19.22"
"23626"	"[K].SHKPLMLSQLPDNR.[I]"	"1xBiotin [K3]"	"0.000364433"	"0.000586377"	"1"	"1"	"5"	"O35963"	"O35963 [201-214]"	"O35963 1xBiotin [K203]"	"Ras-related protein Rab-33B [OS=Mus musculus]"	"0"	"1861.94113"	"0.67"	"0.24"	"0.15"	"-0.39"	"0.62"	"-0.06"	"0.38"	"83.6"	"133.4"	"98.5"	"92.9"	"63.6"	"128.1"	"27951.91015625"	"44611.109375"	"32936.046875"	"31074.8046875"	"21274.138671875"	"42854.58203125"	""	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"3"	"621.31844"	"0.0001108"	"4.951E-06"	"3.60"	"41.65"
"25812"	"[K].TQKIVIK.[K]"	"1xBiotin [K3]"	"0.04884"	"0.00154748"	"1"	"1"	"3"	"Q9D0V7"	"Q9D0V7 [105-111]"	"Q9D0V7 1xBiotin [K107]"	"Receptor-binding cancer antigen expressed on SiSo cells [OS=Mus musculus]"	"1"	"1055.62816"	"0.39"	"-9.97"	"0.09"	"0.01"	"0.25"	"-0.14"	"9.97"	"107.8"	"141.1"	""	"114.9"	"108.2"	"128.0"	"13263.505859375"	"17351.529296875"	""	"14132.9912109375"	"13310.29296875"	"15749.650390625"	""	"Peak Found"	"High"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"2"	"528.31746"	"0.0002716"	"0.006522"	"2.25"	"34.42"
"23733"	"[K].SKHEEDTVQK.[Q]"	"1xBiotin [K2]"	"0.0127767"	"0.000586377"	"1"	"1"	"4"	"Q8BMG7"	"Q8BMG7 [352-361]"	"Q8BMG7 1xBiotin [K353]"	"Rab3 GTPase-activating protein non-catalytic subunit [OS=Mus musculus]"	"1"	"1426.66310"	"0.02"	"-0.14"	"-0.10"	"-0.05"	"-0.11"	"-0.13"	"0.03"	"104.4"	"106.1"	"94.9"	"97.4"	"100.5"	"96.7"	"13655.611328125"	"13877.9873046875"	"12415.9453125"	"12744.7275390625"	"13147.4931640625"	"12655.30078125"	""	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"3"	"476.22589"	"0.0001108"	"0.0008985"	"2.59"	"17.87"
"14012"	"[R].IKTYYQK.[W]"	"1xBiotin [K2]"	"0.090407"	"0.00334029"	"1"	"1"	"3"	"P21855"	"P21855 [318-324]"	"P21855 1xBiotin [K319]"	"B-cell differentiation antigen CD72 [OS=Mus musculus]"	"1"	"1169.60234"	"1.08"	"0.70"	"0.74"	"0.54"	"0.90"	"-0.19"	"0.19"	"61.6"	"130.6"	"100.3"	"103.0"	"89.8"	"114.8"	"6935.20947265625"	"14708.115234375"	"11297.8740234375"	"11607.9873046875"	"10112.810546875"	"12926.69921875"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"2"	"585.30410"	"0.000655"	"0.01649"	"1.62"	"29.80"
"16159"	"[R].LTAKWQR.[Q]"	"1xBiotin [K4]"	"0.0875007"	"0.00334029"	"1"	"1"	"1"	"Q9ERK9"	"Q9ERK9 [319-325]"	"Q9ERK9 1xBiotin [K322]"	"P2Y purinoceptor 6 [OS=Mus musculus]"	"1"	"1128.59826"	"0.52"	"-9.97"	"0.22"	"-9.97"	"0.13"	"-0.39"	"9.97"	"127.9"	"183.0"	""	"149.4"	""	"139.7"	"13953.546875"	"19953.099609375"	""	"16294.7958984375"	""	"15231.8310546875"	""	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"2"	"564.80272"	"0.0005759"	"0.01566"	"1.91"	"36.01"
"25372"	"[K].TKNAVQALIDK.[H]"	"1xBiotin [K2]"	"0.00189726"	"0.000586377"	"1"	"1"	"1"	"Q9D850-1"	"Q9D850-1 [296-306]"	"Q9D850-1 1xBiotin [K297]"	"Transmembrane protein 68 [OS=Mus musculus]"	"1"	"1426.77226"	"-9.97"	"-9.97"	"-0.05"	"-0.15"	"-9.97"	""	""	"209.2"	""	""	"202.0"	"188.9"	""	"13412.16796875"	""	""	"12949.939453125"	"12110.4462890625"	""	""	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Not Found"	"High"	"2"	"713.88944"	"0.0001108"	"5.533E-05"	"2.23"	"43.30"
"24331"	"[K].SQDPGAVVLGKSLTER.[A]"	"1xBiotin [K11]"	"0.0657102"	"0.0019826"	"1"	"3"	"1"	"P70704-1"	"P70704-1 [1091-1106]"	"P70704-1 1xBiotin [K1101]"	"Phospholipid-transporting ATPase IA [OS=Mus musculus]"	"1"	"1882.96912"	"-9.97"	"-9.97"	"0.30"	"-9.97"	"-9.97"	""	""	"268.6"	""	""	"331.4"	""	""	"5677.1767578125"	""	""	"7004.2666015625"	""	""	""	"Peak Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"3"	"628.32832"	"0.0003442"	"0.0102"	"1.74"	"46.20"
"15420"	"[K].LPPPKPLPGTLK.[R]"	"1xBiotin [K5]"	"0.0004964"	"0.000586377"	"1"	"1"	"8"	"O35598"	"O35598 [711-722]"	"O35598 1xBiotin [K715]"	"Disintegrin and metalloproteinase domain-containing protein 10 [OS=Mus musculus]"	"0"	"1483.87052"	"0.20"	"0.14"	"0.04"	"0.07"	"0.37"	"0.17"	"0.22"	"90.7"	"104.1"	"100.1"	"92.9"	"95.4"	"116.8"	"21458.53515625"	"24641.537109375"	"23701.34375"	"21997.4609375"	"22581.740234375"	"27636.16796875"	""	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"2"	"742.43888"	"0.0001108"	"7.823E-06"	"2.62"	"41.86"
"24183"	"[K].SPAKPKAVK.[S]"	"1xBiotin [K6]"	"0.0378561"	"0.00104877"	"1"	"1"	"2"	"P43276"	"P43276 [186-194]"	"P43276 1xBiotin [K191]"	"Histone H1.5 [OS=Mus musculus]"	"1"	"1151.66053"	"0.75"	"0.45"	"0.41"	"0.96"	"0.49"	"-0.26"	"0.03"	"68.7"	"115.3"	"94.1"	"91.5"	"134.1"	"96.3"	"3914.31103515625"	"6569.21875"	"5357.4345703125"	"5208.80517578125"	"7637.07763671875"	"5487.46728515625"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"2"	"576.33327"	"0.0001873"	"0.00447"	"1.92"	"18.27"
"15888"	"[R].LSDKGLK.[A]"	"1xBiotin [K4]"	"0.0918932"	"0.00334029"	"1"	"2"	"1"	"Q8VEK3"	"Q8VEK3 [25-31]"	"Q8VEK3 1xBiotin [K28]"	"Heterogeneous nuclear ribonucleoprotein U [OS=Mus musculus]"	"1"	"986.53393"	"-0.47"	"-0.22"	"-0.39"	"-0.03"	"0.06"	"0.53"	"0.28"	"111.8"	"80.9"	"96.0"	"85.5"	"109.3"	"116.5"	"12162.9111328125"	"8800.615234375"	"10445.0419921875"	"9296.3251953125"	"11889.9619140625"	"12669.978515625"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"2"	"493.77019"	"0.0007348"	"0.0169"	"1.65"	"29.64"
"24532"	"[R].SSGVSYKYSK.[V]"	"1xBiotin [K7]"	"0.013538"	"0.000586377"	"1"	"1"	"3"	"Q07113"	"Q07113 [2336-2345]"	"Q07113 1xBiotin [K2342]"	"Cation-independent mannose-6-phosphate receptor [OS=Mus musculus]"	"1"	"1331.63001"	"-0.08"	"-0.05"	"0.12"	"-0.36"	"0.15"	"0.23"	"0.20"	"101.9"	"96.4"	"98.6"	"110.6"	"79.2"	"113.3"	"20906.59375"	"19779.84375"	"20229.673828125"	"22679.48046875"	"16243.8955078125"	"23242.357421875"	""	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"2"	"666.31848"	"0.0001108"	"0.0009804"	"2.33"	"30.44"
"15183"	"[R].LNPPGGKTSDIFGSPVTATAPLAHPNKPK.[D]"	"1xBiotin [K7]"	"0.0115787"	"0.000586377"	"1"	"1"	"2"	"Q6PGH2"	"Q6PGH2 [84-112]"	"Q6PGH2 1xBiotin [K90]"	"Jupiter microtubule associated homolog 2 [OS=Mus musculus]"	"1"	"3138.64046"	"-0.88"	"-0.66"	"-1.54"	"-9.97"	"-0.37"	"0.51"	"0.29"	"182.2"	"98.8"	"115.1"	"62.7"	""	"141.1"	"21617.43359375"	"11724.5947265625"	"13658.7890625"	"7441.40185546875"	""	"16740.58984375"	""	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"4"	"785.41442"	"0.0001108"	"0.0007786"	"3.65"	"43.61"
"24157"	"[K].SNQNGKDLKPSTPR.[S]"	"1xBiotin [K6]"	"0.00719476"	"0.000586377"	"1"	"1"	"4"	"Q61937"	"Q61937 [206-219]"	"Q61937 1xBiotin [K211]"	"Nucleophosmin [OS=Mus musculus]"	"1"	"1767.88064"	"-0.12"	"0.22"	"-0.43"	"0.06"	"0.23"	"0.35"	"0.01"	"99.3"	"91.3"	"115.9"	"73.5"	"103.5"	"116.4"	"14881.8818359375"	"13682.763671875"	"17367.615234375"	"11016.3720703125"	"15516.3056640625"	"17442.8671875"	""	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"3"	"589.96462"	"0.0001108"	"0.0003883"	"2.11"	"25.56"
"24642"	"[R].SSVSKVPLLLPNVSALESQIEMGNIVKPK.[V]"	"1xBiotin [K5]; 1xOxidation [M22]"	"0.0224937"	"0.00104877"	"1"	"2"	"3"	"Q99P72-2"	"Q99P72-2 [913-941]"	"Q99P72-2 1xBiotin [K917]"	"Reticulon-4 [OS=Mus musculus]"	"1"	"3319.80040"	"0.87"	"-0.59"	"-9.97"	"-9.97"	"0.57"	"-0.30"	"1.16"	"120.6"	"220.3"	"80.2"	""	""	"178.9"	"8616.8837890625"	"15734.4853515625"	"5731.90087890625"	""	""	"12776.22265625"	""	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"4"	"830.70514"	"0.0001873"	"0.002063"	"2.29"	"61.17"
"24692"	"[K].STKSDTPK.[E]"	"1xBiotin [K3]"	"0.0928964"	"0.00379267"	"1"	"1"	"1"	"Q9DBG7"	"Q9DBG7 [230-237]"	"Q9DBG7 1xBiotin [K232]"	"signal recognition particle receptor subunit alpha [OS=Mus musculus]"	"1"	"1089.52449"	"1.18"	"0.50"	"0.49"	"1.03"	"0.32"	"-0.85"	"-0.18"	"64.0"	"144.5"	"90.6"	"90.1"	"131.0"	"80.0"	"3759.71557617188"	"8491.82421875"	"5323.5068359375"	"5296.818359375"	"7699.12109375"	"4701.3154296875"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"2"	"545.26590"	"0.0008081"	"0.01723"	"1.36"	"19.08"
"15137"	"[R].LNKCGVISPR.[F]"	"1xBiotin [K3]; 1xCarbamidomethyl [C4]"	"0.122093"	"0.00820514"	"1"	"1"	"1"	"P62245"	"P62245 [69-78]"	"P62245 1xBiotin [K71]"	"40S ribosomal protein S15a [OS=Mus musculus]"	"1"	"1369.70789"	"0.04"	"0.23"	"-0.23"	"-0.36"	"-0.01"	"-0.05"	"-0.24"	"103.0"	"106.1"	"120.7"	"87.6"	"80.4"	"102.2"	"11286.333984375"	"11621.5693359375"	"13230.1357421875"	"9599.060546875"	"8814.3046875"	"11197.6005859375"	""	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"2"	"685.35946"	"0.00163"	"0.0261"	"2.55"	"35.96"
"23976"	"[K].SIQDIENVALKSENMYDLVM.[-]"	"1xBiotin [K11]; 2xOxidation [M15; M20]"	"0.0750464"	"0.00241047"	"1"	"1"	"1"	"Q9R1W5"	"Q9R1W5 [444-463]"	"Q9R1W5 1xBiotin [K454]"	"Calcitonin gene-related peptide type 1 receptor [OS=Mus musculus]"	"1"	"2570.18229"	"-1.26"	"-0.52"	"-2.73"	"-3.94"	"-0.48"	"0.77"	"0.04"	"197.0"	"82.4"	"137.2"	"29.8"	"12.9"	"140.8"	"55118.07421875"	"23037.37109375"	"38368.13671875"	"8324.203125"	"3595.15478515625"	"39397.31640625"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"3"	"857.39904"	"0.000415"	"0.01248"	"2.69"	"57.52"
"23892"	"[R].SLKGPGK.[H]"	"1xBiotin [K3]"	"0.0738148"	"0.00241047"	"1"	"1"	"1"	"Q7TPN9"	"Q7TPN9 [187-193]"	"Q7TPN9 1xBiotin [K189]"	"Proline-rich protein 14 [OS=Mus musculus]"	"1"	"912.49715"	"0.39"	"0.20"	"0.02"	"-0.25"	"0.14"	"-0.25"	"-0.06"	"93.6"	"122.7"	"107.4"	"94.6"	"78.7"	"103.1"	"27160.65625"	"35607.01953125"	"31183.197265625"	"27446.62109375"	"22843.9609375"	"29914.4453125"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"2"	"456.75219"	"0.000415"	"0.01211"	"1.50"	"25.10"
"24772"	"[K].SVLDKTK.[H]"	"1xBiotin [K5]"	"0.120809"	"0.00731053"	"1"	"1"	"1"	"Q3UPH1"	"Q3UPH1 [226-232]"	"Q3UPH1 1xBiotin [K230]"	"protein PRRC1 [OS=Mus musculus]"	"1"	"1016.54449"	"-0.23"	"0.18"	"0.03"	"0.25"	"0.17"	"0.40"	"-0.01"	"94.8"	"81.0"	"107.6"	"96.9"	"113.0"	"106.7"	"14022.904296875"	"11985.828125"	"15917.0078125"	"14326.33984375"	"16710.158203125"	"15786.2255859375"	""	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"2"	"508.77597"	"0.001478"	"0.02575"	"1.42"	"32.79"
"15089"	"[K].LMWLFGCPLVR.[D]"	"1xCarbamidomethyl [C7]; 1xOxidation [M2]"	"0.0194788"	"0.000586377"	"1"	"1"	"2"	"Q5SUR0"	"Q5SUR0 [60-70]"	""	"Phosphoribosylformylglycinamidine synthase [OS=Mus musculus]"	"0"	"1407.72756"	"-0.38"	"-0.14"	"-9.97"	"-9.97"	"-0.37"	"0.01"	"-0.24"	"173.8"	"133.7"	"158.2"	""	""	"134.2"	"8202.7080078125"	"6308.95849609375"	"7465.56591796875"	""	""	"6333.787109375"	""	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"2"	"704.36825"	"0.0001108"	"0.001674"	"1.98"	"56.63"
"15018"	"[K].LMKEILDK.[K]"	"1xBiotin [K3]; 1xOxidation [M2]"	"0.0166696"	"0.000586377"	"1"	"1"	"3"	"P11499"	"P11499 [566-573]"	"P11499 1xBiotin [K568]"	"Heat shock protein HSP 90-beta [OS=Mus musculus]"	"1"	"1231.64249"	"-0.33"	"0.59"	"0.54"	"-1.95"	"0.33"	"0.67"	"-0.26"	"95.7"	"76.0"	"144.4"	"138.7"	"24.8"	"120.5"	"11119.1162109375"	"8830.4609375"	"16776.998046875"	"16114.6806640625"	"2886.55810546875"	"14001.8349609375"	""	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"2"	"616.32500"	"0.0001108"	"0.001328"	"2.45"	"37.32"
"24942"	"[K].TAMAAAKAPTK.[A]"	"1xBiotin [K7]; 1xOxidation [M3]"	"0.0889429"	"0.00334029"	"1"	"1"	"1"	"Q8BP67"	"Q8BP67 [125-135]"	"Q8BP67 1xBiotin [K131]"	"60S ribosomal protein L24 [OS=Mus musculus]"	"1"	"1302.65445"	"-9.97"	"-1.04"	"-0.51"	"-9.97"	"-9.97"	""	"-9.97"	"274.2"	""	"133.3"	"192.6"	""	""	"6046.0478515625"	""	"2938.94458007813"	"4246.5205078125"	""	""	""	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"High"	"2"	"651.83173"	"0.000655"	"0.01611"	"1.90"	"21.93"
"24980"	"[K].TAYGKPK.[L]"	"1xBiotin [K5]"	"0.0738148"	"0.00241047"	"1"	"2"	"4"	"Q9WU40-1"	"Q9WU40-1 [450-456]"	"Q9WU40-1 1xBiotin [K454]"	"inner nuclear membrane protein Man1 [OS=Mus musculus]"	"0"	"990.50771"	"-0.26"	"0.25"	"-0.35"	"-0.96"	"-0.16"	"0.10"	"-0.42"	"115.0"	"96.1"	"137.3"	"89.9"	"59.1"	"102.6"	"184111.84375"	"153761.984375"	"219691.53125"	"143971.203125"	"94596.9921875"	"164243.59375"	""	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"2"	"495.75747"	"0.000415"	"0.01219"	"1.93"	"26.55"
"25110"	"[K].TEPSANQKGPVYVPDPTSSSK.[L]"	"1xBiotin [K8]"	"0.0562059"	"0.0019826"	"1"	"2"	"5"	"P08103-1"	"P08103-1 [39-59]"	"P08103-1 1xBiotin [K46]"	"Tyrosine-protein kinase HCK [OS=Mus musculus]"	"1"	"2415.14967"	"0.77"	"0.10"	"-0.20"	"1.21"	"0.61"	"-0.16"	"0.51"	"70.6"	"120.4"	"75.9"	"61.4"	"163.9"	"107.8"	"6425.27099609375"	"10949.5"	"6899.7265625"	"5585.609375"	"14901.830078125"	"9806.0146484375"	""	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"805.72161"	"0.0003442"	"0.008087"	"2.47"	"38.04"
"25126"	"[K].TEVKPSSNGSASSASKR.[G]"	"1xBiotin [K16]"	"0.000275461"	"0.000586377"	"1"	"1"	"5"	"Q9DAV9"	"Q9DAV9 [260-276]"	"Q9DAV9 1xBiotin [K275]"	"Trimeric intracellular cation channel type B [OS=Mus musculus]"	"1"	"1918.92871"	"0.11"	"0.26"	"0.30"	"0.59"	"0.22"	"0.12"	"-0.04"	"83.5"	"89.9"	"100.2"	"103.0"	"125.9"	"97.4"	"14648.392578125"	"15773.533203125"	"17565.630859375"	"18065.75390625"	"22075.388671875"	"17088.228515625"	""	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"640.31465"	"0.0001108"	"3.3E-06"	"3.92"	"19.13"
"23777"	"[R].SKSETSLPSSR.[S]"	"1xBiotin [K2]"	"0.0156435"	"0.000586377"	"1"	"1"	"3"	"P23336"	"P23336 [18-28]"	"P23336 1xBiotin [K19]"	"N-acetyllactosaminide alpha-1,3-galactosyltransferase [OS=Mus musculus]"	"1"	"1404.67875"	"0.47"	"0.17"	"0.07"	"0.15"	"0.64"	"0.16"	"0.47"	"83.0"	"115.3"	"93.4"	"87.1"	"91.9"	"129.2"	"10331.2607421875"	"14351.5400390625"	"11621.5244140625"	"10843.2119140625"	"11434.6875"	"16071.4521484375"	""	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"2"	"702.84268"	"0.0001108"	"0.001216"	"2.35"	"27.91"
"14492"	"[K].LILPKR.[L]"	"1xBiotin [K5]"	"0.0842191"	"0.00241047"	"1"	"1"	"3"	"Q8BGT0"	"Q8BGT0 [318-323]"	"Q8BGT0 1xBiotin [K322]"	"Osteopetrosis-associated transmembrane protein 1 [OS=Mus musculus]"	"1"	"965.59647"	"0.14"	"0.21"	"0.35"	"0.13"	"0.38"	"0.24"	"0.17"	"86.4"	"95.4"	"100.3"	"110.3"	"94.8"	"112.8"	"453462.46875"	"500607.25"	"526160.8125"	"578678.125"	"497227.28125"	"591766.6875"	""	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"2"	"483.30162"	"0.000415"	"0.0148"	"1.77"	"37.92"
"16102"	"[R].LSTAHHHKTAHPASSK.[T]"	"1xBiotin [K8]"	"0.0436236"	"0.00104877"	"1"	"1"	"3"	"Q571B6"	"Q571B6 [570-585]"	"Q571B6 1xBiotin [K577]"	"WASP homolog-associated protein with actin, membranes and microtubules [OS=Mus musculus]"	"1"	"1935.96062"	"0.69"	"0.44"	"0.77"	"0.29"	"0.15"	"-0.54"	"-0.29"	"75.0"	"120.8"	"101.7"	"127.8"	"91.5"	"83.2"	"8510.697265625"	"13710.6611328125"	"11534.466796875"	"14505.736328125"	"10376.669921875"	"9442.6923828125"	""	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"4"	"484.74554"	"0.0001873"	"0.005505"	"2.08"	"12.23"
"14486"	"[R].LLLPGELAK.[H]"	"1xBiotin [K9]"	"0.0453851"	"0.00154748"	"2"	"13"	"2"	"Q64525; P10854"	"Q64525 [101-109]; P10854 [101-109]"	"Q64525 1xBiotin [K109]; P10854 1xBiotin [K109]"	"Histone H2B type 2-B [OS=Mus musculus];Histone H2B type 1-M [OS=Mus musculus]"	"0"	"1179.68059"	"-0.04"	"-0.09"	"-0.09"	"-9.97"	"0.11"	"0.15"	"0.19"	"121.6"	"117.9"	"114.7"	"114.6"	""	"131.2"	"9685.7744140625"	"9392.1513671875"	"9131.5546875"	"9123.701171875"	""	"10450.6552734375"	"NotUnique"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"2"	"590.34390"	"0.0002716"	"0.005851"	"1.60"	"54.15"
"25173"	"[K].TGAAAGKR.[K]"	"1xBiotin [K7]"	"0.0242383"	"0.00104877"	"1"	"1"	"5"	"P43277"	"P43277 [27-34]"	"P43277 1xBiotin [K33]"	"Histone H1.3 [OS=Mus musculus]"	"1"	"957.49346"	"1.05"	"1.07"	"0.71"	"0.95"	"0.88"	"-0.17"	"-0.18"	"56.7"	"117.5"	"118.8"	"93.0"	"109.3"	"104.7"	"13443.4140625"	"27864.404296875"	"28161.40625"	"22051.537109375"	"25907.392578125"	"24824.75390625"	""	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"479.25044"	"0.0001873"	"0.002314"	"2.49"	"17.69"
"14409"	"[R].LLLASKHLGAPTTDLA.[-]"	"1xBiotin [K6]"	"0.0252322"	"0.00104877"	"1"	"1"	"2"	"P46062"	"P46062 [1022-1037]"	"P46062 1xBiotin [K1027]"	"signal-induced proliferation-associated protein 1 [OS=Mus musculus]"	"1"	"1847.00953"	"0.73"	"0.41"	"0.28"	"-9.97"	"0.53"	"-0.20"	"0.12"	"90.2"	"150.1"	"120.0"	"109.3"	""	"130.3"	"6513.52392578125"	"10838.533203125"	"8662.962890625"	"7894.2734375"	""	"9410.95703125"	""	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"2"	"924.00824"	"0.0001873"	"0.002459"	"2.71"	"49.74"
"25185"	"[R].TGCIGAKHR.[I]"	"1xBiotin [K7]; 1xCarbamidomethyl [C3]"	"0.120809"	"0.00731053"	"1"	"1"	"2"	"Q9CXW4"	"Q9CXW4 [148-156]"	"Q9CXW4 1xBiotin [K154]"	"60S ribosomal protein L11 [OS=Mus musculus]"	"1"	"1225.59286"	"0.41"	"0.00"	"0.43"	"-0.27"	"0.12"	"-0.29"	"0.12"	"91.1"	"120.7"	"91.0"	"122.9"	"75.3"	"99.0"	"10015.388671875"	"13270.59375"	"10000.009765625"	"13513.0283203125"	"8281.6640625"	"10880.9482421875"	""	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"3"	"409.20214"	"0.001478"	"0.02568"	"1.59"	"21.58"
"25209"	"[K].TGGSSKFDWAAR.[F]"	"1xBiotin [K6]"	"0.00151154"	"0.000586377"	"1"	"1"	"2"	"G5E870"	"G5E870 [254-265]"	"G5E870 1xBiotin [K259]"	"E3 ubiquitin-protein ligase TRIP12 [OS=Mus musculus]"	"1"	"1508.69507"	"-0.03"	"-0.31"	"-9.97"	"-9.97"	"0.11"	"0.14"	"0.42"	"155.3"	"152.0"	"125.4"	""	""	"167.4"	"17633.19921875"	"17261.779296875"	"14237.7509765625"	""	""	"19014.1953125"	""	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"2"	"754.85127"	"0.0001108"	"3.969E-05"	"3.04"	"43.76"
"13168"	"[R].LEKPAK.[Y]"	"1xBiotin [K3]"	"0.101837"	"0.00612902"	"1"	"1"	"7"	"P16858"	"P16858 [247-252]"	"P16858 1xBiotin [K249]"	"glyceraldehyde-3-phosphate dehydrogenase [OS=Mus musculus]"	"0"	"911.50190"	"0.84"	"0.76"	"0.65"	"0.59"	"0.83"	"-0.01"	"0.07"	"64.2"	"115.1"	"108.7"	"101.1"	"96.5"	"114.3"	"41032.48828125"	"73534.6015625"	"69445.1328125"	"64588.9375"	"61611.9296875"	"72981.203125"	""	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"456.25437"	"0.001201"	"0.01987"	"2.07"	"26.00"
"11664"	"[K].KPAAAGVK.[K]"	"1xBiotin [K1]"	"0.0249442"	"0.00104877"	"1"	"1"	"5"	"P43276"	"P43276 [158-165]"	"P43276 1xBiotin [K158]"	"Histone H1.5 [OS=Mus musculus]"	"0"	"967.53935"	"0.56"	"0.54"	"0.51"	"0.31"	"0.32"	"-0.23"	"-0.22"	"76.5"	"112.6"	"111.2"	"108.8"	"95.0"	"95.8"	"29124.1328125"	"42864.875"	"42335.21484375"	"41401.73828125"	"36160.65234375"	"36443.171875"	""	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"2"	"484.27298"	"0.0001873"	"0.002408"	"1.64"	"22.88"
"13126"	"[K].IEGAQNQGKKPEGTSNQGK.[K]"	"1xBiotin [K]"	"0.0485655"	"0.00154748"	"1"	"4"	"2"	"Q99PL5-1"	"Q99PL5-1 [432-450]; [573-591]"	"Q99PL5-1 1xBiotin [K]; 1xBiotin [K]"	"Ribosome-binding protein 1 [OS=Mus musculus]"	"1"	"2197.06660"	"0.69"	"-9.97"	"0.27"	"0.61"	"0.36"	"-0.33"	"9.97"	"90.5"	"146.0"	""	"108.9"	"138.4"	"116.1"	"2757.45336914063"	"4450.13671875"	""	"3319.73071289063"	"4219.01025390625"	"3539.56909179688"	""	"Peak Found"	"High"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"3"	"733.02780"	"0.0002716"	"0.006502"	"1.93"	"19.77"
"16694"	"[K].IYFYWLCR.[D]"	"1xCarbamidomethyl [C7]"	"0.026266"	"0.00104877"	"1"	"1"	"1"	"Q61093"	"Q61093 [439-446]"	""	"Cytochrome b-245 heavy chain [OS=Mus musculus]"	"0"	"1220.59211"	"-0.10"	"0.15"	"-1.62"	"-9.97"	"-0.05"	"0.05"	"-0.21"	"138.5"	"128.8"	"154.0"	"45.2"	""	"133.5"	"35452.6953125"	"32973.29296875"	"39413.1015625"	"11563.5859375"	""	"34169.09765625"	""	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"2"	"610.79939"	"0.0001873"	"0.00261"	"2.47"	"54.21"
"26527"	"[R].VFFLPSKDGDKDVMITGK.[L]"	"1xBiotin [K7]; 1xOxidation [M14]"	"0.126686"	"0.00949852"	"1"	"1"	"1"	"B2RXS4"	"B2RXS4 [1288-1305]"	"B2RXS4 1xBiotin [K1294]"	"Plexin-B2 [OS=Mus musculus]"	"2"	"2239.11374"	"1.15"	"-0.37"	"-0.27"	"-9.97"	"-9.97"	"-9.97"	"-9.97"	"124.6"	"275.6"	"96.6"	"103.2"	""	""	"7172.9111328125"	"15864.5771484375"	"5560.86376953125"	"5938.9140625"	""	""	""	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"3"	"747.04317"	"0.001921"	"0.02766"	"2.30"	"47.59"
"12218"	"[K].KTGSKSVDAAK.[L]"	"1xBiotin [K5]"	"0.00368563"	"0.000586377"	"1"	"1"	"3"	"Q61712"	"Q61712 [189-199]"	"Q61712 1xBiotin [K193]"	"DnaJ homolog subfamily C member 1 [OS=Mus musculus]"	"2"	"1317.68311"	"0.70"	"0.80"	"0.63"	"0.64"	"0.71"	"0.01"	"-0.09"	"65.8"	"107.3"	"114.8"	"101.6"	"102.4"	"108.0"	"13382.6328125"	"21811.4848632813"	"23333.3125"	"20652.4348144531"	"20807.26953125"	"21958.298828125"	""	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"2"	"659.34530"	"0.0001108"	"0.0001461"	"2.52"	"19.17"
"23108"	"[K].SAKNPER.[W]"	"1xBiotin [K3]"	"0.0762972"	"0.00241047"	"1"	"1"	"5"	"Q91YE6"	"Q91YE6 [901-907]"	"Q91YE6 1xBiotin [K903]"	"Importin-9 [OS=Mus musculus]"	"1"	"1027.49894"	"0.85"	"0.62"	"0.47"	"0.52"	"0.67"	"-0.18"	"0.05"	"68.5"	"123.4"	"105.7"	"94.7"	"98.5"	"109.2"	"8262.6591796875"	"14875.427734375"	"12736.744140625"	"11411.2392578125"	"11873.8486328125"	"13164.6162109375"	""	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"514.25315"	"0.000415"	"0.01275"	"1.49"	"19.14"
"26531"	"[K].VFGNEIKLEKPK.[G]"	"1xBiotin [K7]"	"0.0889429"	"0.00334029"	"1"	"1"	"2"	"P09405"	"P09405 [373-384]"	"P09405 1xBiotin [K379]"	"Nucleolin [OS=Mus musculus]"	"1"	"1627.88762"	"-0.08"	"0.16"	"-0.45"	"-1.48"	"0.15"	"0.22"	"-0.02"	"113.9"	"108.1"	"127.5"	"83.3"	"41.0"	"126.1"	"24578.546875"	"23321.5625"	"27509.689453125"	"17980.123046875"	"8839.1533203125"	"27205.931640625"	""	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"3"	"543.29992"	"0.000655"	"0.01613"	"2.21"	"37.23"
"12204"	"[K].KTEMGR.[F]"	"1xBiotin [K1]"	"0.106881"	"0.00731053"	"1"	"1"	"2"	"Q8CFE6"	"Q8CFE6 [3-8]"	"Q8CFE6 1xBiotin [K3]"	"sodium-coupled neutral amino acid transporter 2 [OS=Mus musculus]"	"1"	"947.44373"	"1.06"	"0.99"	"0.66"	"2.15"	"1.03"	"-0.04"	"0.03"	"45.6"	"95.4"	"90.9"	"72.1"	"203.0"	"93.0"	"13130.302734375"	"27460.154296875"	"26169.216796875"	"20763.263671875"	"58450.26171875"	"26767.462890625"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"2"	"474.22547"	"0.001426"	"0.02126"	"1.61"	"22.12"
"18517"	"[R].MPSKSMPPLDQPSCK.[A]"	"1xBiotin [K4]; 1xCarbamidomethyl [C14]; 2xOxidation [M1; M6]"	"0.114565"	"0.00731053"	"1"	"1"	"1"	"Q62419"	"Q62419 [298-312]"	"Q62419 1xBiotin [K301]"	"Endophilin-A2 [OS=Mus musculus]"	"1"	"1960.86354"	"-9.97"	"-0.38"	"0.73"	"-9.97"	"-9.97"	""	"-9.97"	"175.4"	""	"134.5"	"290.1"	""	""	"5796.21142578125"	""	"4444.861328125"	"9584.671875"	""	""	""	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"High"	"3"	"654.29204"	"0.001478"	"0.02365"	"2.42"	"30.51"
"12187"	"[K].KTAMAAAK.[A]"	"1xBiotin [K1]"	"0.031726"	"0.00104877"	"1"	"1"	"1"	"Q8BP67"	"Q8BP67 [124-131]"	"Q8BP67 1xBiotin [K124]"	"60S ribosomal protein L24 [OS=Mus musculus]"	"1"	"1017.52198"	"-9.97"	"-9.97"	"-9.97"	"1.39"	"-9.97"	""	""	"165.4"	""	""	""	"434.6"	""	"2082.80883789063"	""	""	""	"5471.13525390625"	""	""	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"2"	"509.26393"	"0.0001873"	"0.003449"	"2.27"	"23.34"
"12166"	"[K].KSTNDIDDRE.[-]"	"1xBiotin [K1]"	"0.0111184"	"0.000586377"	"1"	"2"	"5"	"Q9DAS1"	"Q9DAS1 [143-152]"	"Q9DAS1 1xBiotin [K143]"	"Chemokine-like factor [OS=Mus musculus]"	"2"	"1418.62163"	"0.32"	"0.40"	"0.23"	"-0.06"	"0.38"	"0.06"	"-0.03"	"85.7"	"107.0"	"113.4"	"100.6"	"82.0"	"111.2"	"9647.6953125"	"12043.5791015625"	"12764.3369140625"	"11318.8603515625"	"9232.7646484375"	"12511.779296875"	""	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"709.81529"	"0.0001108"	"0.0007339"	"2.34"	"26.20"
"23096"	"[R].SAGIKVIMVTGDHPITAK.[A]"	"1xBiotin [K5]; 1xOxidation [M8]"	"0.0226234"	"0.00104877"	"1"	"5"	"1"	"Q8VDN2"	"Q8VDN2 [608-625]"	"Q8VDN2 1xBiotin [K612]"	"Sodium/potassium-transporting ATPase subunit alpha-1 [OS=Mus musculus]"	"1"	"2080.09294"	"-0.58"	"-0.01"	"-9.97"	"-9.97"	"-0.30"	"0.28"	"-0.29"	"172.9"	"115.6"	"171.4"	""	""	"140.1"	"17707.060546875"	"11844.9873046875"	"17561.1015625"	""	""	"14346.4248046875"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"3"	"694.03582"	"0.0001873"	"0.002094"	"2.76"	"40.70"
"12135"	"[K].KSQIFSTASDNQPTVTIK.[V]"	"1xBiotin [K1]"	"0.0243779"	"0.00104877"	"1"	"1"	"1"	"P20029"	"P20029 [448-465]"	"P20029 1xBiotin [K448]"	"78 kDa glucose-regulated protein [OS=Mus musculus]"	"1"	"2191.10634"	"-0.35"	"-9.97"	"1.81"	"-0.87"	"0.58"	"0.93"	"9.97"	"82.0"	"64.1"	""	"286.5"	"45.0"	"122.5"	"9218.125"	"7207.77001953125"	""	"32214.98828125"	"5058.01611328125"	"13774.5595703125"	""	"Peak Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"3"	"731.03997"	"0.0001873"	"0.00232"	"3.12"	"41.87"
"23090"	"[K].SAGAGVKGIEK.[E]"	"1xBiotin [K7]"	"0.0226234"	"0.00104877"	"1"	"2"	"5"	"Q6Y685-2"	"Q6Y685-2 [110-120]"	"Q6Y685-2 1xBiotin [K116]"	"Isoform 2 of Transforming acidic coiled-coil-containing protein 1 [OS=Mus musculus]"	"1"	"1242.65108"	"0.57"	"0.50"	"0.30"	"-0.10"	"0.46"	"-0.12"	"-0.05"	"80.6"	"119.8"	"114.4"	"99.5"	"75.1"	"110.6"	"9993.61328125"	"14848.6162109375"	"14173.7900390625"	"12332.49609375"	"9312.7919921875"	"13704.9619140625"	""	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"621.82929"	"0.0001873"	"0.002091"	"2.69"	"30.23"
"15616"	"[K].IQLANEEYKR.[I]"	"1xBiotin [K9]"	"0.0136165"	"0.000586377"	"1"	"1"	"3"	"Q5SYH2"	"Q5SYH2 [108-117]"	"Q5SYH2 1xBiotin [K116]"	"Transmembrane protein 199 [OS=Mus musculus]"	"1"	"1489.74677"	"0.21"	"-0.07"	"-0.08"	"-0.01"	"-9.97"	"-9.97"	"-9.97"	"118.8"	"137.5"	"113.4"	"112.3"	"118.1"	""	"14425.97265625"	"16697.66015625"	"13769.9345703125"	"13635.9375"	"14350.7958984375"	""	""	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"2"	"745.37692"	"0.0001108"	"0.0009862"	"2.31"	"35.67"
"12249"	"[R].KTPSQATSSQAK.[E]"	"1xBiotin [K1]"	"0.00504656"	"0.000586377"	"1"	"1"	"2"	"Q8CHK3"	"Q8CHK3 [456-467]"	"Q8CHK3 1xBiotin [K456]"	"Lysophospholipid acyltransferase 7 [OS=Mus musculus]"	"1"	"1459.72095"	"0.82"	"0.96"	"0.66"	"0.92"	"0.71"	"-0.11"	"-0.25"	"61.2"	"107.8"	"118.8"	"96.5"	"115.7"	"100.1"	"6042.18408203125"	"10641.7841796875"	"11726.01171875"	"9528.9814453125"	"11425.5576171875"	"9879.779296875"	""	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"2"	"730.36435"	"0.0001108"	"0.0002317"	"2.01"	"19.59"
"23047"	"[R].SAAAFKPVGSTSVK.[S]"	"1xBiotin [K6]"	"0.0274984"	"0.00104877"	"1"	"1"	"3"	"Q8CI51"	"Q8CI51 [345-358]"	"Q8CI51 1xBiotin [K350]"	"PDZ and LIM domain protein 5 [OS=Mus musculus]"	"0"	"1575.81994"	"-0.87"	"0.34"	"-9.97"	"0.02"	"-0.05"	"0.82"	"-0.40"	"125.1"	"68.2"	"158.8"	""	"127.2"	"120.7"	"15143.865234375"	"8257.5859375"	"19222.08203125"	""	"15402.306640625"	"14604.904296875"	""	"Peak Found"	"High"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"2"	"788.41427"	"0.0001873"	"0.002785"	"1.83"	"36.66"
"22945"	"[R].RTPKKPLTR.[A]"	"1xBiotin [K4]"	"0.0679359"	"0.0019826"	"1"	"3"	"2"	"Q61029"	"Q61029 [319-327]"	"Q61029 1xBiotin [K322]"	"Lamina-associated polypeptide 2, isoforms beta/delta/epsilon/gamma [OS=Mus musculus]"	"2"	"1322.77254"	"2.20"	"1.29"	"1.69"	"2.10"	"1.58"	"-0.62"	"0.30"	"32.4"	"149.0"	"78.9"	"104.2"	"138.5"	"97.0"	"2957.83251953125"	"13622.2646484375"	"7215.43701171875"	"9525.5869140625"	"12664.013671875"	"8867.4755859375"	""	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"3"	"441.59572"	"0.0003442"	"0.0107"	"1.57"	"19.38"
"12006"	"[K].KRPPGYYSYLK.[D]"	""	"0.125358"	"0.00909051"	"1"	"2"	"1"	"P52479"	"P52479 [152-162]"	""	"Ubiquitin carboxyl-terminal hydrolase 10 [OS=Mus musculus]"	"1"	"1371.74195"	"-1.13"	"-0.53"	"-0.41"	"-0.92"	"-1.02"	"0.11"	"-0.49"	"153.0"	"70.0"	"105.7"	"115.1"	"80.9"	"75.3"	"12675.19140625"	"5797.69873046875"	"8761.259765625"	"9537.2890625"	"6698.59814453125"	"6240.38037109375"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"3"	"457.91878"	"0.001855"	"0.02722"	"2.55"	"25.51"
"18790"	"[R].MSMDLKNNLLGSLR.[M]"	"1xBiotin [K6]; 2xOxidation [M1; M3]"	"0.0698448"	"0.0019826"	"1"	"3"	"1"	"Q80Y98"	"Q80Y98 [571-584]"	"Q80Y98 1xBiotin [K576]"	"Phospholipase DDHD2 [OS=Mus musculus]"	"1"	"1849.89689"	"0.75"	"0.59"	"0.08"	"-1.27"	"0.45"	"-0.30"	"-0.14"	"85.3"	"143.8"	"128.7"	"90.2"	"35.5"	"116.4"	"28344.5078125"	"47775.03515625"	"42733.72265625"	"29967.1328125"	"11778.177734375"	"38674.5703125"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"2"	"925.45260"	"0.0003442"	"0.01117"	"1.65"	"51.74"
"22688"	"[K].RPPSAFFLFCSEYRPK.[I]"	"1xCarbamidomethyl [C10]"	"0.000404762"	"0.000586377"	"1"	"1"	"2"	"P63158"	"P63158 [97-112]"	""	"High mobility group protein B1 [OS=Mus musculus]"	"0"	"2002.00036"	"0.77"	"-0.02"	"-9.97"	"-4.25"	"0.15"	"-0.62"	"0.17"	"123.8"	"210.6"	"121.9"	""	"6.5"	"137.2"	"35209.62109375"	"59888.25390625"	"34650.828125"	""	"1846.18579101563"	"39024.91796875"	""	"Peak Found"	"High"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"3"	"668.00485"	"0.0001108"	"5.783E-06"	"5.36"	"45.36"
"22667"	"[K].RPLWFICSGMGTQWR.[G]"	"1xCarbamidomethyl [C7]; 1xOxidation [M10]"	"0.000189661"	"0.000586377"	"1"	"1"	"3"	"P19096"	"P19096 [490-504]"	""	"Fatty acid synthase [OS=Mus musculus]"	"0"	"1910.91525"	"0.16"	"0.86"	"-9.97"	"-9.97"	"0.20"	"0.04"	"-0.65"	"118.1"	"131.9"	"214.0"	""	""	"136.0"	"25422.763671875"	"28391.271484375"	"46053.2109375"	""	""	"29261.64453125"	""	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"637.64315"	"0.0001108"	"1.917E-06"	"4.67"	"47.02"
"26690"	"[K].VKAEPAK.[I]"	"1xBiotin [K2]"	"0.0292859"	"0.00104877"	"1"	"1"	"3"	"P09411"	"P09411 [140-146]"	"P09411 1xBiotin [K141]"	"phosphoglycerate kinase 1 [OS=Mus musculus]"	"1"	"968.52336"	"0.76"	"0.51"	"0.95"	"0.65"	"0.67"	"-0.09"	"0.16"	"65.1"	"110.7"	"92.5"	"125.9"	"102.0"	"103.7"	"7605.69775390625"	"12924.69921875"	"10801.958984375"	"14698.2646484375"	"11911.896484375"	"12108.00390625"	""	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"2"	"484.76530"	"0.0001873"	"0.003067"	"2.20"	"20.17"
"11838"	"[R].KPTAPAK.[L]"	"1xBiotin [K1]"	"0.0472151"	"0.00154748"	"1"	"1"	"3"	"Q07113"	"Q07113 [2462-2468]"	"Q07113 1xBiotin [K2462]"	"Cation-independent mannose-6-phosphate receptor [OS=Mus musculus]"	"0"	"938.51280"	"0.85"	"0.48"	"0.11"	"0.41"	"0.59"	"-0.26"	"0.11"	"74.1"	"133.1"	"103.1"	"80.0"	"98.5"	"111.2"	"8406.5341796875"	"15111.169921875"	"11704.869140625"	"9083.9404296875"	"11180.23046875"	"12623.466796875"	""	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"2"	"469.75993"	"0.0002716"	"0.006188"	"1.97"	"21.16"
"11803"	"[K].KPPAAPQQPQPPAPHPPQHPQNQAHR.[G]"	"1xBiotin [K1]"	"0.00604355"	"0.000586377"	"1"	"1"	"6"	"Q8BMK4"	"Q8BMK4 [35-60]"	"Q8BMK4 1xBiotin [K35]"	"Cytoskeleton-associated protein 4 [OS=Mus musculus]"	"0"	"3077.53873"	"1.26"	"0.00"	"-1.68"	"0.13"	"0.70"	"-0.56"	"0.70"	"80.7"	"193.4"	"80.8"	"25.2"	"88.5"	"131.3"	"11223.2202148438"	"26895.0817871094"	"11239.8803710938"	"3509.24877929688"	"12300.9365234375"	"18260.888671875"	""	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"5"	"616.31303"	"0.0001108"	"0.0003012"	"2.99"	"24.82"
"26709"	"[K].VKDVIR.[I]"	"1xBiotin [K2]"	"0.117027"	"0.00731053"	"1"	"2"	"4"	"Q3U2C5-1"	"Q3U2C5-1 [274-279]"	"Q3U2C5-1 1xBiotin [K275]"	"E3 ubiquitin-protein ligase RNF149 [OS=Mus musculus]"	"1"	"955.53935"	"0.38"	"0.39"	"0.15"	"0.04"	"0.35"	"-0.04"	"-0.04"	"85.5"	"111.4"	"111.8"	"94.9"	"87.7"	"108.7"	"27256.318359375"	"35518.69140625"	"35666.21875"	"30272.84375"	"27963.1796875"	"34658"	""	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"2"	"478.27315"	"0.001478"	"0.02443"	"2.03"	"31.37"
"22648"	"[K].RPKHFLELK.[S]"	"1xBiotin [K3]"	"0.0879791"	"0.00334029"	"1"	"1"	"4"	"Q8R092"	"Q8R092 [232-240]"	"Q8R092 1xBiotin [K234]"	"Uncharacterized protein C1orf43 homolog [OS=Mus musculus]"	"1"	"1393.77729"	"0.88"	"0.69"	"0.73"	"0.11"	"0.51"	"-0.37"	"-0.18"	"69.7"	"128.2"	"112.4"	"115.2"	"75.4"	"99.1"	"12107.75"	"22269.48828125"	"19519.80078125"	"20018.66796875"	"13106.982421875"	"17212.703125"	""	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"3"	"465.26367"	"0.0005759"	"0.01586"	"2.57"	"34.82"
"11686"	"[R].KPAVTKGR.[S]"	"1xBiotin [K6]"	"0.0130005"	"0.000586377"	"1"	"1"	"5"	"Q91V04"	"Q91V04 [337-344]"	"Q91V04 1xBiotin [K342]"	"Translocating chain-associated membrane protein 1 [OS=Mus musculus]"	"1"	"1082.61391"	"1.74"	"0.99"	"1.52"	"1.39"	"1.50"	"-0.24"	"0.50"	"41.0"	"136.8"	"81.6"	"117.5"	"107.6"	"115.6"	"6571.611328125"	"21928.73828125"	"13084.4814453125"	"18836.69140625"	"17246.912109375"	"18537.888671875"	""	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"2"	"541.81070"	"0.0001108"	"0.0009236"	"2.49"	"19.02"
"22633"	"[K].RPGGQHGGDWSWR.[V]"	""	"0.0690753"	"0.0019826"	"1"	"1"	"1"	"Q80UM7"	"Q80UM7 [174-186]"	""	"Mannosyl-oligosaccharide glucosidase [OS=Mus musculus]"	"0"	"1495.69377"	"-9.97"	"0.38"	"1.50"	"1.69"	"0.86"	"9.97"	"0.48"	"58.9"	""	"76.7"	"166.6"	"190.7"	"107.1"	"2349.5791015625"	""	"3056.84716796875"	"6642.25634765625"	"7602.24462890625"	"4267.75"	""	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"3"	"499.23570"	"0.0003442"	"0.01097"	"1.70"	"24.96"
"12025"	"[K].KSADTLWGIQK.[E]"	"1xBiotin [K1]"	"0.000278692"	"0.000586377"	"1"	"1"	"4"	"P06151"	"P06151 [318-328]"	"P06151 1xBiotin [K318]"	"L-lactate dehydrogenase A chain [OS=Mus musculus]"	"1"	"1472.75661"	"0.28"	"0.21"	"-0.03"	"-0.42"	"-0.12"	"-0.40"	"-0.34"	"99.7"	"121.1"	"115.7"	"97.6"	"74.3"	"91.7"	"19441.0859375"	"23617.673828125"	"22558.54296875"	"19035.06640625"	"14488.890625"	"17874.52734375"	""	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"2"	"736.88182"	"0.0001108"	"3.369E-06"	"2.66"	"43.45"
"18169"	"[K].MITGLSKDQQIGEK.[I]"	"1xBiotin [K7]"	"0.00590462"	"0.000586377"	"1"	"1"	"1"	"P97310"	"P97310 [463-476]"	"P97310 1xBiotin [K469]"	"DNA replication licensing factor mcm2 [OS=Mus musculus]"	"1"	"1773.88737"	"-9.97"	"0.00"	"-9.97"	"0.64"	"-9.97"	""	"-9.97"	"168.5"	""	"168.5"	""	"263.0"	""	"12618.5859375"	""	"12615.31640625"	""	"19688.40625"	""	""	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Not Found"	"High"	"2"	"887.44858"	"0.0001108"	"0.0002904"	"2.65"	"39.36"
"9783"	"[R].HGRYLTVAAVFRGR.[M]"	""	"0.000619522"	"0.000586377"	"1"	"3"	"1"	"P99024"	"P99024 [307-320]"	""	"tubulin beta-5 chain [OS=Mus musculus]"	"2"	"1602.89755"	"0.86"	"1.24"	"-9.97"	"-1.70"	"-0.10"	"-0.96"	"-1.34"	"93.6"	"169.6"	"220.9"	""	"28.9"	"87.0"	"18554.5234375"	"33640.4375"	"43815.7734375"	""	"5723.18408203125"	"17262.203125"	""	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"4"	"401.47955"	"0.0001108"	"1.079E-05"	"2.89"	"32.25"
"12299"	"[R].KVACIGAWHPAR.[V]"	"1xBiotin [K1]; 1xCarbamidomethyl [C4]"	"0.000511085"	"0.000586377"	"1"	"1"	"1"	"P27659"	"P27659 [250-261]"	"P27659 1xBiotin [K250]"	"60S ribosomal protein L3 [OS=Mus musculus]"	"1"	"1591.79843"	"0.42"	"0.16"	"-9.97"	"-0.06"	"0.20"	"-0.22"	"0.04"	"107.9"	"144.0"	"120.6"	""	"103.5"	"123.9"	"3418.25244140625"	"4563.17236328125"	"3822.26245117188"	""	"3279.90966796875"	"3926.61743164063"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"High"	"3"	"531.27068"	"0.0001108"	"8.139E-06"	"2.38"	"36.23"
"16817"	"[R].MADSLASKVTR.[L]"	"1xBiotin [K8]; 1xOxidation [M1]"	"0.00459798"	"0.000586377"	"1"	"1"	"2"	"O35153"	"O35153 [24-34]"	"O35153 1xBiotin [K31]"	"BET1-like protein [OS=Mus musculus]"	"1"	"1420.69230"	"0.31"	"-0.16"	"0.30"	"0.07"	"0.13"	"-0.18"	"0.29"	"92.3"	"114.1"	"82.7"	"113.4"	"96.6"	"101.0"	"23882997.265625"	"29533192.484375"	"21396016.671875"	"29357005.09375"	"24995745.0625"	"26137750.40625"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"2"	"710.84953"	"0.0001108"	"0.0002012"	"2.40"	"36.92"
"13023"	"[K].LDWDPVDSGGVKNLGVSAQGR.[L]"	"1xBiotin [K12]"	"0.000471022"	"0.000586377"	"1"	"1"	"3"	"Q9Z1R4"	"Q9Z1R4 [114-134]"	"Q9Z1R4 1xBiotin [K125]"	"Uncharacterized protein C6orf47 homolog [OS=Mus musculus]"	"1"	"2396.16632"	"-9.97"	"0.60"	"-9.97"	"-9.97"	"0.43"	"9.97"	"-0.17"	"155.1"	""	"235.7"	""	""	"209.2"	"13576.1181640625"	""	"20633.775390625"	""	""	"18307.359375"	""	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"3"	"799.39402"	"0.0001108"	"7.206E-06"	"2.99"	"50.83"
"25879"	"[K].TSATDLQTKADR.[L]"	"1xBiotin [K9]"	"0.000619522"	"0.000586377"	"1"	"1"	"3"	"Q9Z0S1"	"Q9Z0S1 [41-52]"	"Q9Z0S1 1xBiotin [K49]"	"3'(2'),5'-bisphosphate nucleotidase 1 [OS=Mus musculus]"	"1"	"1532.73733"	"1.38"	"-9.97"	"-9.97"	"0.53"	"0.87"	"-0.51"	"9.97"	"87.1"	"227.3"	""	""	"126.2"	"159.4"	"5759.400390625"	"15026.056640625"	""	""	"8341.32421875"	"10534.7158203125"	""	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"2"	"766.87202"	"0.0001108"	"1.078E-05"	"2.47"	"31.86"
"12840"	"[K].LCFLDKVEPQATISEIK.[T]"	"1xBiotin [K6]; 1xCarbamidomethyl [C2]"	"6.3309E-06"	"0.000586377"	"1"	"1"	"4"	"Q9CY27"	"Q9CY27 [17-33]"	"Q9CY27 1xBiotin [K22]"	"Very-long-chain enoyl-CoA reductase [OS=Mus musculus]"	"1"	"2217.12939"	"0.11"	"0.40"	"-9.97"	"-9.97"	"0.77"	"0.66"	"0.37"	"117.4"	"126.8"	"155.1"	""	""	"200.6"	"17309.521484375"	"18697.17578125"	"22874.7265625"	""	""	"29584.419921875"	""	"Peak Found"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"2"	"1109.06811"	"0.0001108"	"1.336E-08"	"3.99"	"55.75"
"23550"	"[R].SGMFWLR.[F]"	""	"0.0797284"	"0.00241047"	"1"	"1"	"2"	"Q9CZ13"	"Q9CZ13 [473-479]"	""	"Cytochrome b-c1 complex subunit 1, mitochondrial [OS=Mus musculus]"	"0"	"896.44472"	"0.67"	"0.26"	"0.06"	"1.57"	"0.25"	"-0.42"	"-0.01"	"66.8"	"106.0"	"80.0"	"69.5"	"198.3"	"79.4"	"14608.275390625"	"23169.96484375"	"17483.158203125"	"15189.6357421875"	"43358.625"	"17369.666015625"	""	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"2"	"448.72596"	"0.000415"	"0.01362"	"1.49"	"46.52"
"23549"	"[R].SGMFSHALDMKSGPLPPGGWDDSRR.[D]"	"1xBiotin [K11]; 2xOxidation [M3; M10]"	"0.0734084"	"0.00241047"	"1"	"1"	"1"	"Q99J27"	"Q99J27 [16-40]"	"Q99J27 1xBiotin [K26]"	"Acetyl-coenzyme A transporter 1 [OS=Mus musculus]"	"2"	"2959.32839"	"0.34"	"0.52"	"-9.97"	"-9.97"	"0.49"	"0.15"	"-0.03"	"117.4"	"148.8"	"168.8"	""	""	"165.0"	"11129.02734375"	"14097.3486328125"	"16000.8515625"	""	""	"15631.705078125"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"4"	"740.58735"	"0.000415"	"0.01207"	"2.45"	"41.27"
"25945"	"[K].TSPKTSNPFLVAIHDSEADYVTTDNLSK.[V]"	"1xBiotin [K4]"	"0.00286924"	"0.000586377"	"1"	"2"	"2"	"Q99P72-2"	"Q99P72-2 [488-515]"	"Q99P72-2 1xBiotin [K491]"	"Reticulon-4 [OS=Mus musculus]"	"1"	"3276.57290"	"0.37"	"1.31"	"-9.97"	"-9.97"	"-9.97"	"-9.97"	"-9.97"	"125.7"	"162.9"	"311.4"	""	""	""	"5989.93505859375"	"7767.49658203125"	"14844.6748046875"	""	""	""	""	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"1092.86172"	"0.0001108"	"0.0001014"	"3.09"	"55.85"
"12720"	"[K].IAPMFGKK.[A]"	"1xBiotin [K7]"	"0.0407563"	"0.00104877"	"1"	"1"	"1"	"Q8R3R5"	"Q8R3R5 [318-325]"	"Q8R3R5 1xBiotin [K324]"	"transmembrane protein 185B [OS=Mus musculus]"	"1"	"1117.58967"	"0.64"	"0.00"	"-0.04"	"1.25"	"0.78"	"0.14"	"0.78"	"69.6"	"108.4"	"69.6"	"67.6"	"165.3"	"119.5"	"11860.9609375"	"18463.361328125"	"11855.8544921875"	"11513.4033203125"	"28158.962890625"	"20367.001953125"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"2"	"559.29824"	"0.0001873"	"0.005002"	"1.81"	"39.92"
"25948"	"[R].TSPQQKLIIVEGCQR.[QL]"	"1xBiotin [K6]; 1xCarbamidomethyl [C13]"	"0.0175585"	"0.000586377"	"1"	"5"	"5"	"Q8VDN2"	"Q8VDN2 [693-707]"	"Q8VDN2 1xBiotin [K698]"	"Sodium/potassium-transporting ATPase subunit alpha-1 [OS=Mus musculus]"	"1"	"1983.01503"	"0.31"	"0.06"	"-0.24"	"-1.52"	"-0.12"	"-0.43"	"-0.18"	"111.3"	"137.5"	"115.8"	"94.3"	"38.9"	"102.3"	"19763.4165039063"	"24417.5522460938"	"20572.0927734375"	"16748.6164550781"	"6907.11328125"	"18166.6791992188"	""	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"3"	"661.67656"	"0.0001108"	"0.001441"	"2.97"	"46.26"
"17296"	"[K].MDSTEPPYSQKR.[Y]"	"1xBiotin [K11]; 1xOxidation [M1]"	"0.017059"	"0.000586377"	"1"	"1"	"3"	"P10126"	"P10126 [155-166]"	"P10126 1xBiotin [K165]"	"Elongation factor 1-alpha 1 [OS=Mus musculus]"	"1"	"1680.73562"	"0.08"	"-0.24"	"0.14"	"-0.41"	"-0.09"	"-0.17"	"0.15"	"105.4"	"111.2"	"89.1"	"116.0"	"79.5"	"98.8"	"9115.7568359375"	"9614.2265625"	"7706.984375"	"10024.7060546875"	"6872.26318359375"	"8538.6171875"	""	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"2"	"840.87357"	"0.0001108"	"0.001375"	"1.95"	"29.28"
"26013"	"[R].TTINKNAR.[A]"	"1xBiotin [K5]"	"0.0441201"	"0.00104877"	"1"	"1"	"2"	"P41105"	"P41105 [80-87]"	"P41105 1xBiotin [K84]"	"60S ribosomal protein L28 [OS=Mus musculus]"	"1"	"1143.59390"	"0.23"	"-9.97"	"0.07"	"0.02"	"-0.10"	"-0.32"	"9.97"	"116.1"	"135.9"	""	"122.0"	"117.4"	"108.7"	"8705.12109375"	"10191.341796875"	""	"9146.904296875"	"8809.0556640625"	"8149.59423828125"	""	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"2"	"572.30076"	"0.0001873"	"0.005595"	"1.48"	"25.36"
"12562"	"[R].LADKNK.[I]"	"1xBiotin [K]"	"0.112149"	"0.00731053"	"1"	"2"	"4"	"P70336-1"	"P70336-1 [715-720]"	"P70336-1 1xBiotin [K]"	"Rho-associated protein kinase 2 [OS=Mus musculus]"	"1"	"914.47641"	"0.59"	"0.37"	"0.73"	"0.53"	"0.52"	"-0.07"	"0.15"	"72.0"	"108.1"	"93.0"	"119.7"	"104.1"	"103.0"	"11714.3564453125"	"17583.736328125"	"15126.4189453125"	"19455.138671875"	"16921.654296875"	"16751.771484375"	""	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"2"	"457.74178"	"0.001478"	"0.0229"	"1.31"	"20.21"
"23523"	"[R].SGGYSSGKQGR.[G]"	"1xBiotin [K8]"	"0.0991293"	"0.00472246"	"1"	"1"	"2"	"Q922R8"	"Q922R8 [143-153]"	"Q922R8 1xBiotin [K150]"	"Protein disulfide-isomerase A6 [OS=Mus musculus]"	"1"	"1309.59536"	"0.32"	"0.87"	"0.62"	"-9.97"	"-9.97"	"-9.97"	"-9.97"	"107.0"	"133.4"	"195.0"	"164.7"	""	""	"3313.30786132813"	"4130.08447265625"	"6037.19677734375"	"5099.07373046875"	""	""	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"High"	"High"	"2"	"655.30195"	"0.0009666"	"0.01903"	"1.35"	"21.50"
"12478"	"[R].KYEYQQPQSQADSVQLSLE.[-]"	"1xBiotin [K1]"	"0.110368"	"0.00731053"	"1"	"1"	"3"	"Q80ZU4"	"Q80ZU4 [89-107]"	"Q80ZU4 1xBiotin [K89]"	"small integral membrane protein 19 [OS=Mus musculus]"	"1"	"2467.14458"	"-9.97"	"-9.97"	"-0.31"	"-1.80"	"0.20"	"9.97"	"9.97"	"185.0"	""	""	"149.0"	"53.1"	"212.9"	"17796.302734375"	""	""	"14327.10546875"	"5106.54052734375"	"20480.26171875"	""	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"3"	"823.05259"	"0.001478"	"0.02247"	"2.69"	"46.18"
"26126"	"[K].TVTAMDVVYALKR.[Q]"	"1xBiotin [K12]"	"0.00066442"	"0.000586377"	"1"	"1"	"5"	"P62806"	"P62806 [81-93]"	"P62806 1xBiotin [K92]"	"histone H4 [OS=Mus musculus]"	"1"	"1692.88116"	"0.23"	"-0.15"	"-9.97"	"-9.97"	"0.58"	"0.35"	"0.73"	"131.1"	"153.9"	"118.6"	""	""	"196.4"	"8357.8212890625"	"9813.74609375"	"7558.55615234375"	""	""	"12523.513671875"	""	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"2"	"846.94448"	"0.0001108"	"1.192E-05"	"2.97"	"58.80"
"12441"	"[K].KVYASQR.[M]"	"1xBiotin [K1]"	"0.0964872"	"0.00379267"	"1"	"1"	"4"	"Q9D8E6"	"Q9D8E6 [182-188]"	"Q9D8E6 1xBiotin [K182]"	"60S ribosomal protein L4 [OS=Mus musculus]"	"1"	"1077.55098"	"0.58"	"0.43"	"0.38"	"0.23"	"0.85"	"0.26"	"0.42"	"73.8"	"110.7"	"99.4"	"96.2"	"86.8"	"133.0"	"8035.47705078125"	"12046.3271484375"	"10813.37109375"	"10472.0849609375"	"9444.7978515625"	"14474.841796875"	""	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"2"	"539.27930"	"0.0008081"	"0.01824"	"1.54"	"23.22"
"17825"	"[-].MHPPEATTKMSSVR.[F]"	"1xAcetyl [N-Term]; 1xBiotin [K9]; 1xOxidation [M10]"	"0.0414556"	"0.00104877"	"1"	"1"	"2"	"Q924N4"	"Q924N4 [1-14]"	"Q924N4 1xAcetyl [N-Term]; 1xBiotin [K9]"	"Solute carrier family 12 member 6 [OS=Mus musculus]"	"1"	"1855.84994"	"0.70"	"1.67"	"1.47"	"2.13"	"1.50"	"0.79"	"-0.17"	"38.0"	"61.9"	"120.8"	"105.2"	"166.8"	"107.3"	"7115.99462890625"	"11584.1279296875"	"22595.8671875"	"19678.828125"	"31200.9609375"	"20083.6669921875"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"3"	"619.28836"	"0.0001873"	"0.0051"	"2.75"	"34.24"
"12440"	"[K].KVVVSQTK.[K]"	"1xBiotin [K1]"	"0.00766951"	"0.000586377"	"1"	"1"	"4"	"P09405"	"P09405 [63-70]"	"P09405 1xBiotin [K63]"	"Nucleolin [OS=Mus musculus]"	"1"	"1114.62889"	"0.45"	"0.10"	"0.07"	"-0.14"	"0.51"	"0.06"	"0.41"	"88.1"	"120.1"	"94.3"	"92.3"	"79.8"	"125.4"	"21669.15625"	"29561.20703125"	"23208.0390625"	"22709.853515625"	"19648.865234375"	"30855.375"	""	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"2"	"557.81799"	"0.0001108"	"0.0004241"	"2.29"	"25.21"
"12436"	"[K].KVVSFWR.[N]"	"1xBiotin [K1]"	"0.0459009"	"0.00154748"	"1"	"1"	"3"	"Q9D379"	"Q9D379 [92-98]"	"Q9D379 1xBiotin [K92]"	"epoxide hydrolase 1 [OS=Mus musculus]"	"1"	"1147.60810"	"0.59"	"0.25"	"0.07"	"0.49"	"0.54"	"-0.05"	"0.28"	"78.9"	"118.8"	"94.0"	"82.8"	"111.1"	"114.4"	"11009.99609375"	"16569.05078125"	"13113.2177734375"	"11543.4462890625"	"15502.6708984375"	"15958.1103515625"	""	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"2"	"574.30763"	"0.0002716"	"0.005947"	"1.28"	"46.18"
"23344"	"[R].SDVKAR.[D]"	"1xBiotin [K4]"	"0.0913953"	"0.00334029"	"1"	"1"	"3"	"Q60664"	"Q60664 [420-425]"	"Q60664 1xBiotin [K423]"	"Lymphoid-restricted membrane protein [OS=Mus musculus]"	"1"	"901.45601"	"0.82"	"0.68"	"0.57"	"0.60"	"0.71"	"-0.11"	"0.03"	"66.6"	"117.9"	"106.6"	"99.1"	"100.8"	"109.0"	"13559.53125"	"23985.955078125"	"21698.677734375"	"20165.419921875"	"20505.716796875"	"22177.904296875"	""	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"2"	"451.23151"	"0.0007348"	"0.01686"	"1.70"	"19.65"
"12416"	"[K].KVTAQDVR.[K]"	"1xBiotin [K1]"	"0.0370047"	"0.00104877"	"1"	"1"	"4"	"P26041"	"P26041 [64-71]"	"P26041 1xBiotin [K64]"	"Moesin [OS=Mus musculus]"	"1"	"1142.59865"	"-0.25"	"0.06"	"-0.11"	"-0.35"	"-0.20"	"0.05"	"-0.26"	"109.7"	"92.1"	"114.6"	"101.8"	"86.1"	"95.6"	"7624.98486328125"	"6403.11328125"	"7965.61083984375"	"7077.748046875"	"5987.40771484375"	"6641.21142578125"	""	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"2"	"571.80300"	"0.0001873"	"0.004338"	"1.58"	"25.96"
"23272"	"[K].SDDSKSSSPEPVTHLK.[W]"	"1xBiotin [K5]"	"0.0127767"	"0.000586377"	"1"	"1"	"2"	"Q5FWK3"	"Q5FWK3 [44-59]"	"Q5FWK3 1xBiotin [K48]"	"rho GTPase-activating protein 1 [OS=Mus musculus]"	"1"	"1939.90658"	"0.30"	"0.16"	"0.79"	"0.76"	"0.35"	"0.05"	"0.19"	"74.6"	"91.7"	"83.4"	"129.3"	"126.2"	"94.8"	"6841.48876953125"	"8412.98046875"	"7646.13232421875"	"11863.5537109375"	"11576.328125"	"8698.1982421875"	""	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"3"	"647.30733"	"0.0001108"	"0.000903"	"2.07"	"29.27"
"26281"	"[R].VAPKPPQMGR.[A]"	"1xBiotin [K4]"	"0.0928964"	"0.00379267"	"1"	"1"	"2"	"P70302"	"P70302 [533-542]"	"P70302 1xBiotin [K536]"	"stromal interaction molecule 1 [OS=Mus musculus]"	"0"	"1306.67586"	"1.27"	"0.93"	"0.56"	"1.58"	"1.17"	"-0.10"	"0.24"	"49.9"	"120.1"	"94.8"	"73.8"	"149.1"	"112.3"	"4026.26220703125"	"9691.0234375"	"7654.08837890625"	"5952.7939453125"	"12032.6572265625"	"9067.2041015625"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"2"	"653.84192"	"0.0008081"	"0.0172"	"1.78"	"30.62"
"23159"	"[R].SASKPAFSINHLSGK.[G]"	"1xBiotin [K4]"	"0.000414314"	"0.000586377"	"1"	"5"	"2"	"Q9D666-1"	"Q9D666-1 [97-111]"	"Q9D666-1 1xBiotin [K100]"	"SUN domain-containing protein 1 [OS=Mus musculus]"	"0"	"1769.90031"	"0.74"	"0.35"	"0.54"	"-0.39"	"0.13"	"-0.61"	"-0.21"	"82.7"	"138.2"	"105.2"	"120.0"	"63.1"	"90.7"	"51680.4609375"	"86389.1171875"	"65744.6328125"	"74963.25"	"39454.8828125"	"56708.39453125"	""	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"3"	"590.63838"	"0.0001108"	"6.005E-06"	"3.40"	"39.26"
"17940"	"[K].MKSDISEK.[T]"	"1xOxidation [M1]"	"0.0819452"	"0.00241047"	"1"	"2"	"1"	"Q99P69-1"	"Q99P69-1 [212-219]"	""	"kinetochore protein nuf2 [OS=Mus musculus]"	"1"	"953.46082"	"0.02"	"0.31"	"0.09"	"-0.14"	"0.19"	"0.16"	"-0.12"	"94.3"	"95.9"	"116.5"	"100.5"	"85.6"	"107.3"	"6463.5146484375"	"6574.369140625"	"7988.13671875"	"6888.44775390625"	"5869.1640625"	"7354.00146484375"	""	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"2"	"477.23290"	"0.000415"	"0.01426"	"1.60"	"26.20"
"17967"	"[R].MIAGQVLDINLAAEPK.[V]"	"1xBiotin [K16]; 1xOxidation [M1]"	"0.0762972"	"0.00241047"	"1"	"5"	"18"	"Q9Z204"	"Q9Z204 [74-89]"	"Q9Z204 1xBiotin [K89]"	"Heterogeneous nuclear ribonucleoproteins C1/C2 [OS=Mus musculus]"	"0"	"1924.98708"	"-0.43"	"-0.33"	"-0.11"	"-2.51"	"-0.09"	"0.34"	"0.24"	"131.0"	"97.1"	"104.5"	"121.2"	"23.1"	"123.1"	"2194798.359375"	"1625695.80078125"	"1750713.05273438"	"2029209.16210938"	"386563.622070313"	"2062647.88085938"	""	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"2"	"963.00131"	"0.000415"	"0.01275"	"2.59"	"48.04"
"12323"	"[K].KVEKVTISNR.[L]"	"1xBiotin [K]"	"0.044622"	"0.00104877"	"1"	"1"	"3"	"P11499"	"P11499 [574-583]"	"P11499 1xBiotin [K]"	"Heat shock protein HSP 90-beta [OS=Mus musculus]"	"2"	"1399.77259"	"0.69"	"0.39"	"0.49"	"0.40"	"0.52"	"-0.18"	"0.13"	"74.2"	"120.1"	"96.9"	"104.4"	"98.1"	"106.3"	"7973.35009765625"	"12901.234375"	"10415.4150390625"	"11216.66015625"	"10534.15625"	"11419.46875"	""	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"3"	"467.26226"	"0.0001873"	"0.005691"	"2.41"	"28.69"
"23589"	"[K].SGTTKALQVEPLK.[K]"	"1xBiotin [K5]"	"0.021606"	"0.00104877"	"1"	"1"	"1"	"Q8BHE0"	"Q8BHE0 [215-227]"	"Q8BHE0 1xBiotin [K219]"	"Proline-rich protein 11 [OS=Mus musculus]"	"1"	"1597.86180"	"-0.51"	"-0.16"	"0.16"	"-1.65"	"-0.34"	"0.18"	"-0.17"	"124.5"	"87.2"	"111.0"	"138.9"	"39.7"	"98.7"	"48478.125"	"33974.18359375"	"43244.53515625"	"54112.02734375"	"15448.298828125"	"38429.01953125"	""	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"2"	"799.43534"	"0.0001873"	"0.001947"	"1.76"	"40.58"
"20283"	"[R].NTVKGK.[G]"	"1xBiotin [K4]"	"0.102939"	"0.00612902"	"1"	"1"	"4"	"Q99P91"	"Q99P91 [538-543]"	"Q99P91 1xBiotin [K541]"	"Transmembrane glycoprotein NMB [OS=Mus musculus]"	"1"	"872.46585"	"1.38"	"1.12"	"1.33"	"1.03"	"1.16"	"-0.21"	"0.04"	"47.8"	"123.9"	"103.9"	"120.2"	"97.4"	"106.9"	"21665.07421875"	"56205.75"	"47113.40234375"	"54518.12109375"	"44164.33984375"	"48486.51171875"	""	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"2"	"436.73658"	"0.001201"	"0.02014"	"1.44"	"17.99"
"13"	"[K].AAAKPK.[TK]"	"1xBiotin [K4]"	"0.120171"	"0.00731053"	"1"	"3"	"5"	"P43276"	"P43276 [176-181]"	"P43276 1xBiotin [K179]"	"Histone H1.5 [OS=Mus musculus]"	"0"	"811.44947"	"1.29"	"0.96"	"0.98"	"0.77"	"1.12"	"-0.17"	"0.16"	"53.4"	"130.4"	"104.0"	"104.9"	"91.3"	"116.1"	"10420.53125"	"25463.3671875"	"20297.9375"	"20491.548828125"	"17818.43359375"	"22659.181640625"	""	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"406.22847"	"0.001478"	"0.02543"	"1.69"	"18.59"
"8181"	"[K].GFKMEVGQYIFVK.[C]"	"1xBiotin [K3]; 1xOxidation [M4]"	"0.11579"	"0.00731053"	"1"	"1"	"1"	"Q61093"	"Q61093 [316-328]"	"Q61093 1xBiotin [K318]"	"Cytochrome b-245 heavy chain [OS=Mus musculus]"	"1"	"1787.88591"	"-9.97"	"0.16"	"-9.97"	"-9.97"	"-9.97"	""	"-9.97"	"283.3"	""	"316.7"	""	""	""	"4910.65234375"	""	"5490.53515625"	""	""	""	""	"Peak Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"894.44532"	"0.001478"	"0.0242"	"2.16"	"53.81"
"5442"	"[K].EKSGAVR.[N]"	"1xBiotin [K2]"	"0.026266"	"0.00104877"	"1"	"1"	"2"	"Q9WU60"	"Q9WU60 [1408-1414]"	"Q9WU60 1xBiotin [K1409]"	"Attractin [OS=Mus musculus]"	"1"	"972.49313"	"0.60"	"0.48"	"0.43"	"0.32"	"0.60"	"0.00"	"0.12"	"74.9"	"113.5"	"104.2"	"100.6"	"93.6"	"113.1"	"56650.33984375"	"85840.28125"	"78835.25"	"76080.5546875"	"70808.2421875"	"85577.28125"	""	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"2"	"486.75014"	"0.0001873"	"0.002606"	"1.28"	"20.04"
"7530"	"[K].FTGLSKEELLK.[V]"	"1xBiotin [K6]"	"0.000926333"	"0.000586377"	"1"	"2"	"4"	"P10852"	"P10852 [54-64]"	"P10852 1xBiotin [K59]"	"4F2 cell-surface antigen heavy chain [OS=Mus musculus]"	"1"	"1490.79233"	"-9.97"	"0.24"	"-9.97"	"-1.43"	"-0.12"	"9.97"	"-0.36"	"172.8"	""	"203.9"	""	"64.1"	"159.2"	"14090.8701171875"	""	"16628.041015625"	""	"5223.2734375"	"12985.2314453125"	""	"Peak Found"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"2"	"745.90022"	"0.0001108"	"1.947E-05"	"3.35"	"49.05"
"1396"	"[K].APSCQDTQSSLSCAKPVQNLCK.[D]"	"1xBiotin [K15]; 3xCarbamidomethyl [C4; C13; C21]"	"0.00593905"	"0.000586377"	"1"	"1"	"2"	"Q9D8B1-1"	"Q9D8B1-1 [229-250]"	"Q9D8B1-1 1xBiotin [K243]"	"Androgen-induced gene 1 protein [OS=Mus musculus]"	"0"	"2705.21500"	"-9.97"	"0.58"	"-0.11"	"-0.17"	"0.74"	"9.97"	"0.16"	"100.1"	""	"150.0"	"92.9"	"89.2"	"167.7"	"35525.03125"	""	"53207.2109375"	"32962.7265625"	"31648.19140625"	"59498.71875"	""	"Peak Found"	"Not Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"3"	"902.40988"	"0.0001108"	"0.0002927"	"4.37"	"37.48"
"6888"	"[K].EYDAQKASK.[R]"	"1xBiotin [K6]"	"0.0127767"	"0.000586377"	"1"	"1"	"5"	"Q922Q8"	"Q922Q8 [202-210]"	"Q922Q8 1xBiotin [K207]"	"Leucine-rich repeat-containing protein 59 [OS=Mus musculus]"	"1"	"1265.58306"	"0.34"	"0.54"	"0.65"	"0.75"	"0.30"	"-0.03"	"-0.24"	"73.1"	"92.3"	"106.5"	"115.0"	"122.9"	"90.3"	"8933.904296875"	"11282.54296875"	"13019.78515625"	"14053.9755859375"	"15019.474609375"	"11031.828125"	""	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"633.29540"	"0.0001108"	"0.0008986"	"1.96"	"23.17"
"8638"	"[R].GLKTVFDEAIR.[A]"	"1xBiotin [K3]"	"0.0200481"	"0.000586377"	"1"	"3"	"3"	"P60764"	"P60764 [164-174]"	"P60764 1xBiotin [K166]"	"Ras-related C3 botulinum toxin substrate 3 [OS=Mus musculus]"	"1"	"1474.77226"	"-9.97"	"-0.04"	"-9.97"	"-9.97"	"-9.97"	""	"-9.97"	"304.3"	""	"295.7"	""	""	""	"7013.57470703125"	""	"6816.298828125"	""	""	""	""	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"2"	"737.89013"	"0.0001108"	"0.00175"	"2.02"	"52.06"
"352"	"[K].AEGAPNQGKK.[K]"	"1xBiotin [K9]"	"0.0980647"	"0.00472246"	"1"	"9"	"3"	"Q99PL5-1"	"Q99PL5-1 [773-782]"	"Q99PL5-1 1xBiotin [K781]"	"Ribosome-binding protein 1 [OS=Mus musculus]"	"1"	"1225.59938"	"0.63"	"0.71"	"0.58"	"0.81"	"0.61"	"-0.02"	"-0.10"	"66.9"	"103.9"	"109.8"	"99.9"	"117.2"	"102.4"	"3991.53076171875"	"6192.80908203125"	"6545.044921875"	"5955.06298828125"	"6985.35302734375"	"6102.25341796875"	""	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"2"	"613.30318"	"0.0008885"	"0.01863"	"1.75"	"18.32"
"1414"	"[K].APTKAAPK.[Q]"	"1xBiotin [K4]"	"0.0306569"	"0.00104877"	"1"	"1"	"1"	"Q8BP67"	"Q8BP67 [132-139]"	"Q8BP67 1xBiotin [K135]"	"60S ribosomal protein L24 [OS=Mus musculus]"	"1"	"1009.54991"	"0.53"	"0.20"	"0.20"	"0.35"	"0.52"	"-0.01"	"0.32"	"80.6"	"116.2"	"92.7"	"92.7"	"102.4"	"115.4"	"7672.5234375"	"11060.2470703125"	"8821.033203125"	"8820.025390625"	"9749.9716796875"	"10984.779296875"	""	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"2"	"505.27859"	"0.0001873"	"0.003273"	"2.35"	"22.00"
"7596"	"[R].FWYFVSQLK.[K]"	""	"0.0138549"	"0.000586377"	"1"	"1"	"1"	"P62717"	"P62717 [44-52]"	""	"60S ribosomal protein L18a [OS=Mus musculus]"	"0"	"1217.63536"	"-0.25"	"0.01"	"-1.50"	"-9.97"	"-0.61"	"-0.37"	"-0.63"	"155.6"	"131.0"	"156.7"	"55.1"	""	"101.6"	"44417.1328125"	"37386.92578125"	"44740.78515625"	"15724.103515625"	""	"29003.685546875"	""	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"2"	"609.32131"	"0.0001108"	"0.001018"	"1.97"	"53.09"
"7651"	"[K].FYTLFGR.[S]"	""	"0.065346"	"0.0019826"	"1"	"1"	"5"	"Q8CGC7"	"Q8CGC7 [1504-1510]"	""	"Bifunctional glutamate/proline--tRNA ligase [OS=Mus musculus]"	"0"	"903.47231"	"0.48"	"-0.07"	"0.13"	"-0.23"	"0.32"	"-0.16"	"0.38"	"91.7"	"127.8"	"87.7"	"100.2"	"78.2"	"114.4"	"39940.4296875"	"55632.953125"	"38168.92578125"	"43606.3125"	"34054.06640625"	"49803.26953125"	""	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"452.23951"	"0.0003442"	"0.01007"	"1.58"	"44.26"
"2696"	"[K].CTKEEHLCTQR.[M]"	"1xBiotin [K3]; 2xCarbamidomethyl [C1; C8]"	"0.0702326"	"0.00241047"	"1"	"1"	"1"	"P21107-2"	"P21107-2 [226-236]"	"P21107-2 1xBiotin [K228]"	"Isoform 2 of Tropomyosin alpha-3 chain [OS=Mus musculus]"	"1"	"1687.73491"	"0.26"	"-9.97"	"-0.16"	"-9.97"	"0.36"	"0.10"	"9.97"	"136.9"	"164.4"	""	"122.9"	""	"175.9"	"4326.220703125"	"5196.1572265625"	""	"3883.68017578125"	""	"5561.287109375"	""	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"3"	"563.24992"	"0.000415"	"0.01124"	"1.98"	"25.41"
"5556"	"[K].ELEKVCNPIITK.[L]"	"1xBiotin [K4]; 1xCarbamidomethyl [C6]"	"0.00197625"	"0.000586377"	"1"	"1"	"2"	"P63017"	"P63017 [598-609]"	"P63017 1xBiotin [K601]"	"Heat shock cognate 71 kDa protein [OS=Mus musculus]"	"1"	"1669.86517"	"0.42"	"-9.97"	"0.31"	"0.73"	"-9.97"	"-9.97"	""	"114.5"	"153.4"	""	"142.1"	"190.0"	""	"7618.4453125"	"10210.10546875"	""	"9452.373046875"	"12644.60546875"	""	""	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"Not Found"	"High"	"2"	"835.43652"	"0.0001108"	"5.847E-05"	"2.69"	"41.60"
"8529"	"[R].GKVSNLVPYLR.[D]"	"1xBiotin [K2]"	"0.00674927"	"0.000586377"	"1"	"1"	"4"	"Q64343"	"Q64343 [299-309]"	"Q64343 1xBiotin [K300]"	"ATP-binding cassette sub-family G member 1 [OS=Mus musculus]"	"1"	"1471.80898"	"0.46"	"0.28"	"-0.13"	"-9.97"	"0.43"	"-0.04"	"0.15"	"102.4"	"141.4"	"124.5"	"93.9"	""	"137.7"	"12945.4755859375"	"17862.78515625"	"15738.56640625"	"11866.30078125"	""	"17405.93359375"	""	"Peak Found"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"2"	"736.40750"	"0.0001108"	"0.0003542"	"2.40"	"49.27"
"5663"	"[R].ELLEIVKK.[N]"	"1xBiotin [K8]"	"0.00967402"	"0.000586377"	"1"	"1"	"3"	"Q3THS6"	"Q3THS6 [344-351]"	"Q3THS6 1xBiotin [K351]"	"S-adenosylmethionine synthase isoform type-2 [OS=Mus musculus]"	"1"	"1197.69116"	"0.47"	"-0.08"	"0.57"	"-0.35"	"-1.05"	"-1.52"	"-0.97"	"98.6"	"136.5"	"93.5"	"146.7"	"77.1"	"47.6"	"22063.8935546875"	"30548.0493164063"	"20930.330078125"	"32840.1826171875"	"17255.869140625"	"10655.1220703125"	""	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"2"	"599.34933"	"0.0001108"	"0.0005984"	"3.03"	"44.72"
"450"	"[R].AFHMTKDMLPGSYPR.[T]"	"1xBiotin [K6]; 2xOxidation [M4; M8]"	"0.0436236"	"0.00104877"	"1"	"1"	"3"	"Q9D6J5"	"Q9D6J5 [29-43]"	"Q9D6J5 1xBiotin [K34]"	"NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial [OS=Mus musculus]"	"1"	"2008.90779"	"-0.60"	"-0.04"	"-0.28"	"-9.97"	"-0.17"	"0.42"	"-0.13"	"138.2"	"91.5"	"134.4"	"113.4"	""	"122.5"	"19264.99609375"	"12753.8095703125"	"18738.525390625"	"15814.0078125"	""	"17080.30078125"	""	"Peak Found"	"High"	"Peak Found"	"High"	"Not Found"	"High"	"High"	"3"	"670.30750"	"0.0001873"	"0.005516"	"2.22"	"35.26"
"438"	"[R].AFEGQAHSGKGPAGVELNSMQPVK.[E]"	"1xBiotin [K10]"	"8.77592E-06"	"0.000586377"	"1"	"1"	"4"	"P32037"	"P32037 [464-487]"	"P32037 1xBiotin [K473]"	"Solute carrier family 2, facilitated glucose transporter member 3 [OS=Mus musculus]"	"1"	"2665.28612"	"2.34"	"1.22"	"0.55"	"1.50"	"-9.97"	"-9.97"	"-9.97"	"47.3"	"239.3"	"110.1"	"69.1"	"134.1"	""	"7348.20751953125"	"37179.8671875"	"17108.1328125"	"10734.6708984375"	"20835.123046875"	""	""	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"High"	"3"	"889.09951"	"0.0001108"	"2.152E-08"	"4.86"	"39.19"
"8503"	"[R].GKSALLER.[A]"	"1xBiotin [K2]"	"0.105175"	"0.00705524"	"1"	"1"	"3"	"Q9CQA1"	"Q9CQA1 [8-15]"	"Q9CQA1 1xBiotin [K9]"	"Trafficking protein particle complex subunit 5 [OS=Mus musculus]"	"1"	"1099.59284"	"0.34"	"0.33"	"0.45"	"0.21"	"0.21"	"-0.13"	"-0.13"	"83.3"	"105.5"	"105.0"	"113.7"	"96.4"	"96.1"	"22819.615234375"	"28893.365234375"	"28754.322265625"	"31126.0546875"	"26393.67578125"	"26325.09765625"	""	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"2"	"550.29979"	"0.001278"	"0.02076"	"1.82"	"35.55"
"8716"	"[K].GLQKTDLYHLQK.[S]"	"1xBiotin [K4]"	"0.0022076"	"0.000586377"	"1"	"2"	"4"	"Q9JK30-1"	"Q9JK30-1 [527-538]"	"Q9JK30-1 1xBiotin [K530]"	"Origin recognition complex subunit 3 [OS=Mus musculus]"	"1"	"1669.87304"	"-0.40"	"-0.18"	"-0.58"	"-1.28"	"-0.09"	"0.31"	"0.09"	"128.7"	"97.8"	"113.5"	"86.0"	"53.0"	"121.1"	"34376.83984375"	"26107.2578125"	"30317.40625"	"22954.55078125"	"14141.490234375"	"32329.228515625"	""	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"3"	"557.29561"	"0.0001108"	"6.902E-05"	"3.17"	"39.97"
"179"	"[K].AAVAKAAIAAAAAAAAAK.[A]"	"1xBiotin [K5]"	"0.000878982"	"0.000586377"	"1"	"1"	"4"	"Q9CR57"	"Q9CR57 [143-160]"	"Q9CR57 1xBiotin [K147]"	"60S ribosomal protein L14 [OS=Mus musculus]"	"1"	"1707.95744"	"0.80"	"0.79"	"0.14"	"-1.44"	"-9.97"	"-9.97"	"-9.97"	"101.0"	"175.6"	"175.2"	"111.1"	"37.1"	""	"8594.498046875"	"14936.845703125"	"14907.166015625"	"9454.73046875"	"3156.97119140625"	""	""	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"High"	"3"	"569.99040"	"0.0001108"	"1.79E-05"	"4.41"	"52.78"
"5278"	"[K].EHSSWK.[S]"	""	"0.0792917"	"0.00241047"	"1"	"2"	"1"	"O70585"	"O70585 [288-293]"	""	"Dystrobrevin beta [OS=Mus musculus]"	"0"	"773.35768"	"-0.26"	"0.80"	"1.11"	"0.56"	"0.35"	"0.61"	"-0.45"	"70.7"	"59.1"	"123.0"	"152.5"	"104.4"	"90.2"	"19017.90625"	"15906.2802734375"	"33086.61328125"	"41043.015625"	"28099.416015625"	"24280.5546875"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"2"	"387.18237"	"0.000415"	"0.01354"	"0.66"	"17.70"
"7024"	"[K].FDLMYAKR.[A]"	"1xBiotin [K7]; 1xOxidation [M4]"	"0.0412212"	"0.00104877"	"1"	"6"	"3"	"P05213"	"P05213 [395-402]"	"P05213 1xBiotin [K401]"	"Tubulin alpha-1B chain [OS=Mus musculus]"	"1"	"1285.60678"	"0.70"	"0.37"	"0.64"	"-0.72"	"0.19"	"-0.52"	"-0.18"	"83.2"	"135.4"	"107.2"	"129.3"	"50.4"	"94.6"	"9670.3388671875"	"15739.236328125"	"12467.5556640625"	"15033.5693359375"	"5855.42578125"	"11003.3828125"	""	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"2"	"643.30714"	"0.0001873"	"0.005059"	"1.65"	"40.99"
"9054"	"[K].GQKTPAQK.[A]"	"1xBiotin [K3]"	"0.058779"	"0.0019826"	"1"	"1"	"5"	"Q9CR57"	"Q9CR57 [199-206]"	"Q9CR57 1xBiotin [K201]"	"60S ribosomal protein L14 [OS=Mus musculus]"	"1"	"1083.56154"	"0.87"	"1.01"	"0.76"	"0.88"	"0.92"	"0.05"	"-0.09"	"58.5"	"106.6"	"117.8"	"99.0"	"107.8"	"110.3"	"6691.16796875"	"12192.1484375"	"13475.8310546875"	"11327.13671875"	"12335.525390625"	"12624.8662109375"	""	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"542.28400"	"0.0003442"	"0.00861"	"2.51"	"17.77"
"9003"	"[R].GPSKTHAASAYSVDAR.[G]"	"1xBiotin [K4]"	"0.0109268"	"0.000586377"	"1"	"1"	"3"	"Q3TDN0-1"	"Q3TDN0-1 [1164-1179]"	"Q3TDN0-1 1xBiotin [K1167]"	"Protein dispatched homolog 1 [OS=Mus musculus]"	"1"	"1843.87556"	"0.61"	"0.47"	"0.60"	"0.51"	"1.01"	"0.40"	"0.54"	"67.6"	"103.3"	"93.8"	"102.5"	"96.4"	"136.3"	"7206.64013671875"	"11016.9775390625"	"10007.296875"	"10934.8662109375"	"10283.451171875"	"14534.6953125"	""	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"3"	"615.29573"	"0.0001108"	"0.0007172"	"2.31"	"28.57"
"2088"	"[R].CAQYKK.[D]"	"1xBiotin [K5]; 1xCarbamidomethyl [C1]"	"0.11765"	"0.00731053"	"1"	"3"	"4"	"P05064"	"P05064 [135-140]"	"P05064 1xBiotin [K139]"	"fructose-bisphosphate aldolase A [OS=Mus musculus]"	"1"	"1023.47503"	"0.45"	"0.33"	"0.32"	"0.27"	"0.17"	"-0.28"	"-0.16"	"83.2"	"113.8"	"104.9"	"104.3"	"100.3"	"93.6"	"9477.9365234375"	"12961.513671875"	"11939.09765625"	"11871.1171875"	"11415.28515625"	"10654.7998046875"	""	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"2"	"512.24126"	"0.001478"	"0.02479"	"1.73"	"21.42"
"6978"	"[K].FCFSNR.[M]"	"1xCarbamidomethyl [C2]"	"0.0313657"	"0.00104877"	"1"	"1"	"2"	"Q9R0Q3"	"Q9R0Q3 [92-97]"	""	"Transmembrane emp24 domain-containing protein 2 [OS=Mus musculus]"	"0"	"830.36138"	"0.49"	"0.24"	"0.21"	"0.24"	"0.27"	"-0.22"	"0.03"	"84.1"	"118.4"	"99.1"	"97.5"	"99.5"	"101.4"	"6980.46044921875"	"9822.66796875"	"8218.671875"	"8089.28662109375"	"8258.2333984375"	"8411.05859375"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"2"	"415.68423"	"0.0001873"	"0.003394"	"1.35"	"26.20"
"3737"	"[K].DNPKVVHAFDMEDLGDK.[A]"	"1xBiotin [K4]; 1xOxidation [M11]"	"0.0128509"	"0.000586377"	"1"	"1"	"3"	"Q91WS0"	"Q91WS0 [52-68]"	"Q91WS0 1xBiotin [K55]"	"CDGSH iron-sulfur domain-containing protein 1 [OS=Mus musculus]"	"1"	"2171.97362"	"-9.97"	"-0.95"	"0.48"	"-1.05"	"0.04"	"9.97"	"0.99"	"135.6"	""	"70.3"	"188.7"	"65.7"	"139.7"	"17306.625"	""	"8972.4501953125"	"24073.42578125"	"8381.9111328125"	"17821.93359375"	""	"Peak Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"High"	"3"	"724.66254"	"0.0001108"	"0.0009111"	"2.07"	"40.89"
"5304"	"[R].EKDDIQR.[A]"	"1xBiotin [K2]"	"0.107455"	"0.00731053"	"1"	"1"	"2"	"Q61233"	"Q61233 [327-333]"	"Q61233 1xBiotin [K328]"	"Plastin-2 [OS=Mus musculus]"	"1"	"1129.53063"	"0.62"	"0.79"	"1.00"	"0.84"	"1.03"	"0.41"	"0.24"	"59.5"	"91.2"	"102.6"	"119.3"	"106.2"	"121.1"	"5573.07666015625"	"8545.3173828125"	"9611.9599609375"	"11173.6044921875"	"9946.4423828125"	"11343.48828125"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"2"	"565.26891"	"0.001426"	"0.02157"	"1.24"	"24.89"
"1488"	"[K].AQNDVMTMKIQSER.[L]"	"1xBiotin [K9]; 2xOxidation [M6; M8]"	"0.0436236"	"0.00104877"	"1"	"1"	"5"	"Q61334"	"Q61334 [200-213]"	"Q61334 1xBiotin [K208]"	"B-cell receptor-associated protein 29 [OS=Mus musculus]"	"1"	"1908.86123"	"-0.27"	"0.09"	"-1.09"	"-9.97"	"0.55"	"0.82"	"0.46"	"124.3"	"103.4"	"132.0"	"58.2"	""	"182.0"	"12252.568359375"	"10194.3955078125"	"13010.1640625"	"5738.17626953125"	""	"17937.515625"	""	"Peak Found"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"2"	"954.93463"	"0.0001873"	"0.005504"	"1.01"	"29.30"
"2373"	"[R].CHTVESSKPNSLMLKDSISTMSDK.[T]"	"1xBiotin [K15]; 1xCarbamidomethyl [C1]; 2xOxidation [M13; M21]"	"0.12145"	"0.00820514"	"1"	"3"	"1"	"Q9CWP6-1"	"Q9CWP6-1 [442-465]"	"Q9CWP6-1 1xBiotin [K456]"	"motile sperm domain-containing protein 2 [OS=Mus musculus]"	"1"	"2953.34099"	"-9.97"	"0.42"	"-9.97"	"-9.97"	"-9.97"	""	"-9.97"	"256.4"	""	"343.6"	""	""	""	"7342.84521484375"	""	"9841.216796875"	""	""	""	""	"Peak Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"4"	"739.09069"	"0.001478"	"0.02587"	"3.22"	"35.89"
"8862"	"[K].GNKPWISLPR.[G]"	""	"0.0223647"	"0.00104877"	"1"	"1"	"2"	"P62702"	"P62702 [231-240]"	""	"40S ribosomal protein S4, X isoform [OS=Mus musculus]"	"0"	"1167.66330"	"0.94"	"0.52"	"1.23"	"0.98"	"0.71"	"-0.22"	"0.19"	"58.3"	"111.4"	"83.7"	"136.6"	"114.7"	"95.4"	"20659.234375"	"39499.65625"	"29683.138671875"	"48440.9453125"	"40686.27734375"	"33816.90234375"	""	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"2"	"584.33504"	"0.0001873"	"0.002058"	"2.16"	"36.33"
"5367"	"[K].EKLEDFFK.[N]"	"1xBiotin [K2]"	"0.10129"	"0.00566494"	"1"	"1"	"1"	"Q6P8X1"	"Q6P8X1 [182-189]"	"Q6P8X1 1xBiotin [K183]"	"Sorting nexin-6 [OS=Mus musculus]"	"1"	"1281.61839"	"0.52"	"0.01"	"-0.12"	"-1.06"	"-0.05"	"-0.57"	"-0.06"	"103.3"	"148.2"	"104.2"	"94.7"	"49.5"	"100.1"	"17272.884765625"	"24780.505859375"	"17424.24609375"	"15846.7861328125"	"8286.744140625"	"16739.37890625"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"2"	"641.31321"	"0.001124"	"0.01969"	"1.38"	"50.42"
"1448"	"[R].AQEKVLQK.[L]"	"1xBiotin [K4]"	"0.0192556"	"0.000586377"	"1"	"4"	"5"	"D3Z6Q9"	"D3Z6Q9 [24-31]"	"D3Z6Q9 1xBiotin [K27]"	"Bridging integrator 2 [OS=Mus musculus]"	"1"	"1169.63470"	"0.00"	"-0.23"	"0.58"	"-0.03"	"0.21"	"0.22"	"0.44"	"92.4"	"92.4"	"78.9"	"138.3"	"90.7"	"107.2"	"9880.0380859375"	"9871.9873046875"	"8436.8271484375"	"14786.376953125"	"9698.29296875"	"11462.2529296875"	""	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"585.32072"	"0.0001108"	"0.001652"	"2.08"	"27.66"
"8801"	"[R].GMGSLDAMDKHLSSQNR.[Y]"	"1xBiotin [K10]; 2xOxidation [M2; M8]"	"0.0414556"	"0.00104877"	"1"	"1"	"2"	"P24547"	"P24547 [413-429]"	"P24547 1xBiotin [K422]"	"inosine-5'-monophosphate dehydrogenase 2 [OS=Mus musculus]"	"1"	"2104.92087"	"-9.97"	"0.80"	"-0.05"	"-9.97"	"0.48"	"9.97"	"-0.32"	"117.4"	""	"204.8"	"113.6"	""	"164.1"	"5678.345703125"	""	"9905.25"	"5492.46484375"	""	"7937.56494140625"	""	"Peak Found"	"Not Found"	"High"	"High"	"Not Found"	"Peak Found"	"High"	"3"	"702.31162"	"0.0001873"	"0.005111"	"1.54"	"29.09"
"6963"	"[K].FASCFYGPFR.[D]"	"1xCarbamidomethyl [C4]"	"0.00525629"	"0.000586377"	"1"	"1"	"3"	"P10518"	"P10518 [200-209]"	""	"Delta-aminolevulinic acid dehydratase [OS=Mus musculus]"	"0"	"1251.56154"	"0.42"	"-0.10"	"0.86"	"-0.16"	"0.39"	"-0.03"	"0.50"	"82.2"	"110.2"	"76.5"	"149.5"	"73.6"	"107.9"	"9055.21875"	"12131.1767578125"	"8427.7626953125"	"16460.177734375"	"8102.86767578125"	"11885.326171875"	""	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"2"	"626.28402"	"0.0001108"	"0.000246"	"1.92"	"44.01"
"2811"	"[K].DAEGEGLSATTLLPKLIPSGAGR.[E]"	"1xBiotin [K15]"	"0.0282973"	"0.00104877"	"1"	"1"	"2"	"Q9Z0S9"	"Q9Z0S9 [10-32]"	"Q9Z0S9 1xBiotin [K24]"	"Prenylated Rab acceptor protein 1 [OS=Mus musculus]"	"1"	"2479.28610"	"-0.13"	"-0.67"	"-9.97"	"-9.97"	"0.60"	"0.73"	"1.27"	"147.7"	"135.0"	"93.1"	""	""	"224.3"	"5696.47802734375"	"5204.8623046875"	"3588.50073242188"	""	""	"8648.3310546875"	""	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"3"	"827.10153"	"0.0001873"	"0.002911"	"1.83"	"59.14"
"7713"	"[R].GAGKEAAGK.[S]"	"1xBiotin [K4]"	"0.00961806"	"0.000586377"	"1"	"2"	"2"	"Q8VEK3"	"Q8VEK3 [173-181]"	"Q8VEK3 1xBiotin [K176]"	"Heterogeneous nuclear ribonucleoprotein U [OS=Mus musculus]"	"1"	"1014.50369"	"1.22"	"0.92"	"0.79"	"0.83"	"1.20"	"-0.01"	"0.28"	"54.4"	"126.4"	"102.9"	"94.0"	"97.0"	"125.3"	"3684.21655273438"	"8562.62109375"	"6970.60498046875"	"6365.42626953125"	"6565.2822265625"	"8481.6181640625"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"2"	"507.75536"	"0.0001108"	"0.000591"	"1.71"	"17.86"
"8446"	"[K].GKGFSVVADTPELQR.[I]"	"1xBiotin [K2]"	"8.09511E-05"	"0.000586377"	"1"	"1"	"5"	"Q61792"	"Q61792 [95-109]"	"Q61792 1xBiotin [K96]"	"LIM and SH3 domain protein 1 [OS=Mus musculus]"	"1"	"1829.92144"	"0.40"	"-0.21"	"-0.05"	"-0.53"	"0.28"	"-0.12"	"0.49"	"99.0"	"130.8"	"85.4"	"95.9"	"68.7"	"120.2"	"24952.25390625"	"32968.10546875"	"21511.01171875"	"24180.875"	"17310.943359375"	"30288.412109375"	""	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"915.46465"	"0.0001108"	"5.54E-07"	"3.46"	"44.75"
"699"	"[R].AKADTLK.[L]"	"1xBiotin [K2]"	"0.0784252"	"0.00241047"	"1"	"1"	"2"	"Q9ERU9"	"Q9ERU9 [2559-2565]"	"Q9ERU9 1xBiotin [K2560]"	"E3 SUMO-protein ligase RanBP2 [OS=Mus musculus]"	"1"	"972.51828"	"0.04"	"0.01"	"0.16"	"0.39"	"0.27"	"0.23"	"0.26"	"90.0"	"92.5"	"90.9"	"100.4"	"117.7"	"108.7"	"10544.193359375"	"10834.8056640625"	"10649.5498046875"	"11761.2109375"	"13790.8623046875"	"12736.3876953125"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"2"	"486.76265"	"0.000415"	"0.01333"	"1.87"	"26.10"
"704"	"[K].AKAVSTGK.[K]"	"1xBiotin [K2]"	"0.0315454"	"0.00104877"	"1"	"1"	"4"	"Q9Z2A7"	"Q9Z2A7 [234-241]"	"Q9Z2A7 1xBiotin [K235]"	"Diacylglycerol O-acyltransferase 1 [OS=Mus musculus]"	"1"	"987.52918"	"1.23"	"0.92"	"1.15"	"0.55"	"0.87"	"-0.36"	"-0.05"	"55.9"	"130.8"	"105.7"	"124.2"	"81.6"	"101.8"	"4424.90966796875"	"10352.08984375"	"8361.7958984375"	"9827.0712890625"	"6459.9541015625"	"8059.56298828125"	""	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"2"	"494.26831"	"0.0001873"	"0.003417"	"1.52"	"20.59"
"715"	"[K].AKELATK.[L]"	"1xBiotin [K2]"	"0.0939097"	"0.00379267"	"1"	"1"	"2"	"P12970"	"P12970 [258-264]"	"P12970 1xBiotin [K259]"	"60S ribosomal protein L7a [OS=Mus musculus]"	"1"	"986.53393"	"0.13"	"0.44"	"-0.19"	"-0.08"	"0.51"	"0.38"	"0.08"	"89.6"	"98.1"	"121.3"	"78.4"	"84.7"	"127.9"	"10130.931640625"	"11093.8779296875"	"13708.0849609375"	"8856.734375"	"9572.5888671875"	"14457.6923828125"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"2"	"493.77034"	"0.0008081"	"0.01745"	"1.97"	"25.75"
"6063"	"[K].ENKFCSFLQTSK.[V]"	"1xBiotin [K3]; 1xCarbamidomethyl [C5]"	"0.000742254"	"0.000586377"	"1"	"1"	"2"	"P28575"	"P28575 [268-279]"	"P28575 1xBiotin [K270]"	"actin-binding protein IPP [OS=Mus musculus]"	"1"	"1714.79274"	"0.60"	"-9.97"	"-9.97"	"-1.08"	"-9.97"	"-9.97"	""	"200.5"	"304.9"	""	""	"94.6"	""	"6908.31298828125"	"10505.1884765625"	""	""	"3259.96923828125"	""	""	"Peak Found"	"High"	"High"	"Not Found"	"Peak Found"	"Not Found"	"High"	"2"	"857.90043"	"0.0001108"	"1.404E-05"	"2.38"	"49.79"
"8183"	"[R].GFLEHANKER.[V]"	"1xBiotin [K8]"	"0.0784252"	"0.00241047"	"1"	"2"	"2"	"Q8K2X1-1"	"Q8K2X1-1 [257-266]"	"Q8K2X1-1 1xBiotin [K264]"	"Probable phospholipid-transporting ATPase VD [OS=Mus musculus]"	"1"	"1426.68959"	"-0.33"	"0.32"	"-0.17"	"0.15"	"0.33"	"0.66"	"0.02"	"95.2"	"75.8"	"118.5"	"84.4"	"105.9"	"120.1"	"14594.2958984375"	"11620.3525390625"	"18164.701171875"	"12935.06640625"	"16233.8247070313"	"18402.048828125"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"3"	"476.23420"	"0.000415"	"0.01333"	"1.73"	"31.30"
"3439"	"[R].DKYEPAAVSEHGDK.[K]"	"1xBiotin [K2]"	"0.000484956"	"0.000586377"	"1"	"1"	"3"	"Q8VDN2"	"Q8VDN2 [8-21]"	"Q8VDN2 1xBiotin [K9]"	"Sodium/potassium-transporting ATPase subunit alpha-1 [OS=Mus musculus]"	"1"	"1771.79557"	"0.49"	"0.46"	"0.42"	"0.39"	"0.42"	"-0.08"	"-0.04"	"77.2"	"108.8"	"106.2"	"103.1"	"101.5"	"103.1"	"22437.384765625"	"31611.34765625"	"30850.54296875"	"29955.45703125"	"29485.791015625"	"29946.767578125"	""	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"3"	"591.26989"	"0.0001108"	"7.513E-06"	"3.30"	"30.04"
"5974"	"[K].EMIKSGMNVAR.[L]"	"1xBiotin [K4]; 2xOxidation [M2; M7]"	"0.0438712"	"0.00104877"	"1"	"2"	"2"	"P52480"	"P52480 [63-73]"	"P52480 1xBiotin [K66]"	"Pyruvate kinase PKM [OS=Mus musculus]"	"1"	"1493.69092"	"-9.97"	"-0.58"	"-0.01"	"-9.97"	"-9.97"	""	"-9.97"	"225.4"	""	"150.8"	"223.8"	""	""	"19483.2890625"	""	"13031.6474609375"	"19347.375"	""	""	""	"Peak Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"2"	"747.34974"	"0.0001873"	"0.005557"	"1.74"	"26.82"
"736"	"[R].AKHHAISAK.[L]"	"1xBiotin [K2]"	"0.0378561"	"0.00104877"	"1"	"1"	"2"	"P35564"	"P35564 [127-135]"	"P35564 1xBiotin [K128]"	"Calnexin [OS=Mus musculus]"	"1"	"1188.63062"	"0.76"	"0.98"	"1.10"	"0.65"	"0.83"	"0.07"	"-0.15"	"59.1"	"99.9"	"116.5"	"126.7"	"93.0"	"104.8"	"5726.48974609375"	"9677.08984375"	"11290.1328125"	"12272.1513671875"	"9007.4892578125"	"10150.29296875"	""	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"3"	"396.88131"	"0.0001873"	"0.004454"	"2.35"	"14.26"
"839"	"[K].ALAPEYAKAAAK.[L]"	"1xBiotin [K8]"	"0.00803425"	"0.000586377"	"1"	"1"	"1"	"P09103"	"P09103 [60-71]"	"P09103 1xBiotin [K67]"	"Protein disulfide-isomerase [OS=Mus musculus]"	"1"	"1429.75080"	"0.46"	"-9.97"	"0.28"	"-0.04"	"-9.97"	"-9.97"	""	"131.4"	"180.9"	""	"159.8"	"127.9"	""	"8516.87109375"	"11719.5927734375"	""	"10355.57421875"	"8287.931640625"	""	""	"Peak Found"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"2"	"715.37846"	"0.0001108"	"0.0004569"	"1.79"	"35.19"
"744"	"[K].AKKPAGATPK.[K]"	"1xBiotin [K2]"	"0.0710142"	"0.00241047"	"1"	"1"	"1"	"P43276"	"P43276 [128-137]"	"P43276 1xBiotin [K129]"	"Histone H1.5 [OS=Mus musculus]"	"1"	"1194.66634"	"1.04"	"0.99"	"0.49"	"0.68"	"1.13"	"0.08"	"0.13"	"58.5"	"120.6"	"116.6"	"82.3"	"94.1"	"127.8"	"15717.2841796875"	"32384.98046875"	"31291.51953125"	"22102.55078125"	"25261.96875"	"34318.61328125"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"3"	"398.89353"	"0.000415"	"0.01145"	"2.20"	"16.52"
"6370"	"[K].EQGVLSFWR.[G]"	""	"0.0286231"	"0.00104877"	"1"	"1"	"2"	"P51881"	"P51881 [64-72]"	""	"ADP/ATP translocase 2 [OS=Mus musculus]"	"0"	"1121.57382"	"0.43"	"0.18"	"0.93"	"0.22"	"0.86"	"0.43"	"0.68"	"71.7"	"96.5"	"81.5"	"136.8"	"83.3"	"130.2"	"10889.205078125"	"14658.251953125"	"12376.29296875"	"20771.67578125"	"12652.9921875"	"19775.046875"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"2"	"561.29013"	"0.0001873"	"0.002953"	"1.88"	"48.43"
"3353"	"[R].DHSAMLSKCTSSIK.[A]"	"1xBiotin [K8]; 1xCarbamidomethyl [C9]; 1xOxidation [M5]"	"0.0118501"	"0.000586377"	"1"	"1"	"2"	"A2ASA8"	"A2ASA8 [283-296]"	"A2ASA8 1xBiotin [K290]"	"Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1 [OS=Mus musculus]"	"1"	"1806.81830"	"-0.49"	"0.50"	"0.38"	"-0.57"	"0.35"	"0.85"	"-0.15"	"94.0"	"66.8"	"133.3"	"122.5"	"63.2"	"120.2"	"7002.50830078125"	"4972.32275390625"	"9930.037109375"	"9120.421875"	"4710.4521484375"	"8953.2451171875"	""	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"3"	"602.94427"	"0.0001108"	"0.0008062"	"3.11"	"30.15"
"811"	"[K].AKVTKPK.[TK]"	"1xBiotin [K2]"	"0.0469494"	"0.00154748"	"2"	"2"	"5"	"P43275; P15864"	"P43275 [194-200]; P15864 [177-183]"	"P43275 1xBiotin [K195]; P15864 1xBiotin [K178]"	"Histone H1.1 [OS=Mus musculus];Histone H1.2 [OS=Mus musculus]"	"1"	"997.58630"	"0.73"	"0.42"	"0.28"	"1.10"	"0.83"	"0.10"	"0.41"	"65.7"	"109.0"	"87.8"	"79.8"	"141.1"	"116.6"	"5847.9033203125"	"9708.6416015625"	"7823.25830078125"	"7104.1123046875"	"12569.7177734375"	"10384.546875"	"NotUnique"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"499.29685"	"0.0002716"	"0.006173"	"2.12"	"16.67"
"8085"	"[R].GENDLVKTHSPVA.[-]"	"1xBiotin [K7]"	"0.00368563"	"0.000586377"	"1"	"1"	"3"	"Q8VCH2"	"Q8VCH2 [209-221]"	"Q8VCH2 1xBiotin [K215]"	"CMRF35-like molecule 5 [OS=Mus musculus]"	"1"	"1592.77372"	"-0.01"	"-0.22"	"0.05"	"0.58"	"-0.10"	"-0.09"	"0.12"	"94.9"	"94.4"	"81.6"	"98.2"	"142.4"	"88.5"	"26838.63671875"	"26673.271484375"	"23080.341796875"	"27750.240234375"	"40254.0625"	"25020.361328125"	""	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"2"	"796.89034"	"0.0001108"	"0.0001453"	"2.94"	"36.45"
"8179"	"[K].GFKGQLSR.[Q]"	"1xBiotin [K3]"	"0.0453851"	"0.00154748"	"1"	"1"	"2"	"Q3UDR8"	"Q3UDR8 [81-88]"	"Q3UDR8 1xBiotin [K83]"	"protein YIPF3 [OS=Mus musculus]"	"1"	"1118.57752"	"1.15"	"0.86"	"1.22"	"0.69"	"0.83"	"-0.32"	"-0.03"	"55.7"	"124.0"	"101.2"	"130.0"	"90.0"	"99.1"	"26969.07421875"	"59987.125"	"48963.31640625"	"62901.47265625"	"43563.28515625"	"47978.328125"	""	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"2"	"559.79237"	"0.0002716"	"0.005838"	"1.89"	"34.03"
"5972"	"[R].EMLKQYYIGDVHPSDLKPK.[G]"	"1xBiotin [K4]; 1xOxidation [M2]"	"0.0351565"	"0.00104877"	"1"	"1"	"2"	"Q9CQX2"	"Q9CQX2 [85-103]"	"Q9CQX2 1xBiotin [K88]"	"Cytochrome b5 type B [OS=Mus musculus]"	"1"	"2503.23598"	"0.38"	"1.58"	"-9.97"	"-9.97"	"0.52"	"0.14"	"-1.06"	"89.2"	"116.5"	"266.3"	""	""	"128.1"	"15245.6337890625"	"19907.439453125"	"45510.794921875"	""	""	"21895.607421875"	""	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Peak Found"	"High"	"3"	"835.08327"	"0.0001873"	"0.004001"	"2.22"	"41.91"
"7783"	"[K].GAPPAEKK.[S]"	"1xBiotin [K7]"	"0.128026"	"0.00949852"	"1"	"1"	"3"	"Q9WUQ2"	"Q9WUQ2 [120-127]"	"Q9WUQ2 1xBiotin [K126]"	"Prolactin regulatory element-binding protein [OS=Mus musculus]"	"1"	"1023.52918"	"0.55"	"0.38"	"0.34"	"0.38"	"0.32"	"-0.23"	"-0.06"	"79.2"	"115.9"	"102.8"	"100.1"	"103.3"	"98.7"	"9294.7138671875"	"13608.015625"	"12065.2373046875"	"11756.4111328125"	"12125.3603515625"	"11587.474609375"	""	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"2"	"512.26807"	"0.001921"	"0.02809"	"1.79"	"20.07"
"998"	"[K].ALIQTKSGSLPSLHDIIK.[G]"	"1xBiotin [K6]"	"0.0011628"	"0.000586377"	"1"	"2"	"1"	"Q8C341-1"	"Q8C341-1 [1214-1231]"	"Q8C341-1 1xBiotin [K1219]"	"SUN domain-containing ossification factor [OS=Mus musculus]"	"1"	"2147.18929"	"0.55"	"-0.26"	"-9.97"	"-9.97"	"-9.97"	"-9.97"	"-9.97"	"181.9"	"265.8"	"152.3"	""	""	""	"16778.060546875"	"24514.857421875"	"14042.212890625"	""	""	""	""	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"3"	"716.40089"	"0.0001108"	"2.697E-05"	"3.15"	"51.22"
"8438"	"[K].GKEVDNFVDK.[L]"	"1xBiotin [K2]"	"0.00459798"	"0.000586377"	"1"	"1"	"2"	"Q5XJY5"	"Q5XJY5 [232-241]"	"Q5XJY5 1xBiotin [K233]"	"Coatomer subunit delta [OS=Mus musculus]"	"1"	"1376.65148"	"0.36"	"0.13"	"0.52"	"0.46"	"0.38"	"0.02"	"0.25"	"80.1"	"103.0"	"87.5"	"115.0"	"110.0"	"104.4"	"45207.703125"	"58100.94921875"	"49376.125"	"64885.08203125"	"62027.2734375"	"58885.015625"	""	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"2"	"688.82928"	"0.0001108"	"0.0002008"	"3.15"	"37.05"
"482"	"[K].AGAHLKGGAK.[R]"	"1xBiotin [K6]"	"0.00109058"	"0.000586377"	"1"	"1"	"8"	"P16858"	"P16858 [106-115]"	"P16858 1xBiotin [K111]"	"glyceraldehyde-3-phosphate dehydrogenase [OS=Mus musculus]"	"1"	"1135.60407"	"2.03"	"1.24"	"1.67"	"1.50"	"1.61"	"-0.41"	"0.37"	"36.4"	"148.1"	"85.7"	"115.6"	"103.1"	"111.1"	"11652.927734375"	"47449.0322265625"	"27461.0200195313"	"37021.7646484375"	"33029.0458984375"	"35595.9375"	""	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"568.30587"	"0.0001108"	"2.46E-05"	"3.24"	"20.38"
"1193"	"[R].AMPSEFTSAKLR.[S]"	"1xBiotin [K10]"	"0.00305907"	"0.000586377"	"1"	"1"	"3"	"O88829"	"O88829 [27-38]"	"O88829 1xBiotin [K36]"	"Lactosylceramide alpha-2,3-sialyltransferase [OS=Mus musculus]"	"1"	"1563.76580"	"1.03"	"0.83"	"0.65"	"1.14"	"0.94"	"-0.10"	"0.11"	"57.0"	"116.8"	"101.4"	"89.5"	"126.1"	"109.2"	"15268.6259765625"	"31282.87890625"	"27153.619140625"	"23953.74609375"	"33750.03125"	"29239.93359375"	""	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"2"	"782.38698"	"0.0001108"	"0.0001106"	"2.48"	"42.92"
"7722"	"[K].GAGTNGLPTKGPTEVSDKK.[K]"	"1xBiotin [K10]"	"0.00580252"	"0.000586377"	"1"	"1"	"2"	"Q91WE4"	"Q91WE4 [52-70]"	"Q91WE4 1xBiotin [K61]"	"UPF0729 protein C18orf32 homolog [OS=Mus musculus]"	"2"	"2083.04883"	"0.27"	"-0.16"	"0.19"	"-0.10"	"-9.97"	"-9.97"	"-9.97"	"115.9"	"140.0"	"103.8"	"132.1"	"108.2"	""	"9327.033203125"	"11265.1298828125"	"8352.435546875"	"10627.234375"	"8707.5703125"	""	""	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"High"	"3"	"695.02128"	"0.0001108"	"0.0002826"	"4.15"	"31.35"
"3515"	"[R].DILKEMFPYEASTPTGISASCR.[R]"	"1xBiotin [K4]; 1xCarbamidomethyl [C21]"	"0.0621531"	"0.0019826"	"1"	"4"	"1"	"Q61029"	"Q61029 [342-363]"	"Q61029 1xBiotin [K345]"	"Lamina-associated polypeptide 2, isoforms beta/delta/epsilon/gamma [OS=Mus musculus]"	"1"	"2699.25137"	"-0.01"	"0.04"	"-9.97"	"-9.97"	"0.27"	"0.28"	"0.24"	"141.9"	"141.1"	"145.5"	""	""	"171.5"	"7123.36328125"	"7082.07421875"	"7303.83544921875"	""	""	"8606.3720703125"	""	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"3"	"900.42231"	"0.0003442"	"0.009349"	"2.65"	"56.97"
"8426"	"[R].GKEDISQNK.[D]"	"1xBiotin [K2]"	"0.00740682"	"0.000586377"	"1"	"1"	"2"	"B9EJ86"	"B9EJ86 [77-85]"	"B9EJ86 1xBiotin [K78]"	"Oxysterol-binding protein-related protein 8 [OS=Mus musculus]"	"1"	"1244.59396"	"0.59"	"0.24"	"0.54"	"-0.02"	"0.60"	"0.01"	"0.36"	"78.4"	"118.2"	"92.8"	"114.4"	"77.3"	"118.9"	"9271.6640625"	"13970.14453125"	"10971.0869140625"	"13521.1728515625"	"9144.2353515625"	"14061.6162109375"	""	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"2"	"622.80082"	"0.0001108"	"0.0004032"	"2.10"	"24.56"
"2882"	"[R].DAVVGRPPADKK.[S]"	"1xBiotin [K11]"	"0.0879791"	"0.00334029"	"1"	"2"	"2"	"Q91YH5-1"	"Q91YH5-1 [528-539]"	"Q91YH5-1 1xBiotin [K538]"	"Atlastin-3 [OS=Mus musculus]"	"1"	"1478.77841"	"0.38"	"0.48"	"0.81"	"0.90"	"0.74"	"0.35"	"0.26"	"66.7"	"87.1"	"93.0"	"117.3"	"124.9"	"111.1"	"6997.77783203125"	"9135.41796875"	"9760.259765625"	"12305.8193359375"	"13103.2587890625"	"11658.4248046875"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"3"	"493.59747"	"0.0005759"	"0.01584"	"2.96"	"26.04"
"3498"	"[K].DLKEEIDIR.[L]"	"1xBiotin [K3]"	"0.0115787"	"0.000586377"	"1"	"3"	"5"	"Q8R092"	"Q8R092 [57-65]"	"Q8R092 1xBiotin [K59]"	"Uncharacterized protein C1orf43 homolog [OS=Mus musculus]"	"1"	"1356.68278"	"-9.97"	"0.19"	"0.88"	"0.06"	"-9.97"	""	"-9.97"	"119.3"	""	"136.3"	"220.3"	"124.1"	""	"11265.572265625"	""	"12867.462890625"	"20793.43359375"	"11716.0419921875"	""	""	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"678.84456"	"0.0001108"	"0.0007803"	"2.48"	"46.21"
"5850"	"[K].EITALAPSTMKIK.[I]"	"1xBiotin [K]"	"0.0106146"	"0.000586377"	"1"	"6"	"5"	"P60710"	"P60710 [316-328]"	"P60710 1xBiotin [K]"	"Actin, cytoplasmic 1 [OS=Mus musculus]"	"1"	"1628.87501"	"2.12"	"1.81"	"1.00"	"2.16"	"1.34"	"-0.78"	"-0.48"	"33.6"	"145.9"	"118.2"	"67.3"	"150.1"	"84.9"	"8453.9501953125"	"36680.8125"	"29702.2734375"	"16921.85546875"	"37721.7421875"	"21354.701171875"	""	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"2"	"814.94173"	"0.0001108"	"0.0006844"	"1.82"	"44.66"
"8360"	"[K].GGVVGIKVDK.[G]"	"1xBiotin [K]"	"0.0970105"	"0.00379267"	"1"	"1"	"3"	"P05064"	"P05064 [102-111]"	"P05064 1xBiotin [K]"	"fructose-bisphosphate aldolase A [OS=Mus musculus]"	"1"	"1197.66600"	"0.16"	"0.35"	"0.34"	"0.19"	"0.44"	"0.28"	"0.08"	"83.9"	"93.8"	"107.2"	"106.1"	"95.5"	"113.6"	"15102.91015625"	"16884.634765625"	"19301.716796875"	"19111.412109375"	"17190.607421875"	"20451.796875"	""	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"2"	"599.33668"	"0.0008081"	"0.01834"	"1.76"	"35.89"
"8350"	"[R].GGTWFAGFGR.[E]"	""	"0.0110542"	"0.000586377"	"1"	"1"	"4"	"Q91YT0"	"Q91YT0 [258-267]"	""	"NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial [OS=Mus musculus]"	"0"	"1055.50574"	"-0.03"	"-0.26"	"-0.03"	"0.08"	"-0.38"	"-0.36"	"-0.13"	"106.8"	"104.8"	"89.3"	"104.6"	"112.7"	"81.8"	"39217.12109375"	"38479.05078125"	"32773.2734375"	"38413.984375"	"41385.0625"	"30047.03125"	""	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"2"	"528.25628"	"0.0001108"	"0.0007273"	"2.06"	"45.77"
"570"	"[R].AGLQFPVGR.[VI]"	""	"0.00600852"	"0.000586377"	"3"	"12"	"8"	"Q64523; Q8BFU2; P27661"	"Q64523 [22-30]; Q8BFU2 [22-30]; P27661 [22-30]"	""	"Histone H2A type 2-C [OS=Mus musculus];Histone H2A type 3 [OS=Mus musculus];Histone H2AX [OS=Mus musculus]"	"0"	"944.53123"	"0.72"	"0.37"	"0.79"	"0.65"	"0.53"	"-0.19"	"0.16"	"69.2"	"113.9"	"89.6"	"119.2"	"108.2"	"99.8"	"85750.9609375"	"141216.390625"	"111089.84375"	"147810.296875"	"134175.15625"	"123781.4140625"	"NotUnique"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"472.76910"	"0.0001108"	"0.0002988"	"3.08"	"36.65"
"2883"	"[K].DAVYGTPQKYDPTFK.[G]"	"1xBiotin [K9]"	"0.00794148"	"0.000586377"	"1"	"1"	"3"	"Q8BY89-2"	"Q8BY89-2 [7-21]"	"Q8BY89-2 1xBiotin [K15]"	"Isoform 2 of Choline transporter-like protein 2 [OS=Mus musculus]"	"1"	"1955.92078"	"-9.97"	"-9.97"	"0.29"	"-9.97"	"0.55"	"9.97"	"9.97"	"162.8"	""	""	"198.4"	""	"238.8"	"6516.38623046875"	""	""	"7941.02783203125"	""	"9556.3779296875"	""	"Peak Found"	"High"	"Not Found"	"High"	"Not Found"	"High"	"High"	"2"	"978.46357"	"0.0001108"	"0.0004488"	"2.54"	"42.73"
"7736"	"[RK].GAKNFFEAK.[AV]"	"1xBiotin [K3]"	"0.0343643"	"0.00104877"	"1"	"2"	"3"	"Q9D8Y0"	"Q9D8Y0 [189-197]"	"Q9D8Y0 1xBiotin [K191]"	"EF-hand domain-containing protein D2 [OS=Mus musculus]"	"1"	"1237.60340"	"0.61"	"0.18"	"-9.97"	"0.17"	"0.45"	"-0.16"	"0.27"	"97.7"	"148.8"	"110.4"	""	"109.9"	"133.1"	"16197.421875"	"24668.625"	"18294.404296875"	""	"18222.564453125"	"22062.861328125"	""	"Peak Found"	"High"	"High"	"Not Found"	"High"	"Peak Found"	"High"	"2"	"619.30561"	"0.0001873"	"0.003876"	"2.45"	"41.11"
"8278"	"[K].GGKLDMSDLK.[A]"	"1xBiotin [K3]"	"0.00484517"	"0.000586377"	"2"	"3"	"5"	"P13011; P13516"	"P13011 [196-205]; P13516 [193-202]"	"P13011 1xBiotin [K198]; P13516 1xBiotin [K195]"	"Acyl-CoA desaturase 2 [OS=Mus musculus];Acyl-CoA desaturase 1 [OS=Mus musculus]"	"1"	"1289.62282"	"1.01"	"0.85"	"0.43"	"1.30"	"0.58"	"-0.43"	"-0.26"	"59.3"	"119.5"	"106.6"	"79.8"	"146.1"	"88.8"	"12756.8525390625"	"25722.736328125"	"22945.921875"	"17182.12890625"	"31463.265625"	"19111.9453125"	"NotUnique"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"645.31473"	"0.0001108"	"0.0002182"	"2.97"	"41.25"
"5263"	"[K].EHNSNFKAGYIPIDEDR.[L]"	"1xBiotin [K7]"	"0.0037288"	"0.000586377"	"1"	"1"	"1"	"P82349"	"P82349 [37-53]"	"P82349 1xBiotin [K43]"	"beta-sarcoglycan [OS=Mus musculus]"	"1"	"2231.01859"	"0.91"	"-0.31"	"-0.18"	"-9.97"	"0.84"	"-0.07"	"1.15"	"94.4"	"177.1"	"76.1"	"83.2"	""	"169.2"	"6289.92626953125"	"11807.708984375"	"5073.123046875"	"5545.65966796875"	""	"11275.837890625"	""	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"3"	"744.34418"	"0.0001108"	"0.0001481"	"3.53"	"41.70"
"7052"	"[K].FEKEAAEMGK.[G]"	"1xBiotin [K3]; 1xOxidation [M8]"	"0.0131519"	"0.000586377"	"1"	"2"	"1"	"P10126"	"P10126 [42-51]"	"P10126 1xBiotin [K44]"	"Elongation factor 1-alpha 1 [OS=Mus musculus]"	"1"	"1381.61265"	"0.55"	"0.07"	"0.49"	"-1.06"	"0.13"	"-0.42"	"0.06"	"92.4"	"135.5"	"97.0"	"129.5"	"44.4"	"101.2"	"9990.052734375"	"14647.8515625"	"10491.5634765625"	"14007.9453125"	"4804.025390625"	"10938.615234375"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"2"	"691.30980"	"0.0001108"	"0.0009417"	"1.61"	"28.85"
"5384"	"[K].EKLQCLKDFHK.[D]"	"2xBiotin [K2; K7]; 1xCarbamidomethyl [C5]"	"0.0376414"	"0.00104877"	"1"	"1"	"2"	"O35316"	"O35316 [5-15]"	"O35316 2xBiotin [K6; K11]"	"Sodium- and chloride-dependent taurine transporter [OS=Mus musculus]"	"2"	"1897.91214"	"0.70"	"-0.13"	"-0.28"	"-1.20"	"0.11"	"-0.59"	"0.24"	"102.2"	"165.5"	"93.3"	"84.2"	"44.6"	"110.1"	"9681.6669921875"	"15676.4697265625"	"8838.953125"	"7970.79150390625"	"4228.11572265625"	"10421.4814453125"	""	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"3"	"633.30781"	"0.0001873"	"0.004446"	"2.02"	"44.22"
"8150"	"[K].GFAFISFHR.[R]"	""	"0.0140162"	"0.000586377"	"1"	"1"	"4"	"Q9Z1D1"	"Q9Z1D1 [281-289]"	""	"Eukaryotic translation initiation factor 3 subunit G [OS=Mus musculus]"	"0"	"1081.55778"	"-0.31"	"-0.35"	"-0.02"	"-1.26"	"-0.70"	"-0.39"	"-0.35"	"130.1"	"105.0"	"102.2"	"128.3"	"54.2"	"80.2"	"44152.0859375"	"35641.140625"	"34687.93359375"	"43536.7890625"	"18392.966796875"	"27208.955078125"	""	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"2"	"541.28255"	"0.0001108"	"0.001034"	"2.26"	"43.58"
"5072"	"[K].EGATKFGSQASQK.[A]"	"1xBiotin [K5]"	"0.00151154"	"0.000586377"	"1"	"2"	"3"	"Q9EPJ9"	"Q9EPJ9 [227-239]"	"Q9EPJ9 1xBiotin [K231]"	"ADP-ribosylation factor GTPase-activating protein 1 [OS=Mus musculus]"	"1"	"1564.74242"	"0.33"	"-0.15"	"0.01"	"0.01"	"0.15"	"-0.18"	"0.30"	"95.6"	"120.0"	"86.1"	"96.3"	"96.1"	"105.9"	"29825.505859375"	"37412.94140625"	"26859.94921875"	"30018.6015625"	"29962.04296875"	"33017.953125"	""	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"2"	"782.87517"	"0.0001108"	"3.978E-05"	"2.70"	"30.30"
"9212"	"[K].GSKGSEDSPPK.[H]"	"1xBiotin [K3]"	"0.0398418"	"0.00104877"	"1"	"1"	"2"	"Q99LH2"	"Q99LH2 [435-445]"	"Q99LH2 1xBiotin [K437]"	"phosphatidylserine synthase 1 [OS=Mus musculus]"	"1"	"1314.59944"	"0.39"	"-0.08"	"0.04"	"0.14"	"0.39"	"0.00"	"0.47"	"89.5"	"117.6"	"84.7"	"92.1"	"98.6"	"117.4"	"16250.4443359375"	"21356.609375"	"15386.46875"	"16722.5234375"	"17904.455078125"	"21313.9375"	""	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"2"	"657.80304"	"0.0001873"	"0.004835"	"1.72"	"20.89"
"4198"	"[K].DVNAAIATIKTK.[R]"	"1xBiotin [K]"	"0.00129899"	"0.000586377"	"1"	"4"	"4"	"P05213"	"P05213 [327-338]"	"P05213 1xBiotin [K]"	"Tubulin alpha-1B chain [OS=Mus musculus]"	"1"	"1470.79848"	"-0.03"	"0.62"	"-9.97"	"-0.10"	"-9.97"	"-9.97"	"-9.97"	"134.9"	"131.9"	"207.7"	""	"125.6"	""	"11954.7734375"	"11686.3759765625"	"18407.740234375"	""	"11129.4072265625"	""	""	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"High"	"2"	"735.90250"	"0.0001108"	"3.168E-05"	"3.86"	"44.55"
"9554"	"[R].GYSFTTTAER.[E]"	""	"0.126686"	"0.00949852"	"1"	"2"	"2"	"P60710"	"P60710 [197-206]"	""	"Actin, cytoplasmic 1 [OS=Mus musculus]"	"0"	"1132.52693"	"0.86"	"0.37"	"0.49"	"1.23"	"0.76"	"-0.10"	"0.39"	"62.8"	"114.3"	"81.3"	"87.9"	"147.0"	"106.7"	"7373.86962890625"	"13427.8193359375"	"9552.9287109375"	"10321.88671875"	"17258.458984375"	"12528.0302734375"	""	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"2"	"566.76681"	"0.001921"	"0.02771"	"1.46"	"27.70"
"4268"	"[K].DYNDDYYEESYLTTKTYGEPESVGMSK.[S]"	"1xBiotin [K15]; 1xOxidation [M25]"	"0.0750464"	"0.00241047"	"1"	"1"	"2"	"O08579"	"O08579 [90-116]"	"O08579 1xBiotin [K104]"	"Emerin [OS=Mus musculus]"	"1"	"3426.41882"	"1.36"	"-9.97"	"0.35"	"-1.20"	"-9.97"	"-9.97"	""	"113.7"	"291.6"	""	"145.3"	"49.3"	""	"7574.755859375"	"19420.34765625"	""	"9678.7041015625"	"3286.73193359375"	""	""	"Peak Found"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"3"	"1142.81421"	"0.000415"	"0.01241"	"2.99"	"49.06"
"1927"	"[K].AVKAEALSSLHGDDQDSEDEVLTVPEVK.[V]"	"1xBiotin [K3]"	"0.00102284"	"0.000586377"	"1"	"1"	"1"	"Q07113"	"Q07113 [2385-2412]"	"Q07113 1xBiotin [K2387]"	"Cation-independent mannose-6-phosphate receptor [OS=Mus musculus]"	"1"	"3207.53618"	"0.21"	"0.13"	"-9.97"	"-9.97"	"0.87"	"0.66"	"0.74"	"118.3"	"136.4"	"129.1"	""	""	"216.2"	"32378.48828125"	"37332.2421875"	"35312.37890625"	""	""	"59149.703125"	""	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"3"	"1069.85052"	"0.0001108"	"2.233E-05"	"3.81"	"47.64"
"7085"	"[R].FFSGYGR.[L]"	""	"0.104051"	"0.00659446"	"1"	"1"	"2"	"Q3TWW8"	"Q3TWW8 [21-27]"	""	"Serine/arginine-rich splicing factor 6 [OS=Mus musculus]"	"0"	"833.39406"	"0.32"	"0.28"	"0.63"	"0.68"	"0.55"	"0.22"	"0.27"	"74.3"	"93.0"	"90.3"	"114.6"	"119.2"	"108.6"	"51306.859375"	"64251.87890625"	"62388.09375"	"79142.6015625"	"82318.59375"	"75037.8984375"	""	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"2"	"417.20047"	"0.001278"	"0.02043"	"1.73"	"28.45"
"4705"	"[R].EDSKLFLK.[I]"	"1xBiotin [K4]"	"0.0326448"	"0.00104877"	"1"	"1"	"1"	"Q8CGA3"	"Q8CGA3 [550-557]"	"Q8CGA3 1xBiotin [K553]"	"Large neutral amino acids transporter small subunit 4 [OS=Mus musculus]"	"1"	"1205.62347"	"-9.97"	"0.49"	"0.07"	"0.71"	"0.97"	"9.97"	"0.48"	"85.3"	""	"119.5"	"89.3"	"139.0"	"166.8"	"7636.10693359375"	""	"10704.1748046875"	"7997.134765625"	"12450.6005859375"	"14937.53125"	""	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"2"	"603.31477"	"0.0001873"	"0.003596"	"1.76"	"42.71"
"4122"	"[R].DTPAKNAQK.[S]"	"1xBiotin [K5]"	"0.0574787"	"0.0019826"	"1"	"1"	"2"	"Q61937"	"Q61937 [197-205]"	"Q61937 1xBiotin [K201]"	"Nucleophosmin [OS=Mus musculus]"	"1"	"1198.58848"	"0.68"	"0.57"	"0.68"	"0.76"	"0.47"	"-0.22"	"-0.10"	"68.5"	"109.8"	"101.4"	"109.9"	"115.8"	"94.6"	"14732.25"	"23629"	"21821.171875"	"23653.84375"	"24911.15625"	"20347.708984375"	""	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"2"	"599.79784"	"0.0003442"	"0.008314"	"1.69"	"19.66"
"7330"	"[K].FMHNQFLKLK.[K]"	"1xBiotin [K8]; 1xOxidation [M2]"	"0.00436336"	"0.000586377"	"1"	"3"	"3"	"Q80U28"	"Q80U28 [1566-1575]"	"Q80U28 1xBiotin [K1573]"	"MAP kinase-activating death domain protein [OS=Mus musculus]"	"1"	"1547.78614"	"0.41"	"0.40"	"0.20"	"-1.88"	"0.52"	"0.11"	"0.12"	"92.3"	"122.6"	"122.1"	"105.8"	"25.0"	"132.2"	"39852.09375"	"52939.6953125"	"52717.8125"	"45676.890625"	"10813.72265625"	"57110.3671875"	""	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"3"	"516.60008"	"0.0001108"	"0.0001868"	"2.78"	"39.10"
"9224"	"[R].GSLSGWILSK.[A]"	""	"0.0236878"	"0.00104877"	"1"	"1"	"3"	"P35564"	"P35564 [79-88]"	""	"Calnexin [OS=Mus musculus]"	"0"	"1047.58332"	"-9.97"	"-0.12"	"-0.03"	"0.01"	"0.23"	"9.97"	"0.35"	"118.2"	""	"108.4"	"116.1"	"118.9"	"138.4"	"20681.521484375"	""	"18978.66015625"	"20318.13671875"	"20817.4453125"	"24220.478515625"	""	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"2"	"524.29511"	"0.0001873"	"0.002238"	"2.28"	"44.75"
"9460"	"[R].GVPHSASPVSPDGVHIPLKEYSGGR.[A]"	"1xBiotin [K19]"	"0.0130005"	"0.000586377"	"1"	"1"	"1"	"Q80WQ6"	"Q80WQ6 [289-313]"	"Q80WQ6 1xBiotin [K307]"	"Inactive rhomboid protein 2 [OS=Mus musculus]"	"1"	"2769.37771"	"0.59"	"0.34"	"0.38"	"-9.97"	"0.66"	"0.07"	"0.31"	"90.3"	"135.8"	"114.5"	"117.1"	""	"142.4"	"12525.216796875"	"18842.6796875"	"15880.185546875"	"16249.98828125"	""	"19751.4921875"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"High"	"4"	"693.09974"	"0.0001108"	"0.0009255"	"2.49"	"42.54"
"96"	"[K].AAKSPAK.[A]"	"1xBiotin [K3]"	"0.0477509"	"0.00154748"	"1"	"1"	"3"	"P43277"	"P43277 [186-192]"	"P43277 1xBiotin [K188]"	"Histone H1.3 [OS=Mus musculus]"	"1"	"898.48150"	"1.47"	"1.38"	"1.07"	"1.14"	"1.29"	"-0.18"	"-0.09"	"45.7"	"126.6"	"119.0"	"96.1"	"100.9"	"111.7"	"4016.86743164063"	"11137.783203125"	"10469.466796875"	"8450.85546875"	"8875.001953125"	"9822.91015625"	""	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"2"	"449.74441"	"0.0002716"	"0.006342"	"1.65"	"16.96"
"9288"	"[K].GSYVSIHSSGFR.[D]"	""	"0.0412212"	"0.00104877"	"1"	"2"	"4"	"Q9Z1N5"	"Q9Z1N5 [37-48]"	""	"spliceosome RNA helicase DDX39B [OS=Mus musculus]"	"0"	"1296.63312"	"0.67"	"-0.02"	"0.70"	"0.50"	"0.47"	"-0.19"	"0.49"	"75.0"	"119.0"	"74.1"	"121.9"	"105.8"	"104.2"	"27674.9760742188"	"43892.8505859375"	"27313.9487304688"	"44968.37890625"	"39004.2568359375"	"38439.1455078125"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"2"	"648.82057"	"0.0001873"	"0.005091"	"1.60"	"28.18"
"57"	"[K].AAFKELQSTFK.[-]"	"1xBiotin [K4]"	"0.013775"	"0.000586377"	"1"	"1"	"4"	"Q9D8Y0"	"Q9D8Y0 [230-240]"	"Q9D8Y0 1xBiotin [K233]"	"EF-hand domain-containing protein D2 [OS=Mus musculus]"	"1"	"1495.76136"	"0.16"	"0.33"	"-0.16"	"-0.42"	"0.08"	"-0.08"	"-0.25"	"98.7"	"110.5"	"124.0"	"88.5"	"73.8"	"104.5"	"8823.7744140625"	"9875.328125"	"11087.37109375"	"7908.61962890625"	"6600.9765625"	"9346.0302734375"	""	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"2"	"748.38343"	"0.0001108"	"0.001002"	"2.13"	"44.23"
"1806"	"[K].ATGPGKK.[A]"	"1xBiotin [K]"	"0.0359666"	"0.00104877"	"1"	"1"	"4"	"Q9CR57"	"Q9CR57 [168-174]"	"Q9CR57 1xBiotin [K]"	"60S ribosomal protein L14 [OS=Mus musculus]"	"1"	"884.46585"	"1.08"	"1.01"	"1.03"	"1.18"	"0.81"	"-0.27"	"-0.19"	"53.6"	"113.7"	"107.8"	"109.5"	"121.3"	"94.1"	"13797.27734375"	"29243.458984375"	"27720.158203125"	"28159.703125"	"31192.3515625"	"24215.75"	""	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"2"	"442.73649"	"0.0001873"	"0.004155"	"1.78"	"17.75"
"4776"	"[R].EEAWITVSKR.[H]"	"1xBiotin [K9]"	"0.00531779"	"0.000586377"	"1"	"1"	"3"	"Q8BKE6"	"Q8BKE6 [452-461]"	"Q8BKE6 1xBiotin [K460]"	"Cytochrome P450 20A1 [OS=Mus musculus]"	"1"	"1444.72531"	"-9.97"	"-9.97"	"-9.97"	"-0.32"	"0.31"	"9.97"	"9.97"	"197.0"	""	""	""	"158.0"	"245.0"	"10026.3291015625"	""	""	""	"8040.04541015625"	"12465.646484375"	""	"Peak Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"High"	"2"	"722.86583"	"0.0001108"	"0.0002502"	"2.46"	"43.39"
"1874"	"[K].ATYINLKPAR.[K]"	"1xBiotin [K7]"	"0.00715308"	"0.000586377"	"1"	"1"	"2"	"Q9CXX9"	"Q9CXX9 [270-279]"	"Q9CXX9 1xBiotin [K276]"	"CUE domain-containing protein 2 [OS=Mus musculus]"	"0"	"1372.74057"	"0.05"	"-0.17"	"-0.09"	"-0.35"	"-0.28"	"-0.33"	"-0.11"	"109.6"	"113.5"	"97.4"	"103.1"	"86.2"	"90.1"	"17912.4921875"	"18551.638671875"	"15924.1513671875"	"16859.5859375"	"14095.1181640625"	"14735.7333984375"	""	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"2"	"686.87393"	"0.0001108"	"0.0003835"	"2.18"	"40.71"
"1873"	"[R].ATWPLSPEKK.[V]"	"1xBiotin [K9]"	"0.0253774"	"0.00104877"	"1"	"1"	"2"	"Q91W34-1"	"Q91W34-1 [455-464]"	"Q91W34-1 1xBiotin [K463]"	"RUS1 family protein C16orf58 homolog [OS=Mus musculus]"	"1"	"1382.71368"	"-0.12"	"-0.09"	"0.07"	"-0.25"	"-0.02"	"0.10"	"0.06"	"104.6"	"96.3"	"98.5"	"109.7"	"87.9"	"103.0"	"18613.8984375"	"17127.359375"	"17525.498046875"	"19516.30859375"	"15646.1650390625"	"18319.77734375"	""	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"2"	"691.86076"	"0.0001873"	"0.002468"	"2.39"	"42.21"
"4906"	"[R].EELNQLK.[N]"	""	"0.0508036"	"0.00154748"	"1"	"1"	"1"	"Q2KN98"	"Q2KN98 [256-262]"	""	"Cytospin-A [OS=Mus musculus]"	"0"	"873.46762"	"1.54"	"0.67"	"-9.97"	"1.47"	"1.47"	"-0.07"	"0.81"	"54.3"	"158.2"	"86.2"	""	"150.3"	"151.0"	"37333.17578125"	"108672.6328125"	"59228.5"	""	"103277.3046875"	"103716.296875"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"High"	"2"	"437.23736"	"0.0002716"	"0.006916"	"2.03"	"27.25"
"1698"	"[K].ASMKIDLR.[I]"	"1xBiotin [K4]; 1xOxidation [M3]"	"0.0649837"	"0.0019826"	"1"	"1"	"1"	"P35969"	"P35969 [1267-1274]"	"P35969 1xBiotin [K1270]"	"Vascular endothelial growth factor receptor 1 [OS=Mus musculus]"	"1"	"1175.59113"	"-9.97"	"-9.97"	"-0.26"	"-1.48"	"-9.97"	""	""	"273.6"	""	""	"228.3"	"98.1"	""	"17489.205078125"	""	""	"14595.517578125"	"6273.2919921875"	""	""	"Peak Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Not Found"	"High"	"2"	"588.30002"	"0.0003442"	"0.01006"	"2.05"	"34.71"
"7397"	"[R].FPNVVKGEK.[I]"	"1xBiotin [K6]"	"0.0516681"	"0.00154748"	"1"	"1"	"2"	"Q9JHJ0"	"Q9JHJ0 [164-172]"	"Q9JHJ0 1xBiotin [K169]"	"tropomodulin-3 [OS=Mus musculus]"	"1"	"1243.65035"	"-9.97"	"0.62"	"-0.10"	"0.37"	"0.87"	"9.97"	"0.25"	"91.0"	""	"140.0"	"85.0"	"118.0"	"166.0"	"11476.05859375"	""	"17648.552734375"	"10722.67578125"	"14880.3095703125"	"20931.5390625"	""	"Peak Found"	"Not Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"2"	"622.32832"	"0.0002716"	"0.007092"	"2.30"	"37.36"
"7195"	"[K].FKYLGTQDR.[A]"	"1xBiotin [K2]"	"0.00473371"	"0.000586377"	"1"	"2"	"5"	"Q3UPF5-1"	"Q3UPF5-1 [294-302]"	"Q3UPF5-1 1xBiotin [K295]"	"zinc finger CCCH-type antiviral protein 1 [OS=Mus musculus]"	"1"	"1353.66198"	"0.26"	"0.22"	"0.52"	"-0.02"	"0.31"	"0.05"	"0.08"	"85.5"	"102.2"	"99.9"	"122.4"	"84.2"	"105.8"	"22431.271484375"	"26835.59375"	"26215.76171875"	"32134.3125"	"22104.943359375"	"27771.701171875"	""	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"677.33465"	"0.0001108"	"0.0002102"	"2.53"	"37.90"
"155"	"[K].AASGEAKPKAK.[RK]"	"1xBiotin [K9]"	"0.0189255"	"0.000586377"	"3"	"3"	"5"	"P43274; P43276; P43277"	"P43274 [111-121]; P43276 [111-121]; P43277 [112-122]"	"P43274 1xBiotin [K119]; P43276 1xBiotin [K119]; P43277 1xBiotin [K120]"	"Histone H1.4 [OS=Mus musculus];Histone H1.5 [OS=Mus musculus];Histone H1.3 [OS=Mus musculus]"	"1"	"1283.67763"	"0.33"	"0.87"	"0.32"	"1.47"	"0.34"	"0.01"	"-0.53"	"64.1"	"80.4"	"117.4"	"80.0"	"177.0"	"81.1"	"5483.98291015625"	"6882.16455078125"	"10045.9140625"	"6846.912109375"	"15151.8193359375"	"6939.60302734375"	"NotUnique"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"642.34257"	"0.0001108"	"0.001608"	"2.46"	"14.18"
"7405"	"[K].FPSAFFK.[G]"	""	"0.0565215"	"0.0019826"	"1"	"1"	"1"	"A2AF47"	"A2AF47 [1467-1473]"	""	"dedicator of cytokinesis protein 11 [OS=Mus musculus]"	"0"	"843.43995"	"0.95"	"0.76"	"0.79"	"0.61"	"0.69"	"-0.26"	"-0.06"	"63.1"	"122.0"	"106.8"	"109.3"	"96.6"	"102.2"	"4723.3212890625"	"9128.806640625"	"7986.93212890625"	"8180.26171875"	"7225.20458984375"	"7644.4853515625"	""	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"2"	"422.22293"	"0.0003442"	"0.008135"	"1.32"	"19.69"
"7210"	"[K].FIDTTSKFGHGR.[F]"	"1xBiotin [K7]"	"0.0161952"	"0.000586377"	"1"	"1"	"1"	"P27659"	"P27659 [367-378]"	"P27659 1xBiotin [K373]"	"60S ribosomal protein L3 [OS=Mus musculus]"	"1"	"1591.76857"	"-0.39"	"-0.83"	"1.50"	"-0.57"	"-0.43"	"-0.05"	"0.39"	"91.4"	"69.9"	"51.5"	"258.0"	"61.5"	"67.7"	"28512.533203125"	"21804.828125"	"16085.0048828125"	"80512.75"	"19191.56640625"	"21129.40234375"	""	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"3"	"531.26154"	"0.0001108"	"0.001279"	"2.85"	"37.26"
"1674"	"[K].ASKPKVTKPK.[T]"	"1xBiotin [K5]"	"0.0574787"	"0.0019826"	"1"	"1"	"2"	"P43276"	"P43276 [197-206]"	"P43276 1xBiotin [K201]"	"Histone H1.5 [OS=Mus musculus]"	"1"	"1309.76605"	"0.77"	"0.90"	"0.64"	"0.46"	"0.87"	"0.10"	"-0.02"	"64.3"	"110.0"	"119.7"	"99.9"	"88.5"	"117.6"	"9147.375"	"15642.0625"	"17018.302734375"	"14207.3388671875"	"12588.5791015625"	"16728.8359375"	""	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"3"	"437.26018"	"0.0003442"	"0.008307"	"1.98"	"15.13"
"7290"	"[K].FLSKTDKR.[L]"	"1xBiotin [K4]"	"0.120171"	"0.00731053"	"1"	"1"	"3"	"Q00651"	"Q00651 [886-893]"	"Q00651 1xBiotin [K889]"	"Integrin alpha-4 [OS=Mus musculus]"	"2"	"1220.64560"	"0.60"	"0.71"	"0.57"	"0.00"	"-0.02"	"-0.62"	"-0.73"	"78.7"	"119.2"	"128.9"	"116.8"	"78.7"	"77.7"	"10129.3798828125"	"15339.765625"	"16585.9921875"	"15026.3037109375"	"10120.654296875"	"9996.6494140625"	""	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"3"	"407.55325"	"0.001478"	"0.0256"	"1.68"	"28.59"
"77"	"[K].AAGQKAPAQK.[A]"	"1xBiotin [K5]"	"0.00176912"	"0.000586377"	"1"	"1"	"5"	"Q9CR57"	"Q9CR57 [175-184]"	"Q9CR57 1xBiotin [K179]"	"60S ribosomal protein L14 [OS=Mus musculus]"	"1"	"1195.62520"	"0.88"	"0.54"	"0.60"	"0.53"	"0.47"	"-0.42"	"-0.07"	"69.5"	"128.2"	"101.1"	"105.1"	"100.1"	"96.1"	"8880.2919921875"	"16383.166015625"	"12924.7099609375"	"13433.2861328125"	"12789.921875"	"12280.6962890625"	""	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"598.31636"	"0.0001108"	"5.005E-05"	"2.86"	"18.31"
"23732"	"[R].SKGQESFK.[K]"	"1xBiotin [K2]"	"0.0154637"	"0.000586377"	"1"	"1"	"6"	"Q61937"	"Q61937 [220-227]"	"Q61937 1xBiotin [K221]"	"Nucleophosmin [OS=Mus musculus]"	"1"	"1136.54047"	"0.46"	"0.46"	"0.32"	"0.45"	"-9.97"	"-9.97"	"-9.97"	"94.3"	"130.0"	"129.5"	"117.3"	"128.9"	""	"29476.357421875"	"40638.84375"	"40485.1796875"	"36682.640625"	"40317.6484375"	""	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"568.77334"	"0.0001108"	"0.001191"	"2.28"	"26.47"
"2994"	"[K].DDSELDFSALCPKISLTVAAK.[E]"	"1xBiotin [K13]; 1xCarbamidomethyl [C11]"	"1.69621E-05"	"0.000586377"	"1"	"4"	"7"	"Q8VE91-1"	"Q8VE91-1 [146-166]"	"Q8VE91-1 1xBiotin [K158]"	"Isoform 1 of Reticulophagy regulator 1 [OS=Mus musculus]"	"1"	"2506.22039"	"-0.37"	"-0.32"	"-9.97"	"-9.97"	"0.31"	"0.68"	"0.63"	"157.4"	"121.4"	"126.3"	""	""	"194.9"	"85934.4873046875"	"66303.4296875"	"68942.62890625"	""	""	"106450.0546875"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"836.07681"	"0.0001108"	"5.665E-08"	"4.49"	"59.58"
"24667"	"[K].STEVAKTFR.[K]"	"1xBiotin [K6]"	"0.00590462"	"0.000586377"	"1"	"1"	"7"	"Q61233"	"Q61233 [83-91]"	"Q61233 1xBiotin [K88]"	"Plastin-2 [OS=Mus musculus]"	"1"	"1264.63543"	"0.42"	"0.27"	"0.29"	"0.26"	"0.26"	"-0.16"	"-0.01"	"83.8"	"112.1"	"101.1"	"102.1"	"100.5"	"100.5"	"81093.1796875"	"108508.5078125"	"97851.5"	"98834.2890625"	"97286.9375"	"97240.3125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"632.82150"	"0.0001108"	"0.0002908"	"2.49"	"33.94"
"23729"	"[K].SKGIAYIEFK.[S]"	"1xBiotin [K2]"	"0.000619522"	"0.000586377"	"1"	"1"	"5"	"P09405"	"P09405 [430-439]"	"P09405 1xBiotin [K431]"	"Nucleolin [OS=Mus musculus]"	"1"	"1381.71843"	""	""	""	"9.97"	""	""	""	""	""	""	""	"600.0"	""	""	""	""	""	"8040.4052734375"	""	""	"High"	"High"	"High"	"High"	"High"	"Not Found"	"High"	"2"	"691.36272"	"0.0001108"	"1.078E-05"	"3.23"	"46.91"
"24660"	"[K].STCKNFLDTYSPSDK.[G]"	"1xBiotin [K4]; 1xCarbamidomethyl [C3]"	"3.684E-05"	"0.000586377"	"1"	"2"	"6"	"Q3U3D7-1"	"Q3U3D7-1 [930-944]"	"Q3U3D7-1 1xBiotin [K933]"	"Transmembrane protein 131-like [OS=Mus musculus]"	"1"	"1988.87284"	"0.41"	"0.36"	"0.44"	"-0.30"	"0.66"	"0.24"	"0.30"	"81.6"	"108.7"	"104.5"	"110.6"	"66.1"	"128.6"	"25278.1640625"	"33684.22265625"	"32372.927734375"	"34279.04296875"	"20477.626953125"	"39846.2265625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"994.94045"	"0.0001108"	"1.757E-07"	"4.19"	"43.32"
"23734"	"[K].SKHLQEQLNELK.[T]"	"1xBiotin [K2]"	"2.49249E-05"	"0.000586377"	"1"	"2"	"11"	"P46662-1"	"P46662-1 [532-543]"	"P46662-1 1xBiotin [K533]"	"merlin [OS=Mus musculus]"	"1"	"1692.87377"	"-0.37"	"0.18"	"0.26"	"-0.52"	"-0.42"	"-0.06"	"-0.60"	"108.1"	"83.9"	"122.2"	"129.6"	"75.6"	"80.6"	"91381.158203125"	"70911.28125"	"103316.310546875"	"109603.6796875"	"63924.4609375"	"68173.25"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"564.96262"	"0.0001108"	"9.885E-08"	"4.67"	"36.38"
"2897"	"[R].DCKGDTLGSDWGGAMWT.[-]"	"1xBiotin [K3]; 1xCarbamidomethyl [C2]; 1xOxidation [M15]"	"0.00897115"	"0.000586377"	"1"	"1"	"9"	"P01896"	"P01896 [169-185]"	"P01896 1xBiotin [K171]"	"H-2 class I histocompatibility antigen, alpha chain [OS=Mus musculus]"	"1"	"2098.83032"	"-0.23"	"0.19"	"-0.89"	"-2.87"	"-0.26"	"-0.03"	"-0.45"	"133.1"	"113.4"	"151.9"	"72.0"	"18.2"	"111.4"	"91649.87890625"	"78093.064453125"	"104612.390625"	"49594.314453125"	"12507.6665039063"	"76706.294921875"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"2"	"1049.91907"	"0.0001108"	"0.0005348"	"3.64"	"53.02"
"24568"	"[K].SSNMKHLSPAPQLGPSSDSHTSYYSESVVR.[E]"	"1xBiotin [K5]; 1xOxidation [M4]"	"3.12339E-07"	"0.000586377"	"1"	"3"	"7"	"Q8BJS4"	"Q8BJS4 [48-77]"	"Q8BJS4 1xBiotin [K52]"	"SUN domain-containing protein 2 [OS=Mus musculus]"	"1"	"3490.60019"	"-0.04"	"-0.20"	"-0.79"	"-9.97"	"0.09"	"0.14"	"0.30"	"133.8"	"129.8"	"116.3"	"77.3"	""	"142.8"	"80132.75"	"77707.9296875"	"69609.4140625"	"46288.88671875"	""	"85492.3828125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"4"	"873.40639"	"0.0001108"	"1.662E-10"	"6.14"	"37.48"
"24582"	"[K].SSPTVDKAQLK.[T]"	"1xBiotin [K7]"	"0.00421363"	"0.000586377"	"1"	"1"	"6"	"Q99LI2"	"Q99LI2 [497-507]"	"Q99LI2 1xBiotin [K503]"	"chloride channel CLIC-like protein 1 [OS=Mus musculus]"	"1"	"1399.72498"	"0.65"	"0.26"	"0.76"	"0.65"	"0.50"	"-0.16"	"0.24"	"71.0"	"111.8"	"85.1"	"120.3"	"111.6"	"100.2"	"50373.609375"	"79253.5625"	"60344.55859375"	"85299.984375"	"79140.0234375"	"71059.1953125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"700.36620"	"0.0001108"	"0.0001767"	"2.80"	"33.54"
"1911"	"[K].AVGKVIPELNGK.[L]"	"1xBiotin [K4]"	"0.000379615"	"0.000586377"	"1"	"1"	"7"	"P16858"	"P16858 [214-225]"	"P16858 1xBiotin [K217]"	"glyceraldehyde-3-phosphate dehydrogenase [OS=Mus musculus]"	"1"	"1450.80865"	"0.54"	"0.51"	"0.15"	"-0.09"	"0.54"	"0.00"	"0.04"	"81.3"	"118.3"	"115.5"	"90.3"	"76.3"	"118.4"	"27272.5859375"	"39675.62109375"	"38749.9765625"	"30283.203125"	"25605.76171875"	"39715.6796875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"725.90814"	"0.0001108"	"5.282E-06"	"3.51"	"42.63"
"23739"	"[R].SKINLQDLQGTCTK.[K]"	"1xBiotin [K2]; 1xCarbamidomethyl [C12]"	"0.000889291"	"0.000586377"	"1"	"1"	"4"	"Q01237"	"Q01237 [871-884]"	"Q01237 1xBiotin [K872]"	"3-hydroxy-3-methylglutaryl-coenzyme a reductase [OS=Mus musculus]"	"1"	"1831.90408"	""	""	"9.97"	""	""	""	""	""	""	""	"600.0"	""	""	""	""	""	"11868.521484375"	""	""	""	"High"	"High"	"Not Found"	"High"	"Not Found"	"High"	"High"	"2"	"916.45460"	"0.0001108"	"1.821E-05"	"2.60"	"42.39"
"23765"	"[K].SKPQDSDKLNSLSIPSVSK.[R]"	"1xBiotin [K8]"	"0.000981941"	"0.000586377"	"1"	"1"	"6"	"P49070"	"P49070 [63-81]"	"P49070 1xBiotin [K70]"	"calcium signal-modulating cyclophilin ligand [OS=Mus musculus]"	"1"	"2256.15402"	"0.49"	"0.25"	"0.27"	"-1.29"	"0.18"	"-0.32"	"-0.08"	"94.5"	"133.0"	"112.8"	"114.1"	"38.7"	"106.9"	"35313.4296875"	"49708.203125"	"42129.4921875"	"42640.609375"	"14444.6015625"	"39948.03125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"752.72310"	"0.0001108"	"2.116E-05"	"3.09"	"43.05"
"24629"	"[R].SSTLSQLPGDKSK.[A]"	"1xBiotin [K11]"	"0.00225965"	"0.000586377"	"1"	"6"	"6"	"Q58A65"	"Q58A65 [593-605]"	"Q58A65 1xBiotin [K603]"	"C-jun-amino-terminal kinase-interacting protein 4 [OS=Mus musculus]"	"1"	"1573.78903"	"0.18"	"-0.18"	"0.83"	"0.68"	"-9.97"	"-9.97"	"-9.97"	"93.8"	"106.0"	"83.0"	"166.5"	"150.6"	""	"18483.45703125"	"20879.607421875"	"16361.4052734375"	"32814.82421875"	"29677.177734375"	""	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"787.39835"	"0.0001108"	"7.119E-05"	"2.55"	"34.83"
"24606"	"[R].SSSLNSKPSSLR.[R]"	"1xBiotin [K7]"	"0.00020105"	"0.000586377"	"1"	"1"	"38"	"Q60664"	"Q60664 [345-356]"	"Q60664 1xBiotin [K351]"	"Lymphoid-restricted membrane protein [OS=Mus musculus]"	"0"	"1488.74750"	"0.26"	"0.09"	"0.11"	"0.41"	"0.49"	"0.23"	"0.39"	"84.9"	"101.7"	"90.7"	"91.3"	"112.5"	"119.0"	"2345402.27050781"	"2809737.59765625"	"2504630.37011719"	"2522535.87988281"	"3106890.4765625"	"3287660.41308594"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"744.87750"	"0.0001108"	"2.091E-06"	"2.24"	"33.11"
"2829"	"[R].DAKACVVHGSDLK.[D]"	"1xBiotin [K3]; 1xCarbamidomethyl [C5]"	"0.00544296"	"0.000586377"	"1"	"1"	"5"	"Q8VDN2"	"Q8VDN2 [659-671]"	"Q8VDN2 1xBiotin [K661]"	"Sodium/potassium-transporting ATPase subunit alpha-1 [OS=Mus musculus]"	"1"	"1625.77742"	""	"9.97"	""	"9.97"	""	""	"-9.97"	""	""	"318.3"	""	"281.7"	""	""	""	"14917.7470703125"	""	"13204.9072265625"	""	""	"High"	"Not Found"	"High"	"High"	"High"	"Not Found"	"High"	"3"	"542.59709"	"0.0001108"	"0.0002581"	"2.24"	"32.23"
"23726"	"[K].SKFLQLR.[K]"	"1xBiotin [K2]"	"0.0271851"	"0.00104877"	"1"	"1"	"6"	"P58681"	"P58681 [999-1005]"	"P58681 1xBiotin [K1000]"	"Toll-like receptor 7 [OS=Mus musculus]"	"1"	"1117.61866"	"0.79"	"0.48"	"-1.18"	"-0.74"	"0.42"	"-0.36"	"-0.05"	"92.3"	"159.5"	"128.6"	"40.6"	"55.2"	"123.8"	"25843.8828125"	"44656.79296875"	"36002.29296875"	"11371.1357421875"	"15450.7509765625"	"34678.1171875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"559.31292"	"0.0001873"	"0.002733"	"2.26"	"43.76"
"23740"	"[K].SKLNVLTLK.[K]"	"1xBiotin [K2]"	"0.00267554"	"0.000586377"	"1"	"2"	"6"	"Q3UBG2"	"Q3UBG2 [18-26]"	"Q3UBG2 1xBiotin [K19]"	"PTB-containing, cubilin and LRP1-interacting protein [OS=Mus musculus]"	"1"	"1241.72861"	"0.49"	"0.21"	"0.04"	"-0.36"	"0.56"	"0.07"	"0.35"	"87.6"	"123.4"	"101.4"	"90.1"	"68.4"	"129.1"	"42465.4375"	"59801.1015625"	"49150.796875"	"43652.69140625"	"33153.375"	"62575.55078125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"621.36788"	"0.0001108"	"9.12E-05"	"2.94"	"46.88"
"24581"	"[K].SSPTGFGIKSAVTGGK.[E]"	"1xBiotin [K9]"	"2.9837E-06"	"0.000586377"	"1"	"2"	"8"	"Q3UPF5-1"	"Q3UPF5-1 [489-504]"	"Q3UPF5-1 1xBiotin [K497]"	"zinc finger CCCH-type antiviral protein 1 [OS=Mus musculus]"	"1"	"1719.87343"	"0.24"	"0.24"	"-0.06"	"-0.53"	"0.08"	"-0.16"	"-0.16"	"98.9"	"116.7"	"116.6"	"94.6"	"68.7"	"104.4"	"114944.59375"	"135704.5625"	"135543.515625"	"110025.5703125"	"79881.3046875"	"121373.5546875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"860.44059"	"0.0001108"	"4.458E-09"	"4.47"	"44.27"
"24588"	"[R].SSQSASSLEVVVPGREPLELEVAVESLAR.[L]"	""	"0.00409277"	"0.000586377"	"1"	"2"	"2"	"Q61140-1"	"Q61140-1 [441-469]"	""	"Breast cancer anti-estrogen resistance protein 1 [OS=Mus musculus]"	"1"	"3038.60043"	"-9.97"	"-2.75"	"-9.97"	"-9.97"	"-9.97"	""	"-9.97"	"522.2"	""	"77.8"	""	""	""	"30211.92578125"	""	"4503.35791015625"	""	""	""	""	"High"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"3"	"1013.53860"	"0.0001108"	"0.0001705"	"4.28"	"59.10"
"2881"	"[R].DAVTYTEHAKR.[K]"	"1xBiotin [K10]"	"0.00283601"	"0.000586377"	"1"	"1"	"12"	"P62806"	"P62806 [69-79]"	"P62806 1xBiotin [K78]"	"histone H4 [OS=Mus musculus]"	"1"	"1516.72129"	"-0.36"	"0.18"	"0.05"	"0.06"	"-0.08"	"0.28"	"-0.26"	"101.0"	"78.6"	"114.7"	"104.7"	"105.2"	"95.8"	"66552.64453125"	"51791.8203125"	"75592.646484375"	"69020.564453125"	"69316.181640625"	"63098.453125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"758.86414"	"0.0001108"	"9.977E-05"	"2.61"	"29.06"
"24580"	"[R].SSPTDKHTLVK.[G]"	"1xBiotin [K6]"	"0.00180032"	"0.000586377"	"2"	"4"	"7"	"Q6Q477; G5E829"	"Q6Q477 [757-767]; G5E829 [768-778]"	"Q6Q477 1xBiotin [K762]; G5E829 1xBiotin [K773]"	"Plasma membrane calcium-transporting ATPase 4 [OS=Mus musculus];Plasma membrane calcium-transporting ATPase 1 [OS=Mus musculus]"	"1"	"1438.73588"	"0.07"	"0.13"	"0.38"	"0.34"	"0.28"	"0.21"	"0.15"	"86.6"	"91.2"	"94.7"	"112.4"	"109.5"	"105.4"	"107571.140625"	"113273.6328125"	"117638.751953125"	"139617.76171875"	"135977.66015625"	"130884.970703125"	"NotUnique"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"2"	"719.87171"	"0.0001108"	"5.128E-05"	"2.75"	"28.52"
"24672"	"[K].STGGKAPR.[K]"	"1xBiotin [K5]"	"0.0249442"	"0.00104877"	"1"	"4"	"11"	"P68433"	"P68433 [11-18]"	"P68433 1xBiotin [K15]"	"Histone H3.1 [OS=Mus musculus]"	"1"	"999.50402"	"0.76"	"0.47"	"0.41"	"0.09"	"0.51"	"-0.25"	"0.04"	"76.1"	"128.4"	"105.3"	"100.9"	"81.2"	"108.1"	"29492.8359375"	"49780.0703125"	"40811.09765625"	"39131.25390625"	"31468.826171875"	"41895.2109375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"500.25587"	"0.0001873"	"0.002412"	"1.76"	"18.63"
"23666"	"[R].SHSKPFSALTAKSGGSR.[Q]"	"1xBiotin [K12]"	"3.95104E-05"	"0.000586377"	"1"	"2"	"6"	"Q9WU40-1"	"Q9WU40-1 [296-312]"	"Q9WU40-1 1xBiotin [K307]"	"inner nuclear membrane protein Man1 [OS=Mus musculus]"	"1"	"1943.97560"	"0.97"	"0.40"	"1.10"	"0.58"	"0.92"	"-0.06"	"0.52"	"61.2"	"120.0"	"80.6"	"131.4"	"91.2"	"115.5"	"11531.7001953125"	"22617.126953125"	"15184.4658203125"	"24766.48046875"	"17190.880859375"	"21761.556640625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"648.66388"	"0.0001108"	"1.934E-07"	"4.01"	"32.61"
"1909"	"[R].AVFPSIVGRPR.[H]"	""	"0.00364297"	"0.000586377"	"1"	"6"	"17"	"P60710"	"P60710 [29-39]"	""	"Actin, cytoplasmic 1 [OS=Mus musculus]"	"0"	"1198.70550"	"0.38"	"-0.02"	"0.55"	"0.06"	"0.29"	"-0.09"	"0.32"	"85.5"	"111.5"	"84.1"	"124.8"	"89.3"	"104.7"	"167492.296875"	"218514.75"	"164860.265625"	"244634.640625"	"175020.65625"	"205175.4765625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"599.85635"	"0.0001108"	"0.0001436"	"2.05"	"34.70"
"23590"	"[K].SGTTKALQVEPLKK.[D]"	"1xBiotin [K5]"	"0.011919"	"0.000586377"	"1"	"1"	"1"	"Q8BHE0"	"Q8BHE0 [215-228]"	"Q8BHE0 1xBiotin [K219]"	"Proline-rich protein 11 [OS=Mus musculus]"	"2"	"1725.95677"	"-9.97"	"-9.97"	"-9.97"	"0.31"	"-9.97"	""	""	"268.3"	""	""	""	"331.7"	""	"8119.751953125"	""	""	""	"10036.7783203125"	""	""	"High"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"3"	"575.99054"	"0.0001108"	"0.0008156"	"3.37"	"35.06"
"3218"	"[K].DGEKSAIRV.[-]"	"1xBiotin [K4]"	"0.0414556"	"0.00104877"	"1"	"1"	"6"	"Q8BLX4"	"Q8BLX4 [355-363]"	"Q8BLX4 1xBiotin [K358]"	"GDP-fucose transporter 1 [OS=Mus musculus]"	"2"	"1200.60413"	"0.16"	"-0.04"	"0.34"	"0.27"	"0.10"	"-0.06"	"0.14"	"90.5"	"101.2"	"87.8"	"114.6"	"108.9"	"97.0"	"48696.84765625"	"54447.30859375"	"47257.875"	"61645.6328125"	"58568.69140625"	"52215.83203125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"600.80578"	"0.0001873"	"0.005103"	"2.62"	"37.10"
"23586"	"[R].SGTKLIFR.[R]"	"1xBiotin [K4]"	"0.013538"	"0.000586377"	"1"	"1"	"5"	"Q80X80"	"Q80X80 [642-649]"	"Q80X80 1xBiotin [K645]"	"Phospholipid transfer protein C2CD2L [OS=Mus musculus]"	"1"	"1147.62923"	"0.04"	"-0.34"	"-0.04"	"-0.39"	"0.34"	"0.30"	"0.68"	"103.1"	"106.0"	"81.6"	"100.2"	"78.7"	"130.4"	"18737.087890625"	"19263.84765625"	"14833.5126953125"	"18207.986328125"	"14305.23046875"	"23691.119140625"	""	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"2"	"574.31809"	"0.0001108"	"0.0009822"	"2.32"	"42.29"
"24771"	"[K].SVKLSSQLSEEK.[W]"	"1xBiotin [K3]"	"0.000157376"	"0.000586377"	"1"	"1"	"11"	"Q80WJ7"	"Q80WJ7 [289-300]"	"Q80WJ7 1xBiotin [K291]"	"protein LYRIC [OS=Mus musculus]"	"1"	"1560.79378"	"-0.07"	"0.23"	"0.26"	"-0.01"	"0.04"	"0.11"	"-0.19"	"94.7"	"90.1"	"110.8"	"113.5"	"93.8"	"97.1"	"183382.734375"	"174549.8125"	"214746.21875"	"219896.890625"	"181801.78125"	"188047.140625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"780.90043"	"0.0001108"	"1.453E-06"	"3.15"	"34.97"
"23583"	"[R].SGSSKALDK.[T]"	"1xBiotin [K5]"	"0.00593905"	"0.000586377"	"1"	"1"	"6"	"Q8K2C8"	"Q8K2C8 [98-106]"	"Q8K2C8 1xBiotin [K102]"	"glycerol-3-phosphate acyltransferase 4 [OS=Mus musculus]"	"1"	"1118.55103"	"0.56"	"0.13"	"0.25"	"0.17"	"0.63"	"0.07"	"0.50"	"80.7"	"118.9"	"88.2"	"96.3"	"90.9"	"125.0"	"42171.13671875"	"62130.9296875"	"46095.28125"	"50304.8984375"	"47501.6796875"	"65299.1640625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"559.77916"	"0.0001108"	"0.0002925"	"3.19"	"24.15"
"23579"	"[K].SGSKEQGPR.[Q]"	"1xBiotin [K4]"	"0.0301356"	"0.00104877"	"1"	"1"	"5"	"Q9WUQ2"	"Q9WUQ2 [108-116]"	"Q9WUQ2 1xBiotin [K111]"	"Prolactin regulatory element-binding protein [OS=Mus musculus]"	"1"	"1171.55243"	"0.63"	"0.74"	"0.42"	"0.40"	"0.45"	"-0.18"	"-0.30"	"72.8"	"112.5"	"121.9"	"97.4"	"96.1"	"99.3"	"6696.11474609375"	"10344.2705078125"	"11210.9755859375"	"8957.3134765625"	"8839.1630859375"	"9127.7734375"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"2"	"586.28015"	"0.0001873"	"0.003194"	"1.50"	"19.24"
"3264"	"[R].DGLCSKTVEYHR.[L]"	"1xBiotin [K6]; 1xCarbamidomethyl [C4]"	"0.00011689"	"0.000586377"	"1"	"1"	"15"	"Q8K201"	"Q8K201 [228-239]"	"Q8K201 1xBiotin [K233]"	"Keratinocyte-associated transmembrane protein 2 [OS=Mus musculus]"	"1"	"1690.76759"	"0.55"	"0.42"	"0.64"	"0.47"	"0.38"	"-0.17"	"-0.04"	"74.4"	"109.2"	"99.8"	"116.3"	"103.3"	"97.0"	"212264.6171875"	"311267.21484375"	"284613.3046875"	"331744.05859375"	"294589.85546875"	"276490.8203125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"564.26056"	"0.0001108"	"9.438E-07"	"3.37"	"33.71"
"23551"	"[R].SGMFWLR.[F]"	"1xOxidation [M3]"	"0.072202"	"0.00241047"	"1"	"1"	"7"	"Q9CZ13"	"Q9CZ13 [473-479]"	""	"Cytochrome b-c1 complex subunit 1, mitochondrial [OS=Mus musculus]"	"0"	"912.43963"	"0.31"	"-0.06"	"0.38"	"-0.41"	"0.48"	"0.17"	"0.54"	"90.3"	"111.7"	"86.5"	"117.7"	"68.1"	"125.6"	"39022.88671875"	"48239.65234375"	"37347.5546875"	"50836.65234375"	"29434.48828125"	"54266.6484375"	""	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"2"	"456.72320"	"0.000415"	"0.01178"	"1.76"	"38.70"
"3309"	"[K].DGTEAMLVLK.[-]"	"1xBiotin [K10]"	"0.0081281"	"0.000586377"	"1"	"1"	"8"	"Q8K358"	"Q8K358 [425-434]"	"Q8K358 1xBiotin [K434]"	"Phosphatidylinositol glycan anchor biosynthesis class U protein [OS=Mus musculus]"	"0"	"1302.64322"	"0.76"	"0.32"	"0.55"	"1.53"	"0.39"	"-0.37"	"0.07"	"62.4"	"105.8"	"77.9"	"91.6"	"180.7"	"81.6"	"36182.09375"	"61328.73046875"	"45167.19921875"	"53095.43359375"	"104763.0546875"	"47336.19921875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"651.82508"	"0.0001108"	"0.0004621"	"2.13"	"54.06"
"3310"	"[K].DGTEAMLVLK.[-]"	"1xBiotin [K10]; 1xOxidation [M6]"	"0.0117136"	"0.000586377"	"1"	"1"	"9"	"Q8K358"	"Q8K358 [425-434]"	"Q8K358 1xBiotin [K434]"	"Phosphatidylinositol glycan anchor biosynthesis class U protein [OS=Mus musculus]"	"0"	"1318.63814"	"0.14"	"0.12"	"0.38"	"-0.31"	"0.16"	"0.02"	"0.04"	"93.5"	"103.0"	"101.7"	"121.7"	"75.4"	"104.8"	"92179.9736328125"	"101521.41796875"	"100212.4609375"	"119965.850585938"	"74358.8374023438"	"103273.961914063"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"659.82270"	"0.0001108"	"0.0007923"	"2.24"	"47.46"
"23548"	"[R].SGMFSHALDMKSGPLPPGGWDDSR.[R]"	"1xBiotin [K11]; 2xOxidation [M3; M10]"	"1.6571E-05"	"0.000586377"	"1"	"1"	"24"	"Q99J27"	"Q99J27 [16-39]"	"Q99J27 1xBiotin [K26]"	"Acetyl-coenzyme A transporter 1 [OS=Mus musculus]"	"1"	"2803.22728"	"-0.22"	"-0.70"	"-2.11"	"-5.15"	"-0.48"	"-0.26"	"0.23"	"173.8"	"149.2"	"106.9"	"40.3"	"4.9"	"125.0"	"107371.100097656"	"92194.6206054688"	"66024.6391601563"	"24909.5703125"	"3013.83764648438"	"77206.595703125"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"3"	"935.08093"	"0.0001108"	"5.473E-08"	"4.70"	"43.81"
"23547"	"[R].SGMFSHALDMKSGPLPPGGWDDSR.[R]"	"1xBiotin [K11]; 1xOxidation [M]"	"0.00158368"	"0.000586377"	"1"	"1"	"12"	"Q99J27"	"Q99J27 [16-39]"	"Q99J27 1xBiotin [K26]"	"Acetyl-coenzyme A transporter 1 [OS=Mus musculus]"	"1"	"2787.23237"	"0.07"	"0.36"	"-9.97"	"-9.97"	"0.53"	"0.46"	"0.17"	"125.6"	"131.9"	"161.1"	""	""	"181.4"	"29075.0434570313"	"30545.876953125"	"37291.7958984375"	""	""	"42010.41015625"	""	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"929.74941"	"0.0001108"	"4.237E-05"	"3.39"	"47.78"
"23538"	"[R].SGLLDKWK.[I]"	"1xBiotin [K6]"	"0.0103713"	"0.000586377"	"1"	"1"	"6"	"Q9CYN2"	"Q9CYN2 [33-40]"	"Q9CYN2 1xBiotin [K38]"	"Signal peptidase complex subunit 2 [OS=Mus musculus]"	"1"	"1172.61324"	"0.52"	"0.59"	"0.15"	"-0.37"	"0.38"	"-0.14"	"-0.21"	"84.2"	"121.1"	"126.8"	"93.2"	"65.1"	"109.6"	"36465.84375"	"52451.37109375"	"54913.99609375"	"40376.109375"	"28218.109375"	"47501.67578125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"586.81017"	"0.0001108"	"0.0006636"	"2.43"	"48.81"
"23535"	"[R].SGKYDLDFK.[S]"	"1xBiotin [K3]"	"0.00269117"	"0.000586377"	"1"	"1"	"6"	"P17182"	"P17182 [254-262]"	"P17182 1xBiotin [K256]"	"alpha-enolase [OS=Mus musculus]"	"1"	"1298.60855"	"0.21"	"0.09"	"-0.07"	"0.10"	"0.04"	"-0.17"	"-0.05"	"95.7"	"111.0"	"101.7"	"90.9"	"102.3"	"98.4"	"36192.4453125"	"41975.60546875"	"38470.3828125"	"34370.3203125"	"38664.11328125"	"37195.44921875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"649.80777"	"0.0001108"	"9.222E-05"	"2.90"	"42.48"
"3358"	"[K].DHTQVVSLKDK.[L]"	"1xBiotin [K]"	"0.000931749"	"0.000586377"	"1"	"1"	"8"	"Q78RX3"	"Q78RX3 [65-75]"	"Q78RX3 1xBiotin [K]"	"small integral membrane protein 12 [OS=Mus musculus]"	"1"	"1495.75734"	"0.51"	"0.50"	"0.61"	"1.59"	"0.41"	"-0.10"	"-0.09"	"61.8"	"88.2"	"87.2"	"94.4"	"186.2"	"82.1"	"69115.5908203125"	"98639.5859375"	"97455.732421875"	"105550.383789063"	"208144.55078125"	"91820.4716796875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"748.38214"	"0.0001108"	"1.962E-05"	"3.29"	"32.60"
"23598"	"[R].SGVSLAALKK.[AS]"	"1xBiotin [K]"	"0.000720928"	"0.000586377"	"4"	"4"	"6"	"P43274; P43275; P15864; P43277"	"P43274 [55-64]; P43275 [57-66]; P15864 [55-64]; P43277 [56-65]"	"P43274 1xBiotin [K]; P43275 1xBiotin [K]; P15864 1xBiotin [K]; P43277 1xBiotin [K]"	"Histone H1.4 [OS=Mus musculus];Histone H1.1 [OS=Mus musculus];Histone H1.2 [OS=Mus musculus];Histone H1.3 [OS=Mus musculus]"	"1"	"1199.68165"	"0.34"	"0.14"	"0.08"	"0.30"	"0.15"	"-0.19"	"0.01"	"88.9"	"112.1"	"97.8"	"93.6"	"109.3"	"98.3"	"92341.703125"	"116480.7421875"	"101605.203125"	"97282.625"	"113519.6796875"	"102158.6171875"	"NotUnique"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"600.34448"	"0.0001108"	"1.342E-05"	"3.51"	"42.84"
"23720"	"[K].SKFADLSEAANR.[N]"	"1xBiotin [K2]"	"0.000286937"	"0.000586377"	"1"	"1"	"5"	"P20152"	"P20152 [293-304]"	"P20152 1xBiotin [K294]"	"Vimentin [OS=Mus musculus]"	"1"	"1534.73185"	"0.99"	"0.74"	"0.56"	"0.58"	"1.05"	"0.06"	"0.31"	"61.9"	"123.0"	"103.4"	"91.0"	"92.2"	"128.5"	"10919.3515625"	"21712.94140625"	"18254.0859375"	"16059.771484375"	"16276.3544921875"	"22684.759765625"	""	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"2"	"767.86946"	"0.0001108"	"3.51E-06"	"2.97"	"41.79"
"23624"	"[K].SHKDDSELDFSALCPKISLTVAAK.[E]"	"1xBiotin [K16]; 1xCarbamidomethyl [C14]"	"5.09761E-07"	"0.000586377"	"1"	"4"	"18"	"Q8VE91-1"	"Q8VE91-1 [143-166]"	"Q8VE91-1 1xBiotin [K158]"	"Isoform 1 of Reticulophagy regulator 1 [OS=Mus musculus]"	"2"	"2858.40629"	"0.18"	"0.14"	"-4.24"	"-9.97"	"0.55"	"0.37"	"0.41"	"126.3"	"143.0"	"139.4"	"6.7"	""	"184.6"	"820409.103027344"	"929110.889648438"	"905226.947265625"	"43544.61328125"	""	"1199280.72851563"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"953.47359"	"0.0001108"	"3.387E-10"	"5.22"	"53.16"
"24738"	"[K].SVAKTQDPQTAGR.[I]"	"1xBiotin [K4]"	"0.000362314"	"0.000586377"	"1"	"2"	"7"	"Q3UPF5-1"	"Q3UPF5-1 [431-443]"	"Q3UPF5-1 1xBiotin [K434]"	"zinc finger CCCH-type antiviral protein 1 [OS=Mus musculus]"	"1"	"1584.77987"	"0.31"	"0.06"	"0.23"	"0.21"	"0.23"	"-0.09"	"0.17"	"88.4"	"109.8"	"92.0"	"103.8"	"102.5"	"103.4"	"33559.15625"	"41672.171875"	"34907.42578125"	"39400.07421875"	"38913.9375"	"39253.9296875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"792.89415"	"0.0001108"	"4.918E-06"	"3.00"	"24.62"
"23719"	"[K].SKEYFSK.[Q]"	"1xBiotin [K2]"	"0.0351565"	"0.00104877"	"1"	"1"	"3"	"P35700"	"P35700 [191-197]"	"P35700 1xBiotin [K192]"	"peroxiredoxin-1 [OS=Mus musculus]"	"1"	"1114.52376"	"0.62"	"0.18"	"0.38"	"0.16"	"0.59"	"-0.04"	"0.41"	"79.1"	"121.7"	"89.4"	"102.9"	"88.2"	"118.7"	"31069.12890625"	"47832.1484375"	"35146.74609375"	"40418.03125"	"34666.63671875"	"46652.6171875"	""	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"2"	"557.76541"	"0.0001873"	"0.004005"	"2.46"	"32.55"
"24724"	"[R].STTKVGNIEIK.[D]"	"1xBiotin [K4]"	"0.000942677"	"0.000586377"	"1"	"1"	"6"	"P61161"	"P61161 [43-53]"	"P61161 1xBiotin [K46]"	"Actin-related protein 2 [OS=Mus musculus]"	"1"	"1415.75628"	"-0.06"	"0.09"	"0.07"	"0.22"	"0.55"	"0.62"	"0.46"	"89.4"	"85.7"	"95.4"	"94.2"	"103.9"	"131.3"	"42065.6796875"	"40328.4375"	"44903.05859375"	"44308.74609375"	"48911.6171875"	"61801.09375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"708.38239"	"0.0001108"	"1.99E-05"	"3.23"	"38.30"
"24728"	"[K].STVGTTKPPAESVYTSLQR.[R]"	"1xBiotin [K7]"	"1.51831E-05"	"0.000586377"	"1"	"3"	"15"	"Q8R4V1"	"Q8R4V1 [202-220]"	"Q8R4V1 1xBiotin [K208]"	"NFAT activation molecule 1 [OS=Mus musculus]"	"0"	"2248.12781"	"0.12"	"-0.08"	"-0.17"	"-0.55"	"0.12"	"0.01"	"0.20"	"105.4"	"114.2"	"99.8"	"93.9"	"71.9"	"114.7"	"136900.9765625"	"148321.10546875"	"129636.04296875"	"121891.96875"	"93393.171875"	"148911.66796875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"750.04789"	"0.0001108"	"4.793E-08"	"4.76"	"42.33"
"24730"	"[K].STWVILHHKVYDLTK.[F]"	"1xBiotin [K9]"	"0.000725144"	"0.000586377"	"1"	"1"	"8"	"P56395"	"P56395 [25-39]"	"P56395 1xBiotin [K33]"	"Cytochrome b5 [OS=Mus musculus]"	"1"	"2066.08918"	"0.56"	"0.64"	"-9.97"	"-9.97"	"0.38"	"-0.18"	"-0.26"	"112.6"	"165.7"	"175.3"	""	""	"146.4"	"147517.8515625"	"217044.9375"	"229586.294921875"	""	""	"191738.65625"	""	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"689.36736"	"0.0001108"	"1.353E-05"	"4.35"	"47.50"
"23707"	"[K].SKDVNGPEPLNSR.[S]"	"1xBiotin [K2]"	"7.59214E-05"	"0.000586377"	"1"	"1"	"16"	"P61022"	"P61022 [99-111]"	"P61022 1xBiotin [K100]"	"Calcineurin B homologous protein 1 [OS=Mus musculus]"	"1"	"1638.79043"	"0.63"	"0.33"	"0.24"	"0.36"	"0.58"	"-0.04"	"0.25"	"77.3"	"119.2"	"97.1"	"91.4"	"99.2"	"115.8"	"256442.6640625"	"395715.24609375"	"322202.9765625"	"303454.76953125"	"329345.5390625"	"384413.91796875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"819.89926"	"0.0001108"	"5.03E-07"	"4.17"	"32.32"
"23688"	"[K].SHYADVDPENQNFLLESNLGKK.[K]"	"1xBiotin [K22]"	"1.29712E-05"	"0.000586377"	"1"	"1"	"5"	"Q8CFE6"	"Q8CFE6 [39-60]"	"Q8CFE6 1xBiotin [K60]"	"sodium-coupled neutral amino acid transporter 2 [OS=Mus musculus]"	"1"	"2744.29845"	"0.15"	"-0.15"	"-1.11"	"-9.97"	"0.02"	"-0.14"	"0.16"	"133.7"	"148.5"	"120.7"	"61.9"	""	"135.2"	"133295.5625"	"148028.234375"	"120278.8359375"	"61649.8828125"	""	"134762.921875"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"915.43791"	"0.0001108"	"3.801E-08"	"6.24"	"46.26"
"23766"	"[K].SKPQDSDKLNSLSIPSVSKR.[V]"	"1xBiotin [K19]"	"1.27462E-05"	"0.000586377"	"1"	"1"	"14"	"P49070"	"P49070 [63-82]"	"P49070 1xBiotin [K81]"	"calcium signal-modulating cyclophilin ligand [OS=Mus musculus]"	"2"	"2412.25513"	"0.52"	"0.30"	"0.44"	"-1.06"	"0.47"	"-0.05"	"0.18"	"87.1"	"125.3"	"107.0"	"118.0"	"41.8"	"120.8"	"95928.880859375"	"138004.36328125"	"117802.80078125"	"129963.203125"	"45990.78515625"	"133017.39453125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"804.75692"	"0.0001108"	"3.706E-08"	"4.92"	"39.01"
"3006"	"[K].DEAHVSDEFSKSR.[S]"	"1xBiotin [K11]"	"0.000130586"	"0.000586377"	"1"	"2"	"11"	"Q99P72-2"	"Q99P72-2 [900-912]"	"Q99P72-2 1xBiotin [K910]"	"Reticulon-4 [OS=Mus musculus]"	"1"	"1732.75952"	"1.02"	"0.40"	"0.99"	"1.48"	"0.54"	"-0.48"	"0.14"	"56.7"	"115.2"	"74.7"	"112.5"	"158.4"	"82.5"	"27965.333984375"	"56774.95703125"	"36849.4453125"	"55476.771484375"	"78071.416015625"	"40650.85546875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"866.88353"	"0.0001108"	"1.106E-06"	"2.81"	"33.12"
"23648"	"[R].SHPSLEPQAKGPCVIAPVR.[A]"	"1xBiotin [K10]; 1xCarbamidomethyl [C13]"	"7.53448E-07"	"0.000586377"	"1"	"1"	"7"	"Q8BH02"	"Q8BH02 [4-22]"	"Q8BH02 1xBiotin [K13]"	"Torsin-4A [OS=Mus musculus]"	"1"	"2269.15800"	"0.42"	"0.24"	"0.21"	"-0.41"	"0.19"	"-0.23"	"-0.05"	"91.3"	"122.3"	"107.8"	"105.7"	"68.5"	"104.5"	"174842.6875"	"234274.453125"	"206517.5625"	"202450.984375"	"131291.890625"	"200109.625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"757.05772"	"0.0001108"	"5.994E-10"	"6.49"	"39.26"
"1888"	"[K].AVATPAKK.[N]"	"1xBiotin [K7]"	"0.126686"	"0.00949852"	"1"	"1"	"3"	"P09405"	"P09405 [89-96]"	"P09405 1xBiotin [K95]"	"Nucleolin [OS=Mus musculus]"	"1"	"1011.56556"	"0.53"	"0.28"	"-0.01"	"0.40"	"0.16"	"-0.37"	"-0.13"	"84.6"	"122.3"	"103.0"	"83.8"	"112.0"	"94.3"	"27711.712890625"	"40058.1015625"	"33734.15234375"	"27450.806640625"	"36691.80078125"	"30900.482421875"	""	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"2"	"506.28638"	"0.001921"	"0.02768"	"1.82"	"23.79"
"1876"	"[K].AVAASKER.[S]"	"1xBiotin [K6]"	"0.0208727"	"0.00104877"	"3"	"3"	"8"	"P43274; P15864; P43277"	"P43274 [47-54]; P15864 [47-54]; P43277 [48-55]"	"P43274 1xBiotin [K52]; P15864 1xBiotin [K52]; P43277 1xBiotin [K53]"	"Histone H1.4 [OS=Mus musculus];Histone H1.2 [OS=Mus musculus];Histone H1.3 [OS=Mus musculus]"	"1"	"1057.54589"	"0.70"	"0.59"	"0.35"	"0.68"	"0.76"	"0.06"	"0.17"	"69.0"	"112.0"	"103.5"	"88.1"	"110.8"	"116.6"	"71273.6484375"	"115730.3515625"	"106919.9921875"	"90991.3671875"	"114464.7578125"	"120469.5390625"	"NotUnique"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"529.27641"	"0.0001873"	"0.001846"	"2.46"	"21.47"
"23644"	"[K].SHNIVQKTALNWR.[L]"	"1xBiotin [K7]"	"1.71611E-05"	"0.000586377"	"1"	"8"	"12"	"P11881-1"	"P11881-1 [1565-1577]"	"P11881-1 1xBiotin [K1571]"	"Inositol 1,4,5-trisphosphate receptor type 1 [OS=Mus musculus]"	"1"	"1792.92753"	"0.90"	"0.43"	"-0.12"	"-2.54"	"0.60"	"-0.30"	"0.17"	"88.1"	"163.9"	"118.7"	"80.9"	"15.2"	"133.3"	"74120.453125"	"137907.384765625"	"99828.7265625"	"68067.1875"	"12749.1337890625"	"112114.8125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"896.96745"	"0.0001108"	"5.757E-08"	"4.45"	"42.02"
"3132"	"[R].DETGACGKTDAIFR.[A]"	"1xBiotin [K8]; 1xCarbamidomethyl [C6]"	"3.88251E-05"	"0.000586377"	"1"	"3"	"10"	"A2AJ88"	"A2AJ88 [462-475]"	"A2AJ88 1xBiotin [K469]"	"Patatin-like phospholipase domain-containing protein 7 [OS=Mus musculus]"	"1"	"1766.78363"	"0.65"	"0.24"	"0.48"	"0.84"	"0.64"	"-0.01"	"0.40"	"70.7"	"110.8"	"83.4"	"98.3"	"126.5"	"110.2"	"49777.87890625"	"78005.0668945313"	"58703.0390625"	"69203.015625"	"89062.0673828125"	"77565.0576171875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"883.89554"	"0.0001108"	"1.885E-07"	"3.84"	"42.69"
"23627"	"[K].SHKPLMLSQLPDNR.[I]"	"1xBiotin [K3]; 1xOxidation [M6]"	"0.000156461"	"0.000586377"	"1"	"1"	"7"	"O35963"	"O35963 [201-214]"	"O35963 1xBiotin [K203]"	"Ras-related protein Rab-33B [OS=Mus musculus]"	"0"	"1877.93605"	"0.59"	"0.46"	"0.71"	"-0.81"	"0.93"	"0.34"	"0.48"	"75.1"	"113.2"	"103.1"	"122.4"	"42.7"	"143.4"	"62262.1484375"	"93871.8828125"	"85504.03125"	"101511.2265625"	"35423.40234375"	"118925.5703125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"626.65013"	"0.0001108"	"1.443E-06"	"4.79"	"38.12"
"3217"	"[K].DGEKSAIR.[V]"	"1xBiotin [K4]"	"0.00984384"	"0.000586377"	"1"	"1"	"15"	"Q8BLX4"	"Q8BLX4 [355-362]"	"Q8BLX4 1xBiotin [K358]"	"GDP-fucose transporter 1 [OS=Mus musculus]"	"1"	"1101.53572"	"0.66"	"0.14"	"-0.02"	"0.44"	"0.26"	"-0.40"	"0.12"	"83.0"	"131.1"	"91.6"	"82.0"	"112.7"	"99.7"	"272415.302734375"	"430260.04296875"	"300599.61328125"	"269129.310546875"	"369819.98046875"	"327115.8984375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"551.27161"	"0.0001108"	"0.0006147"	"2.69"	"27.43"
"24740"	"[R].SVAPKPISGLSNPLFYTR.[D]"	"1xBiotin [K5]"	"3.55414E-06"	"0.000586377"	"1"	"1"	"12"	"Q05910"	"Q05910 [694-711]"	"Q05910 1xBiotin [K698]"	"Disintegrin and metalloproteinase domain-containing protein 8 [OS=Mus musculus]"	"0"	"2173.14742"	"0.16"	"-0.02"	"-0.95"	"-5.60"	"0.37"	"0.21"	"0.38"	"121.7"	"135.7"	"120.1"	"63.2"	"2.5"	"156.8"	"95989.5703125"	"107077.39453125"	"94775.91015625"	"49824.630859375"	"1984.9912109375"	"123695.625"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"3"	"725.05401"	"0.0001108"	"5.791E-09"	"4.31"	"54.25"
"24567"	"[K].SSNMKHLSPAPQLGPSSDSHTSYYSESVVR.[E]"	"1xBiotin [K5]"	"0.0954486"	"0.00379267"	"1"	"3"	"1"	"Q8BJS4"	"Q8BJS4 [48-77]"	"Q8BJS4 1xBiotin [K52]"	"SUN domain-containing protein 2 [OS=Mus musculus]"	"1"	"3474.60528"	"-9.97"	"-9.97"	"-9.97"	"-9.97"	"-9.97"	""	""	"600.0"	""	""	""	""	""	"54229.93359375"	""	""	""	""	""	""	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"4"	"869.40770"	"0.0008081"	"0.01789"	"2.55"	"39.92"
"23786"	"[R].SKTFPACDGSHNK.[H]"	"1xBiotin [K2]; 1xCarbamidomethyl [C7]"	"2.01869E-06"	"0.000586377"	"1"	"1"	"116"	"Q9CQB5"	"Q9CQB5 [104-116]"	"Q9CQB5 1xBiotin [K105]"	"CDGSH iron-sulfur domain-containing protein 2 [OS=Mus musculus]"	"1"	"1674.73629"	"0.45"	"0.25"	"0.25"	"0.25"	"0.43"	"-0.02"	"0.18"	"82.3"	"112.5"	"97.9"	"98.1"	"98.2"	"110.9"	"2310490.5078125"	"3159113.19921875"	"2749046.74609375"	"2752927.25"	"2756906.8046875"	"3112712.140625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"558.91700"	"0.0001108"	"2.526E-09"	"3.94"	"28.06"
"2790"	"[K].DAASNEIPTLTKK.[E]"	"1xBiotin [K12]"	"0.000272267"	"0.000586377"	"1"	"2"	"9"	"Q99P72-2"	"Q99P72-2 [789-801]"	"Q99P72-2 1xBiotin [K800]"	"Reticulon-4 [OS=Mus musculus]"	"1"	"1613.82033"	"0.45"	"0.29"	"0.40"	"0.53"	"0.23"	"-0.23"	"-0.07"	"79.7"	"109.0"	"97.7"	"105.5"	"114.7"	"93.2"	"39905.0859375"	"54577.015625"	"48920.30078125"	"52802.69140625"	"57427.87890625"	"46670.92578125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"807.41435"	"0.0001108"	"3.234E-06"	"4.17"	"40.39"
"2360"	"[R].CHPGFIMKGASSVHCQSLNK.[W]"	"1xBiotin [K8]; 2xCarbamidomethyl [C1; C15]; 1xOxidation [M7]"	"0.0243779"	"0.00104877"	"1"	"2"	"1"	"Q64735-1"	"Q64735-1 [309-328]"	"Q64735-1 1xBiotin [K316]"	"Complement component receptor 1-like protein [OS=Mus musculus]"	"1"	"2500.13524"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"4"	"625.78894"	"0.0001873"	"0.002331"	"2.44"	""
"24359"	"[K].SQHNAPKVK.[S]"	"1xBiotin [K]"	"0.0148506"	"0.000586377"	"1"	"1"	"10"	"O88455"	"O88455 [5-13]"	"O88455 1xBiotin [K]"	"7-dehydrocholesterol reductase [OS=Mus musculus]"	"1"	"1234.63610"	"0.60"	"0.28"	"0.45"	"1.12"	"0.46"	"-0.13"	"0.18"	"69.4"	"105.0"	"84.3"	"94.6"	"151.0"	"95.7"	"11446.8857421875"	"17306.0703125"	"13895.61328125"	"15596.400390625"	"24900.94921875"	"15771.6884765625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"617.82168"	"0.0001108"	"0.001126"	"2.39"	"17.30"
"24369"	"[R].SQLDLFDDVGTFASGPPKYK.[D]"	"1xBiotin [K18]"	"0.00193072"	"0.000586377"	"1"	"2"	"4"	"Q99K28"	"Q99K28 [339-358]"	"Q99K28 1xBiotin [K356]"	"ADP-ribosylation factor GTPase-activating protein 2 [OS=Mus musculus]"	"1"	"2411.15877"	""	"9.97"	""	""	""	""	"-9.97"	""	""	"600.0"	""	""	""	""	""	"10269.7939453125"	""	""	""	""	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"804.39132"	"0.0001108"	"5.651E-05"	"3.35"	"57.08"
"24045"	"[K].SLVSKGTLVQTK.[G]"	"1xBiotin [K5]"	"0.000814826"	"0.000586377"	"3"	"3"	"7"	"P43274; P43276; P43277"	"P43274 [86-97]; P43276 [86-97]; P43277 [87-98]"	"P43274 1xBiotin [K90]; P43276 1xBiotin [K90]; P43277 1xBiotin [K91]"	"Histone H1.4 [OS=Mus musculus];Histone H1.5 [OS=Mus musculus];Histone H1.3 [OS=Mus musculus]"	"1"	"1486.82978"	"0.37"	"0.14"	"0.16"	"0.32"	"0.15"	"-0.22"	"0.00"	"87.3"	"112.9"	"96.4"	"97.7"	"109.1"	"96.7"	"112484.5546875"	"145449.5625"	"124260.34375"	"125854.7890625"	"140609.09375"	"124584.234375"	"NotUnique"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"2"	"743.91877"	"0.0001108"	"1.604E-05"	"3.47"	"40.50"
"24372"	"[R].SQLHQLPKNPLSELPVVK.[C]"	"1xBiotin [K8]"	"0.00143429"	"0.000586377"	"1"	"2"	"4"	"Q924X6"	"Q924X6 [965-982]"	"Q924X6 1xBiotin [K972]"	"Low-density lipoprotein receptor-related protein 8 [OS=Mus musculus]"	"1"	"2253.24238"	"0.96"	"-9.97"	"-9.97"	"-9.97"	"0.76"	"-0.20"	"9.97"	"129.4"	"251.4"	""	""	""	"219.2"	"12225.5849609375"	"23750.4921875"	""	""	""	"20711.822265625"	""	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"751.75311"	"0.0001108"	"3.682E-05"	"3.53"	"50.01"
"24044"	"[K].SLVSKGILVQTK.[G]"	"1xBiotin [K5]"	"0.00102882"	"0.000586377"	"1"	"1"	"5"	"P15864"	"P15864 [86-97]"	"P15864 1xBiotin [K90]"	"Histone H1.2 [OS=Mus musculus]"	"1"	"1498.86616"	"1.03"	"0.60"	"0.69"	"-0.15"	"0.94"	"-0.10"	"0.33"	"66.7"	"136.6"	"101.4"	"107.7"	"60.0"	"127.6"	"12740.3369140625"	"26077.58203125"	"19368.4453125"	"20556.98046875"	"11456.20703125"	"24364.611328125"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"2"	"749.93658"	"0.0001108"	"2.255E-05"	"3.52"	"45.25"
"24026"	"[R].SLTNSHLEKR.[K]"	"1xBiotin [K9]"	"0.0104922"	"0.000586377"	"1"	"3"	"6"	"Q8K2P7"	"Q8K2P7 [52-61]"	"Q8K2P7 1xBiotin [K60]"	"Sodium-coupled neutral amino acid transporter 1 [OS=Mus musculus]"	"1"	"1410.71581"	"0.27"	"-0.21"	"-0.28"	"0.45"	"0.28"	"0.01"	"0.49"	"92.6"	"112.0"	"80.2"	"76.2"	"126.5"	"112.6"	"21785.3510742188"	"26353.2875976563"	"18860.7094726563"	"17924.740234375"	"29758.1416015625"	"26507.6044921875"	""	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"2"	"705.86156"	"0.0001108"	"0.0006729"	"2.34"	"27.86"
"24379"	"[K].SQLYTVKYK.[D]"	"1xBiotin [K7]"	"0.018282"	"0.000586377"	"1"	"1"	"5"	"Q3U9G9"	"Q3U9G9 [34-42]"	"Q3U9G9 1xBiotin [K40]"	"Lamin-B receptor [OS=Mus musculus]"	"1"	"1355.70278"	"0.49"	"0.37"	"0.41"	"0.39"	"0.73"	"0.24"	"0.36"	"75.0"	"105.6"	"97.0"	"99.4"	"98.3"	"124.7"	"33592.9375"	"47266.328125"	"43445.66015625"	"44502.74609375"	"43988.2734375"	"55817.6796875"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"2"	"678.35403"	"0.0001108"	"0.001522"	"2.85"	"36.96"
"24025"	"[K].SLTNKWYEEVR.[Q]"	"1xBiotin [K5]"	"0.00174862"	"0.000586377"	"1"	"3"	"4"	"Q8R4D1"	"Q8R4D1 [552-562]"	"Q8R4D1 1xBiotin [K556]"	"Sodium/hydrogen exchanger 8 [OS=Mus musculus]"	"1"	"1650.79445"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"2"	"825.90098"	"0.0001108"	"4.925E-05"	"2.35"	""
"24022"	"[R].SITAKQAPETDKK.[N]"	"1xBiotin [K5]"	"0.000544939"	"0.000586377"	"1"	"1"	"14"	"Q80WJ7"	"Q80WJ7 [145-157]"	"Q80WJ7 1xBiotin [K149]"	"protein LYRIC [OS=Mus musculus]"	"2"	"1642.84688"	"0.58"	"0.39"	"0.37"	"0.70"	"0.33"	"-0.25"	"-0.07"	"75.2"	"112.2"	"98.9"	"97.3"	"122.2"	"94.2"	"87529.7373046875"	"130525.7578125"	"115070.131835938"	"113236.381835938"	"142237.494140625"	"109682.153320313"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"548.28716"	"0.0001108"	"8.953E-06"	"2.36"	"25.37"
"24402"	"[K].SQVAEAKTTFR.[I]"	"1xBiotin [K7]"	"0.00644264"	"0.000586377"	"1"	"2"	"6"	"Q91ZV0"	"Q91ZV0 [782-792]"	"Q91ZV0 1xBiotin [K788]"	"Melanoma inhibitory activity protein 2 [OS=Mus musculus]"	"1"	"1463.73112"	""	""	""	"9.97"	""	""	""	""	""	""	""	"600.0"	""	""	""	""	""	"12040.306640625"	""	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"732.36896"	"0.0001108"	"0.0003301"	"2.61"	"35.52"
"24021"	"[R].SITAKQAPETDK.[K]"	"1xBiotin [K5]"	"0.00719476"	"0.000586377"	"1"	"1"	"3"	"Q80WJ7"	"Q80WJ7 [145-156]"	"Q80WJ7 1xBiotin [K149]"	"protein LYRIC [OS=Mus musculus]"	"1"	"1514.75192"	"-0.40"	"0.59"	"0.89"	"0.41"	"0.15"	"0.55"	"-0.44"	"79.3"	"60.1"	"119.8"	"147.1"	"105.7"	"88.0"	"12392.11328125"	"9386.8740234375"	"18711.541015625"	"22985.640625"	"16506.3984375"	"13752.283203125"	""	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"2"	"757.88001"	"0.0001108"	"0.0003863"	"2.27"	"28.90"
"24014"	"[K].SLSLLYPR.[S]"	""	"0.114565"	"0.00731053"	"1"	"1"	"1"	"P56198"	"P56198 [7-14]"	""	"cell death activator cide-3 [OS=Mus musculus]"	"0"	"948.55129"	"-0.98"	"-1.31"	"0.11"	"-0.21"	"-1.33"	"-0.35"	"-0.02"	"141.3"	"71.5"	"56.9"	"152.1"	"122.1"	"56.0"	"16644.93359375"	"8418.7353515625"	"6696.33056640625"	"17913.70703125"	"14384.2939453125"	"6598.93603515625"	""	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"2"	"474.77912"	"0.001478"	"0.02377"	"1.02"	"18.52"
"24012"	"[K].SLSIEIGHEVKNQNK.[L]"	"1xBiotin [K11]"	"0.000138427"	"0.000586377"	"1"	"1"	"12"	"O35623"	"O35623 [48-62]"	"O35623 1xBiotin [K58]"	"BET1 homolog [OS=Mus musculus]"	"1"	"1921.98002"	"0.79"	"0.84"	"0.24"	"0.46"	"0.70"	"-0.09"	"-0.14"	"69.0"	"119.4"	"123.2"	"81.7"	"94.8"	"112.0"	"70302.609375"	"121712.740234375"	"125627.48046875"	"83269.1640625"	"96664.529296875"	"114176.921875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"961.49283"	"0.0001108"	"1.205E-06"	"3.85"	"38.08"
"2389"	"[K].CKELFSSHQWVSEETCGDEDSLAR.[E]"	"1xBiotin [K2]; 2xCarbamidomethyl [C1; C16]"	"9.08025E-07"	"0.000586377"	"1"	"1"	"12"	"P35821"	"P35821 [324-347]"	"P35821 1xBiotin [K325]"	"Tyrosine-protein phosphatase non-receptor type 1 [OS=Mus musculus]"	"1"	"3096.31320"	"0.14"	"0.24"	"-9.97"	"-4.50"	"0.20"	"0.06"	"-0.04"	"134.3"	"147.6"	"158.3"	""	"5.9"	"153.9"	"153215.209960938"	"168425.065429688"	"180661.564453125"	""	"6763.95068359375"	"175681.439453125"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"3"	"1032.77647"	"0.0001108"	"7.892E-10"	"7.07"	"45.99"
"24116"	"[R].SMVKFPGGTPGR.[W]"	"1xBiotin [K4]; 1xOxidation [M2]"	"0.0889429"	"0.00334029"	"1"	"1"	"3"	"Q61712"	"Q61712 [339-350]"	"Q61712 1xBiotin [K342]"	"DnaJ homolog subfamily C member 1 [OS=Mus musculus]"	"1"	"1475.71337"	"-0.01"	"-0.41"	"-0.45"	"-0.94"	"-0.57"	"-0.56"	"-0.16"	"128.3"	"127.7"	"96.6"	"94.0"	"67.1"	"86.4"	"12261.2060546875"	"12199.6689453125"	"9228.517578125"	"8977.447265625"	"6412.0263671875"	"8253.1787109375"	""	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"2"	"738.36041"	"0.000655"	"0.01616"	"1.69"	"35.12"
"23970"	"[K].SLQAKFPSDLK.[V]"	"1xBiotin [K5]"	"0.00144268"	"0.000586377"	"1"	"1"	"11"	"Q8BHF7"	"Q8BHF7 [145-155]"	"Q8BHF7 1xBiotin [K149]"	"CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase, mitochondrial [OS=Mus musculus]"	"1"	"1459.76136"	"0.46"	"0.48"	"0.18"	"-0.37"	"-0.11"	"-0.58"	"-0.59"	"90.8"	"125.3"	"126.7"	"103.1"	"70.2"	"84.0"	"72423.4609375"	"99965.84375"	"101071.21875"	"82300.328125"	"56007.1171875"	"67010.40625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"730.38458"	"0.0001108"	"3.711E-05"	"3.11"	"44.49"
"24141"	"[K].SNHHKDSAVQSLR.[L]"	"1xBiotin [K5]"	"7.28846E-05"	"0.000586377"	"1"	"1"	"6"	"Q3UUQ7-1"	"Q3UUQ7-1 [791-803]"	"Q3UUQ7-1 1xBiotin [K795]"	"GPI inositol-deacylase [OS=Mus musculus]"	"1"	"1704.82346"	"0.59"	"0.32"	"0.23"	"0.37"	"0.52"	"-0.07"	"0.20"	"78.4"	"117.8"	"97.6"	"92.2"	"101.5"	"112.5"	"22350.025390625"	"33576.796875"	"27828.33203125"	"26274.646484375"	"28931.458984375"	"32063.236328125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"568.94611"	"0.0001108"	"4.75E-07"	"4.63"	"24.56"
"2125"	"[K].CCSGAIIVLTKSGR.[S]"	"1xBiotin [K11]; 2xCarbamidomethyl [C1; C2]"	"0.000309534"	"0.000586377"	"1"	"1"	"5"	"P52480"	"P52480 [423-436]"	"P52480 1xBiotin [K433]"	"Pyruvate kinase PKM [OS=Mus musculus]"	"1"	"1747.86519"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"High"	"2"	"874.43644"	"0.0001108"	"3.917E-06"	"2.96"	""
"2011"	"[R].AVVKEGSVSPK.[E]"	"1xBiotin [K4]"	"0.00114932"	"0.000586377"	"1"	"1"	"7"	"Q8C0L0"	"Q8C0L0 [296-306]"	"Q8C0L0 1xBiotin [K299]"	"Thioredoxin-related transmembrane protein 4 [OS=Mus musculus]"	"1"	"1326.70860"	"0.14"	"-0.01"	"-0.06"	"0.05"	"0.02"	"-0.12"	"0.04"	"98.2"	"108.5"	"97.4"	"94.3"	"101.6"	"99.9"	"30500.34765625"	"33714.578125"	"30251.953125"	"29308.30859375"	"31576.291015625"	"31031.9921875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"663.85786"	"0.0001108"	"2.668E-05"	"2.89"	"28.20"
"2021"	"[R].AVYPAFDKNNPSNK.[L]"	"1xBiotin [K8]"	"0.000729384"	"0.000586377"	"1"	"1"	"6"	"Q9JHZ2"	"Q9JHZ2 [298-311]"	"Q9JHZ2 1xBiotin [K305]"	"Progressive ankylosis protein [OS=Mus musculus]"	"1"	"1790.85303"	"0.01"	"-0.71"	"0.42"	"-0.29"	"-1.07"	"-1.08"	"-0.37"	"114.3"	"114.8"	"70.1"	"153.1"	"93.5"	"54.3"	"30599.04296875"	"30716.6328125"	"18766.1328125"	"40967.294921875"	"25019.4404296875"	"14528.0244140625"	""	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"2"	"895.93029"	"0.0001108"	"1.372E-05"	"2.59"	"38.76"
"2022"	"[K].AVYQGPGSSPVKS.[-]"	"1xBiotin [K12]"	"0.0245183"	"0.00104877"	"1"	"2"	"12"	"O88587-1"	"O88587-1 [253-265]"	"O88587-1 1xBiotin [K264]"	"Catechol O-methyltransferase [OS=Mus musculus]"	"1"	"1502.73079"	"0.40"	"0.19"	"0.10"	"0.53"	"0.12"	"-0.28"	"-0.07"	"84.9"	"112.1"	"96.8"	"90.9"	"123.1"	"92.2"	"212667.625"	"280718.9375"	"242420.953125"	"227512.6875"	"308100.40625"	"230705.515625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"751.86914"	"0.0001873"	"0.002346"	"3.16"	"35.73"
"24321"	"[R].SPVVELSKVPLIQR.[G]"	"1xBiotin [K8]"	"1.97391E-05"	"0.000586377"	"1"	"1"	"12"	"Q99MK8"	"Q99MK8 [670-683]"	"Q99MK8 1xBiotin [K677]"	"Beta-adrenergic receptor kinase 1 [OS=Mus musculus]"	"1"	"1791.01970"	"0.18"	"0.06"	"-0.28"	"-2.51"	"0.13"	"-0.05"	"0.08"	"113.9"	"129.1"	"118.5"	"93.6"	"20.0"	"124.8"	"88330.68359375"	"100058.44921875"	"91844.6484375"	"72578.662109375"	"15526.8364257813"	"96769.12890625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"896.01405"	"0.0001108"	"7.041E-08"	"4.14"	"51.54"
"24288"	"[R].SPSKAVAAR.[A]"	"1xBiotin [K4]"	"0.00172836"	"0.000586377"	"1"	"1"	"31"	"Q9CQS8"	"Q9CQS8 [17-25]"	"Q9CQS8 1xBiotin [K20]"	"protein transport protein Sec61 subunit beta [OS=Mus musculus]"	"1"	"1112.58809"	"0.51"	"0.34"	"0.06"	"0.19"	"0.51"	"0.00"	"0.17"	"82.2"	"117.1"	"103.9"	"85.8"	"93.9"	"117.2"	"1521661.98339844"	"2168379"	"1923919"	"1588791.125"	"1740115.69335938"	"2170780.25"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"556.79760"	"0.0001108"	"4.814E-05"	"3.12"	"24.55"
"24260"	"[K].SPNGISDYPKIR.[V]"	"1xBiotin [K10]"	"0.00026911"	"0.000586377"	"1"	"3"	"3"	"Q91ZX6"	"Q91ZX6 [124-135]"	"Q91ZX6 1xBiotin [K133]"	"Sentrin-specific protease 2 [OS=Mus musculus]"	"1"	"1572.78389"	"0.26"	"0.47"	"0.39"	"0.59"	"0.63"	"0.37"	"0.16"	"75.6"	"90.5"	"104.5"	"98.9"	"113.5"	"117.0"	"34645.26171875"	"41501.30859375"	"47878.21875"	"45346.13671875"	"52025.234375"	"53621.69921875"	""	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"2"	"786.89658"	"0.0001108"	"3.202E-06"	"3.50"	"38.06"
"24258"	"[K].SPNGKAGSQGQWGR.[A]"	"1xBiotin [K5]"	"0.000153747"	"0.000586377"	"1"	"1"	"6"	"O88455"	"O88455 [14-27]"	"O88455 1xBiotin [K18]"	"7-dehydrocholesterol reductase [OS=Mus musculus]"	"1"	"1655.77070"	"0.43"	"0.14"	"0.11"	"0.49"	"0.43"	"0.00"	"0.28"	"82.5"	"110.9"	"91.1"	"89.0"	"115.7"	"110.8"	"15570.369140625"	"20934.310546875"	"17198.685546875"	"16795.0078125"	"21831.95703125"	"20909.927734375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"828.38919"	"0.0001108"	"1.409E-06"	"2.84"	"29.64"
"24238"	"[R].SPLGGPDPAELLLMGSYLGKPGPPEPALR.[Q]"	"1xBiotin [K20]; 1xOxidation [M14]"	"0.00283601"	"0.000586377"	"1"	"1"	"3"	"Q8K3Z9"	"Q8K3Z9 [116-144]"	"Q8K3Z9 1xBiotin [K135]"	"Nuclear envelope pore membrane protein POM 121 [OS=Mus musculus]"	"0"	"3171.62170"	"-9.97"	"-9.97"	"-9.97"	"-9.97"	"0.59"	"9.97"	"9.97"	"239.7"	""	""	""	""	"360.3"	"5654.439453125"	""	""	""	""	"8501.5849609375"	""	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"3"	"1057.87873"	"0.0001108"	"9.905E-05"	"3.52"	"61.18"
"24230"	"[R].SPGYVPGKVVPLRPAPPPK.[N]"	"1xBiotin [K8]"	"3.53664E-05"	"0.000586377"	"1"	"1"	"13"	"Q5FWI3"	"Q5FWI3 [24-42]"	"Q5FWI3 1xBiotin [K31]"	"Cell surface hyaluronidase [OS=Mus musculus]"	"1"	"2182.22053"	"0.53"	"0.24"	"0.47"	"-1.11"	"0.78"	"0.25"	"0.55"	"83.3"	"120.6"	"98.3"	"115.7"	"38.6"	"143.5"	"106794"	"154566.875"	"125955.7578125"	"148236.6875"	"49436.93359375"	"183853.828125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"728.07831"	"0.0001108"	"1.656E-07"	"4.02"	"40.93"
"24214"	"[R].SPFLQKQLTQPETSYGR.[E]"	"1xBiotin [K6]"	"2.40679E-05"	"0.000586377"	"1"	"3"	"11"	"Q62418"	"Q62418 [291-307]"	"Q62418 1xBiotin [K296]"	"Drebrin-like protein [OS=Mus musculus]"	"1"	"2206.09611"	"-9.97"	"-9.97"	"-9.97"	"-9.97"	"1.94"	"9.97"	"9.97"	"124.0"	""	""	""	""	"476.0"	"10108.8740234375"	""	""	""	""	"38813.40234375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"1103.55205"	"0.0001108"	"9.436E-08"	"3.12"	"45.01"
"24326"	"[K].SPYQEFTDHLVKTHTR.[V]"	"1xBiotin [K12]"	"7.46047E-05"	"0.000586377"	"1"	"1"	"8"	"P25444"	"P25444 [264-279]"	"P25444 1xBiotin [K275]"	"40S ribosomal protein S2 [OS=Mus musculus]"	"1"	"2185.04950"	"0.76"	"0.20"	"-1.01"	"-9.97"	"0.17"	"-0.59"	"-0.03"	"109.9"	"186.0"	"125.9"	"54.4"	""	"123.7"	"31762.951171875"	"53765.953125"	"36402.802734375"	"15737.4619140625"	""	"35762.13671875"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"4"	"547.01757"	"0.0001108"	"4.89E-07"	"2.90"	"41.77"
"2058"	"[R].CAASGSSSSGSAAAALDADCSLKQNLR.[L]"	"1xBiotin [K23]; 2xCarbamidomethyl [C1; C20]"	"5.68979E-08"	"0.000586377"	"1"	"1"	"8"	"Q99LR1"	"Q99LR1 [15-41]"	"Q99LR1 1xBiotin [K37]"	"Monoacylglycerol lipase ABHD12 [OS=Mus musculus]"	"1"	"2881.28731"	"0.61"	"0.60"	"0.60"	"-0.84"	"0.54"	"-0.07"	"-0.06"	"79.3"	"120.8"	"120.4"	"120.0"	"44.2"	"115.3"	"77651.8125"	"118291.3984375"	"117966.6640625"	"117524.875"	"43316.9765625"	"112958.953125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"961.10038"	"0.0001108"	"1.38E-11"	"7.29"	"45.99"
"2008"	"[R].AVTLYDKPASFFK.[E]"	"1xBiotin [K7]"	"0.000208209"	"0.000586377"	"1"	"2"	"13"	"Q921Q3-1"	"Q921Q3-1 [211-223]"	"Q921Q3-1 1xBiotin [K217]"	"chitobiosyldiphosphodolichol beta-mannosyltransferase [OS=Mus musculus]"	"0"	"1712.87164"	"0.44"	"0.23"	"-0.24"	"-2.47"	"-0.06"	"-0.51"	"-0.29"	"108.8"	"147.9"	"127.5"	"92.1"	"19.6"	"104.1"	"72098.625"	"97984.765625"	"84443.90625"	"61038.47265625"	"13001.640625"	"68940.296875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"856.93943"	"0.0001108"	"2.197E-06"	"3.59"	"53.37"
"24348"	"[R].SQETYETLKHEKPPQ.[-]"	"1xBiotin [K]"	"0.0011294"	"0.000586377"	"1"	"1"	"15"	"P20491"	"P20491 [72-86]"	"P20491 1xBiotin [K]"	"High affinity immunoglobulin epsilon receptor subunit gamma [OS=Mus musculus]"	"1"	"2040.96952"	"0.04"	"-0.34"	"0.55"	"0.49"	"0.01"	"-0.02"	"0.36"	"89.6"	"91.8"	"70.6"	"131.2"	"126.2"	"90.5"	"119546.015625"	"122548.7578125"	"94279.6015625"	"175116.2578125"	"168455.918945313"	"120770.9140625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"680.99456"	"0.0001108"	"2.596E-05"	"3.72"	"34.54"
"24171"	"[K].SNVKIQSTPVK.[Q]"	"1xBiotin [K4]"	"0.00085373"	"0.000586377"	"1"	"1"	"6"	"P62821"	"P62821 [188-198]"	"P62821 1xBiotin [K191]"	"Ras-related protein Rab-1A [OS=Mus musculus]"	"1"	"1426.77226"	"0.47"	"0.35"	"0.43"	"0.42"	"0.32"	"-0.15"	"-0.03"	"79.0"	"109.2"	"100.5"	"106.7"	"105.9"	"98.6"	"25570.990234375"	"35328.92578125"	"32506.7578125"	"34506.078125"	"34270.7265625"	"31912.5859375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"713.88949"	"0.0001108"	"1.722E-05"	"3.17"	"30.76"
"2355"	"[R].CHHLIVTACTCQNNINKVDAK.[I]"	"1xBiotin [K]; 3xCarbamidomethyl [C1; C9; C11]"	"6.0831E-05"	"0.000586377"	"1"	"1"	"8"	"P23298"	"P23298 [214-234]"	"P23298 1xBiotin [K]"	"Protein kinase C eta type [OS=Mus musculus]"	"1"	"2722.26804"	""	"9.97"	"9.97"	""	"9.97"	"9.97"	"-0.82"	""	""	"255.7"	"199.6"	""	"144.7"	""	""	"38159.828125"	"29790.10546875"	""	"21593.88671875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"4"	"681.32204"	"0.0001108"	"3.655E-07"	"4.61"	"33.00"
"23529"	"[K].SGKGDSTLQVSSR.[L]"	"1xBiotin [K3]"	"1.59082E-05"	"0.000586377"	"1"	"1"	"17"	"Q80WJ7"	"Q80WJ7 [261-273]"	"Q80WJ7 1xBiotin [K263]"	"protein LYRIC [OS=Mus musculus]"	"1"	"1547.74823"	"0.42"	"0.29"	"0.53"	"0.62"	"0.51"	"0.08"	"0.22"	"75.3"	"101.0"	"91.9"	"108.7"	"116.1"	"107.0"	"219635.140625"	"294511.090332031"	"267994.8125"	"316878.987304688"	"338483.699707031"	"311940.068359375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"774.37812"	"0.0001108"	"5.15E-08"	"4.28"	"30.02"
"23962"	"[R].SLPPRPPAKGCIPVSR.[L]"	"1xBiotin [K9]; 1xCarbamidomethyl [C11]"	"0.00061592"	"0.000586377"	"1"	"1"	"2"	"Q9ESG9"	"Q9ESG9 [41-56]"	"Q9ESG9 1xBiotin [K49]"	"Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase [OS=Mus musculus]"	"1"	"1958.04627"	"-0.36"	"-0.44"	"0.03"	"-0.49"	"-0.55"	"-0.19"	"-0.11"	"121.7"	"94.8"	"89.8"	"124.2"	"86.5"	"83.0"	"86082.994140625"	"67070.71875"	"63502.32421875"	"87875.205078125"	"61172.16015625"	"58708.29296875"	""	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"3"	"653.35397"	"0.0001108"	"1.073E-05"	"2.56"	"35.23"
"23959"	"[R].SLPGNAPCLKHFPLDLR.[T]"	"1xBiotin [K10]; 1xCarbamidomethyl [C8]"	"0.00129144"	"0.000586377"	"1"	"1"	"7"	"Q9DBT5"	"Q9DBT5 [19-35]"	"Q9DBT5 1xBiotin [K28]"	"AMP deaminase 2 [OS=Mus musculus]"	"1"	"2161.10451"	"0.40"	"0.08"	"-1.93"	"-9.97"	"0.36"	"-0.04"	"0.28"	"122.1"	"160.8"	"128.9"	"32.0"	""	"156.2"	"50638.984375"	"66679.2734375"	"53466.08203125"	"13255.9697265625"	""	"64782.64453125"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"721.03989"	"0.0001108"	"3.153E-05"	"2.85"	"50.89"
"2542"	"[K].CPFYAAQPDKGTLGGSNCPFQTTVAVLR.[K]"	"1xBiotin [K10]; 2xCarbamidomethyl [C1; C18]"	"8.3759E-06"	"0.000586377"	"1"	"1"	"4"	"O70252"	"O70252 [264-291]"	"O70252 1xBiotin [K273]"	"Heme oxygenase 2 [OS=Mus musculus]"	"1"	"3281.55403"	"-9.97"	"0.04"	"-9.97"	"-9.97"	"0.27"	"9.97"	"0.23"	"185.5"	""	"190.9"	""	""	"223.6"	"28759.17578125"	""	"29582.6171875"	""	""	"34659.88671875"	""	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"1094.52112"	"0.0001108"	"2.022E-08"	"4.70"	"54.31"
"23865"	"[K].SLGALKK.[-]"	"1xBiotin [K]"	"0.0710142"	"0.00241047"	"1"	"1"	"6"	"Q9R099"	"Q9R099 [436-442]"	"Q9R099 1xBiotin [K]"	"Transducin beta-like protein 2 [OS=Mus musculus]"	"1"	"942.54410"	"0.43"	"0.42"	"0.22"	"0.73"	"0.42"	"-0.01"	"0.00"	"76.5"	"103.2"	"102.1"	"89.1"	"126.8"	"102.3"	"43556.54296875"	"58733.41015625"	"58117.6328125"	"50700.33984375"	"72173.0546875"	"58228.31640625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"471.77558"	"0.000415"	"0.01142"	"2.23"	"33.30"
"2550"	"[K].CPKVSK.[L]"	"1xBiotin [K3]; 1xCarbamidomethyl [C1]"	"0.0889429"	"0.00334029"	"1"	"1"	"11"	"Q61093"	"Q61093 [329-334]"	"Q61093 1xBiotin [K331]"	"Cytochrome b-245 heavy chain [OS=Mus musculus]"	"1"	"944.46922"	"0.49"	"0.28"	"0.39"	"0.35"	"0.73"	"0.24"	"0.46"	"76.2"	"107.4"	"92.3"	"99.8"	"97.4"	"126.7"	"15750.197265625"	"22195.40625"	"19072.857421875"	"20625.58203125"	"20127.142578125"	"26168.234375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"472.73807"	"0.000655"	"0.01611"	"1.72"	"19.08"
"1972"	"[K].AVQQSGDKNMSK.[V]"	"1xBiotin [K8]"	"0.00105925"	"0.000586377"	"1"	"1"	"12"	"Q91WE4"	"Q91WE4 [36-47]"	"Q91WE4 1xBiotin [K43]"	"UPF0729 protein C18orf32 homolog [OS=Mus musculus]"	"1"	"1518.70392"	"0.73"	"0.55"	"0.63"	"2.06"	"0.57"	"-0.16"	"0.02"	"53.0"	"87.9"	"77.5"	"82.2"	"220.6"	"78.8"	"44917.4887695313"	"74572.435546875"	"65718.9794921875"	"69700.9638671875"	"187060.513671875"	"66775.1630859375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"759.85605"	"0.0001108"	"2.364E-05"	"2.69"	"22.71"
"23807"	"[K].SKYSSLEQSER.[R]"	"1xBiotin [K2]"	"0.0345607"	"0.00104877"	"1"	"1"	"2"	"Q80W37"	"Q80W37 [33-43]"	"Q80W37 1xBiotin [K34]"	"Snurportin-1 [OS=Mus musculus]"	"1"	"1539.71078"	"9.97"	"9.97"	"9.97"	""	"9.97"	"0.13"	"0.59"	""	"152.3"	"110.8"	"170.5"	""	"166.5"	""	"19805.75390625"	"14413.0029296875"	"22172.515625"	""	"21655.021484375"	""	"High"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"2"	"770.35894"	"0.0001873"	"0.003904"	"1.89"	"33.92"
"1971"	"[R].AVQQNGAPATTKVK.[A]"	"1xBiotin [K12]"	"2.06819E-05"	"0.000586377"	"1"	"1"	"22"	"Q9JLJ5"	"Q9JLJ5 [264-277]"	"Q9JLJ5 1xBiotin [K275]"	"Elongation of very long chain fatty acids protein 1 [OS=Mus musculus]"	"1"	"1638.86320"	"0.27"	"0.61"	"0.52"	"0.67"	"0.18"	"-0.09"	"-0.42"	"76.0"	"91.8"	"115.7"	"108.9"	"121.2"	"86.4"	"191779.21484375"	"231815.63671875"	"291926.4765625"	"274974.15625"	"306010.59375"	"218000.890625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"819.93509"	"0.0001108"	"7.562E-08"	"4.34"	"26.87"
"23802"	"[R].SKVTAIKSLSIEIGHEVK.[N]"	"2xBiotin [K2; K7]"	"5.83456E-06"	"0.000586377"	"1"	"1"	"4"	"O35623"	"O35623 [41-58]"	"O35623 2xBiotin [K42; K47]"	"BET1 homolog [OS=Mus musculus]"	"2"	"2391.27745"	"9.97"	"9.97"	""	""	""	"-9.97"	"-9.97"	""	"365.6"	"234.4"	""	""	""	""	"12857.7822265625"	"8241.4951171875"	""	""	""	""	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"797.76392"	"0.0001108"	"1.193E-08"	"4.22"	"58.69"
"23801"	"[R].SKVTAIKSLSIEIGHEVK.[N]"	"1xBiotin [K7]"	"0.000981941"	"0.000586377"	"1"	"1"	"3"	"O35623"	"O35623 [41-58]"	"O35623 1xBiotin [K47]"	"BET1 homolog [OS=Mus musculus]"	"2"	"2165.19985"	""	""	""	""	"9.97"	"9.97"	"9.97"	""	""	""	""	""	"600.0"	""	""	""	""	""	"20798.5859375"	""	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"3"	"722.40435"	"0.0001108"	"2.112E-05"	"4.46"	"46.94"
"23800"	"[R].SKVTAIK.[S]"	"1xBiotin [K2]"	"0.0253774"	"0.00104877"	"1"	"1"	"20"	"O35623"	"O35623 [41-47]"	"O35623 1xBiotin [K42]"	"BET1 homolog [OS=Mus musculus]"	"1"	"972.55466"	"0.57"	"0.24"	"0.18"	"-0.02"	"0.40"	"-0.17"	"0.16"	"84.4"	"125.6"	"99.7"	"95.6"	"83.3"	"111.3"	"3585935.55761719"	"5335880"	"4234961"	"4063112.5"	"3537849.68164063"	"4729946.73046875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"486.78084"	"0.0001873"	"0.002465"	"3.27"	"29.62"
"23790"	"[R].SKTPTGPDLDTSYK.[G]"	"1xBiotin [K2]"	"0.000214369"	"0.000586377"	"1"	"4"	"11"	"Q6ZWR6-1"	"Q6ZWR6-1 [8361-8374]"	"Q6ZWR6-1 1xBiotin [K8362]"	"Nesprin-1 [OS=Mus musculus]"	"1"	"1735.82073"	"0.23"	"0.20"	"0.12"	"0.26"	"0.32"	"0.09"	"0.12"	"87.5"	"102.9"	"100.3"	"95.2"	"104.9"	"109.2"	"139012.734375"	"163483.09375"	"159442.4375"	"151312.453125"	"166655.359375"	"173527.625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"868.41355"	"0.0001108"	"2.282E-06"	"3.65"	"35.23"
"24542"	"[K].SSKSSDLTSDLGNVLTSSNAK.[A]"	"1xBiotin [K3]"	"8.82725E-06"	"0.000586377"	"1"	"3"	"11"	"Q5XG73"	"Q5XG73 [156-176]"	"Q5XG73 1xBiotin [K158]"	"Acyl-CoA-binding domain-containing protein 5 [OS=Mus musculus]"	"1"	"2337.12384"	"0.42"	"0.27"	"-0.60"	"-2.93"	"-0.09"	"-0.52"	"-0.36"	"113.8"	"152.7"	"137.0"	"74.9"	"14.9"	"106.7"	"36940.419921875"	"49576.0546875"	"44483.31640625"	"24324.16796875"	"4849.1982421875"	"34634.6796875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"779.71257"	"0.0001108"	"2.171E-08"	"4.26"	"49.83"
"1962"	"[K].AVPLNASKQDGPLPKPHSVSLNDTETR.[K]"	"1xBiotin [K8]"	"3.129E-05"	"0.000586377"	"1"	"1"	"7"	"Q9WV55"	"Q9WV55 [147-173]"	"Q9WV55 1xBiotin [K154]"	"vesicle-associated membrane protein-associated protein A [OS=Mus musculus]"	"1"	"3097.57351"	"0.93"	"0.38"	"0.41"	"-9.97"	"0.63"	"-0.30"	"0.24"	"84.7"	"161.0"	"110.6"	"112.6"	""	"131.1"	"28453.283203125"	"54053.546875"	"37141.27734375"	"37789.51171875"	""	"44008.21875"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"4"	"775.14856"	"0.0001108"	"1.379E-07"	"2.85"	"37.82"
"2725"	"[R].CVDKSWIPEGVVR.[S]"	"1xBiotin [K4]; 1xCarbamidomethyl [C1]"	"0.000105242"	"0.000586377"	"1"	"1"	"7"	"Q9ERI2"	"Q9ERI2 [188-200]"	"Q9ERI2 1xBiotin [K191]"	"Ras-related protein Rab-27A [OS=Mus musculus]"	"1"	"1770.86657"	"0.72"	"0.46"	"-0.23"	"-1.62"	"0.42"	"-0.29"	"-0.04"	"91.8"	"150.8"	"126.2"	"78.2"	"29.9"	"123.1"	"28698.439453125"	"47126.0795898438"	"39440.06640625"	"24447.71484375"	"9336.7158203125"	"38479.48046875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"885.93730"	"0.0001108"	"8.103E-07"	"3.15"	"49.39"
"23781"	"[R].SKSLQFTGK.[E]"	"1xBiotin [K2]"	"0.0123404"	"0.000586377"	"1"	"2"	"3"	"Q8C341-1"	"Q8C341-1 [1075-1083]"	"Q8C341-1 1xBiotin [K1076]"	"SUN domain-containing ossification factor [OS=Mus musculus]"	"1"	"1221.62962"	"0.41"	"-9.97"	"0.41"	"0.24"	"-0.13"	"-0.54"	"9.97"	"104.4"	"138.9"	""	"138.5"	"122.9"	"95.3"	"43439.55859375"	"57824.15234375"	""	"57645.08984375"	"51138.8046875"	"39659.87109375"	""	"High"	"Peak Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"2"	"611.31848"	"0.0001108"	"0.0008573"	"2.23"	"36.10"
"2787"	"[K].DAAQSKAASSLFSAK.[A]"	"1xBiotin [K6]"	"0.000173776"	"0.000586377"	"1"	"1"	"5"	"Q9JIH2"	"Q9JIH2 [304-318]"	"Q9JIH2 1xBiotin [K309]"	"Nuclear pore complex protein Nup50 [OS=Mus musculus]"	"1"	"1707.83705"	"-0.15"	"0.52"	"-1.39"	"0.09"	"0.26"	"0.41"	"-0.26"	"100.5"	"90.5"	"143.8"	"38.3"	"106.8"	"120.2"	"15257.5185546875"	"13748.6220703125"	"21842.1953125"	"5817.705078125"	"16215.9423828125"	"18249.025390625"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"2"	"854.42178"	"0.0001108"	"1.691E-06"	"3.63"	"42.05"
"1973"	"[K].AVQQSGDKNMSK.[V]"	"1xBiotin [K8]; 1xOxidation [M10]"	"0.00145111"	"0.000586377"	"1"	"1"	"29"	"Q91WE4"	"Q91WE4 [36-47]"	"Q91WE4 1xBiotin [K43]"	"UPF0729 protein C18orf32 homolog [OS=Mus musculus]"	"1"	"1534.69884"	"0.16"	"0.09"	"0.46"	"-0.46"	"0.15"	"-0.01"	"0.06"	"93.9"	"104.9"	"100.1"	"128.7"	"68.4"	"104.0"	"165622.067871094"	"185100.108398438"	"176537.362792969"	"227088.651367188"	"120624.174072266"	"183466.500976563"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"767.85331"	"0.0001108"	"3.737E-05"	"2.73"	"17.55"
"23889"	"[K].SLKDEDVLQK.[L]"	"1xBiotin [K3]"	"0.00145959"	"0.000586377"	"1"	"1"	"12"	"Q9CY27"	"Q9CY27 [58-67]"	"Q9CY27 1xBiotin [K60]"	"Very-long-chain enoyl-CoA reductase [OS=Mus musculus]"	"1"	"1400.70899"	"0.17"	"0.07"	"-0.01"	"0.52"	"0.07"	"-0.10"	"0.00"	"90.3"	"101.7"	"94.5"	"89.5"	"129.1"	"94.8"	"304221.84375"	"342550.84375"	"318429.09375"	"301432.40625"	"434750.34375"	"319338.0625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"700.85816"	"0.0001108"	"3.768E-05"	"2.88"	"37.83"
"23890"	"[K].SLKELQEMDKDDESLTK.[Y]"	"1xBiotin [K3]; 1xOxidation [M8]"	"0.00183207"	"0.000586377"	"1"	"1"	"5"	"Q61599"	"Q61599 [30-46]"	"Q61599 1xBiotin [K32]"	"Rho GDP-dissociation inhibitor 2 [OS=Mus musculus]"	"2"	"2251.04684"	"-0.02"	"-0.18"	"-0.08"	"-0.70"	"-0.35"	"-0.32"	"-0.16"	"115.1"	"113.1"	"101.3"	"109.2"	"70.9"	"90.5"	"27230.10546875"	"26771.435546875"	"23963.900390625"	"25841.310546875"	"16777.22265625"	"21423.365234375"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"3"	"751.01980"	"0.0001108"	"5.256E-05"	"2.52"	"35.47"
"2431"	"[R].CLHDLWVSKR.[G]"	"1xBiotin [K9]; 1xCarbamidomethyl [C1]"	"0.0249442"	"0.00104877"	"1"	"2"	"3"	"Q9CWS1-1"	"Q9CWS1-1 [44-53]"	"Q9CWS1-1 1xBiotin [K52]"	"E3 ubiquitin-protein ligase RNF135 [OS=Mus musculus]"	"1"	"1539.75590"	"0.37"	"0.44"	"-0.02"	"-1.50"	"-9.97"	"-9.97"	"-9.97"	"120.4"	"155.4"	"163.3"	"118.4"	"42.5"	""	"18343.638671875"	"23676.44140625"	"24883.69921875"	"18036.63671875"	"6478.958984375"	""	""	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"3"	"513.92358"	"0.0001873"	"0.002407"	"2.79"	"41.33"
"23956"	"[K].SIPEKFVVDK.[S]"	"1xBiotin [K5]"	"0.023283"	"0.00104877"	"1"	"1"	"6"	"Q8R502"	"Q8R502 [215-224]"	"Q8R502 1xBiotin [K219]"	"volume-regulated anion channel subunit LRRC8C [OS=Mus musculus]"	"1"	"1387.72900"	"0.23"	"-0.10"	"0.18"	"-0.21"	"0.19"	"-0.04"	"0.29"	"95.9"	"112.8"	"89.8"	"108.7"	"83.0"	"109.8"	"48814.73828125"	"57409.3828125"	"45669.5234375"	"55282.81640625"	"42249.7734375"	"55857.953125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"694.36828"	"0.0001873"	"0.002169"	"1.88"	"43.54"
"23950"	"[K].SINNFEVKTIHGSK.[S]"	"1xBiotin [K8]"	"0.00281954"	"0.000586377"	"1"	"1"	"6"	"P70677"	"P70677 [12-25]"	"P70677 1xBiotin [K19]"	"Caspase-3 [OS=Mus musculus]"	"1"	"1799.91088"	"9.97"	"9.97"	"9.97"	"9.97"	""	"-9.97"	"-9.97"	""	"161.6"	"151.8"	"146.0"	"140.6"	""	""	"18091.619140625"	"16991.369140625"	"16349.896484375"	"15748.3369140625"	""	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"600.64151"	"0.0001108"	"9.888E-05"	"2.73"	"37.50"
"24411"	"[K].SQWNNDNPLFKSATTTVMNPK.[F]"	"1xBiotin [K11]"	"4.16394E-05"	"0.000586377"	"1"	"1"	"16"	"P11835"	"P11835 [747-767]"	"P11835 1xBiotin [K757]"	"Integrin beta-2 [OS=Mus musculus]"	"1"	"2619.23302"	"0.45"	"0.47"	"-0.46"	"-4.33"	"0.74"	"0.29"	"0.28"	"96.8"	"132.4"	"133.7"	"70.5"	"4.8"	"161.9"	"401634.8125"	"549280.8984375"	"554693.5546875"	"292432.85546875"	"19992.72265625"	"672016.0546875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"873.74926"	"0.0001108"	"2.094E-07"	"4.88"	"51.15"
"23947"	"[R].SLNIAASAAVQAATKSQGALAGR.[L]"	"1xBiotin [K15]"	"7.39716E-08"	"0.000586377"	"1"	"1"	"8"	"Q8K072"	"Q8K072 [125-147]"	"Q8K072 1xBiotin [K139]"	"Receptor expression-enhancing protein 4 [OS=Mus musculus]"	"1"	"2382.25580"	"0.57"	"0.25"	"-0.23"	"-2.45"	"0.40"	"-0.17"	"0.15"	"99.7"	"147.5"	"118.5"	"85.0"	"18.3"	"131.1"	"71349.6328125"	"105585.234375"	"84817.1875"	"60881.8046875"	"13097.021484375"	"93826.03125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"794.75707"	"0.0001108"	"2.026E-11"	"6.74"	"51.80"
"23941"	"[K].SIMLPKSLLSVVK.[S]"	"1xBiotin [K6]; 1xOxidation [M3]"	"0.00490188"	"0.000586377"	"1"	"1"	"7"	"P15261"	"P15261 [287-299]"	"P15261 1xBiotin [K292]"	"Interferon gamma receptor 1 [OS=Mus musculus]"	"1"	"1656.94270"	"0.63"	"0.17"	"-0.90"	"-9.97"	"0.56"	"-0.07"	"0.39"	"105.6"	"163.2"	"119.1"	"56.5"	""	"155.6"	"9118.7451171875"	"14095.607421875"	"10286.080078125"	"4884.8310546875"	""	"13443.78125"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"2"	"828.97509"	"0.0001108"	"0.0002211"	"2.57"	"57.14"
"24412"	"[K].SQWNNDNPLFKSATTTVMNPK.[F]"	"1xBiotin [K11]; 1xOxidation [M18]"	"5.16668E-05"	"0.000586377"	"1"	"1"	"52"	"P11835"	"P11835 [747-767]"	"P11835 1xBiotin [K757]"	"Integrin beta-2 [OS=Mus musculus]"	"1"	"2635.22793"	"0.32"	"-0.01"	"-0.59"	"-2.27"	"0.34"	"0.02"	"0.34"	"111.6"	"139.1"	"111.1"	"74.0"	"23.1"	"141.0"	"1344748.61035156"	"1676379.859375"	"1338847.4609375"	"891720.484375"	"278796.40234375"	"1699071.55078125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"1318.11877"	"0.0001108"	"2.87E-07"	"4.19"	"46.84"
"23931"	"[K].SLLSVVKSATLETKPESK.[Y]"	"1xBiotin [K7]"	"3.85994E-05"	"0.000586377"	"1"	"1"	"13"	"P15261"	"P15261 [293-310]"	"P15261 1xBiotin [K299]"	"Interferon gamma receptor 1 [OS=Mus musculus]"	"1"	"2143.16788"	"0.20"	"0.25"	"-2.07"	"-9.97"	"0.32"	"0.11"	"0.07"	"124.5"	"143.2"	"147.8"	"29.7"	""	"154.8"	"207133.06640625"	"238330.16015625"	"246048.123046875"	"49362.0991210938"	""	"257697.7421875"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"715.06084"	"0.0001108"	"1.868E-07"	"5.01"	"54.45"
"1934"	"[K].AVKTSSLQVGLPTAAIPHNPR.[V]"	"1xBiotin [K3]"	"5.16206E-06"	"0.000586377"	"1"	"2"	"5"	"Q8BMI4"	"Q8BMI4 [753-773]"	"Q8BMI4 1xBiotin [K755]"	"Flap endonuclease GEN homolog 1 [OS=Mus musculus]"	"1"	"2383.29146"	"0.62"	"0.53"	"-9.97"	"-9.97"	"-9.97"	"-9.97"	"-9.97"	"150.7"	"231.1"	"218.2"	""	""	""	"15048.15234375"	"23065.998046875"	"21780.880859375"	""	""	""	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"795.10254"	"0.0001108"	"9.931E-09"	"4.95"	"43.85"
"23908"	"[R].SIIGSKGLDR.[S]"	"1xBiotin [K6]"	"0.0081281"	"0.000586377"	"1"	"2"	"9"	"Q8R1A4"	"Q8R1A4 [917-926]"	"Q8R1A4 1xBiotin [K922]"	"Dedicator of cytokinesis protein 7 [OS=Mus musculus]"	"1"	"1271.67763"	"0.53"	"0.15"	"0.15"	"0.11"	"0.50"	"-0.04"	"0.35"	"83.8"	"121.4"	"92.8"	"93.3"	"90.6"	"118.2"	"231389.859375"	"335155.8125"	"256280.28125"	"257626.09375"	"250047.671875"	"326310.09375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"636.34207"	"0.0001108"	"0.0004638"	"2.26"	"38.37"
"24484"	"[R].SSAAVKSSSLTR.[T]"	"1xBiotin [K6]"	"0.000619522"	"0.000586377"	"1"	"5"	"6"	"A2AAE1-1"	"A2AAE1-1 [2315-2326]"	"A2AAE1-1 1xBiotin [K2320]"	"Uncharacterized protein KIAA1109 [OS=Mus musculus]"	"1"	"1419.72604"	"0.67"	"0.46"	"0.40"	"0.32"	"0.56"	"-0.10"	"0.10"	"74.9"	"119.1"	"103.1"	"98.7"	"93.5"	"110.8"	"16742.705078125"	"26608.802734375"	"23038.7578125"	"22053.58984375"	"20895.93359375"	"24756.255859375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"710.36703"	"0.0001108"	"1.074E-05"	"3.16"	"30.19"
"2004"	"[K].AVTKVQK.[K]"	"1xBiotin [K4]"	"0.0405258"	"0.00104877"	"1"	"1"	"5"	"Q64525"	"Q64525 [18-24]"	"Q64525 1xBiotin [K21]"	"Histone H2B type 2-B [OS=Mus musculus]"	"1"	"999.56556"	"0.66"	"0.63"	"0.60"	"0.36"	"0.53"	"-0.14"	"-0.10"	"71.7"	"113.4"	"110.8"	"108.7"	"92.1"	"103.2"	"31497.119140625"	"49794.47265625"	"48628.109375"	"47745.796875"	"40438.59375"	"45330.85546875"	""	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"2"	"500.28632"	"0.0001873"	"0.004949"	"2.37"	"22.86"
"23907"	"[K].SLLGKDVLFLK.[D]"	"1xBiotin [K5]"	"0.00576887"	"0.000586377"	"1"	"1"	"4"	"P09411"	"P09411 [87-97]"	"P09411 1xBiotin [K91]"	"phosphoglycerate kinase 1 [OS=Mus musculus]"	"1"	"1458.83888"	"-9.97"	"-0.27"	"-1.99"	"-9.97"	"-9.97"	""	"-9.97"	"288.0"	""	"239.4"	"72.6"	""	""	"11497.2080078125"	""	"9555.0341796875"	"2896.7216796875"	""	""	""	"High"	"Not Found"	"High"	"High"	"Not Found"	"High"	"High"	"2"	"729.92298"	"0.0001108"	"0.0002809"	"2.38"	"57.49"
"23899"	"[R].SLKTNTLAAQSVIK.[K]"	"1xBiotin [K3]"	"2.91752E-05"	"0.000586377"	"1"	"2"	"42"	"Q9CQ56"	"Q9CQ56 [193-206]"	"Q9CQ56 1xBiotin [K195]"	"Vesicle transport protein USE1 [OS=Mus musculus]"	"1"	"1699.94112"	"0.27"	"0.33"	"0.10"	"-0.37"	"0.39"	"0.12"	"0.06"	"90.7"	"109.4"	"114.2"	"97.0"	"70.0"	"118.7"	"2130110.5"	"2570227.8125"	"2681530.32714844"	"2279589.75"	"1645038.44433594"	"2787619.75"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"850.47453"	"0.0001108"	"1.244E-07"	"3.77"	"42.92"
"2003"	"[K].AVTKAQK.[K]"	"1xBiotin [K4]"	"0.0370047"	"0.00104877"	"1"	"8"	"11"	"P10854"	"P10854 [18-24]"	"P10854 1xBiotin [K21]"	"Histone H2B type 1-M [OS=Mus musculus]"	"1"	"971.53426"	"0.76"	"0.59"	"0.42"	"0.50"	"0.48"	"-0.28"	"-0.11"	"71.9"	"121.5"	"108.3"	"96.5"	"101.6"	"100.3"	"83062.6484375"	"140256.078125"	"124993.6640625"	"111391.1953125"	"117257.71875"	"115750.1015625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"486.27074"	"0.0001873"	"0.004317"	"2.05"	"19.46"
"23894"	"[R].SLKLFQK.[L]"	"1xBiotin [K3]"	"0.044875"	"0.00154748"	"1"	"1"	"6"	"Q3UDP0"	"Q3UDP0 [442-448]"	"Q3UDP0 1xBiotin [K444]"	"WD repeat-containing protein 41 [OS=Mus musculus]"	"1"	"1089.61251"	"0.07"	"0.22"	"0.19"	"0.25"	"0.61"	"0.54"	"0.39"	"84.8"	"89.3"	"99.0"	"96.8"	"100.6"	"129.5"	"33217.25390625"	"34964.43359375"	"38786.6015625"	"37915.73828125"	"39384.4140625"	"50723.08203125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"545.30997"	"0.0002716"	"0.005774"	"2.44"	"42.34"
"24528"	"[R].SSGPYGGGGQYFAKPR.[N]"	"1xBiotin [K14]"	"0.000532377"	"0.000586377"	"1"	"1"	"5"	"P49312-1"	"P49312-1 [285-300]"	"P49312-1 1xBiotin [K298]"	"Heterogeneous nuclear ribonucleoprotein A1 [OS=Mus musculus]"	"0"	"1854.85918"	"9.97"	""	"9.97"	"9.97"	"9.97"	"-0.44"	"9.97"	""	"185.6"	""	"123.7"	"153.5"	"137.2"	""	"12455.24609375"	""	"8304.119140625"	"10303.9052734375"	"9207.443359375"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"2"	"927.93459"	"0.0001108"	"8.654E-06"	"3.33"	"39.88"
"2006"	"[K].AVTKYTSSK.[-I]"	"1xBiotin [K4]"	"0.00945211"	"0.000586377"	"2"	"11"	"6"	"Q64525; P10854"	"Q64525 [118-126]; P10854 [118-126]"	"Q64525 1xBiotin [K121]; P10854 1xBiotin [K121]"	"Histone H2B type 2-B [OS=Mus musculus];Histone H2B type 1-M [OS=Mus musculus]"	"1"	"1210.61363"	"-0.37"	"-0.07"	"-0.12"	"-0.30"	"0.18"	"0.55"	"0.25"	"107.2"	"83.0"	"102.1"	"99.0"	"87.4"	"121.4"	"145917.390625"	"112969.9296875"	"138902"	"134679.84375"	"118895.359375"	"165188.421875"	"NotUnique"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"605.81055"	"0.0001108"	"0.0005797"	"2.60"	"26.58"
"24313"	"[R].SPVEKPHNGALFPQQGDFQYR.[N]"	"1xBiotin [K5]"	"5.04304E-06"	"0.000586377"	"1"	"1"	"5"	"Q8CD26"	"Q8CD26 [363-383]"	"Q8CD26 1xBiotin [K367]"	"Solute carrier family 35 member E1 [OS=Mus musculus]"	"0"	"2641.26162"	"0.48"	"0.17"	"-9.97"	"-9.97"	"0.60"	"0.11"	"0.43"	"119.2"	"166.6"	"133.9"	""	""	"180.3"	"31688.259765625"	"44307.67578125"	"35617.796875"	""	""	"47932.15625"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"881.09155"	"0.0001108"	"9.615E-09"	"4.83"	"43.40"
"9606"	"[K].HAVSEGTKAVTK.[Y]"	"1xBiotin [K8]"	"2.56624E-05"	"0.000586377"	"2"	"13"	"22"	"Q64525; P10854"	"Q64525 [110-121]; P10854 [110-121]"	"Q64525 1xBiotin [K117]; P10854 1xBiotin [K117]"	"Histone H2B type 2-B [OS=Mus musculus];Histone H2B type 1-M [OS=Mus musculus]"	"1"	"1453.74677"	"0.25"	"0.15"	"0.15"	"0.23"	"0.28"	"0.02"	"0.13"	"88.3"	"105.2"	"97.9"	"98.2"	"103.5"	"107.0"	"302029.1171875"	"359659.78125"	"334950.9921875"	"335882.28125"	"353903.390625"	"365818.1484375"	"NotUnique"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"727.37731"	"0.0001108"	"1.029E-07"	"3.53"	"21.98"
"23515"	"[K].SGGDKMFSLK.[K]"	"1xBiotin [K5]; 1xOxidation [M6]"	"0.0100166"	"0.000586377"	"1"	"1"	"3"	"Q9WTZ1"	"Q9WTZ1 [24-33]"	"Q9WTZ1 1xBiotin [K28]"	"RING-box protein 2 [OS=Mus musculus]"	"1"	"1311.60717"	"-0.41"	"-0.53"	"-0.26"	"-0.77"	"-0.28"	"0.13"	"0.24"	"127.9"	"96.2"	"88.9"	"106.7"	"75.2"	"105.2"	"28970.662109375"	"21794.310546875"	"20127.3671875"	"24172.431640625"	"17023.169921875"	"23820.17578125"	""	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"2"	"656.30745"	"0.0001108"	"0.0006308"	"2.04"	"37.46"
"4007"	"[K].DSKSTWVILHHK.[V]"	"1xBiotin [K3]"	"0.000377408"	"0.000586377"	"1"	"1"	"15"	"P56395"	"P56395 [22-33]"	"P56395 1xBiotin [K24]"	"Cytochrome b5 [OS=Mus musculus]"	"1"	"1676.85772"	"0.19"	"-0.16"	"-0.15"	"-0.36"	"0.21"	"0.02"	"0.37"	"102.1"	"116.7"	"91.4"	"92.1"	"79.5"	"118.2"	"362715.162109375"	"414587.7109375"	"324722.8203125"	"327165.263671875"	"282356.154296875"	"419862.2265625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"559.62386"	"0.0001108"	"5.239E-06"	"3.77"	"37.67"
"4009"	"[R].DSKTFTPSTTDTSTR.[K]"	"1xBiotin [K3]"	"0.00085373"	"0.000586377"	"1"	"1"	"5"	"P30993"	"P30993 [332-346]"	"P30993 1xBiotin [K334]"	"C5a anaphylatoxin chemotactic receptor 1 [OS=Mus musculus]"	"1"	"1870.84873"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"-0.14"	"0.01"	""	"118.1"	"106.3"	"138.0"	"130.4"	"107.3"	""	"16926.337890625"	"15231.80859375"	"19787.40234375"	"18686.177734375"	"15377.1513671875"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"2"	"935.92749"	"0.0001108"	"1.722E-05"	"2.20"	"33.69"
"20491"	"[K].QAGGFLGPPPPSGKFS.[-]"	"1xBiotin [K14]"	"0.000114863"	"0.000586377"	"1"	"1"	"37"	"Q921L3"	"Q921L3 [173-188]"	"Q921L3 1xBiotin [K186]"	"Calcium load-activated calcium channel [OS=Mus musculus]"	"1"	"1769.86795"	"0.39"	"-0.03"	"-0.10"	"-1.25"	"0.12"	"-0.28"	"0.15"	"104.6"	"137.6"	"102.6"	"97.4"	"44.1"	"113.7"	"112504.345703125"	"147903.29296875"	"110329.16015625"	"104746.881835938"	"47406.017578125"	"122214.45703125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"885.43778"	"0.0001108"	"9.176E-07"	"3.07"	"50.51"
"20443"	"[K].QAALKSHYADVDPENQNFLLESNLGK.[K]"	"1xBiotin [K5]"	"0.000120348"	"0.000586377"	"1"	"1"	"4"	"Q8CFE6"	"Q8CFE6 [34-59]"	"Q8CFE6 1xBiotin [K38]"	"sodium-coupled neutral amino acid transporter 2 [OS=Mus musculus]"	"1"	"3127.51532"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"1043.17626"	"0.0001108"	"9.831E-07"	"4.24"	""
"20424"	"[R].NYMPLAFSDKYSLGTR.[L]"	"1xBiotin [K10]; 1xOxidation [M3]"	"0.00105309"	"0.000586377"	"1"	"1"	"5"	"Q8CBY8-2"	"Q8CBY8-2 [172-187]"	"Q8CBY8-2 1xBiotin [K181]"	"Isoform 2 of Dynactin subunit 4 [OS=Mus musculus]"	"1"	"2104.98306"	""	"9.97"	""	""	""	""	"-9.97"	""	""	"600.0"	""	""	""	""	""	"14241.337890625"	""	""	""	""	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"2"	"1052.99527"	"0.0001108"	"2.329E-05"	"2.75"	"50.23"
"20419"	"[K].NYKNASGVVNSSPR.[S]"	"1xBiotin [K3]"	"5.60619E-05"	"0.000586377"	"1"	"1"	"9"	"Q7TQE6"	"Q7TQE6 [321-334]"	"Q7TQE6 1xBiotin [K323]"	"macoilin [OS=Mus musculus]"	"1"	"1718.82788"	"0.23"	"0.19"	"0.00"	"0.04"	"0.50"	"0.27"	"0.31"	"88.7"	"104.4"	"101.3"	"88.6"	"91.3"	"125.7"	"101517.94140625"	"119459.59765625"	"115944.0859375"	"101377.734375"	"104430.2109375"	"143835.171875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"859.91722"	"0.0001108"	"3.22E-07"	"2.88"	"31.80"
"4017"	"[K].DSLINLKIQK.[E]"	"1xBiotin [K7]"	"0.0013374"	"0.000586377"	"1"	"1"	"10"	"Q9CQB5"	"Q9CQB5 [68-77]"	"Q9CQB5 1xBiotin [K74]"	"CDGSH iron-sulfur domain-containing protein 2 [OS=Mus musculus]"	"1"	"1397.78210"	"0.48"	"0.08"	"-0.02"	"-0.14"	"0.24"	"-0.23"	"0.16"	"91.9"	"127.9"	"97.4"	"90.6"	"83.3"	"108.8"	"190096.359375"	"264468.5625"	"201515.25"	"187427.90625"	"172340.1875"	"225067.625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"699.39463"	"0.0001108"	"3.314E-05"	"3.31"	"46.75"
"20334"	"[R].NVLLTSGHVAKIGDFGLAR.[D]"	"1xBiotin [K11]"	"0.000564341"	"0.000586377"	"1"	"1"	"3"	"P09581"	"P09581 [781-799]"	"P09581 1xBiotin [K791]"	"Macrophage colony-stimulating factor 1 receptor [OS=Mus musculus]"	"1"	"2194.18012"	"9.97"	"9.97"	""	""	"9.97"	"0.24"	"-0.09"	""	"174.5"	"219.6"	""	""	"205.9"	""	"6932.35107421875"	"8725.138671875"	""	""	"8183.00244140625"	""	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"732.06519"	"0.0001108"	"9.399E-06"	"3.65"	"50.11"
"20558"	"[R].QATKDAGTIAGLNVLR.[I]"	"1xBiotin [K4]"	"0.0124842"	"0.000586377"	"1"	"1"	"4"	"P63017"	"P63017 [156-171]"	"P63017 1xBiotin [K159]"	"Heat shock cognate 71 kDa protein [OS=Mus musculus]"	"1"	"1853.99019"	""	""	"9.97"	"9.97"	""	""	""	""	""	""	"367.1"	"232.9"	""	""	""	""	"7124.99951171875"	"4521.060546875"	""	""	"High"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"2"	"927.49803"	"0.0001108"	"0.0008709"	"2.76"	"47.30"
"20333"	"[K].NVLITPGKSQIDLR.[K]"	"1xBiotin [K8]"	"0.00026911"	"0.000586377"	"1"	"1"	"18"	"Q8BHE0"	"Q8BHE0 [291-304]"	"Q8BHE0 1xBiotin [K298]"	"Proline-rich protein 11 [OS=Mus musculus]"	"1"	"1779.97856"	"0.31"	"0.24"	"0.08"	"-0.96"	"0.26"	"-0.05"	"0.02"	"96.8"	"120.2"	"114.6"	"102.1"	"49.9"	"116.3"	"416501.65625"	"517128.8125"	"492820.828125"	"439322.328125"	"214475.1328125"	"500365.5625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"890.49288"	"0.0001108"	"3.181E-06"	"3.54"	"46.00"
"4038"	"[RK].DSPSNKLLYAK.[ED]"	"1xBiotin [K6]"	"0.0469494"	"0.00154748"	"2"	"6"	"3"	"B2RXS4; P70206"	"B2RXS4 [1737-1747]; P70206 [1792-1802]"	"B2RXS4 1xBiotin [K1742]; P70206 1xBiotin [K1797]"	"Plexin-B2 [OS=Mus musculus];Plexin-A1 [OS=Mus musculus]"	"1"	"1461.74063"	"-9.97"	"0.55"	"0.18"	"0.11"	"1.44"	"9.97"	"0.89"	"81.1"	""	"119.0"	"92.1"	"87.5"	"220.3"	"7391.9951171875"	""	"10842.59765625"	"8390.21484375"	"7976.2626953125"	"20077.25390625"	"NotUnique"	"High"	"Not Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"2"	"731.37561"	"0.0002716"	"0.00614"	"2.90"	"40.28"
"4075"	"[R].DSWSYVNSKSNDD.[-]"	"1xBiotin [K9]"	"0.00324251"	"0.000586377"	"1"	"1"	"6"	"Q00651"	"Q00651 [1027-1039]"	"Q00651 1xBiotin [K1035]"	"Integrin alpha-4 [OS=Mus musculus]"	"1"	"1742.69625"	"0.29"	"0.15"	"0.27"	"0.53"	"0.30"	"0.02"	"0.15"	"83.2"	"101.4"	"92.5"	"100.3"	"120.1"	"102.5"	"180297.703125"	"219756.46875"	"200394.953125"	"217301"	"260350.4375"	"222062.8125"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"2"	"871.85158"	"0.0001108"	"0.0001206"	"2.81"	"42.00"
"20307"	"[R].NVGFESDSGGAFKGFK.[G]"	"1xBiotin [K13]"	"0.000188559"	"0.000586377"	"1"	"1"	"6"	"Q9JIH2"	"Q9JIH2 [47-62]"	"Q9JIH2 1xBiotin [K59]"	"Nuclear pore complex protein Nup50 [OS=Mus musculus]"	"1"	"1872.85851"	"-9.97"	"-9.97"	"0.25"	"-1.07"	"-9.97"	""	""	"225.4"	""	""	"267.6"	"107.0"	""	"12929.1806640625"	""	""	"15348.0361328125"	"6137.30126953125"	""	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"936.93382"	"0.0001108"	"1.902E-06"	"3.63"	"46.22"
"4079"	"[K].DSYVGDEAQSKR.[G]"	"1xBiotin [K11]"	"0.000454828"	"0.000586377"	"1"	"6"	"7"	"P60710"	"P60710 [51-62]"	"P60710 1xBiotin [K61]"	"Actin, cytoplasmic 1 [OS=Mus musculus]"	"1"	"1580.70095"	"0.73"	"0.32"	"0.98"	"1.42"	"0.52"	"-0.21"	"0.20"	"60.1"	"99.9"	"75.1"	"118.3"	"160.4"	"86.3"	"26140.318359375"	"43487.5971679688"	"32662.4453125"	"51455.7153320313"	"69771.97265625"	"37546.8364257813"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"790.85431"	"0.0001108"	"6.843E-06"	"3.10"	"30.02"
"20285"	"[K].NTYPKDEAHVSDEFSK.[S]"	"1xBiotin [K5]"	"5.47694E-05"	"0.000586377"	"1"	"2"	"11"	"Q99P72-2"	"Q99P72-2 [895-910]"	"Q99P72-2 1xBiotin [K899]"	"Reticulon-4 [OS=Mus musculus]"	"1"	"2092.92805"	"0.45"	"0.14"	"0.16"	"0.37"	"0.21"	"-0.24"	"0.07"	"85.3"	"116.2"	"93.8"	"95.6"	"110.6"	"98.5"	"324859.32421875"	"442304.453125"	"357105.3359375"	"364060.89453125"	"421102.796875"	"375198.02734375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"1046.96742"	"0.0001108"	"3.131E-07"	"2.41"	"35.09"
"4108"	"[R].DTKHTMEMR.[S]"	"1xBiotin [K3]; 2xOxidation [M6; M8]"	"0.12339"	"0.00909051"	"1"	"2"	"2"	"A2A8U2-1"	"A2A8U2-1 [581-589]"	"A2A8U2-1 1xBiotin [K583]"	"Transmembrane protein 201 [OS=Mus musculus]"	"1"	"1406.58612"	"-0.29"	"-0.06"	"-0.20"	"-2.78"	"0.02"	"0.32"	"0.08"	"124.7"	"101.8"	"119.9"	"108.5"	"18.2"	"126.9"	"64952.443359375"	"53014.9306640625"	"62447.1259765625"	"56513.7265625"	"9482.4482421875"	"66065.09375"	""	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"2"	"703.79661"	"0.001706"	"0.02654"	"1.08"	"16.45"
"4110"	"[K].DTKSLHLNR.[V]"	"1xBiotin [K3]"	"0.00841625"	"0.000586377"	"1"	"2"	"7"	"Q9JIG4-1"	"Q9JIG4-1 [649-657]"	"Q9JIG4-1 1xBiotin [K651]"	"protein phosphatase 1 regulatory subunit 3F [OS=Mus musculus]"	"1"	"1309.66813"	"0.63"	"0.01"	"0.48"	"0.85"	"0.71"	"0.08"	"0.71"	"71.5"	"110.9"	"71.8"	"99.6"	"129.1"	"117.1"	"45678.01953125"	"70876.919921875"	"45902.0703125"	"63684.2744140625"	"82546.861328125"	"74869.1787109375"	""	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"3"	"437.22734"	"0.0001108"	"0.0004862"	"2.13"	"31.93"
"20250"	"[K].NTKEMFGGFFK.[S]"	"1xBiotin [K3]; 1xOxidation [M5]"	"0.00115604"	"0.000586377"	"1"	"1"	"8"	"Q9D8U8"	"Q9D8U8 [178-188]"	"Q9D8U8 1xBiotin [K180]"	"sorting nexin-5 [OS=Mus musculus]"	"1"	"1547.70213"	"0.76"	"1.07"	"-0.44"	"-2.14"	"1.20"	"0.44"	"0.13"	"74.5"	"126.5"	"156.0"	"55.0"	"16.9"	"171.2"	"16193.201171875"	"27473.9443359375"	"33884.666015625"	"11950.951171875"	"3664.41479492188"	"37194.96875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"774.35454"	"0.0001108"	"2.67E-05"	"2.75"	"48.48"
"4020"	"[K].DSLYAQGKR.[R]"	"1xBiotin [K8]"	"0.0632006"	"0.0019826"	"1"	"1"	"4"	"P83882"	"P83882 [31-39]"	"P83882 1xBiotin [K38]"	"60S ribosomal protein L36a [OS=Mus musculus]"	"1"	"1263.61503"	"-9.97"	"-0.03"	"-0.55"	"-0.51"	"-9.97"	""	"-9.97"	"178.4"	""	"174.4"	"122.0"	"125.2"	""	"10940.85546875"	""	"10698.236328125"	"7485.53759765625"	"7681.38623046875"	""	""	"High"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"2"	"632.31147"	"0.0003442"	"0.009616"	"2.00"	"30.89"
"20610"	"[K].QDGPLPKPHSVSLNDTETR.[K]"	"1xBiotin [K7]"	"0.000733649"	"0.000586377"	"1"	"1"	"6"	"Q9WV55"	"Q9WV55 [155-173]"	"Q9WV55 1xBiotin [K161]"	"vesicle-associated membrane protein-associated protein A [OS=Mus musculus]"	"0"	"2317.12412"	"0.04"	"-0.32"	"0.68"	"-0.22"	"0.12"	"0.08"	"0.45"	"94.1"	"96.6"	"75.1"	"150.9"	"81.0"	"102.3"	"16748.712890625"	"17205.30859375"	"13372.6708984375"	"26862.267578125"	"14428.3408203125"	"18209.546875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"773.04593"	"0.0001108"	"1.378E-05"	"2.48"	"37.60"
"20646"	"[K].QDNNPLYKSAITTTVNPR.[F]"	"1xBiotin [K8]"	"0.00297128"	"0.000586377"	"1"	"1"	"3"	"P26011"	"P26011 [771-788]"	"P26011 1xBiotin [K778]"	"Integrin beta-7 [OS=Mus musculus]"	"1"	"2258.12339"	"-9.97"	"-9.97"	"0.32"	"-9.97"	"0.50"	"9.97"	"9.97"	"163.5"	""	""	"204.6"	""	"231.9"	"10076.9072265625"	""	""	"12606.2431640625"	""	"14285.8876953125"	""	"High"	"High"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"3"	"753.37951"	"0.0001108"	"0.000106"	"2.93"	"44.97"
"20716"	"[K].QEKACSLK.[T]"	"1xBiotin [K3]; 1xCarbamidomethyl [C5]"	"0.00749337"	"0.000586377"	"1"	"1"	"7"	"Q80WJ7"	"Q80WJ7 [481-488]"	"Q80WJ7 1xBiotin [K483]"	"protein LYRIC [OS=Mus musculus]"	"1"	"1189.57039"	"0.51"	"0.39"	"0.52"	"0.63"	"0.66"	"0.15"	"0.27"	"72.4"	"103.0"	"94.6"	"103.9"	"111.7"	"114.5"	"135703.5625"	"193125.0625"	"177475.421875"	"194780.625"	"209459.03125"	"214652.96875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"595.28896"	"0.0001108"	"0.0004129"	"2.58"	"25.82"
"21113"	"[R].QIEGKVVEISR.[L]"	"1xBiotin [K5]"	"0.000102816"	"0.000586377"	"1"	"3"	"14"	"Q8VDS8-1"	"Q8VDS8-1 [254-264]"	"Q8VDS8-1 1xBiotin [K258]"	"Syntaxin-18 [OS=Mus musculus]"	"1"	"1483.79372"	"-0.07"	"0.10"	"0.08"	"-0.12"	"-0.36"	"-0.30"	"-0.46"	"103.9"	"99.3"	"111.1"	"109.6"	"95.5"	"80.8"	"409010.255859375"	"390841.359375"	"437411.9921875"	"431423.083984375"	"375870.62109375"	"318045.125976563"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"742.40062"	"0.0001108"	"7.805E-07"	"3.67"	"39.82"
"21097"	"[R].QLDKALDDSR.[F]"	"1xBiotin [K4]"	"0.00528695"	"0.000586377"	"1"	"4"	"6"	"Q6ZWR6-1"	"Q6ZWR6-1 [8340-8349]"	"Q6ZWR6-1 1xBiotin [K8343]"	"Nesprin-1 [OS=Mus musculus]"	"1"	"1386.66819"	"-9.97"	"0.40"	"-9.97"	"-9.97"	"-9.97"	""	"-9.97"	"258.8"	""	"341.2"	""	""	""	"11643.708984375"	""	"15351.5361328125"	""	""	""	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"693.83757"	"0.0001108"	"0.0002465"	"2.50"	"34.01"
"21090"	"[K].QLATKAAR.[K]"	"1xBiotin [K5]"	"0.00629457"	"0.000586377"	"1"	"3"	"7"	"P68433"	"P68433 [20-27]"	"P68433 1xBiotin [K24]"	"Histone H3.1 [OS=Mus musculus]"	"1"	"1084.59317"	"0.27"	"0.21"	"0.15"	"0.02"	"0.06"	"-0.21"	"-0.14"	"91.8"	"110.9"	"106.0"	"102.2"	"93.1"	"95.9"	"61654.18359375"	"74477.953125"	"71189.6328125"	"68608.4296875"	"62516.3984375"	"64398.9921875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"542.80033"	"0.0001108"	"0.0003177"	"2.65"	"26.30"
"3805"	"[K].DPLKAPGR.[L]"	"1xBiotin [K4]"	"0.00749337"	"0.000586377"	"1"	"1"	"12"	"P58742"	"P58742 [53-60]"	"P58742 1xBiotin [K56]"	"Aladin [OS=Mus musculus]"	"1"	"1079.56663"	"0.58"	"0.25"	"0.40"	"0.19"	"0.45"	"-0.13"	"0.20"	"79.9"	"119.3"	"95.0"	"105.6"	"91.2"	"109.1"	"389703.75"	"582075.9375"	"463204.875"	"515042"	"444901.625"	"531999.75"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"540.28692"	"0.0001108"	"0.0004107"	"2.73"	"30.06"
"21050"	"[K].QKSALLSPEEPPASHR.[D]"	"1xBiotin [K2]"	"1.65561E-06"	"0.000586377"	"1"	"1"	"37"	"Q9EPE9"	"Q9EPE9 [912-927]"	"Q9EPE9 1xBiotin [K913]"	"manganese-transporting ATPase 13A1 [OS=Mus musculus]"	"1"	"1972.99092"	"0.67"	"0.26"	"0.26"	"0.22"	"0.43"	"-0.24"	"0.17"	"80.1"	"127.1"	"96.0"	"95.8"	"93.3"	"107.7"	"1404656.66796875"	"2229490.734375"	"1684585.15429688"	"1680558.12304688"	"1636979.0859375"	"1889593.4375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"986.99933"	"0.0001108"	"1.896E-09"	"4.31"	"35.30"
"3821"	"[K].DPSKPKGSSQLDVNEEVEALIVK.[S]"	"1xBiotin [K]"	"2.76835E-05"	"0.000586377"	"1"	"1"	"3"	"O35379"	"O35379 [282-304]"	"O35379 1xBiotin [K]"	"Multidrug resistance-associated protein 1 [OS=Mus musculus]"	"1"	"2708.38112"	"-9.97"	"-0.16"	"-9.97"	"-9.97"	"0.05"	"9.97"	"0.21"	"204.5"	""	"183.2"	""	""	"212.3"	"13685.474609375"	""	"12259.2392578125"	""	""	"14202.6396484375"	""	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"3"	"903.46435"	"0.0001108"	"1.157E-07"	"5.28"	"51.83"
"21031"	"[K].QKLTSIQFTCDTDIAQFR.[Q]"	"1xBiotin [K2]; 1xCarbamidomethyl [C10]"	"4.7297E-06"	"0.000586377"	"1"	"4"	"15"	"Q9R1S3-1"	"Q9R1S3-1 [760-777]"	"Q9R1S3-1 1xBiotin [K761]"	"GPI ethanolamine phosphate transferase 1 [OS=Mus musculus]"	"1"	"2398.15298"	"0.11"	"0.17"	"-2.30"	"-5.41"	"0.46"	"0.35"	"0.29"	"125.0"	"134.6"	"140.2"	"25.4"	"2.9"	"171.8"	"321126.650390625"	"345778.23828125"	"360103.7265625"	"65212.6313476563"	"7539.16015625"	"441414.052734375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"1199.58067"	"0.0001108"	"8.736E-09"	"3.91"	"51.89"
"21008"	"[R].QKGLDYR.[L]"	"1xBiotin [K2]"	"0.0299637"	"0.00104877"	"1"	"1"	"35"	"Q99LI2"	"Q99LI2 [382-388]"	"Q99LI2 1xBiotin [K383]"	"chloride channel CLIC-like protein 1 [OS=Mus musculus]"	"1"	"1105.54589"	"0.55"	"0.57"	"0.37"	"-0.01"	"0.53"	"-0.03"	"-0.05"	"78.1"	"114.7"	"116.0"	"101.1"	"77.7"	"112.4"	"3583985.57617188"	"5264452.41308594"	"5323314.19042969"	"4637986.24804688"	"3564500.97558594"	"5157496.88574219"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"553.27663"	"0.0001873"	"0.003159"	"2.25"	"31.94"
"3849"	"[K].DQENKYQASHPNLR.[R]"	"1xBiotin [K5]"	"0.00544296"	"0.000586377"	"1"	"1"	"6"	"Q9ERB0"	"Q9ERB0 [155-168]"	"Q9ERB0 1xBiotin [K159]"	"Synaptosomal-associated protein 29 [OS=Mus musculus]"	"1"	"1925.89227"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"0.14"	"-0.13"	""	"116.1"	"139.6"	"92.4"	"124.0"	"127.9"	""	"11586.94921875"	"13935.04296875"	"9225.3408203125"	"12374.0166015625"	"12763.6669921875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"642.63581"	"0.0001108"	"0.0002569"	"2.14"	"30.10"
"20938"	"[R].QHAPVKGEAPAK.[S]"	"1xBiotin [K6]"	"0.000834051"	"0.000586377"	"1"	"2"	"10"	"A2AKQ0"	"A2AKQ0 [8-19]"	"A2AKQ0 1xBiotin [K13]"	"UDP-glucuronic acid/UDP-N-acetylgalactosamine transporter [OS=Mus musculus]"	"1"	"1458.75219"	"0.47"	"0.41"	"0.36"	"0.09"	"0.43"	"-0.04"	"0.02"	"80.9"	"112.1"	"107.6"	"104.0"	"86.3"	"109.2"	"35736.4912109375"	"49522.1123046875"	"47535.3295898438"	"45960.79296875"	"38147.291015625"	"48240.3491210938"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"486.92199"	"0.0001108"	"1.669E-05"	"3.46"	"21.67"
"20926"	"[R].QGVLLGTKSADNSLENPFSK.[G]"	"1xBiotin [K8]"	"0.00409277"	"0.000586377"	"1"	"3"	"3"	"P98078"	"P98078 [719-738]"	"P98078 1xBiotin [K726]"	"Disabled homolog 2 [OS=Mus musculus]"	"1"	"2331.16492"	"9.97"	"9.97"	"9.97"	""	"9.97"	"0.17"	"0.19"	""	"157.1"	"155.3"	"110.6"	""	"177.1"	""	"11060.248046875"	"10930.17578125"	"7785.447265625"	""	"12466.0283203125"	""	"High"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"3"	"777.72692"	"0.0001108"	"0.0001702"	"3.17"	"50.33"
"20924"	"[K].QGVKSVAGK.[M]"	"1xBiotin [K4]"	"0.00255372"	"0.000586377"	"1"	"2"	"6"	"Q99K28"	"Q99K28 [493-501]"	"Q99K28 1xBiotin [K496]"	"ADP-ribosylation factor GTPase-activating protein 2 [OS=Mus musculus]"	"1"	"1099.59284"	"0.50"	"0.39"	"0.38"	"0.16"	"0.07"	"-0.43"	"-0.31"	"83.5"	"118.4"	"109.1"	"108.3"	"93.0"	"87.7"	"37628.37109375"	"53375.6171875"	"49209.65234375"	"48842.91015625"	"41922.39453125"	"39558.92578125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"550.30015"	"0.0001108"	"8.516E-05"	"2.91"	"26.25"
"3861"	"[R].DQHLQPSKDHR.[T]"	"1xBiotin [K8]"	"0.00262919"	"0.000586377"	"1"	"1"	"6"	"Q62178"	"Q62178 [732-742]"	"Q62178 1xBiotin [K739]"	"Semaphorin-4A [OS=Mus musculus]"	"1"	"1586.74923"	"0.76"	"-0.38"	"0.41"	"0.62"	"-0.29"	"-1.05"	"0.08"	"84.0"	"141.9"	"64.8"	"111.6"	"129.3"	"68.5"	"13580.265625"	"22943.912109375"	"10470.384765625"	"18040.5546875"	"20907.783203125"	"11072.5263671875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"529.58782"	"0.0001108"	"8.885E-05"	"3.41"	"21.22"
"20854"	"[R].QGGGKLNFDELR.[Q]"	"1xBiotin [K5]"	"0.000688074"	"0.000586377"	"1"	"3"	"6"	"O35245-1"	"O35245-1 [729-740]"	"O35245-1 1xBiotin [K733]"	"polycystin-2 [OS=Mus musculus]"	"1"	"1559.76349"	"-9.97"	"0.04"	"0.34"	"-0.57"	"0.57"	"9.97"	"0.53"	"109.9"	""	"113.4"	"139.1"	"74.0"	"163.6"	"23594.421875"	""	"24334.828125"	"29857.01171875"	"15874.9404296875"	"35103.7578125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"780.38517"	"0.0001108"	"1.258E-05"	"2.93"	"45.36"
"3908"	"[R].DRADKSAVGFDYK.[G]"	"1xBiotin [K5]"	"0.00022592"	"0.000586377"	"1"	"1"	"11"	"P49710"	"P49710 [129-141]"	"P49710 1xBiotin [K133]"	"Hematopoietic lineage cell-specific protein [OS=Mus musculus]"	"2"	"1697.79518"	"0.54"	"-0.22"	"0.42"	"0.53"	"0.19"	"-0.35"	"0.42"	"83.0"	"121.0"	"71.0"	"110.8"	"119.4"	"94.7"	"64138.2255859375"	"93548.40625"	"54915.015625"	"85684.095703125"	"92298.6875"	"73218.943359375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"849.40105"	"0.0001108"	"2.47E-06"	"2.95"	"36.09"
"3943"	"[K].DRVDKSAVGFNEMEAPTTAYK.[K]"	"1xBiotin [K5]; 1xOxidation [M13]"	"0.000101033"	"0.000586377"	"1"	"1"	"6"	"P49710"	"P49710 [203-223]"	"P49710 1xBiotin [K207]"	"Hematopoietic lineage cell-specific protein [OS=Mus musculus]"	"2"	"2571.18540"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"857.73332"	"0.0001108"	"7.635E-07"	"4.33"	""
"20799"	"[K].QFDAYPKTLEDFR.[V]"	"1xBiotin [K7]"	"0.0076251"	"0.000586377"	"1"	"2"	"1"	"Q9CQE7"	"Q9CQE7 [9-21]"	"Q9CQE7 1xBiotin [K15]"	"Endoplasmic reticulum-Golgi intermediate compartment protein 3 [OS=Mus musculus]"	"1"	"1855.86835"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"928.43959"	"0.0001108"	"0.0004216"	"2.37"	""
"20779"	"[R].QETGFFLKNPAGSITSR.[V]"	"1xBiotin [K8]"	"0.0345607"	"0.00104877"	"1"	"1"	"4"	"P21958"	"P21958 [247-263]"	"P21958 1xBiotin [K254]"	"Antigen peptide transporter 1 [OS=Mus musculus]"	"1"	"2079.03279"	"9.97"	"9.97"	"9.97"	""	"9.97"	"-0.19"	"-0.44"	""	"138.8"	"165.0"	"174.5"	""	"121.7"	""	"11444.5810546875"	"13606.2978515625"	"14386.3095703125"	""	"10030.849609375"	""	"High"	"Peak Found"	"High"	"High"	"Not Found"	"Peak Found"	"High"	"3"	"693.68269"	"0.0001873"	"0.003896"	"2.86"	"50.44"
"20748"	"[R].QENIAKAK.[R]"	"1xBiotin [K6]"	"0.019933"	"0.000586377"	"1"	"1"	"3"	"Q3UTD9"	"Q3UTD9 [62-69]"	"Q3UTD9 1xBiotin [K67]"	"Small integral membrane protein 15 [OS=Mus musculus]"	"1"	"1127.58775"	"0.31"	"-0.18"	"0.28"	"0.46"	"-0.19"	"-0.50"	"-0.01"	"91.1"	"112.8"	"80.3"	"110.5"	"125.2"	"80.0"	"9230.53125"	"11437.099609375"	"8139.9541015625"	"11201.162109375"	"12694.998046875"	"8111.154296875"	""	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"2"	"564.29729"	"0.0001108"	"0.001724"	"2.36"	"24.39"
"20249"	"[K].NTKEMFGGFFK.[S]"	"1xBiotin [K3]"	"0.0164782"	"0.000586377"	"1"	"1"	"2"	"Q9D8U8"	"Q9D8U8 [178-188]"	"Q9D8U8 1xBiotin [K180]"	"sorting nexin-5 [OS=Mus musculus]"	"1"	"1531.70722"	"9.97"	"9.97"	"9.97"	""	"9.97"	"-0.10"	"0.07"	""	"190.9"	"169.5"	"61.1"	""	"178.4"	""	"16649.64453125"	"14785.177734375"	"5330.8232421875"	""	"15562.720703125"	""	"High"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"2"	"766.35795"	"0.0001108"	"0.001312"	"2.62"	"54.04"
"3744"	"[K].DNQTLSHSLKMADQNLEK.[L]"	"1xBiotin [K10]; 1xOxidation [M11]"	"7.03785E-05"	"0.000586377"	"1"	"2"	"8"	"Q9CQ56"	"Q9CQ56 [208-225]"	"Q9CQ56 1xBiotin [K217]"	"Vesicle transport protein USE1 [OS=Mus musculus]"	"1"	"2314.08021"	"0.46"	"0.19"	"0.15"	"-0.68"	"0.34"	"-0.12"	"0.15"	"92.2"	"126.5"	"105.0"	"102.1"	"57.8"	"116.4"	"162786.0625"	"223325.1796875"	"185250.75"	"180206.875"	"101935.46484375"	"205371.125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"772.03202"	"0.0001108"	"4.514E-07"	"5.62"	"39.32"
"20248"	"[R].NTKAFVSTSFHK.[C]"	"1xBiotin [K3]"	"0.0016984"	"0.000586377"	"1"	"1"	"5"	"Q8CJF7"	"Q8CJF7 [1254-1265]"	"Q8CJF7 1xBiotin [K1256]"	"protein elys [OS=Mus musculus]"	"1"	"1592.78897"	"0.16"	"0.12"	"0.33"	"0.03"	"0.42"	"0.26"	"0.31"	"87.9"	"98.4"	"95.5"	"110.2"	"89.9"	"118.0"	"23406.287109375"	"26187.0078125"	"25421.94140625"	"29331.751953125"	"23940.046875"	"31409.001953125"	""	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"3"	"531.60087"	"0.0001108"	"4.719E-05"	"3.46"	"36.56"
"20244"	"[R].NTGGKGVNYALAPGSQTSDLSLPDGK.[V]"	"1xBiotin [K5]"	"1.77722E-05"	"0.000586377"	"1"	"1"	"6"	"P01902"	"P01902 [333-358]"	"P01902 1xBiotin [K337]"	"h-2 class I histocompatibility antigen, K-D alpha chain [OS=Mus musculus]"	"1"	"2773.34613"	"0.98"	"0.55"	"-0.21"	"-1.91"	"-0.40"	"-1.38"	"-0.95"	"95.0"	"187.0"	"138.8"	"82.0"	"25.2"	"71.9"	"55591.2421875"	"109390"	"81168.4453125"	"47996.640625"	"14755.177734375"	"42082.1328125"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"3"	"925.12023"	"0.0001108"	"6.048E-08"	"5.27"	"44.61"
"4201"	"[K].DVNLSKTEK.[M]"	"1xBiotin [K6]"	"0.0227538"	"0.00104877"	"1"	"3"	"6"	"Q8R4D1"	"Q8R4D1 [483-491]"	"Q8R4D1 1xBiotin [K488]"	"Sodium/hydrogen exchanger 8 [OS=Mus musculus]"	"1"	"1259.63001"	"0.44"	"0.35"	"0.37"	"0.56"	"0.42"	"-0.02"	"0.07"	"77.7"	"105.1"	"98.9"	"100.2"	"114.5"	"103.6"	"54942.26171875"	"74301.7265625"	"69932.171875"	"70831.0078125"	"80983.203125"	"73279.8046875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"630.31850"	"0.0001873"	"0.002111"	"1.93"	"32.14"
"4208"	"[R].DVPISEVNKMFFLGAK.[E]"	"1xBiotin [K9]"	"0.00121831"	"0.000586377"	"1"	"1"	"3"	"Q9JHG1"	"Q9JHG1 [113-128]"	"Q9JHG1 1xBiotin [K121]"	"Phosphatidylinositol N-acetylglucosaminyltransferase subunit P [OS=Mus musculus]"	"1"	"2021.02347"	"9.97"	"9.97"	""	""	"9.97"	"0.46"	"0.70"	""	"185.8"	"157.9"	""	""	"256.3"	""	"7598.3876953125"	"6455.43017578125"	""	""	"10481.3486328125"	""	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"2"	"1011.01389"	"0.0001108"	"2.893E-05"	"2.78"	"60.06"
"19800"	"[R].NLPTKIPLPTTLASGSK.[S]"	"1xBiotin [K5]"	"0.00012176"	"0.000586377"	"1"	"1"	"14"	"O70472"	"O70472 [1497-1513]"	"O70472 1xBiotin [K1501]"	"Transmembrane protein 131 [OS=Mus musculus]"	"1"	"1964.08851"	"0.10"	"0.14"	"-0.43"	"-2.26"	"0.24"	"0.13"	"0.10"	"113.1"	"121.6"	"124.3"	"83.8"	"23.7"	"133.5"	"173464.4921875"	"186517.0625"	"190611.515625"	"128553.29296875"	"36329.1767578125"	"204748.09375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"982.54795"	"0.0001108"	"9.991E-07"	"3.02"	"51.38"
"4209"	"[R].DVPISEVNKMFFLGAK.[E]"	"1xBiotin [K9]; 1xOxidation [M10]"	"0.0022995"	"0.000586377"	"1"	"1"	"4"	"Q9JHG1"	"Q9JHG1 [113-128]"	"Q9JHG1 1xBiotin [K121]"	"Phosphatidylinositol N-acetylglucosaminyltransferase subunit P [OS=Mus musculus]"	"1"	"2037.01838"	""	""	""	""	"9.97"	"9.97"	"9.97"	""	""	""	""	""	"600.0"	""	""	""	""	""	"17421.416015625"	""	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"2"	"1019.01452"	"0.0001108"	"7.339E-05"	"2.74"	"55.09"
"19782"	"[K].NIMSSKIADR.[N]"	"1xBiotin [K6]; 1xOxidation [M3]"	"0.0129255"	"0.000586377"	"1"	"2"	"6"	"Q8C147"	"Q8C147 [922-931]"	"Q8C147 1xBiotin [K927]"	"Dedicator of cytokinesis protein 8 [OS=Mus musculus]"	"1"	"1376.66608"	"-0.36"	"0.05"	"-0.28"	"-0.82"	"0.35"	"0.71"	"0.30"	"109.6"	"85.3"	"113.3"	"89.9"	"62.2"	"139.7"	"12373.7763671875"	"9631.6201171875"	"12794.6494140625"	"10156.96484375"	"7025.32275390625"	"15773.5322265625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"688.83759"	"0.0001108"	"0.0009173"	"2.55"	"31.30"
"4220"	"[K].DVSGQVPSAGKSSPTVDK.[A]"	"1xBiotin [K]"	"0.00270689"	"0.000586377"	"1"	"1"	"7"	"Q99LI2"	"Q99LI2 [486-503]"	"Q99LI2 1xBiotin [K]"	"chloride channel CLIC-like protein 1 [OS=Mus musculus]"	"1"	"1984.96443"	"0.10"	"-0.53"	"-0.51"	"0.33"	"0.41"	"0.30"	"0.94"	"99.1"	"106.5"	"68.4"	"69.6"	"124.9"	"131.5"	"23867.361328125"	"25645.0087890625"	"16482.36328125"	"16769.5703125"	"30074.2080078125"	"31664.20703125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"992.98675"	"0.0001108"	"9.274E-05"	"2.43"	"31.93"
"4243"	"[R].DYAKGFGGQYGIQK.[D]"	"1xBiotin [K4]"	"1.89496E-05"	"0.000586377"	"1"	"1"	"18"	"P49710"	"P49710 [189-202]"	"P49710 1xBiotin [K192]"	"Hematopoietic lineage cell-specific protein [OS=Mus musculus]"	"1"	"1757.83157"	"0.28"	"0.10"	"0.09"	"-0.10"	"0.22"	"-0.07"	"0.11"	"93.1"	"113.3"	"99.9"	"98.8"	"86.9"	"108.1"	"206638.9453125"	"251505.01953125"	"221758.71484375"	"219257.2734375"	"192978.625"	"240040.34375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"879.41987"	"0.0001108"	"6.609E-08"	"4.37"	"41.03"
"19742"	"[K].NLKWLDLK.[D]"	"1xBiotin [K3]"	"0.0860801"	"0.00288886"	"1"	"1"	"4"	"Q922Q8"	"Q922Q8 [109-116]"	"Q922Q8 1xBiotin [K111]"	"Leucine-rich repeat-containing protein 59 [OS=Mus musculus]"	"1"	"1255.68674"	"-1.53"	"1.08"	"-1.92"	"-9.97"	"-0.46"	"1.06"	"-1.55"	"134.8"	"46.7"	"285.1"	"35.7"	""	"97.7"	"10772.185546875"	"3735.75610351563"	"22787.9990234375"	"2854.37109375"	""	"7806.9990234375"	""	"High"	"High"	"High"	"High"	"Not Found"	"Peak Found"	"High"	"2"	"628.34686"	"0.0004957"	"0.01535"	"2.02"	"52.32"
"19847"	"[K].NLTMSTKGALLSDVK.[D]"	"1xBiotin [K7]; 1xOxidation [M4]"	"0.00255372"	"0.000586377"	"1"	"1"	"3"	"Q8CIC2"	"Q8CIC2 [194-208]"	"Q8CIC2 1xBiotin [K200]"	"nucleoporin-like protein 2 [OS=Mus musculus]"	"1"	"1819.92923"	"0.68"	"0.25"	"0.18"	"-9.97"	"1.11"	"0.43"	"0.86"	"84.9"	"135.6"	"100.9"	"96.0"	""	"182.6"	"6554.85107421875"	"10474.091796875"	"7791.75341796875"	"7411.84301757813"	""	"14103.6572265625"	""	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"2"	"910.47032"	"0.0001108"	"8.498E-05"	"2.96"	"47.21"
"19739"	"[K].NLKLGIHEDSTNR.[R]"	"1xBiotin [K3]"	"0.00563624"	"0.000586377"	"1"	"1"	"4"	"P11499"	"P11499 [436-448]"	"P11499 1xBiotin [K438]"	"Heat shock protein HSP 90-beta [OS=Mus musculus]"	"1"	"1722.85918"	"9.97"	"9.97"	""	"9.97"	"9.97"	"-0.65"	"-0.38"	""	"200.5"	"165.5"	""	"106.6"	"127.4"	""	"22849.01171875"	"18858.189453125"	""	"12141.7958984375"	"14513.87890625"	""	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"3"	"574.95823"	"0.0001108"	"0.0002723"	"1.85"	"34.81"
"19726"	"[K].NIHLEKK.[Y]"	"1xBiotin [K6]"	"0.0918932"	"0.00334029"	"1"	"1"	"3"	"P09581"	"P09581 [699-705]"	"P09581 1xBiotin [K704]"	"Macrophage colony-stimulating factor 1 receptor [OS=Mus musculus]"	"1"	"1107.59793"	"0.50"	"-0.03"	"0.15"	"0.33"	"0.61"	"0.11"	"0.64"	"82.4"	"116.4"	"80.4"	"91.6"	"103.5"	"125.7"	"22906.365234375"	"32386.474609375"	"22369.02734375"	"25476.564453125"	"28782.904296875"	"34954.484375"	""	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"2"	"554.30252"	"0.0007348"	"0.01696"	"1.82"	"29.15"
"19723"	"[K].NIHKALVAEHLR.[G]"	"1xBiotin [K4]"	"7.28846E-05"	"0.000586377"	"1"	"2"	"10"	"Q920B0"	"Q920B0 [890-901]"	"Q920B0 1xBiotin [K893]"	"FERM domain-containing protein 4B [OS=Mus musculus]"	"1"	"1626.88969"	"0.44"	"0.37"	"0.70"	"-0.06"	"0.51"	"0.07"	"0.14"	"78.3"	"106.2"	"101.4"	"127.3"	"75.0"	"111.8"	"131580.171875"	"178425.9609375"	"170347.4765625"	"213777.125"	"126023.52734375"	"187810.78125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"542.96801"	"0.0001108"	"4.743E-07"	"4.57"	"34.13"
"4296"	"[R].EAAHPPDVSISKTALYSR.[I]"	"1xBiotin [K12]"	"0.000105858"	"0.000586377"	"1"	"4"	"12"	"Q9JJG0-1"	"Q9JJG0-1 [913-930]"	"Q9JJG0-1 1xBiotin [K924]"	"Transforming acidic coiled-coil-containing protein 2 [OS=Mus musculus]"	"1"	"2168.08046"	"0.25"	"0.03"	"-0.15"	"-1.02"	"0.09"	"-0.16"	"0.06"	"105.8"	"126.2"	"107.8"	"95.5"	"52.1"	"112.6"	"93664.734375"	"111769.9921875"	"95433.1484375"	"84594.8359375"	"46133.140625"	"99744.484375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"723.36541"	"0.0001108"	"8.172E-07"	"5.39"	"42.09"
"19709"	"[K].NIGKVLLVPGPEK.[E]"	"1xBiotin [K4]"	"0.000224606"	"0.000586377"	"1"	"1"	"6"	"Q62465"	"Q62465 [392-404]"	"Q62465 1xBiotin [K395]"	"Synaptic vesicle membrane protein VAT-1 homolog [OS=Mus musculus]"	"1"	"1589.90836"	"0.09"	"-0.16"	"-0.13"	"-0.67"	"0.03"	"-0.06"	"0.19"	"108.5"	"115.8"	"97.4"	"99.3"	"68.0"	"111.0"	"33091.20703125"	"35332.1875"	"29712.6796875"	"30306.857421875"	"20744.705078125"	"33857.875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"795.45835"	"0.0001108"	"2.459E-06"	"4.01"	"47.93"
"4318"	"[K].EAEAAKAAALLTK.[Q]"	"1xBiotin [K6]"	"7.49741E-06"	"0.000586377"	"1"	"1"	"6"	"Q8VCH8"	"Q8VCH8 [287-299]"	"Q8VCH8 1xBiotin [K292]"	"UBX domain-containing protein 4 [OS=Mus musculus]"	"1"	"1512.80904"	"0.41"	"0.04"	"0.39"	"0.03"	"0.19"	"-0.22"	"0.15"	"87.9"	"116.8"	"90.3"	"115.0"	"90.0"	"100.0"	"52936.70703125"	"70345.5078125"	"54357.5625"	"69222.0078125"	"54169.1953125"	"60216.01953125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"756.90772"	"0.0001108"	"1.714E-08"	"4.25"	"44.87"
"19704"	"[K].NIFSFYLNR.[D]"	""	"0.0108008"	"0.000586377"	"1"	"1"	"5"	"P18242"	"P18242 [225-233]"	""	"Cathepsin D [OS=Mus musculus]"	"0"	"1173.60512"	"0.47"	"-0.02"	"0.32"	"-9.97"	"0.36"	"-0.12"	"0.38"	"101.7"	"141.1"	"100.2"	"127.0"	""	"130.0"	"22690.556640625"	"31487.15234375"	"22374.5"	"28352.93359375"	""	"29021.11328125"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"2"	"587.30527"	"0.0001108"	"0.0007045"	"2.39"	"52.62"
"19673"	"[K].NICKVVEVGSK.[I]"	"1xBiotin [K4]; 1xCarbamidomethyl [C3]"	"0.000557798"	"0.000586377"	"1"	"2"	"6"	"P52480"	"P52480 [163-173]"	"P52480 1xBiotin [K166]"	"Pyruvate kinase PKM [OS=Mus musculus]"	"1"	"1458.74433"	"0.27"	"0.11"	"0.25"	"0.45"	"-9.97"	"-9.97"	"-9.97"	"102.7"	"123.9"	"111.2"	"122.4"	"139.9"	""	"16048.4580078125"	"19361.958984375"	"17376.677734375"	"19138.3671875"	"21873.900390625"	""	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"729.87568"	"0.0001108"	"9.275E-06"	"2.69"	"37.55"
"4325"	"[R].EAEESSKIR.[A]"	"1xBiotin [K7]"	"0.0172571"	"0.000586377"	"1"	"1"	"5"	"Q9DBG7"	"Q9DBG7 [123-131]"	"Q9DBG7 1xBiotin [K129]"	"signal recognition particle receptor subunit alpha [OS=Mus musculus]"	"1"	"1274.60453"	"-1.21"	"0.15"	"0.02"	"0.36"	"-0.08"	"1.13"	"-0.23"	"103.6"	"44.9"	"115.2"	"104.9"	"133.3"	"98.2"	"114485.212890625"	"49575.21875"	"127266.484375"	"115940.578125"	"147308.484375"	"108463.7265625"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"2"	"637.80532"	"0.0001108"	"0.001401"	"2.17"	"26.74"
"19737"	"[K].NLKEAMR.[M]"	"1xBiotin [K3]; 1xOxidation [M6]"	"0.057158"	"0.0019826"	"1"	"5"	"7"	"Q99K01"	"Q99K01 [19-25]"	"Q99K01 1xBiotin [K21]"	"Pyridoxal-dependent decarboxylase domain-containing protein 1 [OS=Mus musculus]"	"1"	"1103.53361"	"-0.17"	"0.19"	"0.01"	"-1.48"	"0.13"	"0.30"	"-0.06"	"109.3"	"97.1"	"124.7"	"109.9"	"39.3"	"119.8"	"54675.4140625"	"48588.9140625"	"62394.0078125"	"54966.17578125"	"19643.927734375"	"59927.00390625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"552.27066"	"0.0003442"	"0.008236"	"1.60"	"25.87"
"4200"	"[R].DVNGVTKSR.[F]"	"1xBiotin [K7]"	"0.0177622"	"0.000586377"	"1"	"1"	"6"	"Q9CZV8-1"	"Q9CZV8-1 [4-12]"	"Q9CZV8-1 1xBiotin [K10]"	"F-box/LRR-repeat protein 20 [OS=Mus musculus]"	"1"	"1201.59938"	"-9.97"	"0.53"	"0.29"	"0.60"	"-9.97"	""	"-9.97"	"115.8"	""	"167.4"	"141.4"	"175.4"	""	"19619.69140625"	""	"28349.025390625"	"23951.705078125"	"29699.056640625"	""	""	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"2"	"601.30311"	"0.0001108"	"0.001456"	"2.09"	"26.38"
"19919"	"[K].NMSKVDCK.[G]"	"1xBiotin [K4]; 1xCarbamidomethyl [C7]; 1xOxidation [M2]"	"0.00593905"	"0.000586377"	"1"	"1"	"11"	"Q91WE4"	"Q91WE4 [44-51]"	"Q91WE4 1xBiotin [K47]"	"UPF0729 protein C18orf32 homolog [OS=Mus musculus]"	"1"	"1223.52173"	"0.25"	"0.07"	"0.26"	"-0.61"	"0.04"	"-0.22"	"-0.03"	"98.0"	"117.0"	"102.8"	"117.6"	"64.1"	"100.5"	"124768.3359375"	"148884.828125"	"130855.7578125"	"149693.890625"	"81536.078125"	"127850.8828125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"612.26449"	"0.0001108"	"0.0002928"	"2.75"	"21.24"
"4195"	"[K].DVITGLKQK.[T]"	"1xBiotin [K]"	"0.0299637"	"0.00104877"	"1"	"1"	"4"	"Q61093"	"Q61093 [500-508]"	"Q61093 1xBiotin [K]"	"Cytochrome b-245 heavy chain [OS=Mus musculus]"	"1"	"1227.67657"	"-0.39"	"0.41"	"0.06"	"-9.97"	"-0.20"	"0.19"	"-0.62"	"119.9"	"91.3"	"159.7"	"125.1"	""	"104.1"	"34096.32421875"	"25966.181640625"	"45408.03125"	"35569.30078125"	""	"29600.5625"	""	"High"	"High"	"Peak Found"	"High"	"Not Found"	"High"	"High"	"2"	"614.34211"	"0.0001873"	"0.003172"	"2.37"	"39.74"
"20243"	"[R].NTGGKGGDYALAPGSQSSEMSLR.[D]"	"1xBiotin [K5]; 1xOxidation [M20]"	"7.58537E-06"	"0.000586377"	"1"	"3"	"6"	"P01896"	"P01896 [146-168]"	"P01896 1xBiotin [K150]"	"H-2 class I histocompatibility antigen, alpha chain [OS=Mus musculus]"	"1"	"2525.13951"	"-9.97"	"0.19"	"-0.08"	"-0.80"	"-0.16"	"9.97"	"-0.35"	"131.9"	""	"149.9"	"124.6"	"75.8"	"117.8"	"41559.88671875"	""	"47257.84765625"	"39280.83984375"	"23878.021484375"	"37127.375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"842.38500"	"0.0001108"	"1.751E-08"	"4.43"	"36.71"
"4117"	"[R].DTLQLSIKQR.[L]"	"1xBiotin [K8]"	"0.00563624"	"0.000586377"	"1"	"1"	"6"	"Q3ZK22-1"	"Q3ZK22-1 [717-726]"	"Q3ZK22-1 1xBiotin [K724]"	"vezatin [OS=Mus musculus]"	"1"	"1427.76751"	"0.09"	"0.36"	"0.23"	"-0.07"	"0.21"	"0.12"	"-0.15"	"90.5"	"96.4"	"116.1"	"106.2"	"85.9"	"104.9"	"24234.39453125"	"25813.16796875"	"31077.505859375"	"28436.548828125"	"23006.896484375"	"28080.681640625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"714.38765"	"0.0001108"	"0.0002704"	"2.79"	"42.22"
"20196"	"[K].NSQPVKTLPPAISAEPSITLSK.[G]"	"1xBiotin [K6]"	"0.000660557"	"0.000586377"	"1"	"1"	"14"	"Q80WJ7"	"Q80WJ7 [502-523]"	"Q80WJ7 1xBiotin [K507]"	"protein LYRIC [OS=Mus musculus]"	"1"	"2504.34289"	"0.39"	"0.32"	"0.12"	"-2.25"	"0.07"	"-0.32"	"-0.25"	"101.6"	"133.3"	"126.6"	"110.5"	"21.3"	"106.7"	"21984.02734375"	"28838.462890625"	"27381.734375"	"23912.181640625"	"4609.96435546875"	"23092.310546875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"835.45151"	"0.0001108"	"1.187E-05"	"3.84"	"48.64"
"4121"	"[K].DTNKVSLAILQK.[Q]"	"1xBiotin [K4]"	"0.000256844"	"0.000586377"	"1"	"1"	"6"	"Q8R1P5"	"Q8R1P5 [351-362]"	"Q8R1P5 1xBiotin [K354]"	"potassium channel subfamily K member 13 [OS=Mus musculus]"	"1"	"1555.85124"	"0.30"	"-0.10"	"0.05"	"-0.50"	"0.05"	"-0.25"	"0.15"	"100.9"	"124.1"	"94.4"	"104.7"	"71.2"	"104.7"	"35598.6171875"	"43768.48828125"	"33282.94140625"	"36922.81640625"	"25128.705078125"	"36908.84765625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"778.42914"	"0.0001108"	"2.981E-06"	"3.41"	"48.03"
"20127"	"[R].NRPPLAAGANSKGPPDFSSDEEREPTPVLGSGASVGR.[G]"	"1xBiotin [K12]"	"1.61744E-06"	"0.000586377"	"1"	"6"	"3"	"Q61029"	"Q61029 [49-85]"	"Q61029 1xBiotin [K60]"	"Lamina-associated polypeptide 2, isoforms beta/delta/epsilon/gamma [OS=Mus musculus]"	"2"	"3945.91480"	"-0.04"	"-0.03"	"-0.90"	"-9.97"	"0.26"	"0.30"	"0.29"	"128.3"	"124.5"	"125.3"	"68.5"	""	"153.5"	"64714.390625"	"62811.0078125"	"63220.08984375"	"34567.09375"	""	"77437.125"	""	"High"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"High"	"High"	"4"	"987.23384"	"0.0001108"	"1.831E-09"	"5.97"	"40.78"
"20093"	"[K].NQNKLLAEMDSQFDSTTGFLGK.[T]"	"1xBiotin [K4]; 1xOxidation [M9]"	"5.77206E-05"	"0.000586377"	"1"	"1"	"5"	"O35623"	"O35623 [59-80]"	"O35623 1xBiotin [K62]"	"BET1 homolog [OS=Mus musculus]"	"1"	"2686.24873"	"-0.29"	"0.05"	"-0.10"	"-9.97"	"0.04"	"0.32"	"-0.02"	"124.7"	"102.1"	"129.3"	"116.1"	""	"127.8"	"31721.3359375"	"25990.76953125"	"32892.453125"	"29550.953125"	""	"32530.71875"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"896.08809"	"0.0001108"	"3.373E-07"	"4.28"	"50.26"
"20073"	"[R].NQKLSSVEEDPGANQER.[K]"	"1xBiotin [K3]"	"0.000198719"	"0.000586377"	"1"	"1"	"10"	"Q01237"	"Q01237 [379-395]"	"Q01237 1xBiotin [K381]"	"3-hydroxy-3-methylglutaryl-coenzyme a reductase [OS=Mus musculus]"	"1"	"2126.97712"	""	"9.97"	""	"9.97"	"9.97"	"9.97"	"0.61"	""	""	"111.6"	""	"318.4"	"170.0"	""	""	"18510.16015625"	""	"52801.099609375"	"28194.154296875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"1063.99225"	"0.0001108"	"2.05E-06"	"2.66"	"33.40"
"4138"	"[K].DTYLKGLVK.[G]"	"1xBiotin [K5]"	"0.0253774"	"0.00104877"	"1"	"1"	"5"	"Q3TZZ7-1"	"Q3TZZ7-1 [325-333]"	"Q3TZZ7-1 1xBiotin [K329]"	"Extended synaptotagmin-2 [OS=Mus musculus]"	"1"	"1262.68132"	"9.97"	""	"9.97"	"9.97"	"9.97"	"-0.19"	"9.97"	""	"165.8"	""	"177.6"	"111.1"	"145.5"	""	"18282.939453125"	""	"19579.919921875"	"12249.6015625"	"16040.9697265625"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"2"	"631.84435"	"0.0001873"	"0.002464"	"2.38"	"45.03"
"20017"	"[K].NPITSPVVTSKK.[A]"	"1xBiotin [K11]"	"0.000444342"	"0.000586377"	"1"	"1"	"6"	"Q01237"	"Q01237 [352-363]"	"Q01237 1xBiotin [K362]"	"3-hydroxy-3-methylglutaryl-coenzyme a reductase [OS=Mus musculus]"	"1"	"1496.81413"	"0.54"	"0.27"	"0.30"	"0.73"	"0.13"	"-0.40"	"-0.13"	"78.6"	"114.1"	"94.5"	"96.8"	"129.9"	"86.2"	"17257.501953125"	"25039.302734375"	"20741.568359375"	"21244.634765625"	"28525.14453125"	"18913.61328125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"748.91057"	"0.0001108"	"6.635E-06"	"3.49"	"35.64"
"20010"	"[K].NPKYNTQR.[A]"	"1xBiotin [K3]"	"0.00939743"	"0.000586377"	"1"	"1"	"6"	"P49769"	"P49769 [312-319]"	"P49769 1xBiotin [K314]"	"Presenilin-1 [OS=Mus musculus]"	"1"	"1246.59972"	"0.30"	"0.20"	"-0.12"	"0.16"	"0.42"	"0.12"	"0.22"	"88.9"	"109.2"	"102.1"	"81.6"	"99.4"	"118.8"	"52434.546875"	"64406.4140625"	"60174.20703125"	"48117.47265625"	"58585.9453125"	"70019.1796875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"623.80364"	"0.0001108"	"0.0005749"	"2.74"	"23.68"
"4142"	"[K].DVAKQLK.[E]"	"1xBiotin [K4]"	"0.110368"	"0.00731053"	"1"	"2"	"1"	"P61620"	"P61620 [389-395]"	"P61620 1xBiotin [K392]"	"Protein transport protein Sec61 subunit alpha isoform 1 [OS=Mus musculus]"	"1"	"1027.56048"	"-0.02"	"-0.23"	"-0.15"	"-0.09"	"-0.27"	"-0.25"	"-0.04"	"108.8"	"107.4"	"93.0"	"97.8"	"102.5"	"90.5"	"108919.984375"	"107515.1640625"	"93045.7421875"	"97854.34375"	"102568.25"	"90535.078125"	""	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"2"	"514.28378"	"0.001478"	"0.02231"	"2.10"	"29.67"
"20001"	"[R].NPGNLYDKAGK.[V]"	"1xBiotin [K8]"	"0.000202226"	"0.000586377"	"1"	"1"	"7"	"Q3TDQ1"	"Q3TDQ1 [503-513]"	"Q3TDQ1 1xBiotin [K510]"	"Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B [OS=Mus musculus]"	"1"	"1402.67836"	"0.39"	"0.31"	"0.56"	"0.37"	"0.32"	"-0.07"	"0.02"	"79.3"	"104.0"	"98.1"	"117.0"	"102.3"	"99.4"	"121209.34375"	"158865.890625"	"149835.84375"	"178703.390625"	"156362.25"	"151808.453125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"701.84285"	"0.0001108"	"2.104E-06"	"3.42"	"33.87"
"19975"	"[K].NPAYLKSVSLQEPR.[G]"	"1xBiotin [K6]"	"0.000128321"	"0.000586377"	"1"	"1"	"4"	"Q80WQ6"	"Q80WQ6 [52-65]"	"Q80WQ6 1xBiotin [K57]"	"Inactive rhomboid protein 2 [OS=Mus musculus]"	"1"	"1827.94218"	""	"9.97"	"9.97"	"9.97"	""	""	"-9.97"	""	""	"232.3"	"204.9"	"162.8"	""	""	""	"14924.2265625"	"13166.64453125"	"10462.5068359375"	""	""	"High"	"Not Found"	"High"	"High"	"High"	"Not Found"	"High"	"2"	"914.47535"	"0.0001108"	"1.078E-06"	"3.36"	"43.54"
"19972"	"[K].NPALKAQSGPVR.[S]"	"1xBiotin [K5]"	"0.000424091"	"0.000586377"	"1"	"1"	"5"	"P40124"	"P40124 [282-293]"	"P40124 1xBiotin [K286]"	"adenylyl cyclase-associated protein 1 [OS=Mus musculus]"	"1"	"1463.77874"	"-0.06"	"0.09"	"-0.13"	"-0.40"	"-0.05"	"0.01"	"-0.14"	"106.0"	"101.4"	"113.1"	"97.0"	"80.2"	"102.4"	"17714.796875"	"16949.11328125"	"18902.337890625"	"16204.58984375"	"13404.2041015625"	"17110.39453125"	""	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"2"	"732.39327"	"0.0001108"	"6.181E-06"	"3.39"	"31.52"
"19961"	"[K].NNSYGKSLSNSK.[H]"	"1xBiotin [K6]"	"0.00918183"	"0.000586377"	"1"	"2"	"4"	"O35495"	"O35495 [457-468]"	"O35495 1xBiotin [K462]"	"Cyclin-dependent kinase 14 [OS=Mus musculus]"	"1"	"1524.71112"	"9.97"	"9.97"	""	"9.97"	"9.97"	"-0.15"	"-0.12"	""	"163.0"	"159.0"	""	"131.2"	"146.8"	""	"7962.87109375"	"7769.61328125"	""	"6410.546875"	"7171.7099609375"	""	"High"	"High"	"High"	"Not Found"	"Peak Found"	"High"	"High"	"2"	"762.85927"	"0.0001108"	"0.0005547"	"2.24"	"29.17"
"4185"	"[K].DVLGPSTVVANSDEPQHLTPGKMSQR.[Q]"	"1xBiotin [K22]; 1xOxidation [M23]"	"0.0020111"	"0.000586377"	"1"	"1"	"5"	"B9EJ86"	"B9EJ86 [21-46]"	"B9EJ86 1xBiotin [K42]"	"Oxysterol-binding protein-related protein 8 [OS=Mus musculus]"	"1"	"3005.44553"	"-9.97"	"0.47"	"-9.97"	"-9.97"	"0.61"	"9.97"	"0.14"	"153.1"	""	"212.5"	""	""	"234.4"	"14592.296875"	""	"20254.732421875"	""	""	"22333.970703125"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"1002.48577"	"0.0001108"	"6.022E-05"	"3.50"	"39.45"
"19949"	"[K].NNLSGSSSSNGANCMNGYMGGSHLAEEQGTCKATGNLHFR.[A]"	"1xBiotin [K32]; 2xCarbamidomethyl [C14; C31]; 2xOxidation [M15; M19]"	"1.11363E-06"	"0.000586377"	"1"	"1"	"5"	"Q9D6K9"	"Q9D6K9 [366-405]"	"Q9D6K9 1xBiotin [K397]"	"Ceramide synthase 5 [OS=Mus musculus]"	"1"	"4473.87581"	"-9.97"	"-0.04"	"-9.97"	"-9.97"	"0.29"	"9.97"	"0.33"	"188.0"	""	"182.2"	""	""	"229.8"	"121267.90625"	""	"117555.7265625"	""	""	"148219.640625"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"4"	"1119.22447"	"0.0001108"	"1.061E-09"	"6.19"	"36.44"
"19947"	"[R].NNLQFGKTLGAGAFGK.[V]"	"1xBiotin [K7]"	"3.43501E-05"	"0.000586377"	"1"	"1"	"12"	"P09581"	"P09581 [578-593]"	"P09581 1xBiotin [K584]"	"Macrophage colony-stimulating factor 1 receptor [OS=Mus musculus]"	"1"	"1848.94251"	"0.13"	"0.17"	"-0.40"	"-1.82"	"0.21"	"0.08"	"0.04"	"110.7"	"121.2"	"124.6"	"83.8"	"31.4"	"128.4"	"364617.296875"	"399325.1484375"	"410532.46875"	"276072.40625"	"103397.466796875"	"422881.265625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"924.97499"	"0.0001108"	"1.584E-07"	"4.10"	"48.19"
"19939"	"[K].NNLDPDLPYKFLK.[A]"	"1xBiotin [K10]"	"0.000272267"	"0.000586377"	"1"	"1"	"13"	"Q9CXR1"	"Q9CXR1 [322-334]"	"Q9CXR1 1xBiotin [K331]"	"Dehydrogenase/reductase SDR family member 7 [OS=Mus musculus]"	"1"	"1802.91457"	"0.11"	"-0.21"	"-0.61"	"-3.11"	"0.05"	"-0.06"	"0.26"	"126.3"	"136.2"	"109.2"	"82.7"	"14.6"	"130.9"	"162633.115234375"	"175441.892578125"	"140667.177734375"	"106527.584960938"	"18804.474609375"	"168519.96484375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"901.96087"	"0.0001108"	"3.249E-06"	"3.42"	"54.44"
"4114"	"[R].DTIFQKER.[F]"	"1xBiotin [K6]"	"0.0119882"	"0.000586377"	"1"	"2"	"5"	"P28867-1"	"P28867-1 [217-224]"	"P28867-1 1xBiotin [K222]"	"protein kinase C delta type [OS=Mus musculus]"	"1"	"1262.61978"	"0.15"	"-0.06"	"0.35"	"0.28"	"0.08"	"-0.07"	"0.14"	"90.6"	"100.8"	"87.1"	"115.9"	"109.8"	"95.8"	"116032.6875"	"129111.1484375"	"111519.59375"	"148354.96875"	"140510.109375"	"122620.796875"	""	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"2"	"631.81342"	"0.0001108"	"0.0008172"	"2.31"	"39.51"
"3743"	"[K].DNQTLSHSLKMADQNLEK.[L]"	"1xBiotin [K10]"	"1.0393E-05"	"0.000586377"	"1"	"2"	"6"	"Q9CQ56"	"Q9CQ56 [208-225]"	"Q9CQ56 1xBiotin [K217]"	"Vesicle transport protein USE1 [OS=Mus musculus]"	"1"	"2298.08529"	"0.81"	"0.84"	"0.35"	"-0.09"	"0.40"	"-0.41"	"-0.44"	"74.2"	"130.5"	"132.8"	"94.5"	"69.9"	"98.0"	"47364.84765625"	"83310.984375"	"84745.109375"	"60313.53515625"	"44605.02734375"	"62555.71875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"766.69989"	"0.0001108"	"2.76E-08"	"4.77"	"42.13"
"21257"	"[R].QISFKAEVNSSGK.[T]"	"1xBiotin [K5]"	"0.000107099"	"0.000586377"	"1"	"1"	"13"	"Q9JJZ4"	"Q9JJZ4 [182-194]"	"Q9JJZ4 1xBiotin [K186]"	"ubiquitin-conjugating enzyme e2 j1 [OS=Mus musculus]"	"1"	"1620.80502"	"0.11"	"0.03"	"0.03"	"0.09"	"0.19"	"0.08"	"0.17"	"94.9"	"102.3"	"96.7"	"96.7"	"100.9"	"108.5"	"357963.251953125"	"386215.3125"	"365052.124023438"	"365001.907226563"	"380628.139648438"	"409402.435546875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"810.90590"	"0.0001108"	"8.291E-07"	"3.87"	"39.88"
"3730"	"[R].DNIQGITKPAIR.[R]"	"1xBiotin [K8]"	"0.000598224"	"0.000586377"	"1"	"1"	"8"	"P62806"	"P62806 [25-36]"	"P62806 1xBiotin [K32]"	"histone H4 [OS=Mus musculus]"	"0"	"1551.83117"	"0.29"	"0.31"	"0.10"	"0.10"	"0.41"	"0.12"	"0.11"	"86.5"	"105.9"	"107.0"	"92.8"	"92.6"	"115.1"	"82705.6875"	"101249.609375"	"102268.516113281"	"88742.65625"	"88529.5988769531"	"110012.583007813"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"776.41959"	"0.0001108"	"1.027E-05"	"3.08"	"41.28"
"23182"	"[K].SAVGFNEMEAPTTAYKK.[T]"	"1xBiotin [K]; 1xOxidation [M8]"	"5.01372E-06"	"0.000586377"	"1"	"1"	"8"	"P49710"	"P49710 [208-224]"	"P49710 1xBiotin [K]"	"Hematopoietic lineage cell-specific protein [OS=Mus musculus]"	"1"	"2085.96199"	"0.02"	"0.05"	"-9.97"	"-0.54"	"-0.33"	"-0.35"	"-0.38"	"132.6"	"134.4"	"136.8"	""	"91.0"	"105.2"	"87553.2109375"	"88793.71875"	"90368.9765625"	""	"60104.7890625"	"69451.072265625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"1043.48523"	"0.0001108"	"9.5E-09"	"3.19"	"37.85"
"23181"	"[K].SAVGFNEMEAPTTAYKK.[T]"	"1xBiotin [K]"	"7.77131E-05"	"0.000586377"	"1"	"1"	"6"	"P49710"	"P49710 [208-224]"	"P49710 1xBiotin [K]"	"Hematopoietic lineage cell-specific protein [OS=Mus musculus]"	"1"	"2069.96707"	""	""	""	"9.97"	""	""	""	""	""	""	""	"600.0"	""	""	""	""	""	"17746.6328125"	""	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"1035.48756"	"0.0001108"	"5.217E-07"	"3.87"	"42.66"
"23173"	"[K].SATTTVMNPKFAES.[-]"	"1xBiotin [K10]; 1xOxidation [M7]"	"0.0270297"	"0.00104877"	"1"	"1"	"4"	"P11835"	"P11835 [758-771]"	"P11835 1xBiotin [K767]"	"Integrin beta-2 [OS=Mus musculus]"	"1"	"1725.78223"	"0.02"	"-0.08"	"0.34"	"-0.58"	"0.15"	"0.13"	"0.23"	"99.8"	"101.5"	"94.5"	"126.3"	"66.9"	"111.0"	"66985.71875"	"68125.4375"	"63380.7421875"	"84752.90625"	"44911.0078125"	"74453.28125"	""	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"2"	"863.39544"	"0.0001873"	"0.002711"	"2.27"	"38.73"
"23172"	"[K].SATTTVMNPKFAES.[-]"	"1xBiotin [K10]"	"0.0531403"	"0.0019826"	"1"	"1"	"5"	"P11835"	"P11835 [758-771]"	"P11835 1xBiotin [K767]"	"Integrin beta-2 [OS=Mus musculus]"	"1"	"1709.78732"	"0.64"	"0.02"	"0.38"	"1.76"	"0.50"	"-0.14"	"0.49"	"62.0"	"96.8"	"62.7"	"80.8"	"209.9"	"87.8"	"27636.92578125"	"43175.61328125"	"27945.62109375"	"36059.24609375"	"93624.2578125"	"39178.484375"	""	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"2"	"855.39713"	"0.0002716"	"0.007405"	"2.51"	"43.98"
"23160"	"[R].SASKPAFSINHLSGKGLSSSTSHDSSCSLR.[S]"	"1xBiotin [K15]; 1xCarbamidomethyl [C27]"	"4.53643E-07"	"0.000586377"	"1"	"5"	"7"	"Q9D666-1"	"Q9D666-1 [97-126]"	"Q9D666-1 1xBiotin [K111]"	"SUN domain-containing protein 1 [OS=Mus musculus]"	"1"	"3331.57940"	"0.57"	"0.60"	"-1.28"	"-9.97"	"0.80"	"0.23"	"0.20"	"97.5"	"144.8"	"147.8"	"40.3"	""	"169.6"	"90119.45703125"	"133859.484375"	"136637.296875"	"37215.0927734375"	""	"156732.7265625"	""	"High"	"High"	"High"	"Peak Found"	"Not Found"	"High"	"High"	"4"	"833.65042"	"0.0001108"	"2.851E-10"	"5.24"	"37.35"
"3440"	"[R].DKYEPAAVSEHGDKK.[G]"	"1xBiotin [K2]"	"0.000209427"	"0.000586377"	"1"	"1"	"4"	"Q8VDN2"	"Q8VDN2 [8-22]"	"Q8VDN2 1xBiotin [K9]"	"Sodium/potassium-transporting ATPase subunit alpha-1 [OS=Mus musculus]"	"2"	"1899.89054"	"1.20"	"1.11"	"0.61"	"-9.97"	"-0.04"	"-1.24"	"-1.16"	"75.4"	"172.7"	"163.3"	"115.3"	""	"73.3"	"22945.4296875"	"52545.06640625"	"49676.064453125"	"35098.76953125"	""	"22306.171875"	""	"High"	"High"	"High"	"Peak Found"	"Not Found"	"High"	"High"	"2"	"950.44767"	"0.0001108"	"2.21E-06"	"2.91"	"27.14"
"23158"	"[K].SASKAVKPK.[A]"	"1xBiotin [K4]"	"0.0117136"	"0.000586377"	"1"	"1"	"8"	"P15864"	"P15864 [187-195]"	"P15864 1xBiotin [K190]"	"Histone H1.2 [OS=Mus musculus]"	"1"	"1141.63979"	"0.60"	"0.42"	"0.58"	"0.32"	"0.41"	"-0.19"	"-0.01"	"75.7"	"114.8"	"101.0"	"113.4"	"94.7"	"100.3"	"18821.94921875"	"28534.9829101563"	"25110.7202148438"	"28191.2119140625"	"23528.0219726563"	"24930.9052734375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"571.32343"	"0.0001108"	"0.0007934"	"2.09"	"17.67"
"23138"	"[R].SAPGGGNKVPQK.[K]"	"1xBiotin [K8]"	"0.0106763"	"0.000586377"	"1"	"1"	"6"	"Q61937"	"Q61937 [143-154]"	"Q61937 1xBiotin [K150]"	"Nucleophosmin [OS=Mus musculus]"	"1"	"1365.69434"	"0.68"	"0.40"	"0.27"	"0.20"	"0.41"	"-0.27"	"0.02"	"78.8"	"126.7"	"103.9"	"94.9"	"90.8"	"105.0"	"16971.646484375"	"27275.95703125"	"22364.638671875"	"20441.7890625"	"19542.9375"	"22604.17578125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"683.35092"	"0.0001108"	"0.0006915"	"2.23"	"24.22"
"24776"	"[K].SVLGFKASEAER.[Q]"	"1xBiotin [K6]"	"0.000216884"	"0.000586377"	"1"	"3"	"7"	"Q3ZK22-1"	"Q3ZK22-1 [588-599]"	"Q3ZK22-1 1xBiotin [K593]"	"vezatin [OS=Mus musculus]"	"1"	"1519.75734"	"0.39"	"0.44"	"0.17"	"0.00"	"0.33"	"-0.05"	"-0.10"	"85.2"	"111.4"	"115.2"	"95.9"	"85.1"	"107.3"	"197739.765625"	"258658.198242188"	"267383.30078125"	"222517.450195313"	"197591.725585938"	"248989.26171875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"760.38226"	"0.0001108"	"2.335E-06"	"3.12"	"41.92"
"23136"	"[K].SAPATGGVKKPHR.[Y]"	"1xBiotin [K9]"	"0.0019878"	"0.000586377"	"1"	"2"	"6"	"P68433"	"P68433 [29-41]"	"P68433 1xBiotin [K37]"	"Histone H3.1 [OS=Mus musculus]"	"1"	"1531.81619"	"0.40"	"-0.08"	"0.26"	"0.27"	"0.36"	"-0.04"	"0.45"	"86.3"	"113.9"	"81.4"	"103.3"	"104.3"	"110.8"	"13399.6455078125"	"17696.978515625"	"12640.263671875"	"16052.9423828125"	"16210.8046875"	"17210.287109375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"511.27688"	"0.0001108"	"5.908E-05"	"2.90"	"18.95"
"3442"	"[R].DKYMAEPWDPSHAPDNFR.[E]"	"1xBiotin [K2]; 1xOxidation [M4]"	"0.00446612"	"0.000586377"	"1"	"1"	"3"	"Q9JIS8"	"Q9JIS8 [987-1004]"	"Q9JIS8 1xBiotin [K988]"	"Solute carrier family 12 member 4 [OS=Mus musculus]"	"1"	"2418.02778"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"3"	"806.68055"	"0.0001108"	"0.0001936"	"1.55"	""
"3444"	"[K].DKYVKGLIEGK.[S]"	"1xBiotin [K5]"	"0.000454828"	"0.000586377"	"1"	"2"	"11"	"Q3U7R1"	"Q3U7R1 [335-345]"	"Q3U7R1 1xBiotin [K339]"	"Extended synaptotagmin-1 [OS=Mus musculus]"	"2"	"1475.79266"	"0.03"	"-0.16"	"0.07"	"-0.65"	"0.01"	"-0.02"	"0.17"	"107.0"	"108.9"	"95.5"	"112.7"	"68.2"	"107.6"	"354753.4609375"	"361099.7109375"	"316686.0390625"	"373554.890625"	"225971.265625"	"356562.21875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"738.40009"	"0.0001108"	"6.871E-06"	"4.12"	"38.72"
"3471"	"[K].DLELLYPFKEK.[V]"	"1xBiotin [K9]"	"0.00297128"	"0.000586377"	"1"	"1"	"5"	"Q9D379"	"Q9D379 [278-288]"	"Q9D379 1xBiotin [K286]"	"epoxide hydrolase 1 [OS=Mus musculus]"	"1"	"1620.83419"	"0.50"	"0.31"	"-0.51"	"-9.97"	"0.51"	"0.01"	"0.20"	"103.7"	"146.5"	"128.9"	"72.9"	""	"148.0"	"17027.93359375"	"24052.677734375"	"21151.94140625"	"11963.2705078125"	""	"24295.390625"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"2"	"810.92073"	"0.0001108"	"0.0001062"	"2.91"	"57.65"
"23104"	"[R].SAHGTLGSSSQPLFEPQAEKR.[S]"	"1xBiotin [K20]"	"1.6189E-05"	"0.000586377"	"1"	"2"	"7"	"Q8K078"	"Q8K078 [45-65]"	"Q8K078 1xBiotin [K64]"	"solute carrier organic anion transporter family member 4A1 [OS=Mus musculus]"	"1"	"2453.18778"	"0.41"	"0.14"	"0.45"	"0.33"	"0.26"	"-0.14"	"0.12"	"82.7"	"109.8"	"91.2"	"112.8"	"104.2"	"99.3"	"62711.30078125"	"83265.296875"	"69132.9140625"	"85574.46875"	"78987.46875"	"75317.21875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"818.40158"	"0.0001108"	"5.278E-08"	"5.22"	"38.18"
"23101"	"[R].SAGSGGWEVVKR.[G]"	"1xBiotin [K11]"	"0.00190835"	"0.000586377"	"1"	"1"	"4"	"Q8BM55"	"Q8BM55 [5-16]"	"Q8BM55 1xBiotin [K15]"	"Transmembrane protein 214 [OS=Mus musculus]"	"1"	"1458.71581"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"High"	"Not Found"	"High"	"High"	"Not Found"	"High"	"2"	"729.86247"	"0.0001108"	"5.591E-05"	"3.19"	""
"3478"	"[K].DIESYKSGSGVNNR.[R]"	"1xBiotin [K6]"	"0.000145038"	"0.000586377"	"1"	"1"	"9"	"O88630"	"O88630 [145-158]"	"O88630 1xBiotin [K150]"	"Golgi SNAP receptor complex member 1 [OS=Mus musculus]"	"1"	"1751.80172"	"0.50"	"0.55"	"0.02"	"0.66"	"0.56"	"0.05"	"0.00"	"75.5"	"107.0"	"110.8"	"76.4"	"119.3"	"111.1"	"81261.53515625"	"115167.794921875"	"119321.185546875"	"82284.5859375"	"128478.677734375"	"119587.888671875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"876.40403"	"0.0001108"	"1.292E-06"	"3.58"	"35.24"
"23095"	"[R].SAGIKVIMVTGDHPITAK.[A]"	"1xBiotin [K5]"	"0.000113531"	"0.000586377"	"1"	"5"	"3"	"Q8VDN2"	"Q8VDN2 [608-625]"	"Q8VDN2 1xBiotin [K612]"	"Sodium/potassium-transporting ATPase subunit alpha-1 [OS=Mus musculus]"	"1"	"2064.09803"	""	""	""	""	"9.97"	"9.97"	"9.97"	""	""	""	""	""	"600.0"	""	""	""	""	""	"11996.744140625"	""	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"688.70390"	"0.0001108"	"9.052E-07"	"4.02"	"45.02"
"3485"	"[K].DLGLKTSSLVLEK.[C]"	"1xBiotin [K5]"	"0.000107726"	"0.000586377"	"1"	"1"	"9"	"Q6ZPJ0"	"Q6ZPJ0 [390-402]"	"Q6ZPJ0 1xBiotin [K394]"	"Testis-expressed protein 2 [OS=Mus musculus]"	"1"	"1628.89277"	"0.31"	"0.44"	"-0.11"	"-1.40"	"0.39"	"0.07"	"-0.05"	"96.7"	"119.9"	"130.9"	"89.6"	"36.7"	"126.2"	"127846.53125"	"158634.125"	"173153.515625"	"118444.7890625"	"48516.34765625"	"166965.421875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"814.95028"	"0.0001108"	"8.381E-07"	"3.95"	"49.99"
"23135"	"[K].SAPAPKK.[G]"	"1xBiotin [K]"	"0.111552"	"0.00731053"	"2"	"9"	"4"	"Q64525; P10854"	"Q64525 [7-13]; P10854 [7-13]"	"Q64525 1xBiotin [K]; P10854 1xBiotin [K]"	"Histone H2B type 2-B [OS=Mus musculus];Histone H2B type 1-M [OS=Mus musculus]"	"1"	"924.49715"	"0.73"	"0.47"	"0.48"	"0.64"	"0.49"	"-0.25"	"0.02"	"71.4"	"118.9"	"98.7"	"99.9"	"111.1"	"100.1"	"100040.5078125"	"166500.75"	"138184.328125"	"139882.359375"	"155589.046875"	"140160.109375"	"NotUnique"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"2"	"462.75217"	"0.001478"	"0.02268"	"1.57"	"18.80"
"23186"	"[K].SAVTGGKEAVYSGVQSLR.[S]"	"1xBiotin [K7]"	"6.43105E-08"	"0.000586377"	"1"	"2"	"17"	"Q3UPF5-1"	"Q3UPF5-1 [498-515]"	"Q3UPF5-1 1xBiotin [K504]"	"zinc finger CCCH-type antiviral protein 1 [OS=Mus musculus]"	"1"	"2035.02770"	"0.42"	"0.27"	"-0.40"	"-2.65"	"0.42"	"0.00"	"0.15"	"103.4"	"138.1"	"125.0"	"78.5"	"16.5"	"138.4"	"316740.4609375"	"423096.375"	"383016.0546875"	"240574.6953125"	"50539.63671875"	"423921.4921875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"1018.01797"	"0.0001108"	"1.649E-11"	"5.51"	"46.96"
"23187"	"[K].SAVTTVVNPKYEGK.[-]"	"1xBiotin [K10]"	"0.000129826"	"0.000586377"	"1"	"1"	"10"	"P09055"	"P09055 [785-798]"	"P09055 1xBiotin [K794]"	"Integrin beta-1 [OS=Mus musculus]"	"1"	"1718.87818"	"1.02"	"0.51"	"0.70"	"0.67"	"1.12"	"0.10"	"0.61"	"61.0"	"123.9"	"87.0"	"98.9"	"96.7"	"132.6"	"51583.08984375"	"104766.94921875"	"73569.484375"	"83654.25"	"81835.0625"	"112126.029296875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"859.94182"	"0.0001108"	"1.105E-06"	"4.05"	"36.91"
"23250"	"[R].SCTTLENYNFELYDGLKHK.[V]"	"1xBiotin [K]; 1xCarbamidomethyl [C2]"	"0.000275461"	"0.000586377"	"1"	"4"	"3"	"O35375-1"	"O35375-1 [901-919]"	"O35375-1 1xBiotin [K]"	"Neuropilin-2 [OS=Mus musculus]"	"1"	"2558.16902"	"0.45"	"-9.97"	"-9.97"	"-9.97"	"0.52"	"0.07"	"9.97"	"157.8"	"215.8"	""	""	""	"226.4"	"13075.69921875"	"17875.181640625"	""	""	""	"18751.900390625"	""	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"3"	"853.39478"	"0.0001108"	"3.298E-06"	"4.43"	"49.45"
"3371"	"[K].DKDAYSSFGSR.[DGS]"	"1xBiotin [K2]"	"0.00462481"	"0.000586377"	"1"	"3"	"6"	"Q62167"	"Q62167 [65-75]"	"Q62167 1xBiotin [K66]"	"ATP-dependent RNA helicase DDX3X [OS=Mus musculus]"	"1"	"1458.63180"	"0.49"	"0.30"	"0.54"	"0.50"	"-9.97"	"-9.97"	"-9.97"	"92.2"	"129.7"	"113.7"	"134.3"	"130.1"	""	"16895.66015625"	"23765.416015625"	"20830.056640625"	"24605.62109375"	"23848.380859375"	""	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"729.81946"	"0.0001108"	"0.0002037"	"2.00"	"35.78"
"3380"	"[K].DKEKAVYAK.[M]"	"1xBiotin [K4]"	"0.0192556"	"0.000586377"	"1"	"1"	"5"	"Q9CR16"	"Q9CR16 [359-367]"	"Q9CR16 1xBiotin [K362]"	"peptidyl-prolyl cis-trans isomerase D [OS=Mus musculus]"	"2"	"1277.65583"	"9.97"	""	"9.97"	"9.97"	"9.97"	"0.63"	"9.97"	""	"103.9"	""	"121.9"	"213.3"	"161.0"	""	"7169.2841796875"	""	"8410.9423828125"	"14719.2001953125"	"11110.4345703125"	""	"High"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"2"	"639.33133"	"0.0001108"	"0.001647"	"3.41"	"24.50"
"23511"	"[R].SGFGKFER.[G]"	"1xBiotin [K5]"	"0.037428"	"0.00104877"	"1"	"2"	"3"	"Q62167"	"Q62167 [114-121]"	"Q62167 1xBiotin [K118]"	"ATP-dependent RNA helicase DDX3X [OS=Mus musculus]"	"1"	"1153.54589"	"0.58"	"0.22"	"0.31"	"0.01"	"0.77"	"0.19"	"0.55"	"78.8"	"118.0"	"91.8"	"97.7"	"79.4"	"134.4"	"17566.771484375"	"26288.171875"	"20446.373046875"	"21759.89453125"	"17701.486328125"	"29938.55859375"	""	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"2"	"577.27621"	"0.0001873"	"0.004386"	"1.95"	"39.81"
"23508"	"[K].SGENPEQDEAQKNFMDTYR.[N]"	"1xBiotin [K12]; 1xOxidation [M15]"	"0.000404762"	"0.000586377"	"1"	"1"	"6"	"Q61263"	"Q61263 [10-28]"	"Q61263 1xBiotin [K21]"	"sterol O-acyltransferase 1 [OS=Mus musculus]"	"1"	"2501.03438"	"9.97"	""	"9.97"	"9.97"	"9.97"	"-1.03"	"9.97"	""	"168.0"	""	"209.9"	"140.1"	"82.1"	""	"25757.412109375"	""	"32192.724609375"	"21479.396484375"	"12587.166015625"	""	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"3"	"834.34980"	"0.0001108"	"5.798E-06"	"3.86"	"36.61"
"3390"	"[K].DKGLQTSQDAR.[F]"	"1xBiotin [K2]"	"0.00228614"	"0.000586377"	"1"	"1"	"6"	"P14211"	"P14211 [63-73]"	"P14211 1xBiotin [K64]"	"Calreticulin [OS=Mus musculus]"	"1"	"1444.68490"	"0.83"	"0.40"	"0.54"	"0.34"	"0.53"	"-0.29"	"0.14"	"72.7"	"128.9"	"95.7"	"105.4"	"92.2"	"105.2"	"12281.3046875"	"21784.478515625"	"16169.0263671875"	"17806.236328125"	"15584.2080078125"	"17772.240234375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"722.84622"	"0.0001108"	"7.283E-05"	"2.11"	"27.95"
"23505"	"[K].SGELWLDAYLHK.[-]"	"1xBiotin [K12]"	"0.000233964"	"0.000586377"	"1"	"1"	"7"	"Q9Z0R9"	"Q9Z0R9 [433-444]"	"Q9Z0R9 1xBiotin [K444]"	"fatty acid desaturase 2 [OS=Mus musculus]"	"0"	"1657.80429"	"0.28"	"0.96"	"-2.81"	"-4.63"	"0.63"	"0.34"	"-0.34"	"101.9"	"123.8"	"198.6"	"14.5"	"4.1"	"157.1"	"53142.9609375"	"64569.25"	"103644.65625"	"7584.04443359375"	"2145.36865234375"	"81969.2578125"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"2"	"829.40647"	"0.0001108"	"2.61E-06"	"3.52"	"57.96"
"23504"	"[R].SGEGLGVFQQSSKHSLFDSCK.[M]"	"1xBiotin [K13]; 1xCarbamidomethyl [C20]"	"1.6189E-05"	"0.000586377"	"1"	"1"	"5"	"Q91W98"	"Q91W98 [281-301]"	"Q91W98 1xBiotin [K293]"	"Solute carrier family 15 member 4 [OS=Mus musculus]"	"1"	"2524.15952"	"0.39"	"0.33"	"-1.57"	"-9.97"	"0.34"	"-0.05"	"0.02"	"116.0"	"152.3"	"145.4"	"39.1"	""	"147.2"	"57778.01953125"	"75838.4765625"	"72384.765625"	"19460.4140625"	""	"73290.390625"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"842.05795"	"0.0001108"	"5.294E-08"	"4.62"	"47.24"
"23500"	"[R].SGCKVK.[K]"	"1xBiotin [K4]; 1xCarbamidomethyl [C3]"	"0.0899165"	"0.00334029"	"1"	"1"	"11"	"Q6Y685-2"	"Q6Y685-2 [56-61]"	"Q6Y685-2 1xBiotin [K59]"	"Isoform 2 of Transforming acidic coiled-coil-containing protein 1 [OS=Mus musculus]"	"1"	"904.43792"	"0.66"	"0.62"	"0.41"	"0.26"	"0.33"	"-0.34"	"-0.30"	"75.9"	"120.3"	"117.0"	"101.1"	"90.6"	"95.1"	"57207.23828125"	"90675.1875"	"88160.3984375"	"76214.875"	"68299.4453125"	"71689.375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"452.72258"	"0.000655"	"0.01642"	"1.82"	"19.29"
"3399"	"[K].DKLEFAPK.[A]"	"1xBiotin [K2]"	"0.00431287"	"0.000586377"	"1"	"1"	"6"	"Q78RX3"	"Q78RX3 [74-81]"	"Q78RX3 1xBiotin [K75]"	"small integral membrane protein 12 [OS=Mus musculus]"	"1"	"1173.59726"	"0.12"	"0.25"	"0.02"	"0.23"	"-0.10"	"-0.22"	"-0.36"	"93.9"	"102.0"	"111.9"	"95.1"	"109.7"	"87.3"	"150943.640625"	"164073.671875"	"179917.109375"	"152936.046875"	"176421.609375"	"140437.109375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"587.30215"	"0.0001108"	"0.0001831"	"2.96"	"40.76"
"23445"	"[K].SFALKHPEYAK.[I]"	"1xBiotin [K5]"	"0.00961806"	"0.000586377"	"1"	"2"	"5"	"Q8BYI6-1"	"Q8BYI6-1 [488-498]"	"Q8BYI6-1 1xBiotin [K492]"	"Lysophosphatidylcholine acyltransferase 2 [OS=Mus musculus]"	"1"	"1516.76170"	"0.17"	"0.02"	"0.23"	"-0.15"	"0.15"	"-0.02"	"0.13"	"94.8"	"106.9"	"96.3"	"111.4"	"85.4"	"105.2"	"18892.265625"	"21298.2734375"	"19185.373046875"	"22205.080078125"	"17019.419921875"	"20969.72265625"	""	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"3"	"506.25881"	"0.0001108"	"0.0005918"	"2.55"	"36.12"
"3400"	"[K].DKLEFAPKAVLNR.[N]"	"1xBiotin [K8]"	"0.00255372"	"0.000586377"	"1"	"1"	"5"	"Q78RX3"	"Q78RX3 [74-86]"	"Q78RX3 1xBiotin [K81]"	"small integral membrane protein 12 [OS=Mus musculus]"	"2"	"1726.93089"	"0.46"	"0.10"	"0.69"	"-9.97"	"-9.97"	"-9.97"	"-9.97"	"118.4"	"163.0"	"127.2"	"191.4"	""	""	"12772.1123046875"	"17580.01953125"	"13719.3955078125"	"20650.224609375"	""	""	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"576.31510"	"0.0001108"	"8.505E-05"	"3.31"	"45.89"
"23400"	"[K].SEITLVTPKPEKLAPSR.[Q]"	"1xBiotin [K12]"	"0.000280322"	"0.000586377"	"1"	"2"	"6"	"Q9QXK3"	"Q9QXK3 [591-607]"	"Q9QXK3 1xBiotin [K602]"	"Coatomer subunit gamma-2 [OS=Mus musculus]"	"1"	"2092.14709"	"0.54"	"-0.26"	"0.06"	"-0.89"	"0.35"	"-0.19"	"0.61"	"97.7"	"141.6"	"81.6"	"102.0"	"52.7"	"124.4"	"30534.173828125"	"44249.15234375"	"25485.55078125"	"31873.41796875"	"16460.666015625"	"38872.39453125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"698.05355"	"0.0001108"	"3.373E-06"	"4.01"	"41.69"
"3410"	"[K].DKNFQWANTGAAVFGTQTTSK.[G]"	"1xBiotin [K2]"	"2.96901E-05"	"0.000586377"	"1"	"1"	"5"	"Q9ERU9"	"Q9ERU9 [2701-2721]"	"Q9ERU9 1xBiotin [K2702]"	"E3 SUMO-protein ligase RanBP2 [OS=Mus musculus]"	"1"	"2498.17688"	"0.27"	"0.26"	"-1.18"	"-9.97"	"0.35"	"0.08"	"0.09"	"117.1"	"141.4"	"140.6"	"51.7"	""	"149.2"	"31328.55078125"	"37811.453125"	"37592.6328125"	"13836.2490234375"	""	"39902.515625"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"833.39656"	"0.0001108"	"1.281E-07"	"3.69"	"51.44"
"23384"	"[R].SEKAASFK.[L]"	"1xBiotin [K3]"	"0.0330195"	"0.00104877"	"1"	"1"	"13"	"Q9Z0F8"	"Q9Z0F8 [806-813]"	"Q9Z0F8 1xBiotin [K808]"	"Disintegrin and metalloproteinase domain-containing protein 17 [OS=Mus musculus]"	"1"	"1093.53466"	"0.45"	"0.50"	"0.20"	"0.32"	"0.38"	"-0.08"	"-0.12"	"80.2"	"109.7"	"113.3"	"92.3"	"100.4"	"104.1"	"3077964.35253906"	"4212956.25390625"	"4352668.70507813"	"3545150.29296875"	"3853853.75634766"	"3998383.69433594"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"547.27056"	"0.0001873"	"0.003658"	"1.80"	"28.85"
"23383"	"[K].SEHITKNIHK.[A]"	"1xBiotin [K6]"	"0.00945211"	"0.000586377"	"1"	"2"	"6"	"Q920B0"	"Q920B0 [884-893]"	"Q920B0 1xBiotin [K889]"	"FERM domain-containing protein 4B [OS=Mus musculus]"	"1"	"1432.73654"	"0.39"	"0.36"	"0.09"	"0.55"	"0.51"	"0.12"	"0.15"	"79.5"	"104.1"	"102.2"	"84.6"	"116.0"	"113.5"	"25398.28125"	"33266.625"	"32644.853515625"	"27030.958984375"	"37060.84765625"	"36273.9921875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"478.25013"	"0.0001108"	"0.0005804"	"2.62"	"23.60"
"3427"	"[K].DKSTYIESSTK.[V]"	"1xBiotin [K2]"	"0.00266"	"0.000586377"	"1"	"1"	"8"	"Q8VBZ3"	"Q8VBZ3 [459-469]"	"Q8VBZ3 1xBiotin [K460]"	"cleft lip and palate transmembrane protein 1 homolog [OS=Mus musculus]"	"1"	"1484.69374"	"0.22"	"0.30"	"0.34"	"0.32"	"0.21"	"-0.01"	"-0.10"	"84.9"	"98.8"	"104.8"	"107.1"	"106.3"	"98.0"	"125271.65625"	"145744.359375"	"154646.90625"	"158044.296875"	"156909.171875"	"144652.28125"	""	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"2"	"742.85069"	"0.0001108"	"9.031E-05"	"2.46"	"34.86"
"23321"	"[R].SDREETESSEGEETAAGAGAKSR.[L]"	"1xBiotin [K21]"	"0.00104089"	"0.000586377"	"1"	"1"	"3"	"Q924Z4"	"Q924Z4 [341-363]"	"Q924Z4 1xBiotin [K361]"	"Ceramide synthase 2 [OS=Mus musculus]"	"2"	"2580.11144"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"High"	"3"	"860.70983"	"0.0001108"	"2.307E-05"	"4.15"	""
"23278"	"[K].SDENEDPSVVGEFKGSFR.[I]"	"1xBiotin [K14]"	"0.000101623"	"0.000586377"	"1"	"1"	"7"	"Q69ZN7-1"	"Q69ZN7-1 [1495-1512]"	"Q69ZN7-1 1xBiotin [K1508]"	"Myoferlin [OS=Mus musculus]"	"1"	"2224.98154"	""	"9.97"	"9.97"	"9.97"	""	""	"-9.97"	""	""	"401.8"	"134.3"	"63.9"	""	""	""	"22429.9453125"	"7498.10400390625"	"3567.90991210938"	""	""	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"3"	"742.33178"	"0.0001108"	"7.707E-07"	"3.59"	"51.67"
"3429"	"[R].DKTASTIQEPAR.[L]"	"1xBiotin [K2]"	"0.000421625"	"0.000586377"	"1"	"1"	"9"	"Q9Z1R4"	"Q9Z1R4 [93-104]"	"Q9Z1R4 1xBiotin [K94]"	"Uncharacterized protein C6orf47 homolog [OS=Mus musculus]"	"1"	"1542.75807"	"0.61"	"0.31"	"0.45"	"0.62"	"0.58"	"-0.02"	"0.27"	"73.5"	"112.0"	"91.0"	"100.1"	"113.2"	"110.1"	"121871.1484375"	"185772.40625"	"150995.75"	"166076.109375"	"187841.625"	"182665.25"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"771.88266"	"0.0001108"	"6.14E-06"	"3.16"	"30.02"
"23083"	"[R].SAESKVIEFGK.[S]"	"1xBiotin [K5]"	"0.00433804"	"0.000586377"	"1"	"1"	"6"	"Q9ERU9"	"Q9ERU9 [992-1002]"	"Q9ERU9 1xBiotin [K996]"	"E3 SUMO-protein ligase RanBP2 [OS=Mus musculus]"	"1"	"1420.71408"	"-0.20"	"0.07"	"0.39"	"0.29"	"0.23"	"0.44"	"0.17"	"90.6"	"78.8"	"94.8"	"118.6"	"110.6"	"106.6"	"15551.8828125"	"13522.0107421875"	"16270.1650390625"	"20355.53125"	"18979.267578125"	"18299.548828125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"710.86090"	"0.0001108"	"0.0001843"	"2.82"	"42.35"
"23062"	"[R].SAASKTVNIYFPK.[K]"	"1xBiotin [K5]"	"5.38195E-05"	"0.000586377"	"1"	"1"	"15"	"P27612"	"P27612 [525-537]"	"P27612 1xBiotin [K529]"	"Phospholipase A-2-activating protein [OS=Mus musculus]"	"1"	"1651.85124"	"0.09"	"-0.11"	"-0.08"	"-2.45"	"0.08"	"0.00"	"0.19"	"116.0"	"123.1"	"107.3"	"109.6"	"21.3"	"122.7"	"74052.025390625"	"78558.7919921875"	"68526.10546875"	"69983.0546875"	"13571.529296875"	"78363.345703125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"826.42955"	"0.0001108"	"3.058E-07"	"4.22"	"45.90"
"3507"	"[R].DLKVDQLGSK.[R]"	"1xBiotin [K3]"	"0.00912871"	"0.000586377"	"1"	"1"	"5"	"Q9Z1R4"	"Q9Z1R4 [76-85]"	"Q9Z1R4 1xBiotin [K78]"	"Uncharacterized protein C6orf47 homolog [OS=Mus musculus]"	"1"	"1328.68786"	"0.33"	"0.08"	"0.16"	"-9.97"	"-9.97"	"-9.97"	"-9.97"	"135.4"	"170.2"	"143.1"	"151.3"	""	""	"11353.396484375"	"14264.484375"	"11998.28515625"	"12682.9755859375"	""	""	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"2"	"664.84753"	"0.0001108"	"0.0005494"	"2.37"	"37.90"
"3516"	"[R].DILKEMFPYEASTPTGISASCR.[R]"	"1xBiotin [K4]; 1xCarbamidomethyl [C21]; 1xOxidation [M6]"	"4.874E-05"	"0.000586377"	"1"	"4"	"5"	"Q61029"	"Q61029 [342-363]"	"Q61029 1xBiotin [K345]"	"Lamina-associated polypeptide 2, isoforms beta/delta/epsilon/gamma [OS=Mus musculus]"	"1"	"2715.24629"	"-0.05"	"-0.07"	"-9.97"	"-2.63"	"-9.97"	"-9.97"	"-9.97"	"194.8"	"187.7"	"186.1"	""	"31.4"	""	"23509.7734375"	"22659.03515625"	"22462.5703125"	""	"3795.56420898438"	""	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"3"	"905.75270"	"0.0001108"	"2.633E-07"	"3.54"	"49.74"
"21905"	"[R].QVWPGPQMDTAPNKSFER.[K]"	"1xBiotin [K14]; 1xOxidation [M8]"	"0.000476547"	"0.000586377"	"1"	"2"	"5"	"Q9JHL0-1"	"Q9JHL0-1 [64-81]"	"Q9JHL0-1 1xBiotin [K77]"	"Linker for activation of T-cells family member 2 [OS=Mus musculus]"	"1"	"2330.06925"	"0.99"	"0.70"	"0.50"	"-1.45"	"0.57"	"-0.42"	"-0.13"	"76.2"	"151.4"	"123.8"	"107.5"	"27.9"	"113.1"	"9805.505859375"	"19482.91796875"	"15928.2041015625"	"13833.337890625"	"3594.54248046875"	"14545.61328125"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"3"	"777.36120"	"0.0001108"	"7.339E-06"	"2.90"	"41.98"
"3617"	"[K].DLTKNMGIIAER.[I]"	"1xBiotin [K4]; 1xOxidation [M6]"	"0.000649104"	"0.000586377"	"1"	"2"	"24"	"Q6P9J9"	"Q6P9J9 [886-897]"	"Q6P9J9 1xBiotin [K889]"	"Anoctamin-6 [OS=Mus musculus]"	"1"	"1602.79782"	"-0.04"	"0.03"	"0.51"	"-0.80"	"0.19"	"0.23"	"0.16"	"97.8"	"95.4"	"100.1"	"138.9"	"56.3"	"111.6"	"389092.875"	"379610.328125"	"398196.942382813"	"552649.984375"	"223949.5078125"	"444247.830078125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"801.90255"	"0.0001108"	"1.149E-05"	"3.19"	"38.93"
"21841"	"[K].QVFTNNIPKAGFLINPQDPIPR.[R]"	"1xBiotin [K9]"	"1.38305E-05"	"0.000586377"	"1"	"2"	"9"	"Q4FZC9-1"	"Q4FZC9-1 [766-787]"	"Q4FZC9-1 1xBiotin [K774]"	"Nesprin-3 [OS=Mus musculus]"	"1"	"2705.42320"	"-0.44"	"0.14"	"-3.44"	"-9.97"	"0.68"	"1.12"	"0.53"	"132.4"	"97.4"	"146.3"	"12.2"	""	"211.7"	"63524.3754882813"	"46731.84765625"	"70213.8818359375"	"5865.80419921875"	""	"101602.251953125"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"902.48030"	"0.0001108"	"4.179E-08"	"4.95"	"56.92"
"3631"	"[K].DLVKNMPFLK.[V]"	"1xBiotin [K4]"	"0.002466"	"0.000586377"	"1"	"1"	"7"	"Q8R0X7"	"Q8R0X7 [98-107]"	"Q8R0X7 1xBiotin [K101]"	"sphingosine-1-phosphate lyase 1 [OS=Mus musculus]"	"1"	"1430.75344"	"0.80"	"0.22"	"0.06"	"-1.04"	"0.32"	"-0.48"	"0.10"	"89.6"	"156.4"	"104.7"	"93.6"	"43.6"	"112.0"	"55617.73828125"	"97078.28125"	"64987.25"	"58121.1015625"	"27091.904296875"	"69550.8125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"715.88035"	"0.0001108"	"8.124E-05"	"3.28"	"52.93"
"21800"	"[R].QTVAVGVIKAVDK.[K]"	"1xBiotin [K9]"	"0.000339804"	"0.000586377"	"1"	"1"	"6"	"P10126"	"P10126 [431-443]"	"P10126 1xBiotin [K439]"	"Elongation factor 1-alpha 1 [OS=Mus musculus]"	"1"	"1553.87197"	"9.97"	""	""	"9.97"	""	"-9.97"	""	""	"379.1"	""	""	"220.9"	""	""	"12636.6708984375"	""	""	"7363.83740234375"	""	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"777.44012"	"0.0001108"	"4.485E-06"	"3.78"	"43.34"
"21789"	"[K].QTSAYNISNSSTFTKSLSR.[Y]"	"1xBiotin [K15]"	"0.00028361"	"0.000586377"	"1"	"1"	"11"	"P70206"	"P70206 [1602-1620]"	"P70206 1xBiotin [K1616]"	"Plexin-A1 [OS=Mus musculus]"	"1"	"2318.10813"	"-0.41"	"-0.27"	"-1.11"	"-9.97"	"-0.78"	"-0.37"	"-0.51"	"165.4"	"124.6"	"137.3"	"76.6"	""	"96.2"	"38805.46484375"	"29241.380859375"	"32214.970703125"	"17965.412109375"	""	"22583.998046875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"773.37400"	"0.0001108"	"3.439E-06"	"4.59"	"42.91"
"21741"	"[R].QSVTNSIKAGLTDQVSHHAR.[L]"	"1xBiotin [K8]"	"0.000149329"	"0.000586377"	"1"	"2"	"4"	"Q6PA06-1"	"Q6PA06-1 [560-579]"	"Q6PA06-1 1xBiotin [K567]"	"Atlastin-2 [OS=Mus musculus]"	"1"	"2375.18845"	"-0.12"	"0.02"	"-9.97"	"-9.97"	"0.10"	"0.22"	"0.08"	"149.6"	"137.9"	"152.0"	""	""	"160.4"	"38576.80859375"	"35557.34375"	"39202.734375"	""	""	"41361.3359375"	""	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"4"	"594.55250"	"0.0001108"	"1.357E-06"	"4.19"	"42.33"
"21725"	"[K].QSSLPAMSKVR.[R]"	"1xBiotin [K9]; 1xOxidation [M7]"	"0.0013931"	"0.000586377"	"1"	"2"	"32"	"Q6DID7"	"Q6DID7 [411-421]"	"Q6DID7 1xBiotin [K419]"	"Protein wntless homolog [OS=Mus musculus]"	"1"	"1445.72393"	"-0.12"	"0.02"	"0.26"	"-1.34"	"0.05"	"0.17"	"0.02"	"107.9"	"99.2"	"109.7"	"129.1"	"42.5"	"111.6"	"480173.68359375"	"441478.911132813"	"487963.419921875"	"574619.233398438"	"189284.821289063"	"496486.678710938"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"723.36596"	"0.0001108"	"3.51E-05"	"3.48"	"30.82"
"21724"	"[K].QSSLPAMSKVR.[R]"	"1xBiotin [K9]"	"0.000720928"	"0.000586377"	"1"	"2"	"17"	"Q6DID7"	"Q6DID7 [411-421]"	"Q6DID7 1xBiotin [K419]"	"Protein wntless homolog [OS=Mus musculus]"	"1"	"1429.72902"	"0.87"	"0.43"	"0.18"	"1.19"	"0.81"	"-0.06"	"0.38"	"64.3"	"117.5"	"86.3"	"73.0"	"146.4"	"112.4"	"139887.25"	"255560.390625"	"187813.15625"	"158848.71875"	"318518.9375"	"244567.53125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"715.36899"	"0.0001108"	"1.347E-05"	"3.42"	"38.62"
"21710"	"[K].QSNAMEYKK.[T]"	"1xBiotin [K8]; 1xOxidation [M5]"	"0.00478912"	"0.000586377"	"1"	"1"	"12"	"P35564"	"P35564 [509-517]"	"P35564 1xBiotin [K516]"	"Calnexin [OS=Mus musculus]"	"1"	"1340.59733"	"0.08"	"-0.03"	"-0.03"	"-0.67"	"0.24"	"0.16"	"0.27"	"103.1"	"108.6"	"100.7"	"100.9"	"64.9"	"121.8"	"51368.32421875"	"54139.00390625"	"50166.74609375"	"50308.1328125"	"32341.26953125"	"60695.79296875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"670.80235"	"0.0001108"	"0.0002143"	"3.17"	"23.61"
"21709"	"[K].QSNAMEYKK.[T]"	"1xBiotin [K8]"	"0.00304131"	"0.000586377"	"1"	"1"	"6"	"P35564"	"P35564 [509-517]"	"P35564 1xBiotin [K516]"	"Calnexin [OS=Mus musculus]"	"1"	"1324.60242"	"0.52"	"0.64"	"0.32"	"1.84"	"0.56"	"0.04"	"-0.08"	"58.2"	"83.5"	"90.9"	"72.6"	"208.9"	"85.9"	"14947.541015625"	"21465.177734375"	"23345.203125"	"18659.603515625"	"53672.45703125"	"22085.009765625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"662.80437"	"0.0001108"	"0.0001104"	"3.12"	"29.08"
"21675"	"[K].QSEGLTKEYDR.[L]"	"1xBiotin [K7]"	"0.00232645"	"0.000586377"	"1"	"1"	"5"	"Q61335"	"Q61335 [214-224]"	"Q61335 1xBiotin [K220]"	"B-cell receptor-associated protein 31 [OS=Mus musculus]"	"1"	"1551.71078"	"0.63"	"0.58"	"0.91"	"1.19"	"0.74"	"0.12"	"0.17"	"60.8"	"93.9"	"90.8"	"114.1"	"138.4"	"101.9"	"31444.521484375"	"48533.8984375"	"46927.82421875"	"58974.0859375"	"71511"	"52673.3828125"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"2"	"776.35916"	"0.0001108"	"7.435E-05"	"2.28"	"32.87"
"21674"	"[K].QSEASNKLDTK.[G]"	"1xBiotin [K7]"	"0.0010169"	"0.000586377"	"1"	"2"	"6"	"A2AKQ0"	"A2AKQ0 [340-350]"	"A2AKQ0 1xBiotin [K346]"	"UDP-glucuronic acid/UDP-N-acetylgalactosamine transporter [OS=Mus musculus]"	"1"	"1446.68932"	"0.49"	"0.17"	"0.22"	"0.28"	"0.05"	"-0.44"	"-0.11"	"86.5"	"121.7"	"97.1"	"100.4"	"104.6"	"89.7"	"23817.466796875"	"33511.46875"	"26753.005859375"	"27656.291015625"	"28822.783203125"	"24711.921875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"723.84860"	"0.0001108"	"2.216E-05"	"3.37"	"28.93"
"21608"	"[K].QQYGEGYIEKSLHR.[L]"	"1xBiotin [K10]"	"0.00040951"	"0.000586377"	"1"	"1"	"6"	"Q58NB6"	"Q58NB6 [236-249]"	"Q58NB6 1xBiotin [K245]"	"Dehydrogenase/reductase SDR family member 9 [OS=Mus musculus]"	"1"	"1933.92251"	"0.49"	"0.36"	"1.08"	"-0.11"	"0.66"	"0.17"	"0.31"	"72.2"	"101.7"	"92.5"	"152.4"	"67.0"	"114.2"	"13094.2890625"	"18453.478515625"	"16772.73828125"	"27643.69921875"	"12163.1728515625"	"20727.578125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"645.31229"	"0.0001108"	"5.884E-06"	"4.20"	"38.90"
"21588"	"[R].QQQYKFLPSELR.[D]"	"1xBiotin [K5]"	"0.000278692"	"0.000586377"	"1"	"1"	"16"	"P26039"	"P26039 [2527-2538]"	"P26039 1xBiotin [K2531]"	"Talin-1 [OS=Mus musculus]"	"1"	"1762.89450"	"0.45"	"0.52"	"0.02"	"-2.42"	"0.44"	"0.00"	"-0.08"	"94.4"	"128.8"	"135.3"	"95.4"	"17.7"	"128.4"	"112669.501953125"	"153749.62109375"	"161428.310546875"	"113900.536132813"	"21074.8559570313"	"153246.58203125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"881.95104"	"0.0001108"	"3.366E-06"	"2.91"	"48.41"
"21580"	"[R].QQQQFSSSEKK.[T]"	"1xBiotin [K10]"	"0.00462481"	"0.000586377"	"1"	"1"	"6"	"Q9DAV9"	"Q9DAV9 [249-259]"	"Q9DAV9 1xBiotin [K258]"	"Trimeric intracellular cation channel type B [OS=Mus musculus]"	"1"	"1550.72677"	"-9.97"	"-0.14"	"0.47"	"0.12"	"-0.17"	"9.97"	"-0.03"	"114.0"	""	"103.1"	"157.9"	"124.0"	"101.0"	"10711.5185546875"	""	"9688.5947265625"	"14840.2822265625"	"11657.3095703125"	"9492.6875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"775.86734"	"0.0001108"	"0.0002029"	"2.22"	"25.22"
"3632"	"[K].DLVKNMPFLK.[V]"	"1xBiotin [K4]; 1xOxidation [M6]"	"0.00541139"	"0.000586377"	"1"	"1"	"6"	"Q8R0X7"	"Q8R0X7 [98-107]"	"Q8R0X7 1xBiotin [K101]"	"sphingosine-1-phosphate lyase 1 [OS=Mus musculus]"	"1"	"1446.74835"	"-0.18"	"-0.16"	"-0.25"	"-1.47"	"0.29"	"0.47"	"0.45"	"115.4"	"101.7"	"103.2"	"97.0"	"41.6"	"141.1"	"138947.915039063"	"122431.075195313"	"124191.532226563"	"116760.390625"	"50127.869140625"	"169932.46875"	""	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"2"	"723.87796"	"0.0001108"	"0.0002557"	"2.89"	"44.10"
"3700"	"[K].DMVAEIEWFGAKGIDK.[E]"	"1xBiotin [K12]; 1xOxidation [M2]"	"9.4671E-06"	"0.000586377"	"1"	"1"	"5"	"Q8VBT6"	"Q8VBT6 [222-237]"	"Q8VBT6 1xBiotin [K233]"	"Apolipoprotein B receptor [OS=Mus musculus]"	"1"	"2050.96126"	""	"9.97"	"9.97"	""	""	""	"-9.97"	""	""	"368.1"	"231.9"	""	""	""	""	"11460.8525390625"	"7217.98046875"	""	""	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"2"	"1025.98393"	"0.0001108"	"2.411E-08"	"4.23"	"55.20"
"3702"	"[K].DMVAEIEWFGAKGIDKEEER.[M]"	"1xBiotin [K12]; 1xOxidation [M2]"	"2.12938E-05"	"0.000586377"	"1"	"1"	"9"	"Q8VBT6"	"Q8VBT6 [222-241]"	"Q8VBT6 1xBiotin [K233]"	"Apolipoprotein B receptor [OS=Mus musculus]"	"2"	"2594.19015"	"0.35"	"0.17"	"-1.52"	"-3.16"	"0.37"	"0.02"	"0.20"	"116.6"	"148.2"	"131.1"	"40.8"	"13.0"	"150.2"	"106455.9609375"	"135273.21875"	"119697.9375"	"37226.10546875"	"11901.7431640625"	"137153.046875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"865.40155"	"0.0001108"	"7.882E-08"	"4.56"	"52.16"
"21906"	"[K].QVYVDKLAELK.[S]"	"1xBiotin [K6]"	"0.00124705"	"0.000586377"	"1"	"1"	"6"	"Q61316"	"Q61316 [670-680]"	"Q61316 1xBiotin [K675]"	"Heat shock 70 kDa protein 4 [OS=Mus musculus]"	"1"	"1531.81888"	""	"9.97"	""	"9.97"	""	""	"-9.97"	""	""	"430.0"	""	"170.0"	""	""	""	"10802.6513671875"	""	"4270.94189453125"	""	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"766.41327"	"0.0001108"	"2.992E-05"	"2.76"	"48.58"
"3364"	"[R].DKAALGYDYK.[G]"	"1xBiotin [K2]"	"0.00150275"	"0.000586377"	"1"	"1"	"6"	"P49710"	"P49710 [169-178]"	"P49710 1xBiotin [K170]"	"Hematopoietic lineage cell-specific protein [OS=Mus musculus]"	"1"	"1369.64566"	"0.24"	"0.39"	"0.16"	"0.22"	"0.07"	"-0.17"	"-0.33"	"88.0"	"103.6"	"115.7"	"98.1"	"102.5"	"92.1"	"81053.6484375"	"95398.8125"	"106498.046875"	"90335.390625"	"94356.671875"	"84850.7265625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"685.32634"	"0.0001108"	"3.918E-05"	"3.16"	"37.74"
"3616"	"[K].DLTKNMGIIAER.[I]"	"1xBiotin [K4]"	"7.90846E-05"	"0.000586377"	"1"	"2"	"13"	"Q6P9J9"	"Q6P9J9 [886-897]"	"Q6P9J9 1xBiotin [K889]"	"Anoctamin-6 [OS=Mus musculus]"	"1"	"1586.80291"	"0.68"	"0.55"	"0.11"	"1.32"	"0.64"	"-0.04"	"0.09"	"65.3"	"104.5"	"95.4"	"70.6"	"162.6"	"101.6"	"155716.765625"	"249363.685546875"	"227491.529296875"	"168526.125"	"387810.33203125"	"242460.25"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"793.90520"	"0.0001108"	"5.363E-07"	"3.64"	"45.83"
"3612"	"[K].DISTNYYASQKK.[T]"	"1xBiotin [K11]"	"0.00115604"	"0.000586377"	"1"	"1"	"5"	"P08113"	"P08113 [672-683]"	"P08113 1xBiotin [K682]"	"Endoplasmin [OS=Mus musculus]"	"1"	"1643.77338"	""	""	"9.97"	"9.97"	""	""	""	""	""	""	"395.1"	"204.9"	""	""	""	""	"8282.9921875"	"4294.6044921875"	""	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"2"	"822.39079"	"0.0001108"	"2.682E-05"	"2.68"	"34.82"
"22765"	"[R].RQQQQFSSSEKK.[T]"	"1xBiotin [K11]"	"0.0353574"	"0.00104877"	"1"	"1"	"3"	"Q9DAV9"	"Q9DAV9 [248-259]"	"Q9DAV9 1xBiotin [K258]"	"Trimeric intracellular cation channel type B [OS=Mus musculus]"	"2"	"1706.82788"	"-9.97"	"0.40"	"-9.97"	"0.67"	"0.45"	"9.97"	"0.05"	"113.8"	""	"150.3"	""	"180.4"	"155.5"	"3354.80102539063"	""	"4433.26611328125"	""	"5319.486328125"	"4585.62890625"	""	"High"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"3"	"569.61441"	"0.0001873"	"0.004043"	"2.87"	"21.89"
"22743"	"[R].RQKGLDYR.[L]"	"1xBiotin [K3]"	"0.001942"	"0.000586377"	"1"	"1"	"10"	"Q99LI2"	"Q99LI2 [381-388]"	"Q99LI2 1xBiotin [K383]"	"chloride channel CLIC-like protein 1 [OS=Mus musculus]"	"2"	"1261.64700"	"0.76"	"0.28"	"0.53"	"0.38"	"0.75"	"-0.02"	"0.47"	"72.0"	"122.2"	"87.1"	"104.1"	"93.8"	"120.7"	"164143.32421875"	"278654.4765625"	"198659.3203125"	"237250.109375"	"213914.484375"	"275205.421875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"421.22024"	"0.0001108"	"5.73E-05"	"3.10"	"27.78"
"3518"	"[K].DILKPSPGK.[S]"	"1xBiotin [K4]"	"0.0208727"	"0.00104877"	"1"	"1"	"4"	"O35316"	"O35316 [16-24]"	"O35316 1xBiotin [K19]"	"Sodium- and chloride-dependent taurine transporter [OS=Mus musculus]"	"0"	"1180.63946"	"0.53"	"0.21"	"0.27"	"0.07"	"0.19"	"-0.34"	"-0.02"	"85.8"	"123.7"	"99.3"	"103.3"	"90.1"	"97.7"	"28366.009765625"	"40875.79296875"	"32812.6640625"	"34154.5546875"	"29785.71875"	"32297.50390625"	""	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"2"	"590.82332"	"0.0001873"	"0.001859"	"1.91"	"35.55"
"22687"	"[R].RPPQDGSSAQNCSSSPAKQELIAWEK.[E]"	"1xBiotin [K18]; 1xCarbamidomethyl [C12]"	"4.45375E-08"	"0.000586377"	"1"	"1"	"35"	"P31651"	"P31651 [585-610]"	"P31651 1xBiotin [K602]"	"Sodium- and chloride-dependent betaine transporter [OS=Mus musculus]"	"1"	"3097.44659"	"0.54"	"0.24"	"-0.31"	"-2.10"	"0.35"	"-0.19"	"0.11"	"100.7"	"146.9"	"119.0"	"81.3"	"23.6"	"128.6"	"227824.184570313"	"332299.626953125"	"269270.404296875"	"183966.08203125"	"53302.3305664063"	"290847.44140625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"1033.15414"	"0.0001108"	"9.623E-12"	"8.38"	"45.15"
"22682"	"[K].RPPKGNEILE.[-]"	"1xBiotin [K4]"	"0.0409881"	"0.00104877"	"1"	"1"	"8"	"O09005"	"O09005 [314-323]"	"O09005 1xBiotin [K317]"	"Sphingolipid delta(4)-desaturase DES1 [OS=Mus musculus]"	"1"	"1378.71475"	"0.36"	"0.15"	"0.18"	"0.24"	"0.25"	"-0.10"	"0.10"	"86.9"	"111.4"	"96.6"	"98.6"	"102.9"	"103.6"	"41453.015625"	"53111.19921875"	"46061.6953125"	"47015.78515625"	"49039.265625"	"49387.8359375"	""	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"2"	"689.86117"	"0.0001873"	"0.005017"	"2.81"	"35.13"
"3519"	"[K].DILKPSPGKSPGTRPEDEADGKPPQR.[E]"	"1xBiotin [K9]"	"0.00147671"	"0.000586377"	"1"	"1"	"5"	"O35316"	"O35316 [16-41]"	"O35316 1xBiotin [K24]"	"Sodium- and chloride-dependent taurine transporter [OS=Mus musculus]"	"1"	"2998.50509"	"1.10"	"0.66"	"0.88"	"0.42"	"0.39"	"-0.72"	"-0.27"	"65.1"	"140.0"	"102.7"	"119.8"	"87.2"	"85.2"	"22722.5654296875"	"48858.541015625"	"35829.26953125"	"41789.498046875"	"30414.904296875"	"29708.1416015625"	""	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"4"	"750.38099"	"0.0001108"	"3.844E-05"	"3.47"	"29.55"
"22666"	"[K].RPITGGSGGGEGAGLGGGKYVSFEDR.[H]"	"1xBiotin [K19]"	"2.55131E-05"	"0.000586377"	"1"	"1"	"5"	"Q9R059"	"Q9R059 [226-251]"	"Q9R059 1xBiotin [K244]"	"four and a half LIM domains protein 3 [OS=Mus musculus]"	"1"	"2707.28929"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"903.10256"	"0.0001108"	"1.02E-07"	"5.30"	""
"22659"	"[R].RPIKGAAGRPLELSDFR.[M]"	"1xBiotin [K4]"	"0.000375214"	"0.000586377"	"1"	"4"	"7"	"Q61029"	"Q61029 [364-380]"	"Q61029 1xBiotin [K367]"	"Lamina-associated polypeptide 2, isoforms beta/delta/epsilon/gamma [OS=Mus musculus]"	"1"	"2109.13859"	"0.92"	"0.57"	"-0.54"	"-3.68"	"0.56"	"-0.36"	"-0.01"	"90.6"	"171.4"	"134.6"	"62.5"	"7.1"	"133.8"	"396232.578125"	"750088.09375"	"588962.203125"	"273437.1171875"	"31021.4375"	"585315.984375"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"3"	"703.71784"	"0.0001108"	"5.187E-06"	"2.53"	"39.82"
"3543"	"[R].DIMNDSNYVVKGNAR.[L]"	"1xBiotin [K11]; 1xOxidation [M3]"	"0.000889291"	"0.000586377"	"1"	"1"	"4"	"P09581"	"P09581 [800-814]"	"P09581 1xBiotin [K810]"	"Macrophage colony-stimulating factor 1 receptor [OS=Mus musculus]"	"1"	"1937.88441"	"-9.97"	"-1.00"	"-9.97"	"-9.97"	"-9.97"	""	"-9.97"	"400.1"	""	"199.9"	""	""	""	"10538.1806640625"	""	"5265.66455078125"	""	""	""	""	"High"	"Not Found"	"High"	"High"	"Not Found"	"High"	"High"	"2"	"969.44615"	"0.0001108"	"1.823E-05"	"3.37"	"35.73"
"22644"	"[R].RPKASDYQR.[L]"	"1xBiotin [K3]"	"0.018601"	"0.000586377"	"1"	"2"	"5"	"Q62314"	"Q62314 [350-358]"	"Q62314 1xBiotin [K352]"	"Trans-Golgi network integral membrane protein 2 [OS=Mus musculus]"	"1"	"1346.66338"	"0.34"	"0.05"	"0.28"	"-0.01"	"0.19"	"-0.15"	"0.14"	"90.2"	"114.4"	"93.4"	"109.5"	"89.4"	"103.0"	"25915.43359375"	"32865.265625"	"26816.1875"	"31444.357421875"	"25684.669921875"	"29593.546875"	""	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"3"	"449.55929"	"0.0001108"	"0.001565"	"3.18"	"20.07"
"22639"	"[R].RPGPKAPDSPPSR.[F]"	"1xBiotin [K5]"	"0.0064802"	"0.000586377"	"1"	"1"	"3"	"Q8K1T1"	"Q8K1T1 [230-242]"	"Q8K1T1 1xBiotin [K234]"	"Leucine-rich repeat-containing protein 25 [OS=Mus musculus]"	"1"	"1587.80602"	"0.99"	"0.23"	"0.13"	"0.42"	"0.81"	"-0.18"	"0.58"	"71.8"	"143.0"	"84.3"	"78.5"	"96.1"	"126.2"	"6080.06591796875"	"12112.0146484375"	"7135.12109375"	"6649.97607421875"	"8139.91748046875"	"10690.5078125"	""	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"3"	"529.93954"	"0.0001108"	"0.0003323"	"2.72"	"23.18"
"3558"	"[R].DLPGKQVQLLR.[L]"	"1xBiotin [K5]"	"0.00481706"	"0.000586377"	"1"	"2"	"5"	"Q4FZC9-1"	"Q4FZC9-1 [579-589]"	"Q4FZC9-1 1xBiotin [K583]"	"Nesprin-3 [OS=Mus musculus]"	"1"	"1492.83044"	""	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"-0.04"	""	""	"169.0"	"146.5"	"120.0"	"164.6"	""	""	"13866.7861328125"	"12017.5966796875"	"9844.0576171875"	"13504.8125"	""	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"2"	"746.91911"	"0.0001108"	"0.0002157"	"2.19"	"46.16"
"22630"	"[K].RPFWPWK.[G]"	""	"0.0562059"	"0.0019826"	"1"	"4"	"2"	"Q99J72"	"Q99J72 [384-390]"	""	"DNA dC->dU-editing enzyme APOBEC-3 [OS=Mus musculus]"	"0"	"1016.54648"	"-0.20"	"0.09"	"-1.43"	"-0.48"	"0.05"	"0.24"	"-0.05"	"118.6"	"103.6"	"126.5"	"43.9"	"85.0"	"122.4"	"31905.451171875"	"27856.314453125"	"34014.87109375"	"11818.6015625"	"22866.39453125"	"32937.0390625"	""	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"2"	"508.77635"	"0.0003442"	"0.008065"	"2.47"	"42.03"
"22575"	"[R].RNLPTKIPLPTTLASGSK.[S]"	"1xBiotin [K6]"	"0.0632006"	"0.0019826"	"1"	"1"	"2"	"O70472"	"O70472 [1496-1513]"	"O70472 1xBiotin [K1501]"	"Transmembrane protein 131 [OS=Mus musculus]"	"2"	"2120.18962"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"3"	"707.40143"	"0.0003442"	"0.009616"	"2.72"	""
"22354"	"[R].RKPQQQYAKK.[T]"	"1xBiotin [K]"	"0.00428784"	"0.000586377"	"1"	"1"	"9"	"Q8VBT0"	"Q8VBT0 [212-221]"	"Q8VBT0 1xBiotin [K]"	"Thioredoxin-related transmembrane protein 1 [OS=Mus musculus]"	"2"	"1500.81038"	"0.87"	"0.78"	"0.75"	"0.72"	"1.06"	"0.19"	"0.28"	"60.3"	"110.0"	"103.6"	"101.2"	"99.5"	"125.3"	"67718.671875"	"123590.4609375"	"116353.40625"	"113712.859375"	"111746.3125"	"140790.53125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"500.94174"	"0.0001108"	"0.0001814"	"3.04"	"16.24"
"22344"	"[R].RKMCLFAGFQR.[K]"	"1xCarbamidomethyl [C4]; 1xOxidation [M3]"	"0.0189255"	"0.000586377"	"1"	"2"	"5"	"Q8VEK3"	"Q8VEK3 [567-577]"	""	"Heterogeneous nuclear ribonucleoprotein U [OS=Mus musculus]"	"2"	"1429.71912"	"-0.50"	"0.15"	"0.26"	"-0.18"	"-0.38"	"0.12"	"-0.54"	"105.9"	"74.8"	"117.7"	"126.9"	"93.7"	"81.1"	"26082.767578125"	"18423.888671875"	"28992.560546875"	"31264.873046875"	"23090.044921875"	"19976.1171875"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"3"	"477.24454"	"0.0001108"	"0.001607"	"2.47"	"30.54"
"3597"	"[K].DISENKR.[A]"	"1xBiotin [K6]"	"0.0558919"	"0.0019826"	"1"	"1"	"3"	"P63017"	"P63017 [252-258]"	"P63017 1xBiotin [K257]"	"Heat shock cognate 71 kDa protein [OS=Mus musculus]"	"1"	"1087.52007"	"0.60"	"0.26"	"0.65"	"0.71"	"0.42"	"-0.18"	"0.16"	"72.7"	"110.0"	"87.2"	"114.2"	"118.7"	"97.3"	"16321.1435546875"	"24672.869140625"	"19557.279296875"	"25625.548828125"	"26635.34375"	"21823.876953125"	""	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"2"	"544.26367"	"0.0003442"	"0.007998"	"1.60"	"25.35"
"22119"	"[R].REEVKAK.[E]"	"1xBiotin [K5]"	"0.0562059"	"0.0019826"	"1"	"1"	"10"	"Q3U9G9"	"Q3U9G9 [182-188]"	"Q3U9G9 1xBiotin [K186]"	"Lamin-B receptor [OS=Mus musculus]"	"2"	"1085.57719"	"0.67"	"0.60"	"0.52"	"1.02"	"0.82"	"0.15"	"0.22"	"64.3"	"102.3"	"97.6"	"92.1"	"130.2"	"113.5"	"191610.09375"	"304746.375"	"290735.4375"	"274432.21875"	"387791.3125"	"338129.53125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"543.29215"	"0.0003442"	"0.008037"	"2.28"	"16.37"
"22113"	"[K].REEAAPPTPAPDDLAQLKNLR.[S]"	"1xBiotin [K18]"	"0.000136026"	"0.000586377"	"1"	"1"	"3"	"Q80WJ7"	"Q80WJ7 [89-109]"	"Q80WJ7 1xBiotin [K106]"	"protein LYRIC [OS=Mus musculus]"	"2"	"2528.29258"	"-0.62"	"-0.44"	"-9.97"	"-9.97"	"-0.76"	"-0.13"	"-0.31"	"201.6"	"130.9"	"148.1"	""	""	"119.3"	"15201.5625"	"9872.5322265625"	"11169.8056640625"	""	""	"8997.3291015625"	""	"High"	"High"	"High"	"Not Found"	"Not Found"	"Peak Found"	"High"	"3"	"843.43677"	"0.0001108"	"1.182E-06"	"4.98"	"48.42"
"21924"	"[K].QYAGTGALKTDFTR.[T]"	"1xBiotin [K9]"	"0.000557798"	"0.000586377"	"1"	"1"	"3"	"Q9EP69"	"Q9EP69 [448-461]"	"Q9EP69 1xBiotin [K456]"	"Phosphatidylinositide phosphatase SAC1 [OS=Mus musculus]"	"1"	"1754.85303"	"0.07"	"0.03"	"-0.50"	"-9.97"	"-0.22"	"-0.29"	"-0.25"	"129.4"	"135.7"	"132.4"	"91.5"	""	"111.0"	"21176.619140625"	"22215.91015625"	"21667.525390625"	"14970.3544921875"	""	"18171.9375"	""	"High"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"2"	"877.93039"	"0.0001108"	"9.222E-06"	"2.97"	"42.83"
"24784"	"[K].SVISGGLDALEFIGKK.[T]"	"1xBiotin [K]"	"1.67654E-05"	"0.000586377"	"1"	"2"	"5"	"Q8VE88"	"Q8VE88 [164-179]"	"Q8VE88 1xBiotin [K]"	"Protein FAM114A2 [OS=Mus musculus]"	"1"	"1859.99355"	"-9.97"	"-0.21"	"-9.97"	"-9.97"	"0.55"	"9.97"	"0.76"	"180.2"	""	"155.5"	""	""	"264.2"	"9137.521484375"	""	"7884.44677734375"	""	""	"13396.15234375"	""	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"2"	"930.50108"	"0.0001108"	"5.546E-08"	"4.42"	"58.79"
"1767"	"[R].ASVVSLMTWKPSK.[S]"	"1xBiotin [K10]"	"0.000700215"	"0.000586377"	"1"	"1"	"5"	"Q8VD58"	"Q8VD58 [268-280]"	"Q8VD58 1xBiotin [K277]"	"Protein EVI2B [OS=Mus musculus]"	"0"	"1659.85970"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"2"	"830.43369"	"0.0001108"	"1.29E-05"	"3.04"	""
"1856"	"[K].ATTTPAKK.[V]"	"1xBiotin [K7]"	"0.0493934"	"0.00154748"	"1"	"1"	"3"	"P09405"	"P09405 [56-63]"	"P09405 1xBiotin [K62]"	"Nucleolin [OS=Mus musculus]"	"1"	"1043.55539"	"0.78"	"0.65"	"0.85"	"1.01"	"0.72"	"-0.06"	"0.07"	"61.5"	"105.8"	"96.6"	"110.7"	"124.1"	"101.4"	"8935.65625"	"15370.1982421875"	"14038.173828125"	"16081.8154296875"	"18032.451171875"	"14729.6591796875"	""	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"2"	"522.28140"	"0.0002716"	"0.006638"	"1.74"	"19.81"
"272"	"[K].ADLINNLGTIAKSGTK.[A]"	"1xBiotin [K12]"	"0.00134522"	"0.000586377"	"1"	"2"	"6"	"P11499"	"P11499 [96-111]"	"P11499 1xBiotin [K107]"	"Heat shock protein HSP 90-beta [OS=Mus musculus]"	"1"	"1841.97896"	"9.97"	""	""	"9.97"	""	"-9.97"	""	""	"442.4"	""	""	"157.6"	""	""	"9758.615234375"	""	""	"3475.58447265625"	""	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"2"	"921.49305"	"0.0001108"	"3.342E-05"	"3.26"	"49.04"
"276"	"[K].ADINTKWAATR.[W]"	"1xBiotin [K6]"	"0.0372158"	"0.00104877"	"1"	"1"	"1"	"Q9CR57"	"Q9CR57 [80-90]"	"Q9CR57 1xBiotin [K85]"	"60S ribosomal protein L14 [OS=Mus musculus]"	"1"	"1472.73146"	"-9.97"	"-9.97"	"-9.97"	"-9.97"	"0.58"	"9.97"	"9.97"	"240.5"	""	""	""	""	"359.5"	"6611.0654296875"	""	""	""	""	"9879.2265625"	""	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"2"	"736.86920"	"0.0001873"	"0.004364"	"2.07"	"40.21"
"27629"	"[K].VTEKCPK.[L]"	"1xBiotin [K4]; 1xCarbamidomethyl [C5]"	"0.042406"	"0.00104877"	"1"	"1"	"9"	"Q9D0T2"	"Q9D0T2 [186-192]"	"Q9D0T2 1xBiotin [K189]"	"Dual specificity protein phosphatase 12 [OS=Mus musculus]"	"1"	"1087.52746"	"0.69"	"0.40"	"0.48"	"0.47"	"0.68"	"-0.01"	"0.28"	"72.2"	"116.3"	"95.5"	"100.4"	"100.0"	"115.6"	"48557.4296875"	"78193.609375"	"64205.91796875"	"67493.2578125"	"67235.4609375"	"77719.2421875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"544.26750"	"0.0001873"	"0.005313"	"1.97"	"21.14"
"322"	"[K].AEAMLGPSLSPGQDSEGDSSYKNIHLEK.[K]"	"1xBiotin [K22]"	"7.6812E-05"	"0.000586377"	"1"	"1"	"5"	"P09581"	"P09581 [677-704]"	"P09581 1xBiotin [K698]"	"Macrophage colony-stimulating factor 1 receptor [OS=Mus musculus]"	"1"	"3186.47180"	"9.97"	"9.97"	""	""	"9.97"	"-0.72"	"0.59"	""	"298.7"	"120.1"	""	""	"181.2"	""	"74871.515625"	"30108.830078125"	""	""	"45416.60546875"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"1062.82947"	"0.0001108"	"5.128E-07"	"5.26"	"44.64"
"27611"	"[K].VTAIKSLSIEIGHEVK.[N]"	"1xBiotin [K5]"	"4.41003E-06"	"0.000586377"	"1"	"1"	"26"	"O35623"	"O35623 [43-58]"	"O35623 1xBiotin [K47]"	"BET1 homolog [OS=Mus musculus]"	"1"	"1950.07286"	"0.63"	"0.65"	"-0.89"	"-4.45"	"0.67"	"0.03"	"0.02"	"95.4"	"147.9"	"149.5"	"51.6"	"4.4"	"151.2"	"1163068.2890625"	"1804344.625"	"1823097.65625"	"629783.82421875"	"53154.53515625"	"1844194.25"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"975.54050"	"0.0001108"	"7.935E-09"	"4.35"	"49.41"
"27599"	"[R].VSTMRPLATAYKASTSDYQVISDR.[Q]"	"1xBiotin [K12]; 1xOxidation [M4]"	"1.28842E-06"	"0.000586377"	"1"	"1"	"5"	"Q8R4R6"	"Q8R4R6 [282-305]"	"Q8R4R6 1xBiotin [K293]"	"Nucleoporin NUP53 [OS=Mus musculus]"	"1"	"2902.40735"	"0.01"	"0.12"	"-0.98"	"-3.50"	"0.41"	"0.40"	"0.29"	"119.5"	"120.5"	"130.2"	"60.5"	"10.6"	"158.7"	"82475.234375"	"83110.890625"	"89795.3359375"	"41759.60546875"	"7296.24658203125"	"109508.375"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"3"	"968.14098"	"0.0001108"	"1.314E-09"	"5.79"	"41.97"
"323"	"[K].AEAMLGPSLSPGQDSEGDSSYKNIHLEK.[K]"	"1xBiotin [K22]; 1xOxidation [M4]"	"1.39802E-06"	"0.000586377"	"1"	"1"	"12"	"P09581"	"P09581 [677-704]"	"P09581 1xBiotin [K698]"	"Macrophage colony-stimulating factor 1 receptor [OS=Mus musculus]"	"1"	"3202.46672"	"0.53"	"0.18"	"-0.18"	"-2.43"	"0.38"	"-0.15"	"0.20"	"100.9"	"145.8"	"114.4"	"89.0"	"18.7"	"131.2"	"154109.13671875"	"222718.701171875"	"174734.3125"	"135937.65625"	"28535.404296875"	"200341.544921875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"1068.16060"	"0.0001108"	"1.477E-09"	"5.53"	"42.30"
"27560"	"[R].VSNVLKEEWSR.[I]"	"1xBiotin [K6]"	"0.000203409"	"0.000586377"	"1"	"1"	"6"	"Q922Y2"	"Q922Y2 [281-291]"	"Q922Y2 1xBiotin [K286]"	"Tripartite motif-containing protein 59 [OS=Mus musculus]"	"1"	"1572.78389"	"0.18"	"-0.01"	"-0.31"	"-0.48"	"0.05"	"-0.13"	"0.06"	"105.6"	"119.7"	"104.8"	"85.3"	"75.5"	"109.2"	"64265.51953125"	"72885.0234375"	"63772.84375"	"51916.32421875"	"45943.6875"	"66469.875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"786.89567"	"0.0001108"	"2.116E-06"	"3.08"	"44.32"
"27656"	"[K].VTKSAQK.[A]"	"1xBiotin [K3]"	"0.0179684"	"0.000586377"	"1"	"2"	"12"	"P10126"	"P10126 [451-457]"	"P10126 1xBiotin [K453]"	"Elongation factor 1-alpha 1 [OS=Mus musculus]"	"1"	"987.52918"	"1.22"	"1.03"	"1.20"	"1.13"	"1.07"	"-0.15"	"0.04"	"50.2"	"116.8"	"102.3"	"115.6"	"109.8"	"105.3"	"35255.0625"	"82061.1796875"	"71906.7421875"	"81212.8359375"	"77135.4296875"	"73965.828125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"494.26807"	"0.0001108"	"0.001484"	"2.70"	"17.82"
"368"	"[R].AEKRPILSVQR.[R]"	"1xBiotin [K3]"	"0.00245168"	"0.000586377"	"1"	"1"	"6"	"Q3TB48"	"Q3TB48 [107-117]"	"Q3TB48 1xBiotin [K109]"	"transmembrane protein 104 [OS=Mus musculus]"	"1"	"1522.85224"	"0.54"	"0.31"	"0.42"	"0.30"	"0.39"	"-0.15"	"0.07"	"79.3"	"114.9"	"98.6"	"106.1"	"97.4"	"103.8"	"32781.02734375"	"47502.4921875"	"40769.34765625"	"43892.35546875"	"40271.015625"	"42943.49609375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"508.28866"	"0.0001108"	"8.064E-05"	"3.92"	"34.26"
"27523"	"[R].VSGILVKR.[N]"	"1xBiotin [K7]"	"0.0139353"	"0.000586377"	"1"	"1"	"4"	"Q9QXK7"	"Q9QXK7 [481-488]"	"Q9QXK7 1xBiotin [K487]"	"Cleavage and polyadenylation specificity factor subunit 3 [OS=Mus musculus]"	"1"	"1097.64996"	"3.51"	"0.84"	"0.83"	"0.62"	"0.70"	"-2.81"	"-0.13"	"31.3"	"357.9"	"55.9"	"55.5"	"48.3"	"51.0"	"21123.640625"	"241387.79296875"	"37728.18359375"	"37451.6875"	"32558.8369140625"	"34398.48046875"	""	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"2"	"549.32855"	"0.0001108"	"0.001024"	"2.66"	"37.35"
"439"	"[R].AFEGQAHSGKGPAGVELNSMQPVK.[E]"	"1xBiotin [K10]; 1xOxidation [M20]"	"1.55135E-07"	"0.000586377"	"1"	"1"	"6"	"P32037"	"P32037 [464-487]"	"P32037 1xBiotin [K473]"	"Solute carrier family 2, facilitated glucose transporter member 3 [OS=Mus musculus]"	"1"	"2681.28103"	"-0.08"	"0.16"	"0.16"	"-0.93"	"-0.05"	"0.03"	"-0.21"	"105.9"	"100.2"	"118.2"	"118.1"	"55.6"	"102.1"	"76923.2265625"	"72794.5234375"	"85891.6328125"	"85809.3515625"	"40377.28515625"	"74215.296875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"894.43210"	"0.0001108"	"5.961E-11"	"6.89"	"34.89"
"27504"	"[R].VSDHAAAMNKR.[I]"	"1xBiotin [K10]; 1xOxidation [M8]"	"0.0562059"	"0.0019826"	"1"	"1"	"4"	"Q8BGD6"	"Q8BGD6 [56-66]"	"Q8BGD6 1xBiotin [K65]"	"Sodium-coupled neutral amino acid transporter 9 [OS=Mus musculus]"	"1"	"1441.66748"	"-0.18"	"-0.08"	"0.19"	"-1.18"	"0.01"	"0.19"	"0.09"	"110.8"	"97.5"	"104.7"	"126.6"	"48.9"	"111.5"	"11347.7265625"	"9982.046875"	"10720.82421875"	"12959.94140625"	"5008.64453125"	"11415.740234375"	""	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"3"	"481.22728"	"0.0003442"	"0.008071"	"2.27"	"17.41"
"27465"	"[R].VRPGFCFHLCSR.[A]"	"2xCarbamidomethyl [C6; C10]"	"0.0391689"	"0.00104877"	"1"	"3"	"1"	"O70133"	"O70133 [770-781]"	""	"Atp-dependent rna helicase a [OS=Mus musculus]"	"0"	"1535.73583"	"0.80"	"0.55"	"0.85"	"0.53"	"-0.28"	"-1.08"	"-0.83"	"72.5"	"126.1"	"105.8"	"131.0"	"105.0"	"59.7"	"18685.892578125"	"32514.6171875"	"27287.279296875"	"33779.70703125"	"27071.416015625"	"15392.1474609375"	""	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"3"	"512.58341"	"0.0001873"	"0.004694"	"2.47"	"34.09"
"443"	"[R].AFGDKQSCLHPFTEDDAVDPNDSDIDPESR.[E]"	"1xBiotin [K5]; 1xCarbamidomethyl [C8]"	"0.002466"	"0.000586377"	"1"	"1"	"2"	"P41233"	"P41233 [1274-1303]"	"P41233 1xBiotin [K1278]"	"ATP-binding cassette sub-family A member 1 [OS=Mus musculus]"	"1"	"3603.52748"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"3"	"1201.84782"	"0.0001108"	"8.089E-05"	"4.27"	""
"27381"	"[K].VQGVGSKGWR.[D]"	"1xBiotin [K7]"	"0.0138549"	"0.000586377"	"1"	"1"	"1"	"Q9EPJ9"	"Q9EPJ9 [279-288]"	"Q9EPJ9 1xBiotin [K285]"	"ADP-ribosylation factor GTPase-activating protein 1 [OS=Mus musculus]"	"1"	"1299.66265"	"0.44"	"0.07"	"0.02"	"0.24"	"0.09"	"-0.35"	"0.02"	"90.0"	"121.9"	"94.7"	"91.4"	"106.3"	"95.7"	"70750.328125"	"95772.640625"	"74382.0703125"	"71806.8984375"	"83559.2578125"	"75163.109375"	""	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"2"	"650.33523"	"0.0001108"	"0.001016"	"2.68"	"35.11"
"446"	"[R].AFGSGYR.[R]"	""	"0.026417"	"0.00104877"	"1"	"1"	"6"	"Q8BGD9"	"Q8BGD9 [280-286]"	""	"eukaryotic translation initiation factor 4B [OS=Mus musculus]"	"0"	"757.36276"	"0.77"	"0.54"	"1.22"	"1.05"	"0.63"	"-0.15"	"0.09"	"59.4"	"101.5"	"86.1"	"138.6"	"122.8"	"91.6"	"7327.02099609375"	"12517.30078125"	"10620.8486328125"	"17097.412109375"	"15152.509765625"	"11302.6123046875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"379.18504"	"0.0001873"	"0.002622"	"1.50"	"19.55"
"447"	"[R].AFGYYGPLR.[S]"	""	"0.0810517"	"0.00241047"	"1"	"2"	"6"	"P84104-1"	"P84104-1 [29-37]"	""	"Serine/arginine-rich splicing factor 3 [OS=Mus musculus]"	"0"	"1043.53089"	"0.82"	"0.63"	"1.16"	"0.87"	"0.67"	"-0.15"	"0.03"	"60.2"	"106.0"	"93.4"	"134.6"	"110.1"	"95.6"	"90999.9375"	"160111.546875"	"141122.765625"	"203362.84375"	"166342.515625"	"144326.78125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"522.26893"	"0.000415"	"0.01398"	"2.26"	"38.80"
"27530"	"[RK].VSKATVLAR.[I]"	"1xBiotin [K3]"	"0.00256864"	"0.000586377"	"1"	"3"	"8"	"P13516"	"P13516 [335-343]"	"P13516 1xBiotin [K337]"	"Acyl-CoA desaturase 1 [OS=Mus musculus]"	"1"	"1170.66634"	"0.84"	"0.35"	"0.80"	"0.50"	"0.78"	"-0.06"	"0.43"	"67.1"	"120.3"	"85.3"	"117.1"	"95.1"	"115.1"	"132746.015625"	"237929.40625"	"168654.125"	"231699.421875"	"188107.21875"	"227589"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"585.83681"	"0.0001108"	"8.573E-05"	"2.93"	"36.32"
"27359"	"[K].VQALKSEVDTTLYEQVLLEK.[E]"	"1xBiotin [K5]"	"0.00102284"	"0.000586377"	"1"	"4"	"2"	"Q8BH79"	"Q8BH79 [467-486]"	"Q8BH79 1xBiotin [K471]"	"Anoctamin-10 [OS=Mus musculus]"	"1"	"2532.32657"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"3"	"844.78064"	"0.0001108"	"2.248E-05"	"2.84"	""
"27658"	"[K].VTLADGNPLGCVCGKAK.[L]"	"1xBiotin [K]; 2xCarbamidomethyl [C11; C13]"	"5.70004E-06"	"0.000586377"	"1"	"2"	"12"	"Q3TNL8-1"	"Q3TNL8-1 [244-260]"	"Q3TNL8-1 1xBiotin [K]"	"Inositol 1,4,5-trisphosphate receptor-interacting protein [OS=Mus musculus]"	"1"	"1985.96055"	"-9.97"	"0.56"	"0.60"	"0.12"	"1.01"	"9.97"	"0.45"	"84.7"	""	"124.6"	"128.6"	"91.9"	"170.2"	"22503.767578125"	""	"33119.462890625"	"34159.345703125"	"24415.205078125"	"45237.4384765625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"993.48438"	"0.0001108"	"1.145E-08"	"2.63"	"43.58"
"27663"	"[K].VTLDWAKPK.[G]"	"1xBiotin [K7]"	"0.00961806"	"0.000586377"	"1"	"1"	"6"	"P09405"	"P09405 [637-645]"	"P09405 1xBiotin [K643]"	"Nucleolin [OS=Mus musculus]"	"0"	"1283.68165"	""	""	"9.97"	"9.97"	""	""	""	""	""	""	"277.1"	"322.9"	""	""	""	""	"9695.3095703125"	"11297.39453125"	""	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"642.34483"	"0.0001108"	"0.0005951"	"2.65"	"44.46"
"178"	"[K].AAVAAVHGAVHELLEFAR.[G]"	""	"1.45758E-05"	"0.000586377"	"1"	"2"	"2"	"Q61140-1"	"Q61140-1 [510-527]"	""	"Breast cancer anti-estrogen resistance protein 1 [OS=Mus musculus]"	"0"	"1861.00789"	"-9.97"	"-1.14"	"-9.97"	"-2.21"	"-9.97"	""	"-9.97"	"359.4"	""	"162.7"	""	"77.9"	""	"21982.796875"	""	"9950.73046875"	""	"4763.072265625"	""	""	"High"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"3"	"621.00802"	"0.0001108"	"4.511E-08"	"5.04"	"48.82"
"27859"	"[K].VWEVCFGKK.[G]"	"1xBiotin [K]; 1xCarbamidomethyl [C5]"	"0.00912871"	"0.000586377"	"1"	"1"	"4"	"Q9R099"	"Q9R099 [251-259]"	"Q9R099 1xBiotin [K]"	"Transducin beta-like protein 2 [OS=Mus musculus]"	"1"	"1378.66462"	"0.24"	"-9.97"	"-9.97"	"-1.13"	"0.19"	"-0.05"	"9.97"	"158.9"	"187.7"	""	""	"72.6"	"180.8"	"12541.3828125"	"14808.58984375"	""	""	"5728.93359375"	"14265.4716796875"	""	"High"	"High"	"High"	"Not Found"	"Peak Found"	"High"	"High"	"2"	"689.83587"	"0.0001108"	"0.0005513"	"2.20"	"46.44"
"27844"	"[K].VVTHPFKTIELQMK.[K]"	"1xBiotin [K7]; 1xOxidation [M13]"	"0.00081959"	"0.000586377"	"1"	"1"	"13"	"Q61093"	"Q61093 [300-313]"	"Q61093 1xBiotin [K306]"	"Cytochrome b-245 heavy chain [OS=Mus musculus]"	"1"	"1913.00234"	"-0.15"	"-0.16"	"-0.63"	"-2.26"	"0.09"	"0.24"	"0.26"	"127.2"	"114.9"	"113.5"	"82.1"	"26.6"	"135.6"	"179050.794921875"	"161695.8359375"	"159781.65625"	"115572.7109375"	"37508.953125"	"190878.521484375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"638.33890"	"0.0001108"	"1.623E-05"	"4.14"	"40.07"
"27843"	"[K].VVTHPFKTIELQMK.[K]"	"1xBiotin [K7]"	"0.00487344"	"0.000586377"	"1"	"1"	"6"	"Q61093"	"Q61093 [300-313]"	"Q61093 1xBiotin [K306]"	"Cytochrome b-245 heavy chain [OS=Mus musculus]"	"1"	"1897.00742"	"0.63"	"0.45"	"-0.66"	"-9.97"	"0.40"	"-0.24"	"-0.05"	"102.3"	"158.8"	"139.4"	"64.9"	""	"134.6"	"39814.2578125"	"61783.9453125"	"54250.71875"	"25265.1328125"	""	"52363.6640625"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"633.00738"	"0.0001108"	"0.0002198"	"3.22"	"44.87"
"27812"	"[K].VVNEINIEDLCLTKAAYCR.[C]"	"1xBiotin [K14]; 2xCarbamidomethyl [C11; C18]"	"2.15242E-06"	"0.000586377"	"1"	"1"	"51"	"Q9CQB5"	"Q9CQB5 [82-100]"	"Q9CQB5 1xBiotin [K95]"	"CDGSH iron-sulfur domain-containing protein 2 [OS=Mus musculus]"	"1"	"2507.20911"	"0.00"	"-0.13"	"-1.76"	"-5.43"	"0.54"	"0.54"	"0.66"	"128.0"	"128.2"	"117.2"	"37.9"	"3.0"	"185.8"	"2609881.66992188"	"2614395.44140625"	"2391454.25390625"	"772128.625"	"60631.1083984375"	"3789909.09130859"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"836.40795"	"0.0001108"	"2.765E-09"	"4.39"	"54.83"
"27804"	"[R].VVITQSPGKYVPPPPK.[L]"	"1xBiotin [K9]"	"0.00406902"	"0.000586377"	"1"	"1"	"6"	"Q8R3R5"	"Q8R3R5 [328-343]"	"Q8R3R5 1xBiotin [K336]"	"transmembrane protein 185B [OS=Mus musculus]"	"1"	"1933.06157"	"0.22"	"0.12"	"0.90"	"-0.31"	"0.11"	"-0.11"	"0.00"	"85.7"	"99.8"	"92.9"	"160.0"	"69.0"	"92.6"	"20202.32421875"	"23527.484375"	"21891.97265625"	"37722.41796875"	"16268.03125"	"21836.951171875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"645.02446"	"0.0001108"	"0.000169"	"2.80"	"39.71"
"27801"	"[K].VVITKVVTHPFK.[T]"	"1xBiotin [K5]"	"0.00431287"	"0.000586377"	"1"	"1"	"5"	"Q61093"	"Q61093 [295-306]"	"Q61093 1xBiotin [K299]"	"Cytochrome b-245 heavy chain [OS=Mus musculus]"	"1"	"1593.91853"	"9.97"	"9.97"	""	""	"9.97"	"-0.15"	"0.28"	""	"226.6"	"168.7"	""	""	"204.7"	""	"29578.609375"	"22018.0859375"	""	""	"26721.46484375"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"531.97761"	"0.0001108"	"0.0001836"	"2.97"	"41.76"
"27782"	"[K].VVIDKHPVR.[F]"	"1xBiotin [K5]"	"0.00355911"	"0.000586377"	"1"	"1"	"9"	"Q3TP92"	"Q3TP92 [97-105]"	"Q3TP92 1xBiotin [K101]"	"CTD nuclear envelope phosphatase 1 [OS=Mus musculus]"	"1"	"1288.71944"	"0.46"	"0.44"	"0.48"	"0.19"	"0.59"	"0.14"	"0.15"	"77.1"	"105.8"	"104.9"	"107.5"	"88.2"	"116.5"	"120776.643554688"	"165751.47265625"	"164327.736328125"	"168383.86328125"	"138135.537109375"	"182412.125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"644.86341"	"0.0001108"	"0.0001383"	"2.33"	"31.23"
"27661"	"[KR].VTIAQGGVLPNIQAVLLPKK.[T]"	"1xBiotin [K]"	"9.64274E-05"	"0.000586377"	"2"	"8"	"4"	"Q64523; Q8BFU2"	"Q64523 [101-120]; Q8BFU2 [101-120]"	"Q64523 1xBiotin [K]; Q8BFU2 1xBiotin [K]"	"Histone H2A type 2-C [OS=Mus musculus];Histone H2A type 3 [OS=Mus musculus]"	"1"	"2285.34137"	"-0.49"	"-0.35"	"-9.97"	"-9.97"	"0.22"	"0.72"	"0.57"	"163.7"	"116.2"	"128.8"	""	""	"191.2"	"16103.654296875"	"11432.8408203125"	"12666.7900390625"	""	""	"18807.69921875"	"NotUnique"	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"762.45199"	"0.0001108"	"7.134E-07"	"4.26"	"59.02"
"27773"	"[K].VVKTSVVFNK.[L]"	"1xBiotin [K3]"	"0.0267216"	"0.00104877"	"1"	"1"	"5"	"Q791N7"	"Q791N7 [51-60]"	"Q791N7 1xBiotin [K53]"	"DNA-directed RNA polymerase I subunit RPA12 [OS=Mus musculus]"	"1"	"1346.75007"	""	""	""	""	"9.97"	"9.97"	"9.97"	""	""	""	""	""	"600.0"	""	""	""	""	""	"20089.603515625"	""	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"2"	"673.87889"	"0.0001873"	"0.002665"	"2.77"	"38.36"
"183"	"[R].AAVPDAVGKCR.[S]"	"1xBiotin [K9]; 1xCarbamidomethyl [C10]"	"0.00732126"	"0.000586377"	"1"	"3"	"6"	"Q8VDN2"	"Q8VDN2 [597-607]"	"Q8VDN2 1xBiotin [K605]"	"Sodium/potassium-transporting ATPase subunit alpha-1 [OS=Mus musculus]"	"1"	"1369.67150"	"-0.01"	"-0.02"	"-0.36"	"0.19"	"0.23"	"0.24"	"0.26"	"98.7"	"98.3"	"97.1"	"77.2"	"112.6"	"116.2"	"26825.501953125"	"26709.421875"	"26373.630859375"	"20966.380859375"	"30591.396484375"	"31560.12890625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"685.33928"	"0.0001108"	"0.0003986"	"2.61"	"31.65"
"188"	"[K].AAVTPGKK.[A]"	"1xBiotin [K7]"	"0.0226234"	"0.00104877"	"1"	"1"	"6"	"P09405"	"P09405 [81-88]"	"P09405 1xBiotin [K87]"	"Nucleolin [OS=Mus musculus]"	"1"	"997.54991"	"0.65"	"0.63"	"0.46"	"0.71"	"0.66"	"0.01"	"0.03"	"68.9"	"108.0"	"106.9"	"94.5"	"112.8"	"108.8"	"18929.552734375"	"29670.208984375"	"29354.16796875"	"25956.552734375"	"30985.44140625"	"29886.314453125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"499.27847"	"0.0001873"	"0.002078"	"2.47"	"23.00"
"27742"	"[R].VVEPKR.[AI]"	"1xBiotin [K5]"	"0.12274"	"0.00865053"	"3"	"8"	"2"	"O88569; P49312-1; Q8BG05"	"O88569 [90-95]; P49312-1 [83-88]; Q8BG05 [104-109]"	"O88569 1xBiotin [K94]; P49312-1 1xBiotin [K87]; Q8BG05 1xBiotin [K108]"	"heterogeneous nuclear ribonucleoproteins A2/B1 [OS=Mus musculus];Heterogeneous nuclear ribonucleoprotein A1 [OS=Mus musculus];Heterogeneous nuclear ribonucleoprotein A3 [OS=Mus musculus]"	"1"	"953.52370"	"-0.06"	"-9.97"	"-0.19"	"0.02"	"0.12"	"0.17"	"9.97"	"121.7"	"116.8"	""	"106.7"	"123.0"	"131.9"	"61561.90625"	"59128.625"	""	"53986.90234375"	"62221.78125"	"66733.4140625"	"NotUnique"	"High"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"2"	"477.26533"	"0.00163"	"0.02633"	"1.58"	"23.43"
"27734"	"[K].VVEATAFGLGKEDAVLK.[V]"	"1xBiotin [K]"	"0.000199881"	"0.000586377"	"1"	"1"	"8"	"P09581"	"P09581 [594-610]"	"P09581 1xBiotin [K]"	"Macrophage colony-stimulating factor 1 receptor [OS=Mus musculus]"	"1"	"1973.04122"	"9.97"	"9.97"	"9.97"	""	""	"-9.97"	"-9.97"	""	"178.1"	"217.5"	"204.3"	""	""	""	"18415.890625"	"22484.17578125"	"21124.533203125"	""	""	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"987.02422"	"0.0001108"	"2.07E-06"	"3.98"	"50.74"
"267"	"[R].ADKSAVGFDYK.[G]"	"1xBiotin [K3]"	"0.00010899"	"0.000586377"	"1"	"1"	"6"	"P49710"	"P49710 [131-141]"	"P49710 1xBiotin [K133]"	"Hematopoietic lineage cell-specific protein [OS=Mus musculus]"	"1"	"1426.66713"	"0.28"	"0.40"	"0.38"	"0.70"	"0.59"	"0.31"	"0.19"	"75.3"	"91.3"	"99.4"	"98.0"	"122.6"	"113.5"	"47674.46484375"	"57828.12890625"	"62949.6953125"	"62050.5390625"	"77634.375"	"71922.2734375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"713.83768"	"0.0001108"	"8.53E-07"	"3.88"	"38.12"
"27708"	"[R].VTTNVKR.[G]"	"1xBiotin [K6]"	"0.0591084"	"0.0019826"	"1"	"3"	"6"	"Q9DBR4-1"	"Q9DBR4-1 [735-741]"	"Q9DBR4-1 1xBiotin [K740]"	"Amyloid-beta A4 precursor protein-binding family B member 2 [OS=Mus musculus]"	"1"	"1043.56663"	"-0.13"	"0.11"	"-0.26"	"-0.10"	"0.01"	"0.15"	"-0.09"	"104.1"	"95.0"	"112.0"	"87.0"	"97.0"	"105.0"	"26694.544921875"	"24359.998046875"	"28730.41015625"	"22314.525390625"	"24876.51171875"	"26942.759765625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"522.28689"	"0.0003442"	"0.008663"	"2.35"	"23.43"
"269"	"[R].ADLDQPKFFTFDSLTELTSR.[T]"	"1xBiotin [K7]"	"0.000493514"	"0.000586377"	"1"	"1"	"4"	"Q8BH02"	"Q8BH02 [64-83]"	"Q8BH02 1xBiotin [K70]"	"Torsin-4A [OS=Mus musculus]"	"1"	"2557.22792"	"0.61"	"0.38"	"-9.97"	"-9.97"	"0.61"	"0.00"	"0.23"	"111.9"	"171.3"	"146.0"	""	""	"170.8"	"13886.48828125"	"21261.9453125"	"18129.10546875"	""	""	"21207.240234375"	""	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"853.08005"	"0.0001108"	"7.761E-06"	"3.78"	"62.57"
"27669"	"[R].VTIMPKDIQLAR.[R]"	"1xBiotin [K6]; 1xOxidation [M4]"	"0.00076421"	"0.000586377"	"1"	"4"	"9"	"P68433"	"P68433 [118-129]"	"P68433 1xBiotin [K123]"	"Histone H3.1 [OS=Mus musculus]"	"1"	"1626.87059"	"-0.11"	"-0.27"	"-0.10"	"-1.88"	"-0.04"	"0.08"	"0.23"	"121.6"	"112.5"	"101.0"	"113.1"	"33.1"	"118.6"	"39949.2109375"	"36956.69140625"	"33184.03515625"	"37159.625"	"10862.8955078125"	"38964.65625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"813.93937"	"0.0001108"	"1.46E-05"	"3.13"	"43.71"
"27771"	"[K].VVKQASEGPLK.[G]"	"1xBiotin [K3]"	"0.00028361"	"0.000586377"	"1"	"1"	"8"	"P16858"	"P16858 [259-269]"	"P16858 1xBiotin [K261]"	"glyceraldehyde-3-phosphate dehydrogenase [OS=Mus musculus]"	"1"	"1381.75080"	"0.22"	"0.13"	"0.18"	"0.28"	"0.07"	"-0.15"	"-0.06"	"90.3"	"104.8"	"98.6"	"102.4"	"109.3"	"94.6"	"62473.9921875"	"72515.96875"	"68195.40625"	"70833.1328125"	"75625.015625"	"65468.81640625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"691.37843"	"0.0001108"	"3.448E-06"	"3.32"	"30.92"
"27339"	"[R].VPTTAKER.[V]"	"1xBiotin [K6]"	"0.0297929"	"0.00104877"	"1"	"2"	"4"	"Q9CQ56"	"Q9CQ56 [106-113]"	"Q9CQ56 1xBiotin [K111]"	"Vesicle transport protein USE1 [OS=Mus musculus]"	"1"	"1127.58775"	"0.01"	"-0.01"	"-0.08"	"-0.22"	"-0.15"	"-0.15"	"-0.13"	"105.2"	"105.8"	"104.1"	"99.6"	"90.3"	"95.1"	"17118.689453125"	"17222.5703125"	"16943.154296875"	"16221.70703125"	"14693.033203125"	"15480.4453125"	""	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"2"	"564.29752"	"0.0001873"	"0.003122"	"1.95"	"23.72"
"27286"	"[K].VPKTAENFR.[A]"	"1xBiotin [K3]"	"0.0207529"	"0.00104877"	"1"	"1"	"7"	"P17742"	"P17742 [29-37]"	"P17742 1xBiotin [K31]"	"peptidyl-prolyl cis-trans isomerase A [OS=Mus musculus]"	"1"	"1287.65142"	"0.77"	"0.33"	"0.36"	"0.49"	"0.63"	"-0.14"	"0.30"	"73.1"	"124.7"	"92.2"	"94.0"	"102.7"	"113.3"	"24840.193359375"	"42351.4921875"	"31323.77734375"	"31924.255859375"	"34875.59765625"	"38489.44921875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"644.32936"	"0.0001108"	"0.001829"	"2.21"	"32.21"
"27252"	"[R].VPEKGGFSPFGNTQGPSR.[V]"	"1xBiotin [K4]"	"4.86964E-06"	"0.000586377"	"1"	"1"	"21"	"Q8BMG7"	"Q8BMG7 [441-458]"	"Q8BMG7 1xBiotin [K444]"	"Rab3 GTPase-activating protein non-catalytic subunit [OS=Mus musculus]"	"1"	"2087.99673"	"0.25"	"0.20"	"-0.02"	"-0.62"	"0.33"	"0.08"	"0.13"	"96.4"	"114.3"	"110.8"	"95.2"	"62.5"	"120.8"	"160890.1953125"	"190738.5859375"	"184833.57421875"	"158889.140625"	"104345.78515625"	"201630.890625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"1044.50149"	"0.0001108"	"9.153E-09"	"4.09"	"43.74"
"26944"	"[K].VILHLKEDQTEYLEER.[R]"	"1xBiotin [K6]"	"0.00600852"	"0.000586377"	"1"	"2"	"1"	"P11499"	"P11499 [181-196]"	"P11499 1xBiotin [K186]"	"Heat shock protein HSP 90-beta [OS=Mus musculus]"	"1"	"2241.12199"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"3"	"747.71196"	"0.0001108"	"0.0002971"	"2.05"	""
"26922"	"[K].VLKQVHPDTGISSK.[A]"	"1xBiotin [K3]"	"3.64128E-05"	"0.000586377"	"2"	"13"	"19"	"Q64525; P10854"	"Q64525 [45-58]; P10854 [45-58]"	"Q64525 1xBiotin [K47]; P10854 1xBiotin [K47]"	"Histone H2B type 2-B [OS=Mus musculus];Histone H2B type 1-M [OS=Mus musculus]"	"1"	"1734.92072"	"0.67"	"0.21"	"0.46"	"0.49"	"0.42"	"-0.25"	"0.21"	"76.4"	"121.3"	"88.4"	"104.9"	"106.9"	"102.1"	"366853.99609375"	"582461.3515625"	"424562.05078125"	"503929.94140625"	"513623.078125"	"490346.953125"	"NotUnique"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"867.96373"	"0.0001108"	"1.728E-07"	"3.91"	"31.28"
"26876"	"[R].VLFRPSDATNSSNLDALSSNTSLKLR.[K]"	"1xBiotin [K24]"	"1.75346E-07"	"0.000586377"	"1"	"1"	"5"	"Q8K273"	"Q8K273 [99-124]"	"Q8K273 1xBiotin [K122]"	"Membrane magnesium transporter 1 [OS=Mus musculus]"	"1"	"3032.54696"	"0.35"	"0.02"	"-9.97"	"-9.97"	"0.90"	"0.55"	"0.88"	"116.2"	"148.6"	"118.1"	""	""	"217.1"	"77920.859375"	"99616.3359375"	"79147.3828125"	""	""	"145530.640625"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"1011.52090"	"0.0001108"	"7.146E-11"	"7.50"	"48.82"
"26858"	"[K].VLEALHSIKTK.[G]"	"1xBiotin [K9]"	"0.00846525"	"0.000586377"	"1"	"1"	"6"	"P00920"	"P00920 [159-169]"	"P00920 1xBiotin [K167]"	"Carbonic anhydrase 2 [OS=Mus musculus]"	"1"	"1464.82430"	"-9.97"	"0.32"	"-9.97"	"0.40"	"0.18"	"9.97"	"-0.14"	"127.4"	""	"159.2"	""	"168.5"	"144.8"	"15321.9575195313"	""	"19146.22265625"	""	"20261.2260742188"	"17408.560546875"	""	"High"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"High"	"2"	"732.91723"	"0.0001108"	"0.0004939"	"3.08"	"38.63"
"668"	"[R].AHHKFSETHADPHNSR.[R]"	"1xBiotin [K4]"	"0.000468283"	"0.000586377"	"2"	"4"	"11"	"P13011; P13516"	"P13011 [158-173]; P13516 [155-170]"	"P13011 1xBiotin [K161]; P13516 1xBiotin [K158]"	"Acyl-CoA desaturase 2 [OS=Mus musculus];Acyl-CoA desaturase 1 [OS=Mus musculus]"	"1"	"2096.94676"	"0.83"	"0.75"	"0.46"	"0.75"	"0.64"	"-0.18"	"-0.10"	"66.1"	"117.1"	"111.1"	"90.9"	"111.4"	"103.3"	"24195.931640625"	"42869.052734375"	"40662.2573242188"	"33282.5966796875"	"40795.5498046875"	"37831.4135742188"	"NotUnique"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"4"	"524.99200"	"0.0001108"	"7.147E-06"	"3.15"	"17.51"
"676"	"[K].AHLSAPVPNTKSPTAPR.[F]"	"1xBiotin [K11]"	"0.000261377"	"0.000586377"	"1"	"1"	"6"	"P70261"	"P70261 [586-602]"	"P70261 1xBiotin [K596]"	"paladin [OS=Mus musculus]"	"1"	"1970.02764"	"0.52"	"0.23"	"0.36"	"-0.21"	"0.69"	"0.18"	"0.47"	"81.4"	"116.5"	"95.4"	"104.6"	"70.4"	"131.7"	"43350.015625"	"62012.8828125"	"50774.6171875"	"55666.19140625"	"37460.7265625"	"70113.09375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"657.34785"	"0.0001108"	"3.054E-06"	"4.94"	"32.33"
"696"	"[R].AHVTGASSSSSSSTKGTYFPAILNPPPSPATER.[S]"	"1xBiotin [K15]"	"0.00140124"	"0.000586377"	"1"	"1"	"4"	"O88572"	"O88572 [1463-1495]"	"O88572 1xBiotin [K1477]"	"Low-density lipoprotein receptor-related protein 6 [OS=Mus musculus]"	"1"	"3528.70637"	"0.10"	"-0.08"	"-2.75"	"-9.97"	"0.59"	"0.49"	"0.67"	"128.5"	"137.3"	"121.6"	"19.2"	""	"193.4"	"23871.984375"	"25499.18359375"	"22582.8125"	"3559.21606445313"	""	"35908.3359375"	""	"High"	"High"	"High"	"Peak Found"	"Not Found"	"High"	"High"	"3"	"1176.90689"	"0.0001108"	"3.543E-05"	"3.90"	"47.72"
"26805"	"[R].VKVTEGQDPELVR.[H]"	"1xBiotin [K2]"	"0.000729384"	"0.000586377"	"1"	"1"	"6"	"Q8VBT6"	"Q8VBT6 [446-458]"	"Q8VBT6 1xBiotin [K447]"	"Apolipoprotein B receptor [OS=Mus musculus]"	"1"	"1695.87343"	"0.11"	"0.08"	"-0.08"	"0.07"	"0.01"	"-0.10"	"-0.07"	"97.8"	"105.3"	"103.7"	"92.5"	"102.3"	"98.5"	"40536.53515625"	"43644.10546875"	"42987.76953125"	"38332.140625"	"42418.8203125"	"40816.5546875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"848.44018"	"0.0001108"	"1.372E-05"	"3.30"	"35.41"
"617"	"[K].AGSKGGNLR.[D]"	"1xBiotin [K4]"	"0.0122692"	"0.000586377"	"1"	"1"	"6"	"Q922Q8"	"Q922Q8 [4-12]"	"Q922Q8 1xBiotin [K7]"	"Leucine-rich repeat-containing protein 59 [OS=Mus musculus]"	"1"	"1085.55204"	"0.48"	"0.28"	"0.33"	"0.31"	"0.52"	"0.04"	"0.24"	"79.6"	"111.1"	"96.7"	"99.7"	"98.4"	"114.4"	"53534.828125"	"74723.515625"	"65044.515625"	"67065.6015625"	"66173.4296875"	"76894.9140625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"543.27954"	"0.0001108"	"0.0008488"	"2.47"	"23.56"
"26787"	"[K].VKTVPLHLEEDIRPEMK.[E]"	"1xBiotin [K2]; 1xOxidation [M16]"	"0.000305946"	"0.000586377"	"1"	"1"	"17"	"P13516"	"P13516 [31-47]"	"P13516 1xBiotin [K32]"	"Acyl-CoA desaturase 1 [OS=Mus musculus]"	"1"	"2276.17774"	"0.23"	"0.07"	"-0.37"	"-2.48"	"0.15"	"-0.09"	"0.08"	"113.6"	"133.5"	"119.0"	"87.8"	"20.3"	"125.8"	"1026852.5625"	"1206367.09375"	"1075607.53125"	"793324.25"	"183522.6171875"	"1136858.5"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"759.39726"	"0.0001108"	"3.837E-06"	"4.69"	"40.51"
"697"	"[K].AKAAALAAAAADAPQR.[N]"	"1xBiotin [K2]"	"2.44926E-05"	"0.000586377"	"1"	"2"	"7"	"Q91ZP6"	"Q91ZP6 [167-182]"	"Q91ZP6 1xBiotin [K168]"	"NEDD4 family-interacting protein 2 [OS=Mus musculus]"	"1"	"1692.88500"	"0.88"	"0.82"	"0.74"	"0.78"	"1.09"	"0.21"	"0.27"	"59.3"	"108.9"	"104.6"	"98.9"	"102.1"	"126.1"	"26882.005859375"	"49362.830078125"	"47436.9951171875"	"44845.6328125"	"46306.6494140625"	"57189.142578125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"846.94604"	"0.0001108"	"9.62E-08"	"4.33"	"38.97"
"26783"	"[K].VKSPNGK.[A]"	"1xBiotin [K2]"	"0.0347582"	"0.00104877"	"1"	"1"	"7"	"O88455"	"O88455 [12-18]"	"O88455 1xBiotin [K13]"	"7-dehydrocholesterol reductase [OS=Mus musculus]"	"1"	"955.50296"	"1.11"	"0.89"	"0.76"	"0.83"	"0.76"	"-0.34"	"-0.12"	"59.0"	"127.2"	"109.3"	"99.8"	"104.5"	"100.2"	"53002.4765625"	"114239.8671875"	"98166.7734375"	"89663.84375"	"93914.078125"	"90058.9296875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"478.25506"	"0.0001873"	"0.003944"	"2.68"	"18.20"
"716"	"[K].AKEIESEEQNLVTK.[G]"	"1xBiotin [K2]"	"4.92677E-06"	"0.000586377"	"1"	"1"	"12"	"Q3U9G9"	"Q3U9G9 [187-200]"	"Q3U9G9 1xBiotin [K188]"	"Lamin-B receptor [OS=Mus musculus]"	"1"	"1843.91060"	"-0.05"	"-0.15"	"-0.26"	"0.00"	"-0.20"	"-0.15"	"-0.05"	"107.7"	"103.9"	"97.1"	"90.1"	"107.4"	"93.8"	"168923.2734375"	"163088.4765625"	"152347.6484375"	"141318.93359375"	"168541.21875"	"147235.3203125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"922.45909"	"0.0001108"	"9.322E-09"	"4.74"	"37.84"
"26738"	"[K].VKHMANQLLAK.[F]"	"1xBiotin [K2]; 1xOxidation [M4]"	"0.000942677"	"0.000586377"	"1"	"3"	"19"	"Q8BML1"	"Q8BML1 [713-723]"	"Q8BML1 1xBiotin [K714]"	"[F-actin]-monooxygenase MICAL2 [OS=Mus musculus]"	"1"	"1494.79195"	"0.58"	"0.03"	"0.09"	"-0.69"	"0.51"	"-0.07"	"0.48"	"90.6"	"135.1"	"92.4"	"96.6"	"56.1"	"129.1"	"121112.517578125"	"180536.2421875"	"123492.845703125"	"129126.5859375"	"74904.748046875"	"172488.390136719"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"498.93517"	"0.0001108"	"1.994E-05"	"4.17"	"27.88"
"26737"	"[K].VKHMANQLLAK.[F]"	"1xBiotin [K2]"	"0.000111562"	"0.000586377"	"1"	"3"	"9"	"Q8BML1"	"Q8BML1 [713-723]"	"Q8BML1 1xBiotin [K714]"	"[F-actin]-monooxygenase MICAL2 [OS=Mus musculus]"	"1"	"1478.79704"	"1.55"	"0.86"	"-9.97"	"2.00"	"0.66"	"-0.89"	"-0.20"	"53.0"	"155.0"	"96.4"	""	"211.9"	"83.8"	"29412.6484375"	"86095.625"	"53512.80859375"	""	"117646.359375"	"46507.5078125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"493.60375"	"0.0001108"	"8.791E-07"	"4.52"	"33.57"
"717"	"[K].AKEIESEEQNLVTKGPAPLGTFQVTTPQR.[K]"	"1xBiotin [K14]"	"3.47219E-06"	"0.000586377"	"1"	"1"	"19"	"Q3U9G9"	"Q3U9G9 [187-215]"	"Q3U9G9 1xBiotin [K200]"	"Lamin-B receptor [OS=Mus musculus]"	"2"	"3394.73113"	"-0.32"	"-0.17"	"-1.90"	"-5.30"	"0.15"	"0.48"	"0.32"	"146.6"	"117.2"	"130.2"	"39.3"	"3.7"	"163.0"	"582867.234375"	"465792.40625"	"517772.875"	"156338.4609375"	"14752.5703125"	"647966.0625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"1132.24835"	"0.0001108"	"5.567E-09"	"5.43"	"47.92"
"26720"	"[R].VKEVLPHVPLNVIQR.[D]"	"1xBiotin [K2]"	"1.88394E-05"	"0.000586377"	"1"	"1"	"6"	"P70295"	"P70295 [304-318]"	"P70295 1xBiotin [K305]"	"Ancient ubiquitous protein 1 [OS=Mus musculus]"	"1"	"1967.12590"	"0.60"	"0.51"	"-0.57"	"-9.97"	"0.68"	"0.07"	"0.16"	"96.5"	"146.6"	"137.6"	"65.1"	""	"154.1"	"74736.7578125"	"113542.875"	"106547.5859375"	"50406.73046875"	""	"119346.4296875"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"656.38026"	"0.0001108"	"6.561E-08"	"4.58"	"47.57"
"718"	"[K].AKEIESEEQNLVTKGPAPLGTFQVTTPQR.[K]"	"2xBiotin [K2; K14]"	"0.0088163"	"0.000586377"	"1"	"1"	"2"	"Q3U9G9"	"Q3U9G9 [187-215]"	"Q3U9G9 2xBiotin [K188; K200]"	"Lamin-B receptor [OS=Mus musculus]"	"2"	"3620.80873"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"3"	"1207.61013"	"0.0001108"	"0.0005233"	"3.17"	""
"26786"	"[K].VKTVPLHLEEDIRPEMK.[E]"	"1xBiotin [K2]"	"6.75032E-06"	"0.000586377"	"1"	"1"	"10"	"P13516"	"P13516 [31-47]"	"P13516 1xBiotin [K32]"	"Acyl-CoA desaturase 1 [OS=Mus musculus]"	"1"	"2260.18282"	"0.87"	"0.38"	"-1.11"	"-9.97"	"0.69"	"-0.18"	"0.31"	"96.9"	"176.7"	"125.7"	"44.8"	""	"155.9"	"157835.2265625"	"287798.1171875"	"204847.4609375"	"73028.38671875"	""	"254004.6171875"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"754.06540"	"0.0001108"	"1.47E-08"	"4.94"	"43.18"
"26979"	"[R].VLMKSPSPALHPPQK.[Y]"	"1xBiotin [K4]; 1xOxidation [M3]"	"0.00137695"	"0.000586377"	"1"	"1"	"6"	"B2RR83"	"B2RR83 [1232-1246]"	"B2RR83 1xBiotin [K1235]"	"Probable ATP-dependent RNA helicase YTHDC2 [OS=Mus musculus]"	"1"	"1871.98702"	"-0.21"	"0.16"	"0.31"	"-0.84"	"0.16"	"0.37"	"0.00"	"101.8"	"87.9"	"113.6"	"126.1"	"57.0"	"113.6"	"17787.751953125"	"15369.845703125"	"19857.740234375"	"22043.796875"	"9964.7978515625"	"19866.15625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"624.66783"	"0.0001108"	"3.458E-05"	"2.88"	"33.33"
"26989"	"[K].VLNKGVENPLPDRPR.[E]"	"1xBiotin [K4]"	"2.00875E-05"	"0.000586377"	"1"	"1"	"9"	"Q07832"	"Q07832 [342-356]"	"Q07832 1xBiotin [K345]"	"Serine/threonine-protein kinase PLK1 [OS=Mus musculus]"	"1"	"1930.03273"	"1.27"	"0.25"	"0.39"	"-0.16"	"0.88"	"-0.39"	"0.63"	"69.3"	"167.6"	"82.5"	"90.9"	"62.2"	"127.5"	"68724.953125"	"166276.96875"	"81816.5625"	"90223.1484375"	"61704.7890625"	"126508.90625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"644.01592"	"0.0001108"	"7.238E-08"	"3.98"	"36.79"
"27002"	"[K].VLNPPGGKSSLSFY.[-]"	"1xBiotin [K8]"	"0.106881"	"0.00731053"	"1"	"1"	"4"	"Q6PGH2"	"Q6PGH2 [177-190]"	"Q6PGH2 1xBiotin [K184]"	"Jupiter microtubule associated homolog 2 [OS=Mus musculus]"	"1"	"1691.84615"	"-0.29"	"-0.65"	"-0.51"	"-2.05"	"-0.14"	"0.15"	"0.51"	"139.4"	"114.1"	"88.9"	"97.6"	"33.7"	"126.3"	"27575.298828125"	"22564.064453125"	"17577.224609375"	"19297.048828125"	"6661.14892578125"	"24983.580078125"	""	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"2"	"846.42614"	"0.001426"	"0.02131"	"3.39"	"52.15"
"27234"	"[R].VPAYDLCSAESANLVLKK.[S]"	"1xBiotin [K]; 1xCarbamidomethyl [C7]"	"1.64599E-06"	"0.000586377"	"1"	"1"	"9"	"Q99KC8"	"Q99KC8 [639-656]"	"Q99KC8 1xBiotin [K]"	"von Willebrand factor A domain-containing protein 5A [OS=Mus musculus]"	"1"	"2204.10899"	"1.07"	"0.89"	"0.50"	"-9.97"	"0.04"	"-1.03"	"-0.85"	"81.2"	"170.5"	"150.4"	"114.6"	""	"83.4"	"15690.25390625"	"32951.2158203125"	"29070.1123046875"	"22147.1469726563"	""	"16129.470703125"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"2"	"1102.55789"	"0.0001108"	"1.867E-09"	"4.47"	"48.17"
"27233"	"[R].VPATKTVHLQSR.[A]"	"1xBiotin [K5]"	"2.49249E-05"	"0.000586377"	"1"	"2"	"30"	"Q9CQ56"	"Q9CQ56 [114-125]"	"Q9CQ56 1xBiotin [K118]"	"Vesicle transport protein USE1 [OS=Mus musculus]"	"1"	"1562.84716"	"0.49"	"0.26"	"0.54"	"0.31"	"0.59"	"0.10"	"0.33"	"77.0"	"108.0"	"92.0"	"112.2"	"95.3"	"115.5"	"727844.375"	"1020981.6640625"	"870354.421875"	"1061276.265625"	"901245.34375"	"1092780.46875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"781.92710"	"0.0001108"	"9.932E-08"	"4.40"	"30.64"
"27227"	"[K].VPAGPKTLK.[K]"	"1xBiotin [K6]"	"0.0078955"	"0.000586377"	"1"	"1"	"10"	"P14148"	"P14148 [22-30]"	"P14148 1xBiotin [K27]"	"60S ribosomal protein L7 [OS=Mus musculus]"	"1"	"1136.64963"	"0.66"	"0.30"	"0.32"	"0.42"	"0.59"	"-0.06"	"0.29"	"76.0"	"119.8"	"93.5"	"94.6"	"101.4"	"114.6"	"45369.85546875"	"71556.6171875"	"55867.40625"	"56479.10546875"	"60582.32421875"	"68467.9765625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"568.82847"	"0.0001108"	"0.0004452"	"2.83"	"31.25"
"27182"	"[R].VNLAMDVGKAR.[G]"	"1xBiotin [K9]"	"0.00209482"	"0.000586377"	"1"	"2"	"4"	"P52480"	"P52480 [490-500]"	"P52480 1xBiotin [K498]"	"Pyruvate kinase PKM [OS=Mus musculus]"	"1"	"1399.71845"	"0.04"	"0.62"	"0.58"	"-9.97"	"-9.97"	"-9.97"	"-9.97"	"118.6"	"121.9"	"181.7"	"177.8"	""	""	"5849.96044921875"	"6012.64501953125"	"8961.4521484375"	"8769.2392578125"	""	""	""	"High"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"High"	"2"	"700.36324"	"0.0001108"	"6.4E-05"	"2.95"	"40.18"
"459"	"[K].AFNKNNLILEER.[N]"	"1xBiotin [K4]"	"0.000191886"	"0.000586377"	"1"	"1"	"6"	"Q62217"	"Q62217 [1039-1050]"	"Q62217 1xBiotin [K1042]"	"Semaphorin-5A [OS=Mus musculus]"	"1"	"1686.86320"	"0.19"	"0.04"	"0.03"	"-1.45"	"0.12"	"-0.06"	"0.09"	"106.4"	"121.1"	"109.2"	"108.6"	"38.9"	"115.9"	"31933.849609375"	"36341.19921875"	"32766.712890625"	"32609.193359375"	"11671.380859375"	"34783"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"843.93529"	"0.0001108"	"1.948E-06"	"3.59"	"46.16"
"27173"	"[K].VNGKAGNLGGGVVTIER.[S]"	"1xBiotin [K4]"	"0.0337815"	"0.00104877"	"1"	"1"	"3"	"P67984"	"P67984 [49-65]"	"P67984 1xBiotin [K52]"	"60S ribosomal protein L22 [OS=Mus musculus]"	"1"	"1866.98544"	"-9.97"	"0.13"	"-9.97"	"0.08"	"-9.97"	""	"-9.97"	"190.2"	""	"208.5"	""	"201.2"	""	"11620.6806640625"	""	"12740.3876953125"	""	"12294.3134765625"	""	""	"High"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"High"	"2"	"933.99721"	"0.0001873"	"0.00379"	"2.78"	"40.54"
"468"	"[R].AFSYYGPLR.[T]"	""	"0.108612"	"0.00731053"	"1"	"4"	"1"	"Q8BL97-1"	"Q8BL97-1 [59-67]"	""	"serine/arginine-rich splicing factor 7 [OS=Mus musculus]"	"0"	"1073.54146"	"0.36"	"0.20"	"0.77"	"0.66"	"0.23"	"-0.13"	"0.03"	"76.1"	"97.4"	"87.7"	"129.6"	"120.0"	"89.2"	"36918.87109375"	"47227.8046875"	"42502.79296875"	"62856.39453125"	"58174.5390625"	"43246.2421875"	""	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"2"	"537.27386"	"0.001426"	"0.02187"	"1.75"	"38.49"
"27165"	"[K].VNDKSVGGSFYLQSK.[V]"	"1xBiotin [K4]"	"0.000449555"	"0.000586377"	"1"	"1"	"5"	"Q9CQV1"	"Q9CQV1 [83-97]"	"Q9CQV1 1xBiotin [K86]"	"Mitochondrial import inner membrane translocase subunit TIM16 [OS=Mus musculus]"	"1"	"1854.90546"	""	""	""	"9.97"	"9.97"	"9.97"	"9.97"	""	""	""	""	"343.2"	"256.8"	""	""	""	""	"21708.552734375"	"16243.46484375"	""	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"2"	"927.95656"	"0.0001108"	"6.745E-06"	"3.40"	"41.07"
"472"	"[R].AFVGPLSPSKAEDFR.[K]"	"1xBiotin [K10]"	"0.0004964"	"0.000586377"	"1"	"3"	"6"	"Q6P1H6-1"	"Q6P1H6-1 [529-543]"	"Q6P1H6-1 1xBiotin [K538]"	"ankyrin repeat and LEM domain-containing protein 2 [OS=Mus musculus]"	"1"	"1846.91563"	"0.76"	"0.24"	"-0.24"	"-1.66"	"0.16"	"-0.60"	"-0.08"	"97.6"	"164.9"	"115.1"	"82.6"	"31.0"	"108.8"	"12623.193359375"	"21319.01171875"	"14885.34375"	"10675.1337890625"	"4003.171875"	"14071.388671875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"923.96058"	"0.0001108"	"7.799E-06"	"3.32"	"49.03"
"27157"	"[R].VMVEKYNGK.[R]"	"1xBiotin [K5]; 1xOxidation [M2]"	"0.0208727"	"0.00104877"	"1"	"2"	"5"	"Q06180-1"	"Q06180-1 [308-316]"	"Q06180-1 1xBiotin [K312]"	"Tyrosine-protein phosphatase non-receptor type 2 [OS=Mus musculus]"	"1"	"1309.62791"	"-0.04"	"0.06"	"-0.08"	"-0.72"	"-0.04"	"0.00"	"-0.10"	"108.1"	"105.4"	"112.8"	"102.4"	"65.8"	"105.4"	"18108.888671875"	"17662.123046875"	"18889.5859375"	"17158.673828125"	"11025.6533203125"	"17660.685546875"	""	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"2"	"655.31770"	"0.0001873"	"0.001859"	"1.64"	"30.05"
"473"	"[R].AFVGPLSPSKAEDFRK.[L]"	"1xBiotin [K10]"	"0.00573543"	"0.000586377"	"1"	"3"	"6"	"Q6P1H6-1"	"Q6P1H6-1 [529-544]"	"Q6P1H6-1 1xBiotin [K538]"	"ankyrin repeat and LEM domain-containing protein 2 [OS=Mus musculus]"	"2"	"1975.01059"	"0.06"	"-0.46"	"-0.36"	"-2.12"	"-0.06"	"-0.13"	"0.40"	"126.6"	"132.3"	"92.2"	"98.5"	"29.2"	"121.2"	"27449.349609375"	"28693.876953125"	"19985.3984375"	"21357.07421875"	"6329.646484375"	"26292.11328125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"659.00855"	"0.0001108"	"0.000278"	"3.30"	"43.57"
"474"	"[K].AFVSTSFHKCGLPAETEWMK.[T]"	"1xBiotin [K9]; 1xCarbamidomethyl [C10]; 1xOxidation [M19]"	"0.072202"	"0.00241047"	"1"	"1"	"3"	"Q8CJF7"	"Q8CJF7 [1257-1276]"	"Q8CJF7 1xBiotin [K1265]"	"protein elys [OS=Mus musculus]"	"1"	"2568.17200"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"3"	"856.72843"	"0.000415"	"0.01179"	"2.89"	""
"27128"	"[R].VMAGKVEMTLEVLNER.[E]"	"1xBiotin [K5]; 1xOxidation [M2]"	"0.0190349"	"0.000586377"	"1"	"2"	"2"	"Q69ZN7-1"	"Q69ZN7-1 [1948-1963]"	"Q69ZN7-1 1xBiotin [K1952]"	"Myoferlin [OS=Mus musculus]"	"1"	"2061.01773"	"-0.07"	"0.10"	"-1.34"	"-9.97"	"0.14"	"0.22"	"0.04"	"132.6"	"126.0"	"142.4"	"52.6"	""	"146.4"	"10759.3720703125"	"10223.5615234375"	"11553.25390625"	"4263.8203125"	""	"11877.69921875"	""	"High"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"3"	"687.67715"	"0.0001108"	"0.001623"	"2.68"	"56.19"
"27090"	"[K].VLTKEAEEK.[L]"	"1xBiotin [K4]"	"0.00341697"	"0.000586377"	"1"	"2"	"10"	"Q99P72-2"	"Q99P72-2 [942-950]"	"Q99P72-2 1xBiotin [K945]"	"Reticulon-4 [OS=Mus musculus]"	"1"	"1272.65041"	"0.37"	"0.29"	"0.21"	"0.29"	"0.14"	"-0.23"	"-0.16"	"85.8"	"110.6"	"105.2"	"99.0"	"105.2"	"94.3"	"196635.796875"	"253591.109375"	"241138.140625"	"227068.921875"	"241210.109375"	"216159.703125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"636.82880"	"0.0001108"	"0.000131"	"2.93"	"28.76"
"548"	"[K].AGKKDR.[R]"	"1xBiotin [K3]"	"0.120171"	"0.00731053"	"1"	"1"	"3"	"Q99ME9"	"Q99ME9 [628-633]"	"Q99ME9 1xBiotin [K630]"	"Nucleolar GTP-binding protein 1 [OS=Mus musculus]"	"2"	"900.47200"	"-0.01"	"0.08"	"0.69"	"-2.32"	"0.31"	"0.31"	"0.22"	"98.3"	"97.8"	"104.0"	"158.6"	"19.7"	"121.5"	"417037.96875"	"414757.39453125"	"441110.78515625"	"672677.90234375"	"83765.015625"	"515435.716796875"	""	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"2"	"450.73950"	"0.001478"	"0.02551"	"1.64"	"14.79"
"551"	"[K].AGKTEPSFTK.[E]"	"1xBiotin [K3]"	"0.000564341"	"0.000586377"	"1"	"1"	"7"	"Q80TN4"	"Q80TN4 [578-587]"	"Q80TN4 1xBiotin [K580]"	"DnaJ homolog subfamily C member 16 [OS=Mus musculus]"	"1"	"1291.63510"	"0.14"	"-0.03"	"0.10"	"0.18"	"0.23"	"0.09"	"0.25"	"92.8"	"102.1"	"91.2"	"99.8"	"105.3"	"108.8"	"38367.375"	"42197.8046875"	"37701.99609375"	"41230.65234375"	"43527.8125"	"44978.23046875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"646.32154"	"0.0001108"	"9.384E-06"	"3.66"	"32.09"
"27019"	"[K].VIPELNGKLTGMAFR.[V]"	"1xBiotin [K8]; 1xOxidation [M12]"	"0.00040951"	"0.000586377"	"1"	"1"	"7"	"P16858"	"P16858 [218-232]"	"P16858 1xBiotin [K225]"	"glyceraldehyde-3-phosphate dehydrogenase [OS=Mus musculus]"	"1"	"1887.98194"	"9.97"	""	""	""	"9.97"	"0.47"	"9.97"	""	"251.7"	""	""	""	"348.3"	""	"15062.8115234375"	""	""	""	"20841.857421875"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"2"	"944.49506"	"0.0001108"	"5.87E-06"	"2.26"	"50.87"
"560"	"[K].AGLKCGPITSTTR.[F]"	"1xBiotin [K4]; 1xCarbamidomethyl [C5]"	"0.000236709"	"0.000586377"	"1"	"4"	"6"	"Q6P1H6-1"	"Q6P1H6-1 [89-101]"	"Q6P1H6-1 1xBiotin [K92]"	"ankyrin repeat and LEM domain-containing protein 2 [OS=Mus musculus]"	"1"	"1587.79816"	"0.74"	"0.49"	"0.02"	"-0.12"	"0.51"	"-0.22"	"0.03"	"80.7"	"134.5"	"113.1"	"82.0"	"74.4"	"115.3"	"42115.4296875"	"70222.96875"	"59018.39453125"	"42829.33203125"	"38861.94140625"	"60173.84765625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"794.40173"	"0.0001108"	"2.653E-06"	"2.77"	"35.52"
"561"	"[R].AGIKNR.[V]"	"1xBiotin [K4]"	"0.107455"	"0.00731053"	"1"	"3"	"30"	"Q3TBT3"	"Q3TBT3 [232-237]"	"Q3TBT3 1xBiotin [K235]"	"Stimulator of interferon genes protein [OS=Mus musculus]"	"1"	"884.47708"	"1.04"	"0.88"	"0.98"	"0.65"	"1.12"	"0.08"	"0.23"	"56.6"	"116.0"	"104.4"	"111.3"	"89.0"	"122.8"	"1926296.32519531"	"3951025.25"	"3555734"	"3791605.07421875"	"3031477.79882813"	"4181732.85546875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"442.74210"	"0.001426"	"0.02153"	"1.57"	"23.16"
"159"	"[R].AASIFGGAKPVDTAAR.[E]"	"1xBiotin [K9]"	"0.0109268"	"0.000586377"	"1"	"1"	"5"	"Q8BGD9"	"Q8BGD9 [357-372]"	"Q8BGD9 1xBiotin [K365]"	"eukaryotic translation initiation factor 4B [OS=Mus musculus]"	"0"	"1757.90031"	"-0.35"	"-0.41"	"0.00"	"-1.84"	"0.12"	"0.47"	"0.52"	"122.5"	"95.9"	"92.3"	"122.3"	"34.3"	"132.7"	"97689.65625"	"76411.421875"	"73580.4140625"	"97477.828125"	"27336.669921875"	"105798"	""	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"2"	"879.45425"	"0.0001108"	"0.0007155"	"3.68"	"42.98"
"27874"	"[K].VYDLTKFLEEHPGGEEVLR.[E]"	"1xBiotin [K6]"	"0.0188167"	"0.000586377"	"1"	"1"	"1"	"P56395"	"P56395 [34-52]"	"P56395 1xBiotin [K39]"	"Cytochrome b5 [OS=Mus musculus]"	"1"	"2457.21187"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"3"	"819.74260"	"0.0001108"	"0.001595"	"2.38"	""
"27884"	"[K].VYLPNKQR.[T]"	"1xBiotin [K6]"	"0.0299637"	"0.00104877"	"1"	"1"	"8"	"P04627"	"P04627 [23-30]"	"P04627 1xBiotin [K28]"	"serine/threonine-protein kinase A-Raf [OS=Mus musculus]"	"1"	"1243.66159"	"0.29"	"0.28"	"0.34"	"0.35"	"0.52"	"0.23"	"0.24"	"80.9"	"99.3"	"98.3"	"102.2"	"103.0"	"116.2"	"326576.03125"	"400418.28125"	"396714.0625"	"412429.90625"	"415607.8125"	"468849.65625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"622.33425"	"0.0001873"	"0.003168"	"1.95"	"34.27"
"27885"	"[R].VYNGILEKSCSMHQLSSGIPVPHPR.[H]"	"1xBiotin [K8]; 1xCarbamidomethyl [C10]"	"0.000551331"	"0.000586377"	"1"	"1"	"6"	"P83093"	"P83093 [670-694]"	"P83093 1xBiotin [K677]"	"Stromal interaction molecule 2 [OS=Mus musculus]"	"1"	"3032.49031"	"0.62"	"0.15"	"-9.97"	"-9.97"	"0.87"	"0.25"	"0.72"	"109.4"	"168.6"	"121.8"	""	""	"200.1"	"105845.638671875"	"163098.73046875"	"117832.1875"	""	""	"193583.22265625"	""	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"4"	"758.87756"	"0.0001108"	"9.103E-06"	"4.75"	"48.82"
"28601"	"[K].YLTQKLLHESHLK.[D]"	"1xBiotin [K5]"	"0.00259874"	"0.000586377"	"1"	"2"	"3"	"Q6P9J9"	"Q6P9J9 [873-885]"	"Q6P9J9 1xBiotin [K877]"	"Anoctamin-6 [OS=Mus musculus]"	"1"	"1835.98365"	"-1.21"	"0.06"	"-9.97"	"-9.97"	"-0.14"	"1.08"	"-0.20"	"177.3"	"76.6"	"184.8"	""	""	"161.4"	"64097.767578125"	"27682.474609375"	"66800.546875"	""	""	"58348.71875"	""	"High"	"High"	"High"	"Not Found"	"Not Found"	"Peak Found"	"High"	"3"	"612.66615"	"0.0001108"	"8.756E-05"	"2.16"	"40.05"
"76"	"[K].AAGQKAAPPAK.[G]"	"1xBiotin [K5]"	"0.00353845"	"0.000586377"	"1"	"1"	"9"	"Q9CR57"	"Q9CR57 [185-195]"	"Q9CR57 1xBiotin [K189]"	"60S ribosomal protein L14 [OS=Mus musculus]"	"1"	"1235.65650"	"0.34"	"0.68"	"0.29"	"0.18"	"0.58"	"0.24"	"-0.10"	"77.8"	"98.3"	"124.6"	"95.1"	"88.1"	"116.2"	"8958.228515625"	"11317.7705078125"	"14344.2158203125"	"10945.599609375"	"10139.9580078125"	"13381.568359375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"618.33119"	"0.0001108"	"0.0001372"	"2.89"	"21.67"
"28586"	"[R].YIQKDQGLHVDFGVENTDPSPR.[D]"	"1xBiotin [K4]"	"0.00011621"	"0.000586377"	"1"	"2"	"4"	"Q3UMB5"	"Q3UMB5 [617-638]"	"Q3UMB5 1xBiotin [K620]"	"Guanine nucleotide exchange protein SMCR8 [OS=Mus musculus]"	"1"	"2741.29879"	"1.21"	"-9.97"	"-9.97"	"-9.97"	"-9.97"	"-9.97"	""	"181.0"	"419.0"	""	""	""	""	"18302.091796875"	"42373.78515625"	""	""	""	""	""	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"914.43845"	"0.0001108"	"9.35E-07"	"2.69"	"44.73"
"28584"	"[R].YLQDNPASGEKFAYVPFGAGR.[H]"	"1xBiotin [K11]"	"1.30353E-06"	"0.000586377"	"1"	"1"	"11"	"Q8K0C4"	"Q8K0C4 [426-446]"	"Q8K0C4 1xBiotin [K436]"	"lanosterol 14-alpha demethylase [OS=Mus musculus]"	"1"	"2513.19180"	"0.27"	"0.21"	"-1.15"	"-4.51"	"0.31"	"0.04"	"0.10"	"117.8"	"141.8"	"136.2"	"53.3"	"5.2"	"145.7"	"156589.943359375"	"188437.01953125"	"181037.84375"	"70787.248046875"	"6853.90576171875"	"193602.41796875"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"2"	"1257.09876"	"0.0001108"	"1.334E-09"	"4.54"	"52.94"
"28581"	"[K].YIPKQSFLTR.[K]"	"1xBiotin [K4]"	"0.102939"	"0.00612902"	"1"	"1"	"1"	"Q99KI3"	"Q99KI3 [67-76]"	"Q99KI3 1xBiotin [K70]"	"ER membrane protein complex subunit 3 [OS=Mus musculus]"	"1"	"1478.78243"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"739.89531"	"0.001201"	"0.02012"	"1.43"	""
"28578"	"[K].YIPGTKMIFAGIK.[K]"	"1xBiotin [K6]; 1xOxidation [M7]"	"0.00462481"	"0.000586377"	"1"	"2"	"3"	"P00015"	"P00015 [75-87]"	"P00015 1xBiotin [K80]"	"Cytochrome c, testis-specific [OS=Mus musculus]"	"1"	"1680.88518"	"0.05"	"-0.09"	"-0.68"	"-9.97"	"-0.18"	"-0.23"	"-0.09"	"133.8"	"138.7"	"126.1"	"83.3"	""	"118.1"	"18171.642578125"	"18842.970703125"	"17129.806640625"	"11312.8955078125"	""	"16044.9306640625"	""	"High"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"High"	"High"	"2"	"840.94622"	"0.0001108"	"0.0002037"	"2.22"	"50.29"
"28572"	"[R].YLNFFTK.[A]"	""	"0.107455"	"0.00731053"	"1"	"1"	"5"	"P17918"	"P17918 [211-217]"	""	"proliferating cell nuclear antigen [OS=Mus musculus]"	"0"	"932.48763"	"0.35"	"0.02"	"0.45"	"0.34"	"0.15"	"-0.20"	"0.13"	"85.2"	"108.7"	"86.6"	"116.8"	"108.0"	"94.8"	"88699.9375"	"113199.0546875"	"90173.78125"	"121568.75"	"112438.6015625"	"98672.1328125"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"2"	"466.74740"	"0.001426"	"0.02146"	"2.01"	"43.37"
"28570"	"[R].YLMSGVVAPVKR.[R]"	"1xBiotin [K11]; 1xOxidation [M3]"	"0.000119648"	"0.000586377"	"1"	"1"	"7"	"Q69ZF3"	"Q69ZF3 [567-578]"	"Q69ZF3 1xBiotin [K577]"	"Non-lysosomal glucosylceramidase [OS=Mus musculus]"	"1"	"1561.82292"	"-0.02"	"0.38"	"0.14"	"-1.25"	"0.40"	"0.43"	"0.02"	"97.8"	"96.2"	"127.6"	"108.1"	"41.0"	"129.3"	"93610.8671875"	"92061.4453125"	"122148.9375"	"103426.640625"	"39289.53515625"	"123760.2265625"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"2"	"781.41497"	"0.0001108"	"9.806E-07"	"3.53"	"38.10"
"28610"	"[K].YMACCLLYR.[G]"	"2xCarbamidomethyl [C4; C5]; 1xOxidation [M2]"	"0.013775"	"0.000586377"	"1"	"5"	"5"	"P05213"	"P05213 [312-320]"	""	"Tubulin alpha-1B chain [OS=Mus musculus]"	"0"	"1265.54755"	"0.59"	"0.45"	"0.57"	"-0.58"	"0.39"	"-0.21"	"-0.06"	"81.8"	"123.5"	"111.6"	"121.5"	"54.6"	"107.0"	"37765.87109375"	"57016.29296875"	"51484.96484375"	"56070.45703125"	"25193.451171875"	"49370.31640625"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"2"	"633.27749"	"0.0001108"	"0.001004"	"2.19"	"35.46"
"28569"	"[R].YLMSGVVAPVKR.[R]"	"1xBiotin [K11]"	"0.001385"	"0.000586377"	"1"	"1"	"6"	"Q69ZF3"	"Q69ZF3 [567-578]"	"Q69ZF3 1xBiotin [K577]"	"Non-lysosomal glucosylceramidase [OS=Mus musculus]"	"1"	"1545.82800"	"1.34"	"1.18"	"0.45"	"0.61"	"0.92"	"-0.42"	"-0.26"	"56.8"	"143.2"	"128.7"	"77.6"	"86.4"	"107.3"	"29849.8671875"	"75313.84375"	"67700.8515625"	"40816.29296875"	"45430.00390625"	"56452.2421875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"773.41796"	"0.0001108"	"3.481E-05"	"3.12"	"44.65"
"82"	"[K].AAGTATAKK.[S]"	"1xBiotin [K8]"	"0.0111184"	"0.000586377"	"1"	"1"	"6"	"P43274"	"P43274 [141-149]"	"P43274 1xBiotin [K148]"	"Histone H1.4 [OS=Mus musculus]"	"1"	"1044.55064"	"1.25"	"1.19"	"1.12"	"1.28"	"1.05"	"-0.20"	"-0.14"	"48.6"	"115.5"	"111.1"	"105.7"	"118.4"	"100.6"	"10773.2607421875"	"25592.125"	"24621.490234375"	"23426.0859375"	"26231.5546875"	"22277.603515625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"522.77897"	"0.0001108"	"0.0007326"	"1.96"	"17.74"
"28505"	"[R].YKGKEDVGK.[T]"	"1xBiotin [K4]"	"0.00467894"	"0.000586377"	"1"	"1"	"11"	"Q9CQU3"	"Q9CQU3 [184-192]"	"Q9CQU3 1xBiotin [K187]"	"Protein RER1 [OS=Mus musculus]"	"2"	"1249.62453"	"0.32"	"0.24"	"0.38"	"-0.10"	"0.22"	"-0.10"	"-0.02"	"87.8"	"109.8"	"103.8"	"114.0"	"82.0"	"102.6"	"128995.708984375"	"161359.265625"	"152526.421875"	"167476.822265625"	"120503.5234375"	"150754.57421875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"625.31611"	"0.0001108"	"0.0002064"	"2.76"	"22.68"
"28503"	"[K].YKEVGIHLNYKEDSCVR.[L]"	"2xBiotin [K2; K11]; 1xCarbamidomethyl [C15]"	"7.11406E-06"	"0.000586377"	"1"	"2"	"7"	"Q64735-1"	"Q64735-1 [441-457]"	"Q64735-1 2xBiotin [K442; K451]"	"Complement component receptor 1-like protein [OS=Mus musculus]"	"2"	"2562.19380"	"1.56"	"0.85"	"-0.50"	"-9.97"	"1.68"	"0.12"	"0.83"	"62.2"	"183.1"	"111.8"	"44.1"	""	"198.8"	"37199.453125"	"109517.328125"	"66877.625"	"26379.951171875"	""	"118912.6953125"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"854.73637"	"0.0001108"	"1.588E-08"	"5.23"	"45.11"
"28502"	"[K].YKEVGIHLNYK.[E]"	"1xBiotin [K2]"	"4.02077E-05"	"0.000586377"	"1"	"2"	"18"	"Q64735-1"	"Q64735-1 [441-451]"	"Q64735-1 1xBiotin [K442]"	"Complement component receptor 1-like protein [OS=Mus musculus]"	"1"	"1589.81446"	"0.23"	"0.26"	"-0.16"	"-1.82"	"0.00"	"-0.24"	"-0.26"	"108.1"	"127.1"	"129.2"	"96.9"	"30.7"	"108.0"	"532506.75"	"626088.765625"	"636035.328125"	"477071.015625"	"151305.447265625"	"531785.6875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"530.60942"	"0.0001108"	"1.988E-07"	"4.66"	"39.28"
"28497"	"[K].YKEALLGR.[V]"	"1xBiotin [K2]"	"0.0140975"	"0.000586377"	"1"	"1"	"3"	"Q99PT1"	"Q99PT1 [51-58]"	"Q99PT1 1xBiotin [K52]"	"rho GDP-dissociation inhibitor 1 [OS=Mus musculus]"	"1"	"1175.62414"	"0.34"	"0.35"	"0.39"	"-0.26"	"0.19"	"-0.15"	"-0.16"	"87.9"	"111.4"	"111.8"	"115.4"	"73.5"	"100.1"	"28168.15625"	"35708.2734375"	"35837.30078125"	"36990.64453125"	"23546.6328125"	"32085.87109375"	""	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"2"	"588.31554"	"0.0001108"	"0.001042"	"2.07"	"38.74"
"28496"	"[K].YKDNPFSLGETFGSR.[W]"	"1xBiotin [K2]"	"2.29708E-05"	"0.000586377"	"1"	"2"	"15"	"Q99K28"	"Q99K28 [357-371]"	"Q99K28 1xBiotin [K358]"	"ADP-ribosylation factor GTPase-activating protein 2 [OS=Mus musculus]"	"1"	"1943.89562"	"0.27"	"0.03"	"-0.74"	"-3.03"	"0.36"	"0.09"	"0.33"	"114.6"	"138.4"	"117.0"	"68.7"	"14.0"	"147.3"	"157531.67578125"	"190315.3984375"	"160926.5"	"94401.18359375"	"19268.54296875"	"202474.33203125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"972.45164"	"0.0001108"	"8.787E-08"	"3.34"	"52.01"
"28491"	"[K].YKAEILK.[K]"	"1xBiotin [K2]"	"0.0349568"	"0.00104877"	"1"	"1"	"14"	"Q76N33-1"	"Q76N33-1 [143-149]"	"Q76N33-1 1xBiotin [K144]"	"AMSH-like protease [OS=Mus musculus]"	"1"	"1090.59653"	"0.43"	"0.20"	"0.27"	"0.23"	"0.39"	"-0.04"	"0.19"	"83.6"	"112.4"	"95.9"	"101.0"	"97.7"	"109.4"	"696248.375"	"936447.25"	"799394.1875"	"841700.3125"	"814119.5"	"911841.6875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"545.80186"	"0.0001873"	"0.003967"	"2.81"	"36.38"
"94"	"[R].AAKMPR.[S]"	"1xBiotin [K3]"	"0.0632006"	"0.0019826"	"1"	"1"	"18"	"Q3UBX0"	"Q3UBX0 [233-238]"	"Q3UBX0 1xBiotin [K235]"	"Transmembrane protein 109 [OS=Mus musculus]"	"1"	"899.45899"	"1.21"	"0.83"	"0.71"	"1.38"	"1.13"	"-0.08"	"0.30"	"52.2"	"120.3"	"92.5"	"85.3"	"135.8"	"113.9"	"151120.984375"	"348656.822265625"	"267881.625"	"247265.642089844"	"393628.324707031"	"329996.03125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"450.23306"	"0.0003442"	"0.009609"	"1.82"	"24.47"
"28548"	"[R].YIGIVKQAGLDR.[M]"	"1xBiotin [K6]"	"4.49189E-05"	"0.000586377"	"1"	"2"	"10"	"Q9Z2X1-1"	"Q9Z2X1-1 [219-230]"	"Q9Z2X1-1 1xBiotin [K224]"	"Heterogeneous nuclear ribonucleoprotein F [OS=Mus musculus]"	"1"	"1558.84101"	"0.26"	"-0.01"	"-0.02"	"-0.70"	"0.07"	"-0.19"	"0.08"	"102.8"	"123.3"	"101.7"	"101.4"	"63.1"	"107.8"	"329083.3125"	"394774.5625"	"325702.375"	"324536.625"	"202108.125"	"345074.5"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"779.92426"	"0.0001108"	"2.345E-07"	"3.86"	"43.73"
"28646"	"[K].YNCSGLNFGKVDVGR.[Y]"	"1xBiotin [K10]; 1xCarbamidomethyl [C3]"	"5.60619E-05"	"0.000586377"	"1"	"1"	"10"	"Q9D710"	"Q9D710 [184-198]"	"Q9D710 1xBiotin [K193]"	"Thioredoxin-related transmembrane protein 2 [OS=Mus musculus]"	"1"	"1911.88401"	"0.42"	"-0.20"	"-0.51"	"-0.93"	"-0.06"	"-0.48"	"0.13"	"111.3"	"148.8"	"97.1"	"78.1"	"58.3"	"106.4"	"29750.138671875"	"39780.37109375"	"25962.38671875"	"20894.361328125"	"15594.5009765625"	"28456"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"956.44579"	"0.0001108"	"3.231E-07"	"3.28"	"45.74"
"28650"	"[R].YNLKSPAVK.[R]"	"1xBiotin [K4]"	"0.00667128"	"0.000586377"	"1"	"1"	"8"	"Q9JJZ4"	"Q9JJZ4 [5-13]"	"Q9JJZ4 1xBiotin [K8]"	"ubiquitin-conjugating enzyme e2 j1 [OS=Mus musculus]"	"1"	"1245.66600"	"0.82"	"0.60"	"0.65"	"0.15"	"0.42"	"-0.40"	"-0.18"	"72.2"	"127.7"	"109.8"	"113.3"	"80.1"	"96.8"	"64729.6875"	"114491.8046875"	"98423.640625"	"101557.6328125"	"71823.0078125"	"86720.2109375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"623.33649"	"0.0001108"	"0.0003462"	"2.65"	"35.41"
"70"	"[K].AAGKGDVPTK.[R]"	"1xBiotin [K4]"	"0.000777694"	"0.000586377"	"1"	"1"	"13"	"P12970"	"P12970 [122-131]"	"P12970 1xBiotin [K125]"	"60S ribosomal protein L7a [OS=Mus musculus]"	"1"	"1169.59832"	"0.46"	"0.09"	"0.02"	"-0.02"	"0.14"	"-0.32"	"0.05"	"91.7"	"125.8"	"97.6"	"93.2"	"90.6"	"101.0"	"114514.796875"	"157119.6875"	"121923.890625"	"116425.71875"	"113159.4921875"	"126073.5625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"585.30271"	"0.0001108"	"1.5E-05"	"3.14"	"25.10"
"28879"	"[R].YYKNNFSDGFR.[Q]"	"1xBiotin [K3]"	"0.00170833"	"0.000586377"	"1"	"1"	"5"	"Q9EP69"	"Q9EP69 [481-491]"	"Q9EP69 1xBiotin [K483]"	"Phosphatidylinositide phosphatase SAC1 [OS=Mus musculus]"	"1"	"1636.72129"	"9.97"	""	""	"9.97"	""	"-9.97"	""	""	"397.9"	""	""	"202.1"	""	""	"16755.78515625"	""	""	"8513.2861328125"	""	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"2"	"818.86458"	"0.0001108"	"4.733E-05"	"2.71"	"41.75"
"18"	"[K].AAALLTKQAGTEVK.[R]"	"1xBiotin [K7]"	"2.28168E-06"	"0.000586377"	"1"	"1"	"31"	"Q8VCH8"	"Q8VCH8 [293-306]"	"Q8VCH8 1xBiotin [K299]"	"UBX domain-containing protein 4 [OS=Mus musculus]"	"1"	"1626.88835"	"0.16"	"0.10"	"-0.07"	"0.16"	"0.23"	"0.07"	"0.14"	"93.2"	"104.4"	"99.7"	"88.8"	"104.2"	"109.7"	"1755095.40625"	"1965487.53417969"	"1876838.53125"	"1670801.0625"	"1961874.62402344"	"2064778.79003906"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"813.94748"	"0.0001108"	"3.018E-09"	"5.07"	"38.31"
"56"	"[R].AAETQQLKDHSR.[G]"	"1xBiotin [K8]"	"0.000242295"	"0.000586377"	"1"	"2"	"11"	"Q8K078"	"Q8K078 [348-359]"	"Q8K078 1xBiotin [K355]"	"solute carrier organic anion transporter family member 4A1 [OS=Mus musculus]"	"1"	"1609.77511"	"0.41"	"0.30"	"0.31"	"0.51"	"0.18"	"-0.23"	"-0.12"	"81.6"	"108.4"	"100.6"	"100.9"	"116.2"	"92.4"	"220812.525390625"	"293331.296875"	"272233.44140625"	"273279.578125"	"314522.90234375"	"250085.732421875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"805.39163"	"0.0001108"	"2.73E-06"	"3.19"	"25.59"
"28831"	"[K].YVPKYAPLADVK.[S]"	"1xBiotin [K4]"	"0.00101098"	"0.000586377"	"1"	"4"	"57"	"Q61029"	"Q61029 [389-400]"	"Q61029 1xBiotin [K392]"	"Lamina-associated polypeptide 2, isoforms beta/delta/epsilon/gamma [OS=Mus musculus]"	"1"	"1589.83961"	"0.57"	"0.47"	"0.38"	"-0.64"	"0.52"	"-0.05"	"0.05"	"82.8"	"122.9"	"114.8"	"107.7"	"53.2"	"118.6"	"3176160.9375"	"4714360.34375"	"4404794.46679688"	"4133198.44726563"	"2039782.09179688"	"4551766.71289063"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"795.42355"	"0.0001108"	"2.195E-05"	"2.22"	"45.14"
"28828"	"[R].YVLKDKLK.[W]"	"2xBiotin [K4; K6]"	"0.015286"	"0.000586377"	"1"	"1"	"5"	"Q9D1E8"	"Q9D1E8 [117-124]"	"Q9D1E8 2xBiotin [K120; K122]"	"1-acyl-sn-glycerol-3-phosphate acyltransferase epsilon [OS=Mus musculus]"	"2"	"1458.78474"	"9.97"	""	"9.97"	""	"9.97"	"-0.80"	"9.97"	""	"319.0"	""	"98.0"	""	"183.0"	""	"24691.720703125"	""	"7587.94677734375"	""	"14161.697265625"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"2"	"729.89621"	"0.0001108"	"0.00117"	"2.50"	"46.90"
"28822"	"[K].YVKGLIEGK.[S]"	"1xBiotin [K3]"	"0.00426296"	"0.000586377"	"1"	"2"	"9"	"Q3U7R1"	"Q3U7R1 [337-345]"	"Q3U7R1 1xBiotin [K339]"	"Extended synaptotagmin-1 [OS=Mus musculus]"	"1"	"1232.67076"	"0.23"	"0.12"	"0.20"	"-0.21"	"0.33"	"0.10"	"0.21"	"91.8"	"107.9"	"99.6"	"105.6"	"79.5"	"115.5"	"223118.59375"	"262240.5"	"241860.421875"	"256654.109375"	"193144.640625"	"280605.78125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"616.83908"	"0.0001108"	"0.0001804"	"3.01"	"38.74"
"28810"	"[R].YTYLEKAIK.[I]"	"1xBiotin [K6]"	"0.00607879"	"0.000586377"	"1"	"2"	"4"	"Q6A4J8"	"Q6A4J8 [1092-1100]"	"Q6A4J8 1xBiotin [K1097]"	"Ubiquitin carboxyl-terminal hydrolase 7 [OS=Mus musculus]"	"1"	"1354.70754"	"0.25"	"0.21"	"-0.16"	"0.12"	"-0.22"	"-0.47"	"-0.44"	"97.0"	"115.1"	"112.5"	"87.0"	"105.3"	"83.1"	"30201.83203125"	"35827.36328125"	"35016.14453125"	"27100.341796875"	"32781.36328125"	"25865.298828125"	""	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"2"	"677.85708"	"0.0001108"	"0.0003023"	"2.23"	"42.87"
"28809"	"[K].YTTLIAKLK.[S]"	"1xBiotin [K7]"	"0.013305"	"0.000586377"	"1"	"2"	"6"	"P47226-1"	"P47226-1 [77-85]"	"P47226-1 1xBiotin [K83]"	"Testin [OS=Mus musculus]"	"1"	"1276.73336"	"0.18"	"0.27"	"-0.30"	"-1.77"	"0.12"	"-0.06"	"-0.15"	"108.4"	"122.9"	"131.1"	"87.8"	"31.7"	"118.1"	"67318.5"	"76345.0390625"	"81432.90625"	"54512.8828125"	"19692.759765625"	"73331.125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"638.87051"	"0.0001108"	"0.0009531"	"2.05"	"48.18"
"28791"	"[K].YTGLSKGLEPEEK.[L]"	"1xBiotin [K6]"	"1.59082E-05"	"0.000586377"	"1"	"1"	"15"	"P03975"	"P03975 [62-74]"	"P03975 1xBiotin [K67]"	"IgE-binding protein [OS=Mus musculus]"	"1"	"1676.82000"	"0.42"	"0.18"	"0.24"	"0.27"	"0.57"	"0.15"	"0.39"	"81.7"	"109.6"	"92.5"	"96.2"	"98.7"	"121.3"	"355976.650390625"	"477185.0390625"	"402976.8671875"	"419166.6015625"	"429672.857421875"	"528081.734375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"838.91397"	"0.0001108"	"5.158E-08"	"4.27"	"38.61"
"28767"	"[K].YSQFINFPIYVWSSK.[T]"	""	"0.000411905"	"0.000586377"	"1"	"1"	"4"	"P08113"	"P08113 [271-285]"	""	"Endoplasmin [OS=Mus musculus]"	"0"	"1878.94250"	"-0.94"	"-0.17"	"-9.97"	"-9.97"	"-0.35"	"0.58"	"-0.18"	"187.8"	"98.2"	"166.7"	""	""	"147.3"	"22162.033203125"	"11590.4921875"	"19673.330078125"	""	""	"17378.923828125"	""	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"2"	"939.97483"	"0.0001108"	"5.92E-06"	"2.72"	"59.84"
"28766"	"[R].YSQDSFSKHYK.[S]"	"1xBiotin [K8]"	"0.00547471"	"0.000586377"	"1"	"1"	"6"	"Q91YQ1"	"Q91YQ1 [27-37]"	"Q91YQ1 1xBiotin [K34]"	"Ras-related protein Rab-7L1 [OS=Mus musculus]"	"1"	"1615.72095"	"-0.01"	"0.33"	"0.26"	"-0.24"	"0.35"	"0.36"	"0.01"	"91.3"	"90.6"	"115.1"	"109.3"	"77.4"	"116.3"	"17716.6796875"	"17586.365234375"	"22342.044921875"	"21206.41796875"	"15019.357421875"	"22565.20703125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"539.24513"	"0.0001108"	"0.0002597"	"2.66"	"31.17"
"28763"	"[R].YSNVIQPSSFPKSTPWGGSR.[D]"	"1xBiotin [K12]"	"9.20322E-05"	"0.000586377"	"1"	"2"	"6"	"Q8CIC2"	"Q8CIC2 [56-75]"	"Q8CIC2 1xBiotin [K67]"	"nucleoporin-like protein 2 [OS=Mus musculus]"	"1"	"2421.16559"	"0.20"	"0.14"	"-0.35"	"-9.97"	"0.13"	"-0.07"	"-0.01"	"117.0"	"134.8"	"128.6"	"91.5"	""	"128.1"	"27994.17578125"	"32243.890625"	"30777.9609375"	"21901.359375"	""	"30653.59765625"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"807.72794"	"0.0001108"	"6.665E-07"	"3.66"	"48.47"
"28757"	"[K].YSKVSK.[E]"	"1xBiotin [K3]"	"0.106309"	"0.00731053"	"1"	"1"	"6"	"Q07113"	"Q07113 [2343-2348]"	"Q07113 1xBiotin [K2345]"	"Cation-independent mannose-6-phosphate receptor [OS=Mus musculus]"	"1"	"937.48116"	"0.65"	"0.05"	"0.04"	"0.17"	"0.69"	"0.03"	"0.64"	"81.4"	"128.0"	"84.3"	"83.5"	"91.8"	"130.9"	"27576.51171875"	"43392.41015625"	"28571.646484375"	"28308.150390625"	"31128.875"	"44372.640625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"469.24421"	"0.001354"	"0.02109"	"1.85"	"23.64"
"28756"	"[K].YSKIVEIPFNSTNK.[Y]"	"1xBiotin [K3]"	"0.00177946"	"0.000586377"	"1"	"1"	"5"	"Q8VDN2"	"Q8VDN2 [474-487]"	"Q8VDN2 1xBiotin [K476]"	"Sodium/potassium-transporting ATPase subunit alpha-1 [OS=Mus musculus]"	"1"	"1865.94660"	"0.09"	"-0.06"	"-0.50"	"-2.25"	"0.28"	"0.18"	"0.34"	"116.5"	"124.0"	"111.6"	"82.3"	"24.6"	"140.9"	"16021.759765625"	"17063.51953125"	"15359.64453125"	"11327.8359375"	"3379.04663085938"	"19390.205078125"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"2"	"933.47662"	"0.0001108"	"5.041E-05"	"2.63"	"49.02"
"28723"	"[R].YRPGTVALR.[E]"	""	"0.0453851"	"0.00154748"	"1"	"4"	"6"	"P68433"	"P68433 [42-50]"	""	"Histone H3.1 [OS=Mus musculus]"	"0"	"1032.59489"	"0.58"	"0.29"	"0.60"	"0.89"	"0.47"	"-0.11"	"0.18"	"70.9"	"105.9"	"86.4"	"107.2"	"131.6"	"98.0"	"202317.984375"	"302463.28125"	"246591.46875"	"305935.21875"	"375744.53125"	"279928.15625"	""	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"2"	"516.80107"	"0.0002716"	"0.00585"	"2.40"	"21.97"
"28702"	"[R].YQKSTELLIR.[K]"	"1xBiotin [K3]"	"0.000375214"	"0.000586377"	"1"	"4"	"8"	"P68433"	"P68433 [55-64]"	"P68433 1xBiotin [K57]"	"Histone H3.1 [OS=Mus musculus]"	"1"	"1476.78791"	"0.37"	"0.08"	"0.09"	"-0.56"	"0.28"	"-0.09"	"0.20"	"95.1"	"122.8"	"100.8"	"101.0"	"64.7"	"115.7"	"136360.546875"	"176109.875"	"144630.3125"	"144806.359375"	"92764.6640625"	"165902.8125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"738.89769"	"0.0001108"	"5.196E-06"	"3.02"	"43.09"
"58"	"[R].AAFQLGSPWR.[R]"	""	"0.0040454"	"0.000586377"	"1"	"1"	"6"	"P47738"	"P47738 [87-96]"	""	"Aldehyde dehydrogenase, mitochondrial [OS=Mus musculus]"	"0"	"1132.58980"	"0.58"	"0.39"	"0.66"	"0.51"	"0.17"	"-0.41"	"-0.22"	"75.6"	"113.0"	"99.0"	"119.8"	"107.9"	"84.8"	"33568.69921875"	"50194.20703125"	"43964.578125"	"53193.73828125"	"47906.33984375"	"37661.703125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"566.79855"	"0.0001108"	"0.0001677"	"2.45"	"43.55"
"28673"	"[K].YPKSVYLGR.[I]"	"1xBiotin [K3]"	"0.00261392"	"0.000586377"	"1"	"1"	"7"	"Q9D081"	"Q9D081 [207-215]"	"Q9D081 1xBiotin [K209]"	"UDP-N-acetylglucosamine transferase subunit ALG14 homolog [OS=Mus musculus]"	"1"	"1308.67690"	"0.59"	"0.19"	"0.35"	"-0.54"	"0.29"	"-0.30"	"0.10"	"87.9"	"132.2"	"100.3"	"111.8"	"60.5"	"107.3"	"42418.33203125"	"63817.625"	"48409.99609375"	"53942.05078125"	"29199.140625"	"51794.15625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"654.84201"	"0.0001108"	"8.79E-05"	"2.66"	"39.35"
"62"	"[K].AAGAGKVTK.[S]"	"1xBiotin [K6]"	"0.00934307"	"0.000586377"	"1"	"1"	"8"	"P10126"	"P10126 [445-453]"	"P10126 1xBiotin [K450]"	"Elongation factor 1-alpha 1 [OS=Mus musculus]"	"1"	"1028.55573"	"0.60"	"0.59"	"0.39"	"0.30"	"0.47"	"-0.12"	"-0.11"	"75.5"	"114.1"	"113.3"	"99.1"	"93.1"	"104.8"	"98350.203125"	"148685.921875"	"147653.296875"	"129163.8671875"	"121322.1796875"	"136495.015625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"514.78148"	"0.0001108"	"0.0005678"	"2.84"	"21.50"
"28489"	"[K].YKADTLK.[S]"	"1xBiotin [K2]"	"0.0702326"	"0.00241047"	"1"	"1"	"6"	"Q99LC8"	"Q99LC8 [252-258]"	"Q99LC8 1xBiotin [K253]"	"Translation initiation factor eIF-2B subunit alpha [OS=Mus musculus]"	"1"	"1064.54449"	"0.52"	"0.27"	"0.21"	"0.09"	"0.34"	"-0.18"	"0.08"	"84.2"	"120.8"	"101.5"	"97.2"	"89.5"	"106.9"	"159068.671875"	"228242.109375"	"191732.09375"	"183728.734375"	"169112.9375"	"201964.109375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"532.77594"	"0.000415"	"0.01125"	"2.21"	"28.91"
"720"	"[R].AKELTGSNLLLQSPGVLTAAR.[E]"	"1xBiotin [K2]"	"1.96068E-06"	"0.000586377"	"1"	"1"	"10"	"P20934"	"P20934 [191-211]"	"P20934 1xBiotin [K192]"	"Protein EVI2A [OS=Mus musculus]"	"1"	"2365.29079"	"0.10"	"0.47"	"-0.87"	"-4.89"	"0.22"	"0.11"	"-0.25"	"115.3"	"124.0"	"159.8"	"63.1"	"3.9"	"133.9"	"63885.68359375"	"68686.0078125"	"88498.3984375"	"34963.296875"	"2158.38208007813"	"74183.0419921875"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"3"	"789.10211"	"0.0001108"	"2.429E-09"	"5.22"	"53.27"
"28483"	"[K].YHPGYFGK.[V]"	""	"0.027975"	"0.00104877"	"1"	"1"	"5"	"P14115"	"P14115 [48-55]"	""	"60S ribosomal protein L27a [OS=Mus musculus]"	"0"	"968.46248"	"0.92"	"0.34"	"0.92"	"1.38"	"0.80"	"-0.12"	"0.47"	"57.7"	"109.4"	"72.9"	"109.3"	"150.1"	"100.7"	"23393.177734375"	"44328.515625"	"29535.45703125"	"44283.140625"	"60828.93359375"	"40820.87109375"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"2"	"484.73476"	"0.0001873"	"0.002867"	"2.01"	"22.25"
"28469"	"[K].YGTQNKYTGLSK.[G]"	"1xBiotin [K6]"	"6.9158E-05"	"0.000586377"	"1"	"1"	"6"	"P03975"	"P03975 [56-67]"	"P03975 1xBiotin [K61]"	"IgE-binding protein [OS=Mus musculus]"	"1"	"1585.76790"	"0.31"	"0.36"	"0.26"	"0.35"	"0.42"	"0.11"	"0.06"	"81.9"	"101.3"	"105.1"	"97.8"	"104.6"	"109.3"	"82711.2265625"	"102255.953125"	"106124.5390625"	"98716.125"	"105605.7890625"	"110341.7890625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"793.38780"	"0.0001108"	"4.399E-07"	"3.75"	"34.20"
"28211"	"[R].WYASLQKPSWHPPR.[W]"	""	"0.000564341"	"0.000586377"	"1"	"1"	"4"	"P50637"	"P50637 [33-46]"	""	"translocator protein [OS=Mus musculus]"	"0"	"1752.89688"	"-0.29"	"-0.23"	"-9.97"	"-9.97"	"-1.06"	"-0.77"	"-0.83"	"190.4"	"155.7"	"162.7"	""	""	"91.2"	"31691.1953125"	"25920.5185546875"	"27075.470703125"	""	""	"15179.251953125"	""	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Peak Found"	"High"	"4"	"438.97956"	"0.0001108"	"9.42E-06"	"2.42"	"35.94"
"28208"	"[K].WWTCFVK.[R]"	"1xCarbamidomethyl [C4]"	"0.0710142"	"0.00241047"	"1"	"1"	"5"	"Q9JM76"	"Q9JM76 [159-165]"	""	"Actin-related protein 2/3 complex subunit 3 [OS=Mus musculus]"	"0"	"1026.48658"	"0.49"	"0.36"	"0.34"	"-0.91"	"0.20"	"-0.29"	"-0.16"	"90.4"	"127.0"	"116.3"	"114.2"	"48.2"	"104.0"	"40095.83984375"	"56329.1875"	"51581.09375"	"50672.734375"	"21368.9375"	"46164.5234375"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"2"	"513.74678"	"0.000415"	"0.01147"	"1.67"	"46.47"
"28204"	"[R].WVVPFSPVIQK.[-]"	"1xBiotin [K11]"	"0.0508036"	"0.00154748"	"1"	"1"	"3"	"Q9QUK4"	"Q9QUK4 [1437-1447]"	"Q9QUK4 1xBiotin [K1447]"	"Baculoviral IAP repeat-containing protein 1b [OS=Mus musculus]"	"0"	"1525.82357"	"0.40"	"0.05"	"-1.04"	"-9.97"	"0.32"	"-0.08"	"0.27"	"117.9"	"155.9"	"121.9"	"57.4"	""	"147.1"	"10267.7958984375"	"13577.3720703125"	"10616.056640625"	"4997.13720703125"	""	"12810.84375"	""	"High"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"2"	"763.41453"	"0.0002716"	"0.006928"	"2.96"	"61.60"
"157"	"[K].AASGEAKPQAKK.[A]"	"1xBiotin [K]"	"0.00978691"	"0.000586377"	"1"	"1"	"5"	"P15864"	"P15864 [111-122]"	"P15864 1xBiotin [K]"	"Histone H1.2 [OS=Mus musculus]"	"1"	"1411.73621"	"1.23"	"1.29"	"1.04"	"1.13"	"1.26"	"0.03"	"-0.03"	"48.3"	"113.4"	"117.9"	"99.6"	"105.4"	"115.5"	"9056.755859375"	"21266.3295898438"	"22103.3583984375"	"18680.6293945313"	"19766.99609375"	"21655.896484375"	""	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"3"	"471.25019"	"0.0001108"	"0.0006106"	"2.46"	"15.95"
"28150"	"[K].WQKVLYER.[Q]"	"1xBiotin [K3]"	"0.002466"	"0.000586377"	"1"	"1"	"7"	"Q9CXR4"	"Q9CXR4 [14-21]"	"Q9CXR4 1xBiotin [K16]"	"phosphatidylinositol n-acetylglucosaminyltransferase subunit c [OS=Mus musculus]"	"1"	"1347.68780"	"0.31"	"0.57"	"0.07"	"-0.42"	"0.33"	"0.02"	"-0.23"	"88.5"	"110.1"	"131.0"	"92.8"	"66.1"	"111.4"	"57044.39453125"	"70953.75"	"84401.8515625"	"59776.83203125"	"42580.796875"	"71793.5625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"674.34748"	"0.0001108"	"8.076E-05"	"2.83"	"41.87"
"28126"	"[K].WPFWLSPR.[Q]"	""	"0.0201639"	"0.000586377"	"1"	"1"	"5"	"Q9D0R2"	"Q9D0R2 [611-618]"	""	"Threonine--tRNA ligase, cytoplasmic [OS=Mus musculus]"	"0"	"1088.56761"	"0.47"	"0.16"	"-0.71"	"-3.34"	"0.10"	"-0.38"	"-0.06"	"113.6"	"157.8"	"126.6"	"69.3"	"11.2"	"121.4"	"23738.09765625"	"32972.28515625"	"26439.564453125"	"14478.80078125"	"2347.13232421875"	"25361.13671875"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"2"	"544.78766"	"0.0001108"	"0.001755"	"2.10"	"55.31"
"28099"	"[R].WMKNEGPGR.[L]"	"1xBiotin [K3]; 1xOxidation [M2]"	"0.00597369"	"0.000586377"	"1"	"2"	"8"	"A2ALW5"	"A2ALW5 [343-351]"	"A2ALW5 1xBiotin [K345]"	"dnaJ homolog subfamily C member 25 [OS=Mus musculus]"	"1"	"1316.58744"	"0.49"	"0.10"	"0.40"	"-0.56"	"0.29"	"-0.20"	"0.20"	"89.6"	"125.8"	"95.8"	"118.3"	"60.7"	"109.7"	"50703.90625"	"71148.0546875"	"54222.55859375"	"66944.53125"	"34361.55859375"	"62073.87890625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"658.79745"	"0.0001108"	"0.0002942"	"2.12"	"29.95"
"28072"	"[R].WIQPSASCDKTLVIPSK.[V]"	"1xBiotin [K10]; 1xCarbamidomethyl [C8]"	"2.00875E-05"	"0.000586377"	"1"	"2"	"23"	"Q9WU40-1"	"Q9WU40-1 [757-773]"	"Q9WU40-1 1xBiotin [K766]"	"inner nuclear membrane protein Man1 [OS=Mus musculus]"	"1"	"2156.08786"	"0.72"	"0.50"	"0.08"	"-1.70"	"0.68"	"-0.04"	"0.18"	"85.4"	"140.8"	"120.8"	"90.3"	"26.3"	"136.5"	"487463.5"	"803914.4375"	"689812.5"	"515875.96875"	"149998.234375"	"779268.0625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"1078.54547"	"0.0001108"	"7.228E-08"	"4.77"	"46.95"
"28218"	"[KR].WYLSGFYK.[K]"	""	"0.026266"	"0.00104877"	"1"	"2"	"3"	"B9EJ86"	"B9EJ86 [468-475]"	""	"Oxysterol-binding protein-related protein 8 [OS=Mus musculus]"	"0"	"1063.52474"	"0.08"	"0.28"	"-2.97"	"-9.97"	"-0.02"	"-0.10"	"-0.30"	"136.8"	"144.7"	"166.1"	"17.5"	""	"134.9"	"18319.8203125"	"19383.146484375"	"22252.0461425781"	"2338.75805664063"	""	"18067.951171875"	""	"High"	"Peak Found"	"High"	"High"	"Not Found"	"Peak Found"	"High"	"2"	"532.26571"	"0.0001873"	"0.002596"	"2.23"	"47.30"
"28016"	"[R].WKLQVQEQR.[K]"	"1xBiotin [K2]"	"0.001385"	"0.000586377"	"2"	"2"	"6"	"Q9JJR8; Q9CR23"	"Q9JJR8 [180-188]; Q9CR23 [164-172]"	"Q9JJR8 1xBiotin [K181]; Q9CR23 1xBiotin [K165]"	"transmembrane protein 9B [OS=Mus musculus];Transmembrane protein 9 [OS=Mus musculus]"	"1"	"1440.74163"	"-0.01"	"-0.28"	"-0.52"	"0.53"	"0.05"	"0.06"	"0.33"	"100.1"	"99.4"	"82.7"	"69.9"	"144.4"	"103.6"	"42080.27734375"	"41806.71484375"	"34765.72265625"	"29382.42578125"	"60720.05859375"	"43573"	"NotUnique"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"720.87439"	"0.0001108"	"3.503E-05"	"2.96"	"40.02"
"27983"	"[K].WGEGTPKTLSTDAVQYHLQMEDR.[N]"	"1xBiotin [K7]; 1xOxidation [M20]"	"1.44068E-05"	"0.000586377"	"1"	"1"	"4"	"Q8BX90"	"Q8BX90 [971-993]"	"Q8BX90 1xBiotin [K977]"	"Fibronectin type-III domain-containing protein 3a [OS=Mus musculus]"	"1"	"2904.32910"	"-0.43"	"-0.17"	"-9.97"	"-9.97"	"0.31"	"0.74"	"0.48"	"154.9"	"114.8"	"138.1"	""	""	"192.3"	"30597.525390625"	"22680.34765625"	"27290.74609375"	""	""	"37988.08984375"	""	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"968.78111"	"0.0001108"	"4.439E-08"	"3.60"	"45.51"
"27980"	"[R].WGAKTIEGSGR.[T]"	"1xBiotin [K4]"	"8.04804E-05"	"0.000586377"	"1"	"1"	"1"	"P49710"	"P49710 [38-48]"	"P49710 1xBiotin [K41]"	"Hematopoietic lineage cell-specific protein [OS=Mus musculus]"	"1"	"1387.67869"	"0.50"	"0.37"	"0.21"	"0.48"	"0.41"	"-0.09"	"0.04"	"79.2"	"111.8"	"102.3"	"91.8"	"110.1"	"104.8"	"235616.609375"	"332878.78125"	"304335.625"	"273342.5"	"327548.03125"	"312023.09375"	""	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"2"	"694.34305"	"0.0001108"	"5.48E-07"	"3.39"	"36.33"
"27947"	"[K].WDTGENPIYKSAVTTVVNPK.[Y]"	"1xBiotin [K10]"	"4.20902E-06"	"0.000586377"	"1"	"1"	"26"	"P09055"	"P09055 [775-794]"	"P09055 1xBiotin [K784]"	"Integrin beta-1 [OS=Mus musculus]"	"1"	"2445.21187"	"0.27"	"0.39"	"-0.48"	"-3.68"	"0.45"	"0.18"	"0.05"	"105.7"	"127.3"	"138.8"	"76.0"	"8.2"	"144.0"	"901456.578125"	"1085935.125"	"1183907.25"	"648473.046875"	"70175.033203125"	"1228114.40625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"1223.10905"	"0.0001108"	"7.412E-09"	"5.37"	"51.13"
"27919"	"[R].WANGLHDEKPLSVPR.[D]"	"1xBiotin [K9]"	"8.6314E-05"	"0.000586377"	"1"	"1"	"4"	"Q8VCA6-1"	"Q8VCA6-1 [64-78]"	"Q8VCA6-1 1xBiotin [K72]"	"Transmembrane protein 161A [OS=Mus musculus]"	"0"	"1944.97488"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"Not Found"	"High"	"High"	"High"	"Not Found"	"High"	"2"	"972.99146"	"0.0001108"	"6.057E-07"	"3.28"	""
"27915"	"[R].WALWFFK.[N]"	""	"0.0574787"	"0.0019826"	"1"	"1"	"4"	"P63073"	"P63073 [43-49]"	""	"Eukaryotic translation initiation factor 4E [OS=Mus musculus]"	"0"	"997.52944"	"0.26"	"0.48"	"-9.97"	"-9.97"	"0.29"	"0.03"	"-0.19"	"124.7"	"148.8"	"174.2"	""	""	"152.2"	"33845.40625"	"40389.8828125"	"47285.46875"	""	""	"41320.37890625"	""	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"2"	"499.26816"	"0.0003442"	"0.008368"	"2.47"	"60.65"
"27898"	"[R].VYTPSISKPLAKGEVSGLTK.[AE]"	"1xBiotin [K]"	"1.35116E-05"	"0.000586377"	"1"	"2"	"12"	"Q91WE6"	"Q91WE6 [496-515]"	"Q91WE6 1xBiotin [K]"	"threonylcarbamoyladenosine tRNA methylthiotransferase [OS=Mus musculus]"	"1"	"2301.25228"	"0.22"	"0.09"	"-0.10"	"-9.97"	"0.35"	"0.14"	"0.27"	"110.4"	"128.3"	"117.4"	"102.8"	""	"141.1"	"252780.65625"	"293671.6875"	"268896.71875"	"235338.703125"	""	"323158.78125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"767.75562"	"0.0001108"	"4.054E-08"	"4.27"	"42.39"
"27897"	"[R].VYTPSISKPLAK.[G]"	"1xBiotin [K8]"	"0.000884122"	"0.000586377"	"1"	"2"	"16"	"Q91WE6"	"Q91WE6 [496-507]"	"Q91WE6 1xBiotin [K503]"	"threonylcarbamoyladenosine tRNA methylthiotransferase [OS=Mus musculus]"	"0"	"1529.83961"	"0.43"	"0.24"	"0.34"	"-0.38"	"0.27"	"-0.16"	"0.03"	"88.7"	"119.6"	"104.7"	"111.9"	"68.0"	"106.9"	"110963.265625"	"149589.68359375"	"130906.62109375"	"139969.947265625"	"85067.84765625"	"133719.349609375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"765.42338"	"0.0001108"	"1.81E-05"	"3.19"	"41.42"
"27886"	"[R].VYNGILEKSCSMHQLSSGIPVPHPR.[H]"	"1xBiotin [K8]; 1xCarbamidomethyl [C10]; 1xOxidation [M12]"	"0.000110268"	"0.000586377"	"1"	"1"	"12"	"P83093"	"P83093 [670-694]"	"P83093 1xBiotin [K677]"	"Stromal interaction molecule 2 [OS=Mus musculus]"	"1"	"3048.48523"	"0.35"	"0.27"	"-2.48"	"-9.97"	"0.71"	"0.36"	"0.44"	"113.3"	"144.6"	"136.8"	"20.3"	""	"185.1"	"155396.11328125"	"198349.775390625"	"187577.771484375"	"27797.60546875"	""	"253858.3046875"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"1016.83270"	"0.0001108"	"8.672E-07"	"4.01"	"43.31"
"28009"	"[R].WKDSWDILIR.[K]"	"1xBiotin [K2]"	"0.0270297"	"0.00104877"	"1"	"1"	"3"	"Q8R2R1"	"Q8R2R1 [736-745]"	"Q8R2R1 1xBiotin [K737]"	"Protein O-mannosyl-transferase 1 [OS=Mus musculus]"	"1"	"1557.78825"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"779.39756"	"0.0001873"	"0.002707"	"1.82"	""
"28222"	"[R].WYQMGAYQPFFR.[A]"	"1xOxidation [M4]"	"0.00026599"	"0.000586377"	"1"	"3"	"5"	"Q8BHN3"	"Q8BHN3 [663-674]"	""	"Neutral alpha-glucosidase AB [OS=Mus musculus]"	"0"	"1609.72565"	"-0.68"	"-0.11"	"-9.97"	"-9.97"	"-0.44"	"0.24"	"-0.33"	"182.5"	"113.8"	"169.3"	""	""	"134.4"	"26226.208984375"	"16353.0068359375"	"24330.662109375"	""	""	"19317.64453125"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"2"	"805.36615"	"0.0001108"	"3.147E-06"	"2.00"	"46.48"
"28229"	"[K].YAFVNWINK.[A]"	""	"0.0102517"	"0.000586377"	"1"	"2"	"7"	"Q61233"	"Q61233 [124-132]"	""	"Plastin-2 [OS=Mus musculus]"	"0"	"1154.59931"	"0.81"	"0.56"	"0.72"	"-0.45"	"0.36"	"-0.45"	"-0.20"	"76.0"	"133.7"	"112.0"	"124.8"	"55.7"	"97.7"	"70055.984375"	"123181.5390625"	"103232.8515625"	"114998.21875"	"51358.9375"	"90001.40625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"577.80311"	"0.0001108"	"0.0006539"	"2.70"	"46.40"
"28236"	"[K].YAKTESFK.[M]"	"1xBiotin [K3]"	"0.0332084"	"0.00104877"	"1"	"1"	"5"	"P58681"	"P58681 [962-969]"	"P58681 1xBiotin [K964]"	"Toll-like receptor 7 [OS=Mus musculus]"	"1"	"1199.57652"	"0.05"	"-0.14"	"-0.17"	"-0.55"	"-0.44"	"-0.50"	"-0.30"	"114.3"	"118.6"	"103.4"	"101.4"	"78.3"	"84.0"	"20458.724609375"	"21233.791015625"	"18511.064453125"	"18163.240234375"	"14016.7109375"	"15048.9169921875"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"2"	"600.29208"	"0.0001873"	"0.003677"	"1.90"	"32.46"
"95"	"[R].AAKMPR.[S]"	"1xBiotin [K3]; 1xOxidation [M4]"	"0.12145"	"0.00820514"	"1"	"1"	"31"	"Q3UBX0"	"Q3UBX0 [233-238]"	"Q3UBX0 1xBiotin [K235]"	"Transmembrane protein 109 [OS=Mus musculus]"	"1"	"915.45390"	"0.21"	"0.10"	"0.34"	"-0.63"	"0.28"	"0.07"	"0.19"	"94.4"	"109.1"	"101.1"	"119.6"	"60.9"	"114.9"	"536382.31640625"	"620328.8515625"	"574423.27734375"	"679928.255859375"	"346393.8671875"	"653102.15625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"458.23059"	"0.001555"	"0.02599"	"1.49"	"17.67"
"28462"	"[K].YGPKGYGYGQGAGTLSTDKGESLGIK.[H]"	"1xBiotin [K4]"	"4.86964E-06"	"0.000586377"	"1"	"1"	"4"	"P97315"	"P97315 [66-91]"	"P97315 1xBiotin [K69]"	"Cysteine and glycine-rich protein 1 [OS=Mus musculus]"	"2"	"2830.37162"	"9.97"	""	""	""	"9.97"	"-0.35"	"9.97"	""	"335.9"	""	""	""	"264.1"	""	"24671.93359375"	""	""	""	"19395.962890625"	""	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"944.12818"	"0.0001108"	"9.113E-09"	"4.56"	"40.51"
"28451"	"[K].YGLFKEQNPYEKF.[-]"	"1xBiotin [K5]"	"0.000240886"	"0.000586377"	"1"	"1"	"4"	"Q8R143"	"Q8R143 [162-174]"	"Q8R143 1xBiotin [K166]"	"pituitary tumor-transforming gene 1 protein-interacting protein [OS=Mus musculus]"	"2"	"1888.89383"	"-0.40"	"-0.35"	"-9.97"	"-9.97"	"-0.29"	"0.10"	"0.06"	"178.6"	"135.6"	"140.0"	""	""	"145.8"	"49363.70703125"	"37484.1484375"	"38679.8515625"	""	""	"40301.45703125"	""	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"2"	"944.95106"	"0.0001108"	"2.724E-06"	"3.10"	"51.13"
"28450"	"[K].YGLFKEQNPYEK.[F]"	"1xBiotin [K5]"	"0.000145886"	"0.000586377"	"1"	"1"	"18"	"Q8R143"	"Q8R143 [162-173]"	"Q8R143 1xBiotin [K166]"	"pituitary tumor-transforming gene 1 protein-interacting protein [OS=Mus musculus]"	"1"	"1741.82542"	"0.58"	"0.17"	"-0.17"	"-1.20"	"0.71"	"0.14"	"0.55"	"91.2"	"136.2"	"102.3"	"81.0"	"39.7"	"149.6"	"257895.65234375"	"385111.484375"	"289302.08984375"	"229042.51953125"	"112370.1015625"	"423146.59765625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"871.41678"	"0.0001108"	"1.305E-06"	"2.59"	"44.24"
"111"	"[R].AALKLEPSNK.[T]"	"1xBiotin [K4]"	"0.0163833"	"0.000586377"	"1"	"2"	"4"	"O35465-1"	"O35465-1 [321-330]"	"O35465-1 1xBiotin [K324]"	"peptidyl-prolyl cis-trans isomerase FKBP8 [OS=Mus musculus]"	"1"	"1296.69803"	"0.50"	"-0.09"	"0.58"	"0.34"	"0.67"	"0.17"	"0.76"	"77.8"	"110.0"	"73.0"	"116.5"	"98.8"	"124.0"	"12525.728515625"	"17699.79296875"	"11748.3212890625"	"18745.806640625"	"15895.65234375"	"19957.662109375"	""	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"2"	"648.85260"	"0.0001108"	"0.001296"	"2.18"	"34.41"
"28446"	"[K].YGKDATNVGDEGGFAPNILENK.[E]"	"1xBiotin [K3]"	"0.00345699"	"0.000586377"	"1"	"1"	"4"	"P17182"	"P17182 [200-221]"	"P17182 1xBiotin [K202]"	"alpha-enolase [OS=Mus musculus]"	"1"	"2535.18203"	""	""	""	""	"9.97"	"9.97"	"9.97"	""	""	""	""	""	"600.0"	""	""	""	""	""	"8589.353515625"	""	"High"	"Not Found"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"845.73170"	"0.0001108"	"0.0001332"	"3.39"	"47.24"
"28423"	"[R].YFYFYNTGLQNQR.[V]"	""	"0.00928901"	"0.000586377"	"1"	"1"	"4"	"Q9QUR6"	"Q9QUR6 [86-98]"	""	"prolyl endopeptidase [OS=Mus musculus]"	"0"	"1713.80198"	"0.97"	"0.65"	"-0.35"	"-2.20"	"1.12"	"0.15"	"0.47"	"77.9"	"152.5"	"122.3"	"60.9"	"16.9"	"169.5"	"36380.36328125"	"71273.91796875"	"57170.8125"	"28453.126953125"	"7912.5029296875"	"79183.6494140625"	""	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"2"	"857.40522"	"0.0001108"	"0.0005653"	"3.30"	"45.53"
"28404"	"[K].YFPYYGK.[K]"	""	"0.0584513"	"0.0019826"	"1"	"1"	"11"	"P97370"	"P97370 [213-219]"	""	"sodium/potassium-transporting ATPase subunit beta-3 [OS=Mus musculus]"	"0"	"937.44543"	"0.78"	"0.17"	"1.79"	"0.87"	"0.28"	"-0.50"	"0.11"	"58.0"	"99.9"	"65.2"	"200.7"	"105.8"	"70.4"	"15125.3359375"	"26053.205078125"	"17015.94921875"	"52336.546875"	"27598.5859375"	"18358.77734375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"469.22631"	"0.0003442"	"0.008559"	"1.21"	"33.72"
"28403"	"[R].YFPTQALNFAFKDK.[Y]"	"1xBiotin [K]"	"0.026266"	"0.00104877"	"2"	"3"	"4"	"P48962; P51881"	"P48962 [81-94]; P51881 [81-94]"	"P48962 1xBiotin [K]; P51881 1xBiotin [K]"	"ADP/ATP translocase 1 [OS=Mus musculus];ADP/ATP translocase 2 [OS=Mus musculus]"	"1"	"1915.94112"	"9.97"	""	""	""	"9.97"	"0.75"	"9.97"	""	"223.5"	""	""	""	"376.5"	""	"9382.603515625"	""	""	""	"15802.9052734375"	"NotUnique"	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"2"	"958.47612"	"0.0001873"	"0.002602"	"2.21"	"56.28"
"28402"	"[R].YFPTQALNFAFK.[D]"	""	"0.0011628"	"0.000586377"	"2"	"3"	"9"	"P48962; P51881"	"P48962 [81-92]; P51881 [81-92]"	""	"ADP/ATP translocase 1 [OS=Mus musculus];ADP/ATP translocase 2 [OS=Mus musculus]"	"0"	"1446.74161"	"0.34"	"0.22"	"0.01"	"-3.23"	"0.26"	"-0.08"	"0.03"	"104.6"	"132.2"	"122.0"	"105.0"	"11.2"	"125.0"	"57309.140625"	"72388.25"	"66824.40625"	"57532.0078125"	"6119.10888671875"	"68435.0078125"	"NotUnique"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"723.87432"	"0.0001108"	"2.702E-05"	"2.92"	"54.05"
"28352"	"[K].YENVYITKQFVR.[F]"	"1xBiotin [K8]"	"0.000431575"	"0.000586377"	"1"	"4"	"5"	"Q7TNJ0-1"	"Q7TNJ0-1 [242-253]"	"Q7TNJ0-1 1xBiotin [K249]"	"Dendritic cell-specific transmembrane protein [OS=Mus musculus]"	"1"	"1785.89925"	"0.06"	"0.02"	"-9.97"	"-9.97"	"0.32"	"0.25"	"0.30"	"139.4"	"145.6"	"141.4"	""	""	"173.6"	"24790.978515625"	"25881.634765625"	"25135.564453125"	""	""	"30867.982421875"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"2"	"893.45341"	"0.0001108"	"6.336E-06"	"3.18"	"47.69"
"138"	"[K].AAPQSPSVPKKPGPPVLSSDPNMLSNEEAGHHFEQMLK.[L]"	"1xBiotin [K10]; 2xOxidation [M23; M36]"	"0.018601"	"0.000586377"	"1"	"1"	"2"	"Q99P88"	"Q99P88 [988-1025]"	"Q99P88 1xBiotin [K997]"	"nuclear pore complex protein nup155 [OS=Mus musculus]"	"1"	"4310.06787"	"-9.97"	"-0.45"	"-9.97"	"-9.97"	"-9.97"	""	"-9.97"	"346.1"	""	"253.9"	""	""	""	"31231.912109375"	""	"22910.78515625"	""	""	""	""	"High"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"5"	"862.81963"	"0.0001108"	"0.001559"	"4.04"	"39.04"
"152"	"[K].AASEKSCNCLLLK.[V]"	"1xBiotin [K5]; 2xCarbamidomethyl [C7; C9]"	"5.16668E-05"	"0.000586377"	"1"	"1"	"6"	"P17182"	"P17182 [331-343]"	"P17182 1xBiotin [K335]"	"alpha-enolase [OS=Mus musculus]"	"1"	"1719.82266"	"0.50"	"0.35"	"0.76"	"0.97"	"-9.97"	"-9.97"	"-9.97"	"81.6"	"115.6"	"104.3"	"138.5"	"160.0"	""	"13910.126953125"	"19704.390625"	"17772.447265625"	"23609.798828125"	"27267.73046875"	""	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"860.41514"	"0.0001108"	"2.862E-07"	"3.88"	"39.01"
"154"	"[K].AASGEAKPK.[A]"	"1xBiotin [K7]"	"0.00636818"	"0.000586377"	"3"	"3"	"6"	"P43274; P43276; P43277"	"P43274 [111-119]; P43276 [111-119]; P43277 [112-120]"	"P43274 1xBiotin [K117]; P43276 1xBiotin [K117]; P43277 1xBiotin [K118]"	"Histone H1.4 [OS=Mus musculus];Histone H1.5 [OS=Mus musculus];Histone H1.3 [OS=Mus musculus]"	"0"	"1084.54556"	"0.47"	"0.38"	"0.58"	"0.64"	"0.35"	"-0.11"	"-0.02"	"74.9"	"103.6"	"97.1"	"111.7"	"116.9"	"95.7"	"39658.09375"	"54895.62890625"	"51437.87890625"	"59180.8828125"	"61909.265625"	"50695.265625"	"NotUnique"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"542.77639"	"0.0001108"	"0.0003238"	"2.33"	"20.16"
"28254"	"[R].YASGINGSLQKNLTLPK.[N]"	"1xBiotin [K11]"	"7.16206E-05"	"0.000586377"	"1"	"3"	"5"	"Q3U3D7-1"	"Q3U3D7-1 [1034-1050]"	"Q3U3D7-1 1xBiotin [K1044]"	"Transmembrane protein 131-like [OS=Mus musculus]"	"1"	"2030.07392"	""	"9.97"	""	""	""	""	"-9.97"	""	""	"600.0"	""	""	""	""	""	"9020.77734375"	""	""	""	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"2"	"1015.54108"	"0.0001108"	"4.615E-07"	"2.94"	"45.85"
"28249"	"[K].YAPLADVKSEK.[T]"	"1xBiotin [K8]"	"0.00128393"	"0.000586377"	"1"	"4"	"6"	"Q61029"	"Q61029 [393-403]"	"Q61029 1xBiotin [K400]"	"Lamina-associated polypeptide 2, isoforms beta/delta/epsilon/gamma [OS=Mus musculus]"	"1"	"1446.72973"	"0.06"	"0.19"	"0.56"	"0.09"	"-0.10"	"-0.16"	"-0.29"	"90.1"	"94.2"	"103.1"	"132.9"	"95.6"	"84.2"	"79462.4921875"	"83059.6875"	"90920.7734375"	"117264.6015625"	"84339.859375"	"74240.7421875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"723.86860"	"0.0001108"	"3.129E-05"	"2.87"	"39.36"
"28246"	"[R].YANNSNYKNDVMIR.[K]"	"1xBiotin [K8]; 1xOxidation [M12]"	"0.0239615"	"0.00104877"	"1"	"2"	"1"	"Q9CQL1"	"Q9CQL1 [34-47]"	"Q9CQL1 1xBiotin [K41]"	"protein mago nashi homolog 2 [OS=Mus musculus]"	"1"	"1943.87384"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"972.44084"	"0.0001873"	"0.002263"	"1.67"	""
"156"	"[K].AASGEAKPQAK.[K]"	"1xBiotin [K7]"	"0.00231293"	"0.000586377"	"1"	"1"	"6"	"P15864"	"P15864 [111-121]"	"P15864 1xBiotin [K117]"	"Histone H1.2 [OS=Mus musculus]"	"0"	"1283.64125"	"0.61"	"0.59"	"0.53"	"1.00"	"0.61"	"0.00"	"0.02"	"66.7"	"101.6"	"100.3"	"96.1"	"133.4"	"101.9"	"9225.6064453125"	"14058.7958984375"	"13868.2626953125"	"13287.6435546875"	"18444.802734375"	"14099.9892578125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"642.32416"	"0.0001108"	"7.361E-05"	"2.81"	"20.96"
"28242"	"[R].YAMGAKSVGPLQYASR.[M]"	"1xBiotin [K6]; 1xOxidation [M3]"	"0.00050516"	"0.000586377"	"1"	"1"	"4"	"Q8VE99"	"Q8VE99 [47-62]"	"Q8VE99 1xBiotin [K52]"	"Coiled-coil domain-containing protein 115 [OS=Mus musculus]"	"1"	"1940.93571"	"9.97"	"9.97"	"9.97"	""	"9.97"	"0.40"	"0.77"	""	"149.2"	"116.0"	"137.2"	""	"197.5"	""	"7163.91015625"	"5569.7666015625"	"6587.05078125"	""	"9482.060546875"	""	"High"	"Peak Found"	"High"	"High"	"Not Found"	"High"	"High"	"2"	"970.97034"	"0.0001108"	"8.022E-06"	"3.17"	"40.82"
"28476"	"[R].YHFFLYK.[H]"	""	"0.0810517"	"0.00241047"	"1"	"3"	"4"	"Q9Z0P5"	"Q9Z0P5 [236-242]"	""	"Twinfilin-2 [OS=Mus musculus]"	"0"	"1017.51926"	"0.10"	"0.52"	"-0.03"	"-2.25"	"0.10"	"0.01"	"-0.42"	"104.1"	"111.3"	"149.0"	"102.2"	"21.8"	"111.7"	"20987.380859375"	"22436.70703125"	"30045.462890625"	"20609.134765625"	"4400.015625"	"22518.681640625"	""	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"2"	"509.26311"	"0.000415"	"0.01398"	"1.73"	"39.70"
"723"	"[K].AKETADAISK.[E]"	"1xBiotin [K2]"	"0.00107794"	"0.000586377"	"1"	"1"	"6"	"Q60870"	"Q60870 [159-168]"	"Q60870 1xBiotin [K160]"	"Receptor expression-enhancing protein 5 [OS=Mus musculus]"	"1"	"1259.63001"	"-0.56"	"-1.16"	"-0.01"	"-0.05"	"-0.02"	"0.54"	"1.14"	"118.3"	"80.1"	"52.9"	"117.6"	"114.7"	"116.5"	"250254.140625"	"169323.375"	"111898.4453125"	"248627.296875"	"242504.640625"	"246289.390625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"630.31860"	"0.0001108"	"2.418E-05"	"3.60"	"26.59"
"26700"	"[K].VKCLNNLAASQLK.[L]"	"1xBiotin [K2]; 1xCarbamidomethyl [C3]"	"6.07766E-06"	"0.000586377"	"1"	"2"	"12"	"O35465-1"	"O35465-1 [262-274]"	"O35465-1 1xBiotin [K263]"	"peptidyl-prolyl cis-trans isomerase FKBP8 [OS=Mus musculus]"	"1"	"1684.88731"	"0.56"	"-0.07"	"0.40"	"-0.12"	"0.53"	"-0.03"	"0.60"	"84.4"	"124.7"	"80.4"	"111.1"	"77.6"	"121.8"	"130116.354003906"	"192283.362304688"	"123884.6328125"	"171246.867675781"	"119579.7109375"	"187704.248046875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"842.94714"	"0.0001108"	"1.262E-08"	"4.53"	"41.35"
"727"	"[K].AKFESLAEEK.[R]"	"1xBiotin [K2]"	"0.00143429"	"0.000586377"	"1"	"1"	"5"	"P49710"	"P49710 [240-249]"	"P49710 1xBiotin [K241]"	"Hematopoietic lineage cell-specific protein [OS=Mus musculus]"	"1"	"1377.67188"	"-0.05"	"-0.23"	"0.20"	"-0.09"	"0.10"	"0.15"	"0.33"	"100.2"	"96.8"	"85.6"	"115.0"	"94.5"	"107.8"	"29248.791015625"	"28256.712890625"	"24985.033203125"	"33563.16796875"	"27570.0234375"	"31451.001953125"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"2"	"689.33951"	"0.0001108"	"3.677E-05"	"2.36"	"38.42"
"1495"	"[R].AQQMTGTKSQGPTKPPPPR.[K]"	"1xBiotin [K8]"	"0.000205795"	"0.000586377"	"1"	"1"	"13"	"O88839-3"	"O88839-3 [753-771]"	"O88839-3 1xBiotin [K760]"	"Isoform 3 of Disintegrin and metalloproteinase domain-containing protein 15 [OS=Mus musculus]"	"1"	"2233.12162"	"1.00"	"0.51"	"0.47"	"1.58"	"0.81"	"-0.19"	"0.30"	"56.8"	"113.9"	"81.2"	"78.5"	"170.0"	"99.6"	"10787.6669921875"	"21624.9453125"	"15408.818359375"	"14896.94140625"	"32280.974609375"	"18908.544921875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"745.04571"	"0.0001108"	"2.164E-06"	"4.23"	"24.73"
"25469"	"[K].TIHGSKSVDSGIYLDSSYK.[M]"	"1xBiotin [K6]"	"2.64216E-05"	"0.000586377"	"1"	"1"	"2"	"P70677"	"P70677 [20-38]"	"P70677 1xBiotin [K25]"	"Caspase-3 [OS=Mus musculus]"	"1"	"2283.09617"	"9.97"	"9.97"	""	""	""	"-9.97"	"-9.97"	""	"306.1"	"293.9"	""	""	""	""	"30940.802734375"	"29702.734375"	""	""	""	""	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"3"	"761.70293"	"0.0001108"	"1.08E-07"	"3.88"	"39.26"
"25460"	"[K].TIGGGDDSFNTFFSETGAGKHVPR.[A]"	"1xBiotin [K20]"	"2.49025E-06"	"0.000586377"	"1"	"4"	"4"	"P05213"	"P05213 [41-64]"	"P05213 1xBiotin [K60]"	"Tubulin alpha-1B chain [OS=Mus musculus]"	"1"	"2723.25184"	"0.13"	"-0.58"	"-9.97"	"-9.97"	"0.10"	"-0.03"	"0.69"	"156.5"	"171.2"	"104.4"	""	""	"167.9"	"25161.62890625"	"27520.322265625"	"16782.826171875"	""	""	"26996.15234375"	""	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"908.42286"	"0.0001108"	"3.426E-09"	"5.22"	"50.02"
"25453"	"[K].TLGAGAFGKVVEATAFGLGK.[E]"	"1xBiotin [K9]"	"2.08028E-05"	"0.000586377"	"1"	"1"	"8"	"P09581"	"P09581 [585-604]"	"P09581 1xBiotin [K593]"	"Macrophage colony-stimulating factor 1 receptor [OS=Mus musculus]"	"1"	"2120.12087"	"-0.58"	"-1.96"	"-9.97"	"-9.97"	"0.46"	"1.04"	"2.41"	"181.7"	"121.8"	"46.9"	""	""	"249.6"	"21673.7666015625"	"14522.9897460938"	"5590.09326171875"	""	""	"29769.380859375"	""	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"2"	"1060.56391"	"0.0001108"	"7.589E-08"	"4.37"	"61.48"
"1496"	"[R].AQQMTGTKSQGPTKPPPPR.[K]"	"1xBiotin [K8]; 1xOxidation [M4]"	"0.000101623"	"0.000586377"	"1"	"1"	"22"	"O88839-3"	"O88839-3 [753-771]"	"O88839-3 1xBiotin [K760]"	"Isoform 3 of Disintegrin and metalloproteinase domain-containing protein 15 [OS=Mus musculus]"	"1"	"2249.11653"	"-0.07"	"-0.16"	"-0.26"	"-0.80"	"0.02"	"0.09"	"0.18"	"113.9"	"108.4"	"101.8"	"95.0"	"65.2"	"115.6"	"55158.953125"	"52469.80078125"	"49310.79296875"	"46015.3203125"	"31593.326171875"	"55985.2734375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"750.37722"	"0.0001108"	"7.718E-07"	"5.25"	"21.61"
"25443"	"[R].TLEPHNGKCK.[E]"	"1xBiotin [K]; 1xCarbamidomethyl [C9]"	"0.00856411"	"0.000586377"	"1"	"1"	"20"	"P35821"	"P35821 [316-325]"	"P35821 1xBiotin [K]"	"Tyrosine-protein phosphatase non-receptor type 1 [OS=Mus musculus]"	"1"	"1409.66642"	"0.30"	"0.42"	"0.19"	"0.35"	"0.18"	"-0.12"	"-0.24"	"84.3"	"103.9"	"113.1"	"95.9"	"107.1"	"95.7"	"567242.15625"	"699350.234375"	"760861.734375"	"645687.3828125"	"720682.28125"	"643888.2109375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"705.33672"	"0.0001108"	"0.0005008"	"1.74"	"20.79"
"25415"	"[K].TIAPALVSKK.[V]"	"1xBiotin [K]"	"0.00923527"	"0.000586377"	"1"	"1"	"6"	"P17182"	"P17182 [72-81]"	"P17182 1xBiotin [K]"	"alpha-enolase [OS=Mus musculus]"	"1"	"1253.72861"	"0.03"	"-0.07"	"-0.36"	"-0.27"	"-0.25"	"-0.28"	"-0.18"	"110.6"	"112.8"	"105.5"	"86.1"	"92.0"	"93.0"	"48449.96875"	"49425.16796875"	"46206.95703125"	"37710.6953125"	"40319.9609375"	"40719.85546875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"627.36780"	"0.0001108"	"0.0005579"	"2.85"	"38.30"
"25412"	"[R].TLAHFRPIEDNEKSK.[D]"	"1xBiotin [K]"	"0.00285258"	"0.000586377"	"1"	"1"	"6"	"P61022"	"P61022 [86-100]"	"P61022 1xBiotin [K]"	"Calcineurin B homologous protein 1 [OS=Mus musculus]"	"1"	"2011.00657"	"0.46"	"0.43"	"0.74"	"0.14"	"0.09"	"-0.37"	"-0.34"	"79.3"	"108.9"	"106.9"	"132.9"	"87.6"	"84.4"	"25420.18359375"	"34881.578125"	"34266.984375"	"42575.0546875"	"28055.173828125"	"27042.970703125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"671.00629"	"0.0001108"	"0.0001002"	"2.30"	"32.35"
"1494"	"[R].AQQMTGTKQASVVSFPVPPSRPLPPNPVPK.[K]"	"1xBiotin [K8]; 1xOxidation [M4]"	"0.00234004"	"0.000586377"	"1"	"1"	"5"	"O88839-1"	"O88839-1 [753-782]"	"O88839-1 1xBiotin [K760]"	"Disintegrin and metalloproteinase domain-containing protein 15 [OS=Mus musculus]"	"1"	"3397.77591"	"0.55"	"0.36"	"-0.92"	"-9.97"	"1.00"	"0.45"	"0.64"	"95.5"	"140.0"	"122.7"	"50.5"	""	"191.3"	"11425.5170898438"	"16742.6591796875"	"14680.4760742188"	"6040.365234375"	""	"22889.2202148438"	""	"High"	"High"	"High"	"Peak Found"	"Not Found"	"High"	"High"	"3"	"1133.26355"	"0.0001108"	"7.484E-05"	"3.92"	"44.72"
"25411"	"[K].TLAGMGLQPGNISPTSKLISR.[S]"	"1xBiotin [K17]; 1xOxidation [M5]"	"1.67353E-07"	"0.000586377"	"1"	"1"	"15"	"P23298"	"P23298 [305-325]"	"P23298 1xBiotin [K321]"	"Protein kinase C eta type [OS=Mus musculus]"	"1"	"2383.24721"	"0.03"	"0.21"	"-0.23"	"-2.68"	"0.26"	"0.23"	"0.05"	"111.4"	"114.0"	"128.9"	"94.7"	"17.3"	"133.7"	"200164.6171875"	"204751.03125"	"231453.228515625"	"170106.111328125"	"31147.5625"	"240073.306640625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"795.08733"	"0.0001108"	"6.654E-11"	"5.87"	"47.29"
"25404"	"[R].TLAAKVELVDIQR.[E]"	"1xBiotin [K5]"	"9.03557E-06"	"0.000586377"	"1"	"1"	"14"	"Q9JID9"	"Q9JID9 [177-189]"	"Q9JID9 1xBiotin [K181]"	"SH2B adapter protein 2 [OS=Mus musculus]"	"1"	"1681.93055"	"0.60"	"0.38"	"-0.40"	"-2.93"	"0.47"	"-0.12"	"0.09"	"98.4"	"148.8"	"128.3"	"74.8"	"12.9"	"136.7"	"63615.478515625"	"96178.93359375"	"82947.099609375"	"48314.5751953125"	"8359.0888671875"	"88376.9453125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"841.46895"	"0.0001108"	"2.253E-08"	"4.49"	"51.97"
"1501"	"[R].AQSQKTADPSNPGR.[H]"	"1xBiotin [K5]"	"8.19007E-05"	"0.000586377"	"1"	"1"	"19"	"Q8K1N4-1"	"Q8K1N4-1 [456-469]"	"Q8K1N4-1 1xBiotin [K460]"	"Spermatogenesis-associated serine-rich protein 2 [OS=Mus musculus]"	"1"	"1682.79149"	"0.55"	"0.55"	"0.40"	"0.32"	"0.41"	"-0.14"	"-0.14"	"76.7"	"112.0"	"112.2"	"101.4"	"95.9"	"101.9"	"87503.451171875"	"127699.12890625"	"127980.1171875"	"115624.88671875"	"109371.83203125"	"116171.3671875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"841.89952"	"0.0001108"	"5.64E-07"	"3.53"	"22.62"
"1510"	"[K].AQYEDIAQK.[S]"	""	"0.0549599"	"0.0019826"	"1"	"1"	"1"	"Q3UV17"	"Q3UV17 [343-351]"	""	"Keratin, type II cytoskeletal 2 oral [OS=Mus musculus]"	"0"	"1065.52111"	"-1.99"	"-1.86"	"-9.97"	"-9.97"	"-2.01"	"-0.01"	"-0.15"	"337.7"	"84.9"	"93.3"	""	""	"84.1"	"11867.7080078125"	"2983.7841796875"	"3277.861328125"	""	""	"2956.39916992188"	""	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"2"	"533.26389"	"0.0003442"	"0.007775"	"1.51"	"20.57"
"25391"	"[R].TKSDLSLK.[M]"	"1xBiotin [K2]"	"0.0194788"	"0.000586377"	"1"	"1"	"6"	"Q9EQJ0"	"Q9EQJ0 [765-772]"	"Q9EQJ0 1xBiotin [K766]"	"Two pore calcium channel protein 1 [OS=Mus musculus]"	"1"	"1117.59217"	"1.09"	"0.49"	"0.74"	"0.44"	"0.78"	"-0.30"	"0.29"	"64.7"	"137.4"	"90.9"	"107.7"	"87.9"	"111.4"	"58349.78125"	"123939.5234375"	"82041.890625"	"97125.0078125"	"79308.4921875"	"100513.84375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"559.29939"	"0.0001108"	"0.001677"	"2.83"	"33.58"
"25390"	"[R].TKSDASCIIQR.[R]"	"1xBiotin [K2]; 1xCarbamidomethyl [C7]"	"0.00150275"	"0.000586377"	"1"	"3"	"4"	"Q8CB96"	"Q8CB96 [140-150]"	"Q8CB96 1xBiotin [K141]"	"Ras association domain-containing protein 4 [OS=Mus musculus]"	"1"	"1504.72466"	"-9.97"	"-1.00"	"-0.93"	"-9.97"	"-0.83"	"9.97"	"0.17"	"231.7"	""	"116.2"	"121.6"	""	"130.5"	"18952.3037109375"	""	"9502.5634765625"	"9946.0654296875"	""	"10677.751953125"	""	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"2"	"752.86620"	"0.0001108"	"3.94E-05"	"2.62"	"32.50"
"1659"	"[K].ASGPPVSELITKAVAASK.[E]"	"1xBiotin [K12]"	"4.54458E-05"	"0.000586377"	"2"	"2"	"15"	"P15864; P43277"	"P15864 [35-52]; P43277 [36-53]"	"P15864 1xBiotin [K46]; P43277 1xBiotin [K47]"	"Histone H1.2 [OS=Mus musculus];Histone H1.3 [OS=Mus musculus]"	"1"	"1952.05212"	"0.21"	"0.09"	"-0.63"	"-9.97"	"0.69"	"0.48"	"0.61"	"109.3"	"126.8"	"116.3"	"70.6"	""	"176.9"	"33108.162109375"	"38404.640625"	"35219.630859375"	"21390.7309570313"	""	"53573.1953125"	"NotUnique"	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"651.35596"	"0.0001108"	"2.381E-07"	"4.80"	"58.32"
"25379"	"[K].TKPIWTR.[N]"	""	"0.0698448"	"0.0019826"	"1"	"2"	"7"	"P11499"	"P11499 [285-291]"	""	"Heat shock protein HSP 90-beta [OS=Mus musculus]"	"0"	"901.52541"	"0.84"	"0.31"	"0.95"	"1.30"	"0.60"	"-0.24"	"0.29"	"60.4"	"108.2"	"74.9"	"116.3"	"148.7"	"91.6"	"43106.546875"	"77232.46875"	"53440.81640625"	"83020.234375"	"106139.6640625"	"65395.69140625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"451.26624"	"0.0003442"	"0.01116"	"1.37"	"22.97"
"25368"	"[R].TKLLNGPDVETGTSTAIPQKK.[W]"	"1xBiotin [K2]"	"4.23363E-06"	"0.000586377"	"1"	"1"	"6"	"P52875"	"P52875 [207-227]"	"P52875 1xBiotin [K208]"	"Transmembrane protein 165 [OS=Mus musculus]"	"2"	"2424.28029"	"0.32"	"0.28"	"-0.45"	"-9.97"	"0.34"	"0.02"	"0.06"	"109.8"	"137.1"	"133.7"	"80.6"	""	"138.9"	"25368.884765625"	"31683.29296875"	"30893.984375"	"18622.318359375"	""	"32106.767578125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"808.76534"	"0.0001108"	"7.475E-09"	"5.04"	"37.92"
"25410"	"[K].TLAGMGLQPGNISPTSKLISR.[S]"	"1xBiotin [K17]"	"1.93794E-06"	"0.000586377"	"1"	"1"	"5"	"P23298"	"P23298 [305-325]"	"P23298 1xBiotin [K321]"	"Protein kinase C eta type [OS=Mus musculus]"	"1"	"2367.25230"	"0.84"	"0.68"	"-9.97"	"-9.97"	"1.08"	"0.24"	"0.39"	"92.3"	"165.1"	"148.1"	""	""	"194.6"	"46139.16015625"	"82530.90625"	"74034.609375"	""	""	"97265.8515625"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"789.75564"	"0.0001108"	"2.382E-09"	"5.65"	"51.31"
"25505"	"[R].TLLIKTVETR.[D]"	"1xBiotin [K5]"	"0.0010169"	"0.000586377"	"1"	"1"	"17"	"P20152"	"P20152 [441-450]"	"P20152 1xBiotin [K445]"	"Vimentin [OS=Mus musculus]"	"1"	"1399.79775"	"0.98"	"0.33"	"0.65"	"0.17"	"0.59"	"-0.39"	"0.26"	"71.2"	"140.5"	"89.5"	"111.9"	"79.9"	"106.9"	"379020.75"	"747618.4375"	"476187.625"	"595702.875"	"425380.46875"	"568830.5"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"700.40252"	"0.0001108"	"2.225E-05"	"3.42"	"44.69"
"25532"	"[R].TINKAWVESR.[E]"	"1xBiotin [K4]"	"0.00583636"	"0.000586377"	"1"	"1"	"4"	"Q9CXW3"	"Q9CXW3 [210-219]"	"Q9CXW3 1xBiotin [K213]"	"Calcyclin-binding protein [OS=Mus musculus]"	"1"	"1429.72564"	"0.25"	"0.53"	"0.24"	"-0.29"	"0.23"	"-0.03"	"-0.31"	"88.1"	"105.1"	"127.4"	"104.3"	"72.0"	"103.1"	"9311.6513671875"	"11099.2197265625"	"13456.9755859375"	"11023.25390625"	"7605.58447265625"	"10890.9814453125"	""	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"2"	"715.36727"	"0.0001108"	"0.0002867"	"2.46"	"41.14"
"1493"	"[R].AQQMTGTKAALADR.[S]"	"1xBiotin [K8]; 1xOxidation [M4]"	"0.000205795"	"0.000586377"	"1"	"1"	"6"	"O88839-2"	"O88839-2 [753-766]"	"O88839-2 1xBiotin [K760]"	"Isoform 2 of Disintegrin and metalloproteinase domain-containing protein 15 [OS=Mus musculus]"	"1"	"1703.82035"	"-9.97"	"0.37"	"0.12"	"-0.47"	"-0.06"	"9.97"	"-0.44"	"118.6"	""	"153.4"	"128.7"	"85.9"	"113.4"	"10531.4111328125"	""	"13616.892578125"	"11428.384765625"	"7622.10546875"	"10070.751953125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"852.41366"	"0.0001108"	"2.162E-06"	"3.24"	"31.05"
"1401"	"[K].APSGTPTKHPNWTNK.[Q]"	"1xBiotin [K8]"	"0.00253889"	"0.000586377"	"1"	"1"	"6"	"Q9QXX0"	"Q9QXX0 [1185-1199]"	"Q9QXX0 1xBiotin [K1192]"	"Protein jagged-1 [OS=Mus musculus]"	"1"	"1861.90138"	"0.54"	"0.33"	"0.12"	"0.00"	"0.25"	"-0.29"	"-0.08"	"85.9"	"124.9"	"108.0"	"93.4"	"85.8"	"101.9"	"27772.54296875"	"40405.984375"	"34952.8828125"	"30227.09375"	"27771.484375"	"32966.40625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"621.30589"	"0.0001108"	"8.476E-05"	"3.50"	"29.47"
"25779"	"[K].TPSQATSSQAKEK.[L]"	"1xBiotin [K11]"	"0.000261377"	"0.000586377"	"1"	"1"	"6"	"Q8CHK3"	"Q8CHK3 [457-469]"	"Q8CHK3 1xBiotin [K467]"	"Lysophospholipid acyltransferase 7 [OS=Mus musculus]"	"1"	"1588.76355"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"0.02"	"-0.18"	""	"99.0"	"114.4"	"137.9"	"148.0"	"100.7"	""	"10885.2880859375"	"12582.453125"	"15160.509765625"	"16277.998046875"	"11069.599609375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"794.88607"	"0.0001108"	"3.058E-06"	"3.21"	"20.17"
"25726"	"[R].TPKKPLTR.[A]"	"1xBiotin [K]"	"0.065346"	"0.0019826"	"1"	"3"	"3"	"Q61029"	"Q61029 [320-327]"	"Q61029 1xBiotin [K]"	"Lamina-associated polypeptide 2, isoforms beta/delta/epsilon/gamma [OS=Mus musculus]"	"1"	"1166.67142"	"0.86"	"0.27"	"0.29"	"0.88"	"0.21"	"-0.65"	"-0.06"	"72.7"	"132.3"	"87.8"	"88.7"	"134.2"	"84.2"	"9660.6435546875"	"17563.392578125"	"11662.94921875"	"11782.7841796875"	"17818.93359375"	"11187.5712890625"	""	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"2"	"583.83884"	"0.0003442"	"0.01008"	"1.46"	"22.44"
"25725"	"[K].TPKGPSSVEDIK.[A]"	"1xBiotin [K3]"	"0.00397538"	"0.000586377"	"1"	"1"	"6"	"Q61937"	"Q61937 [235-246]"	"Q61937 1xBiotin [K237]"	"Nucleophosmin [OS=Mus musculus]"	"1"	"1483.74611"	"0.66"	"0.49"	"0.42"	"-0.37"	"0.47"	"-0.19"	"-0.02"	"80.2"	"126.5"	"112.7"	"107.6"	"62.0"	"111.0"	"23770.60546875"	"37469.28515625"	"33391.33203125"	"31870.2734375"	"18353.939453125"	"32876.23046875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"742.37683"	"0.0001108"	"0.0001631"	"1.90"	"33.90"
"25704"	"[K].TPAQKAPAPK.[A]"	"1xBiotin [K5]"	"0.000746594"	"0.000586377"	"1"	"1"	"8"	"Q9CR57"	"Q9CR57 [202-211]"	"Q9CR57 1xBiotin [K206]"	"60S ribosomal protein L14 [OS=Mus musculus]"	"1"	"1234.66125"	"-0.10"	"-0.06"	"-0.07"	"0.09"	"0.06"	"0.16"	"0.12"	"100.8"	"94.2"	"96.4"	"96.1"	"107.6"	"105.0"	"71595.421875"	"66953.453125"	"68491.125"	"68265.3671875"	"76435.1640625"	"74629.7109375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"617.83429"	"0.0001108"	"1.421E-05"	"3.27"	"23.65"
"25693"	"[K].TNTLAAQSVIKK.[D]"	"1xBiotin [K11]"	"0.000145038"	"0.000586377"	"1"	"2"	"6"	"Q9CQ56"	"Q9CQ56 [196-207]"	"Q9CQ56 1xBiotin [K206]"	"Vesicle transport protein USE1 [OS=Mus musculus]"	"1"	"1499.82502"	"0.08"	"0.18"	"0.38"	"0.22"	"-0.05"	"-0.12"	"-0.22"	"90.7"	"95.7"	"102.6"	"117.6"	"105.7"	"87.8"	"73758.484375"	"77818.734375"	"83436.3203125"	"95692.3984375"	"86005.7265625"	"71400.421875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"750.41600"	"0.0001108"	"1.296E-06"	"3.90"	"35.89"
"1418"	"[R].APTTMKK.[F]"	"1xBiotin [K6]; 1xOxidation [M5]"	"0.106881"	"0.00731053"	"1"	"1"	"5"	"Q9DBG7"	"Q9DBG7 [132-138]"	"Q9DBG7 1xBiotin [K137]"	"signal recognition particle receptor subunit alpha [OS=Mus musculus]"	"1"	"1018.50600"	"0.53"	"0.47"	"0.51"	"-0.84"	"0.34"	"-0.19"	"-0.13"	"84.8"	"122.6"	"117.4"	"120.5"	"47.3"	"107.3"	"13080.73828125"	"18910.048828125"	"18111.787109375"	"18587.19140625"	"7292.611328125"	"16550.119140625"	""	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"2"	"509.75662"	"0.001426"	"0.02131"	"1.41"	"18.02"
"25673"	"[R].TNLATGLPSSKVKYSR.[L]"	"1xBiotin [K]"	"0.00476133"	"0.000586377"	"1"	"1"	"4"	"Q8CIB6"	"Q8CIB6 [6-21]"	"Q8CIB6 1xBiotin [K]"	"Transmembrane protein 230 [OS=Mus musculus]"	"2"	"1948.03206"	"-9.97"	"-9.97"	"-0.25"	"-9.97"	"-9.97"	""	""	"325.9"	""	""	"274.1"	""	""	"10048.236328125"	""	""	"8448.8681640625"	""	""	""	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"3"	"650.01590"	"0.0001108"	"0.0002126"	"3.51"	"37.37"
"25672"	"[R].TNLATGLPSSKVK.[Y]"	"1xBiotin [K11]"	"7.20395E-05"	"0.000586377"	"1"	"1"	"35"	"Q8CIB6"	"Q8CIB6 [6-18]"	"Q8CIB6 1xBiotin [K16]"	"Transmembrane protein 230 [OS=Mus musculus]"	"1"	"1541.83559"	"0.41"	"0.56"	"0.60"	"0.83"	"0.80"	"0.39"	"0.24"	"67.9"	"90.3"	"100.1"	"102.7"	"120.9"	"118.0"	"1559699.57128906"	"2074839.22070313"	"2300168.09863281"	"2359639.015625"	"2777916.64111328"	"2711588.6796875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"771.42163"	"0.0001108"	"4.656E-07"	"4.22"	"38.12"
"25670"	"[K].TNKVIPSLFR.[L]"	"1xBiotin [K3]"	"0.0287874"	"0.00104877"	"1"	"2"	"5"	"Q3TVP5"	"Q3TVP5 [257-266]"	"Q3TVP5 1xBiotin [K259]"	"inactive ubiquitin thioesterase FAM105A [OS=Mus musculus]"	"1"	"1400.77187"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"-0.45"	"-0.17"	""	"173.7"	"143.5"	"126.9"	"28.4"	"127.5"	""	"16533.224609375"	"13665.3671875"	"12084.150390625"	"2704.71997070313"	"12136.0634765625"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"2"	"700.88944"	"0.0001873"	"0.002977"	"2.31"	"50.45"
"1434"	"[K].AQASAPAQAPKGAQAPK.[G]"	"1xBiotin [K11]"	"0.0133822"	"0.000586377"	"1"	"1"	"4"	"P47915"	"P47915 [135-151]"	"P47915 1xBiotin [K145]"	"60S ribosomal protein L29 [OS=Mus musculus]"	"1"	"1817.93268"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"Not Found"	"High"	"Not Found"	"High"	"High"	"High"	"3"	"606.64881"	"0.0001108"	"0.0009663"	"3.28"	""
"25651"	"[K].TMSTSDPAEVLIKNSQPVK.[T]"	"1xBiotin [K13]; 1xOxidation [M2]"	"0.00149402"	"0.000586377"	"1"	"1"	"11"	"Q80WJ7"	"Q80WJ7 [489-507]"	"Q80WJ7 1xBiotin [K501]"	"protein LYRIC [OS=Mus musculus]"	"1"	"2287.13084"	"0.04"	"0.25"	"0.60"	"0.01"	"0.47"	"0.43"	"0.23"	"84.2"	"86.8"	"100.0"	"127.3"	"84.8"	"116.9"	"23301.6025390625"	"24020.02734375"	"27671.77734375"	"35252.1372070313"	"23474.4892578125"	"32368.240234375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"763.04850"	"0.0001108"	"3.911E-05"	"3.53"	"45.07"
"25627"	"[K].TMGKVSR.[F]"	"1xBiotin [K4]; 1xOxidation [M2]"	"0.0453851"	"0.00154748"	"1"	"1"	"4"	"Q7TPN9"	"Q7TPN9 [467-473]"	"Q7TPN9 1xBiotin [K470]"	"Proline-rich protein 14 [OS=Mus musculus]"	"1"	"1020.49650"	"0.35"	"0.37"	"0.29"	"-0.91"	"0.05"	"-0.29"	"-0.32"	"94.4"	"120.0"	"122.1"	"115.2"	"50.4"	"98.0"	"7957.916015625"	"10114.2890625"	"10290.0361328125"	"9715.748046875"	"4248.13623046875"	"8259.271484375"	""	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"2"	"510.75196"	"0.0002716"	"0.005837"	"1.71"	"19.76"
"1479"	"[R].AQLSSVSSKAAGVR.[G]"	"1xBiotin [K9]"	"9.04361E-05"	"0.000586377"	"1"	"2"	"11"	"Q3UPF5-1"	"Q3UPF5-1 [303-316]"	"Q3UPF5-1 1xBiotin [K311]"	"zinc finger CCCH-type antiviral protein 1 [OS=Mus musculus]"	"1"	"1586.83190"	"1.07"	"1.05"	"0.16"	"0.94"	"0.00"	"-1.07"	"-1.05"	"65.1"	"137.1"	"134.7"	"72.9"	"125.0"	"65.1"	"24051.171875"	"50659.08203125"	"49777.36328125"	"26946.123046875"	"46167.794921875"	"24065.412109375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"793.92043"	"0.0001108"	"6.517E-07"	"3.60"	"35.72"
"25586"	"[K].TLTGKTITLEVEPSDTIENVK.[A]"	"1xBiotin [K5]"	"0.000277072"	"0.000586377"	"1"	"4"	"7"	"P62983"	"P62983 [7-27]"	"P62983 1xBiotin [K11]"	"Ubiquitin-40S ribosomal protein S27a [OS=Mus musculus]"	"1"	"2514.30075"	"0.07"	"0.07"	"-0.83"	"-9.97"	"-0.20"	"-0.27"	"-0.27"	"132.3"	"139.2"	"138.9"	"74.5"	""	"115.1"	"24155.8828125"	"25408.021484375"	"25355.6640625"	"13591.6396484375"	""	"21019.833984375"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"838.77007"	"0.0001108"	"3.322E-06"	"5.19"	"50.19"
"25585"	"[K].TITGKTFSSR.[-]"	"1xBiotin [K5]"	"0.00841625"	"0.000586377"	"1"	"1"	"6"	"Q9CVB6"	"Q9CVB6 [291-300]"	"Q9CVB6 1xBiotin [K295]"	"Actin-related protein 2/3 complex subunit 2 [OS=Mus musculus]"	"1"	"1323.67255"	""	""	"9.97"	"9.97"	""	""	""	""	""	""	"332.4"	"267.6"	""	""	""	""	"31122.240234375"	"25049.0703125"	""	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"662.34014"	"0.0001108"	"0.0004876"	"2.08"	"34.64"
"1484"	"[K].AQMSPHDIPKPVTDFLPR.[Y]"	"1xBiotin [K10]; 1xOxidation [M3]"	"0.000419174"	"0.000586377"	"1"	"1"	"5"	"Q8K1T1"	"Q8K1T1 [208-225]"	"Q8K1T1 1xBiotin [K217]"	"Leucine-rich repeat-containing protein 25 [OS=Mus musculus]"	"0"	"2291.13112"	"1.13"	"0.57"	"-9.97"	"-9.97"	"1.09"	"-0.03"	"0.52"	"88.2"	"192.3"	"131.3"	""	""	"188.2"	"6637.85693359375"	"14480.21484375"	"9882.568359375"	""	""	"14170.8564453125"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"764.38141"	"0.0001108"	"6.09E-06"	"3.37"	"48.37"
"25573"	"[R].TLSKDDVNYR.[M]"	"1xBiotin [K4]"	"0.0019878"	"0.000586377"	"1"	"1"	"6"	"Q99LH2"	"Q99LH2 [9-18]"	"Q99LH2 1xBiotin [K12]"	"phosphatidylserine synthase 1 [OS=Mus musculus]"	"1"	"1436.68384"	"0.31"	"0.42"	"0.57"	"0.30"	"0.05"	"-0.26"	"-0.37"	"81.8"	"101.3"	"109.8"	"121.8"	"100.6"	"84.7"	"59496.13671875"	"73614.234375"	"79806.4375"	"88567.171875"	"73111.4453125"	"61569.2421875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"718.84559"	"0.0001108"	"5.923E-05"	"2.26"	"34.89"
"25572"	"[R].TISKCAELHPCICESEAFR.[F]"	"1xBiotin [K4]; 3xCarbamidomethyl [C5; C11; C13]"	"0.000649104"	"0.000586377"	"1"	"1"	"5"	"P21855"	"P21855 [328-346]"	"P21855 1xBiotin [K331]"	"B-cell differentiation antigen CD72 [OS=Mus musculus]"	"1"	"2534.12948"	"-0.01"	"-0.45"	"-9.97"	"-9.97"	"-9.97"	"-9.97"	"-9.97"	"220.4"	"218.2"	"161.4"	""	""	""	"26042.80859375"	"25790.21484375"	"19078.75390625"	""	""	""	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"845.38098"	"0.0001108"	"1.15E-05"	"2.76"	"42.16"
"25363"	"[K].TKHSVESMITTLDPGMAPYIK.[S]"	"1xBiotin [K2]; 2xOxidation [M8; M16]"	"0.00161162"	"0.000586377"	"1"	"1"	"3"	"Q3UPH1"	"Q3UPH1 [231-251]"	"Q3UPH1 1xBiotin [K232]"	"protein PRRC1 [OS=Mus musculus]"	"1"	"2577.23974"	"-0.71"	"-0.23"	"-9.97"	"-9.97"	"-0.30"	"0.42"	"-0.07"	"183.2"	"111.6"	"156.1"	""	""	"149.0"	"19566.703125"	"11924.15625"	"16675.474609375"	""	""	"15916.7529296875"	""	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"859.75181"	"0.0001108"	"4.345E-05"	"4.32"	"43.58"
"25786"	"[K].TPTGPDLDTSYKGYMK.[L]"	"1xBiotin [K12]; 1xOxidation [M15]"	"3.05686E-05"	"0.000586377"	"1"	"4"	"9"	"Q6ZWR6-1"	"Q6ZWR6-1 [8363-8378]"	"Q6ZWR6-1 1xBiotin [K8374]"	"Nesprin-1 [OS=Mus musculus]"	"1"	"2015.90889"	"-0.65"	"-0.22"	"-0.40"	"-9.97"	"-9.97"	"-9.97"	"-9.97"	"184.6"	"117.5"	"158.4"	"139.5"	""	""	"26635.03515625"	"16960.19921875"	"22857.845703125"	"20139.708984375"	""	""	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"2"	"1008.45873"	"0.0001108"	"1.332E-07"	"4.25"	"38.09"
"25348"	"[K].TKEAVQLLK.[K]"	"1xBiotin [K2]"	"0.0046518"	"0.000586377"	"1"	"1"	"5"	"Q9D8E6"	"Q9D8E6 [164-172]"	"Q9D8E6 1xBiotin [K165]"	"60S ribosomal protein L4 [OS=Mus musculus]"	"1"	"1255.70787"	"-9.97"	"0.56"	"-9.97"	"-9.97"	"0.35"	"9.97"	"-0.21"	"160.2"	""	"236.2"	""	""	"203.6"	"10651.2763671875"	""	"15701.876953125"	""	""	"13540.486328125"	""	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"2"	"628.35767"	"0.0001108"	"0.0002041"	"2.36"	"40.35"
"25340"	"[K].TKANPAMKTVYK.[F]"	"1xBiotin [K2]; 1xOxidation [M7]"	"0.111552"	"0.00731053"	"1"	"1"	"1"	"Q8K382"	"Q8K382 [421-432]"	"Q8K382 1xBiotin [K422]"	"DENN domain-containing protein 1A [OS=Mus musculus]"	"2"	"1593.81275"	"0.64"	"0.44"	"0.06"	"0.32"	"0.35"	"-0.28"	"-0.08"	"80.2"	"124.7"	"108.6"	"83.5"	"100.4"	"102.6"	"16733.56640625"	"26017.423828125"	"22646.98828125"	"17411.85546875"	"20941.404296875"	"21391.3984375"	""	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"2"	"797.41006"	"0.001478"	"0.02276"	"2.44"	"29.46"
"25035"	"[KR].TDKLVNER.[L]"	"1xBiotin [K3]"	"0.0161952"	"0.000586377"	"1"	"2"	"6"	"Q8VDN2"	"Q8VDN2 [841-848]"	"Q8VDN2 1xBiotin [K843]"	"Sodium/potassium-transporting ATPase subunit alpha-1 [OS=Mus musculus]"	"1"	"1200.60413"	"0.92"	"0.17"	"0.37"	"0.48"	"0.37"	"-0.55"	"0.20"	"75.0"	"142.3"	"84.3"	"97.0"	"104.5"	"96.9"	"14857.548828125"	"28188.5"	"16693.451171875"	"19217.390625"	"20707.91796875"	"19193.671875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"600.80563"	"0.0001108"	"0.00127"	"2.39"	"30.57"
"25008"	"[K].TCSGLKSTVGTTKPPAESVYTSLQR.[R]"	"1xBiotin [K6]; 1xCarbamidomethyl [C2]"	"2.25522E-06"	"0.000586377"	"1"	"3"	"6"	"Q8R4V1"	"Q8R4V1 [196-220]"	"Q8R4V1 1xBiotin [K201]"	"NFAT activation molecule 1 [OS=Mus musculus]"	"1"	"2894.43865"	"0.56"	"0.48"	"0.00"	"-9.97"	"0.31"	"-0.25"	"-0.18"	"98.3"	"144.6"	"137.5"	"98.0"	""	"121.5"	"50945.234375"	"74940.734375"	"71269.21875"	"50805.46875"	""	"62989.5703125"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"965.48577"	"0.0001108"	"2.963E-09"	"4.92"	"41.90"
"24997"	"[R].TCLGPKSMMK.[M]"	"1xBiotin [K6]; 1xCarbamidomethyl [C2]; 2xOxidation [M8; M9]"	"0.112149"	"0.00731053"	"1"	"1"	"1"	"P80318"	"P80318 [39-48]"	"P80318 1xBiotin [K44]"	"T-complex protein 1 subunit gamma [OS=Mus musculus]"	"1"	"1410.62481"	"-0.10"	"0.28"	"0.63"	"-1.11"	"0.10"	"0.20"	"-0.18"	"96.4"	"89.9"	"116.7"	"148.9"	"44.8"	"103.3"	"11681.25"	"10889.4423828125"	"14141.064453125"	"18048.494140625"	"5429.84521484375"	"12517.9404296875"	""	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"2"	"705.81614"	"0.001478"	"0.02302"	"1.29"	"27.62"
"1808"	"[K].ATGPPVSELITKAVSASK.[E]"	"1xBiotin [K12]"	"0.000101033"	"0.000586377"	"1"	"1"	"10"	"P43276"	"P43276 [35-52]"	"P43276 1xBiotin [K46]"	"Histone H1.5 [OS=Mus musculus]"	"1"	"1982.06269"	"0.64"	"0.28"	"-0.19"	"-9.97"	"0.84"	"0.20"	"0.56"	"93.0"	"145.3"	"113.2"	"81.7"	""	"166.8"	"15907.63671875"	"24850.0170898438"	"19353.3413085938"	"13964.2993164063"	""	"28524.0830078125"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"2"	"991.53538"	"0.0001108"	"7.614E-07"	"3.26"	"57.68"
"24975"	"[K].TASVAAPLSGKACLDLK.[H]"	"1xBiotin [K]; 1xCarbamidomethyl [C13]"	"0.000239486"	"0.000586377"	"1"	"1"	"12"	"P14719"	"P14719 [549-565]"	"P14719 1xBiotin [K]"	"Interleukin-1 receptor-like 1 [OS=Mus musculus]"	"1"	"1927.99798"	"0.23"	"0.32"	"-0.02"	"-1.11"	"0.32"	"0.09"	"0.00"	"98.0"	"115.0"	"122.8"	"96.4"	"45.3"	"122.5"	"53039.38671875"	"62222.2265625"	"66424.423828125"	"52162.08984375"	"24489.3212890625"	"66257.474609375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"643.33757"	"0.0001108"	"2.686E-06"	"4.73"	"46.57"
"24948"	"[R].TANPSKTIDLGAAAHYTGDK.[A]"	"1xBiotin [K6]"	"1.28957E-05"	"0.000586377"	"1"	"2"	"4"	"Q99KN9-1"	"Q99KN9-1 [286-305]"	"Q99KN9-1 1xBiotin [K291]"	"Clathrin interactor 1 [OS=Mus musculus]"	"1"	"2257.09176"	"0.18"	"-0.01"	"-0.14"	"-0.57"	"-0.30"	"-0.48"	"-0.29"	"108.7"	"123.6"	"107.7"	"98.5"	"73.1"	"88.3"	"37265.91796875"	"42345.76171875"	"36923.37890625"	"33772"	"25042.939453125"	"30267.470703125"	""	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"3"	"753.03588"	"0.0001108"	"3.77E-08"	"3.97"	"39.86"
"1843"	"[K].ATQKGDPVAILK.[R]"	"1xBiotin [K4]"	"0.000188559"	"0.000586377"	"1"	"1"	"6"	"Q99PL5-1"	"Q99PL5-1 [891-902]"	"Q99PL5-1 1xBiotin [K894]"	"Ribosome-binding protein 1 [OS=Mus musculus]"	"1"	"1466.80356"	"0.10"	"-0.15"	"0.23"	"-0.34"	"-0.09"	"-0.19"	"0.06"	"102.2"	"109.3"	"92.1"	"119.9"	"80.8"	"95.7"	"39002.6015625"	"41703.7421875"	"35143.5078125"	"45781.05859375"	"30843.083984375"	"36531.0625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"733.90540"	"0.0001108"	"1.893E-06"	"3.09"	"41.39"
"24939"	"[K].TALRPLKPSENKEDDGQEIA.[-]"	"1xBiotin [K7]"	"0.0194788"	"0.000586377"	"1"	"1"	"6"	"Q8VE98"	"Q8VE98 [297-316]"	"Q8VE98 1xBiotin [K303]"	"CD276 antigen [OS=Mus musculus]"	"1"	"2437.20276"	"0.40"	"0.06"	"0.44"	"0.24"	"0.07"	"-0.33"	"0.01"	"86.3"	"113.9"	"90.0"	"117.5"	"101.8"	"90.5"	"42758.05078125"	"56426.53125"	"44595.83984375"	"58188.80078125"	"50436.0390625"	"44814.4296875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"813.07248"	"0.0001108"	"0.001671"	"4.06"	"36.17"
"25089"	"[R].TELFLKEHDHLR.[N]"	"1xBiotin [K6]"	"0.0103713"	"0.000586377"	"1"	"1"	"5"	"O88630"	"O88630 [160-171]"	"O88630 1xBiotin [K165]"	"Golgi SNAP receptor complex member 1 [OS=Mus musculus]"	"1"	"1763.88975"	"0.20"	"0.30"	"-9.97"	"-9.97"	"0.21"	"0.02"	"-0.08"	"132.3"	"151.5"	"162.7"	""	""	"153.5"	"55680.826171875"	"63763.671875"	"68441.775390625"	""	""	"64582.33984375"	""	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"588.63489"	"0.0001108"	"0.0006634"	"2.20"	"38.65"
"24920"	"[K].TAKLILER.[F]"	"1xBiotin [K3]"	"0.00803425"	"0.000586377"	"1"	"1"	"7"	"Q7TQ95"	"Q7TQ95 [131-138]"	"Q7TQ95 1xBiotin [K133]"	"Protein lunapark [OS=Mus musculus]"	"1"	"1169.67109"	"0.17"	"0.18"	"0.39"	"0.30"	"0.68"	"0.51"	"0.50"	"81.1"	"91.5"	"91.8"	"106.1"	"99.5"	"129.9"	"112368.421875"	"126743.2734375"	"127138.140625"	"146951.75"	"137872.640625"	"179934.09375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"585.33900"	"0.0001108"	"0.0004556"	"3.22"	"40.25"
"24912"	"[R].TAFPKGGWALAQTENQPK.[F]"	"1xBiotin [K5]"	"0.000623145"	"0.000586377"	"1"	"1"	"25"	"P97465"	"P97465 [117-134]"	"P97465 1xBiotin [K121]"	"docking protein 1 [OS=Mus musculus]"	"1"	"2170.07498"	"0.67"	"0.16"	"-0.26"	"-1.58"	"0.62"	"-0.05"	"0.46"	"93.4"	"148.9"	"104.5"	"78.0"	"31.3"	"143.8"	"42652.7001953125"	"67986.2353515625"	"47729.123046875"	"35599.126953125"	"14295.3190917969"	"65649.873046875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"724.02975"	"0.0001108"	"1.092E-05"	"3.84"	"47.25"
"24908"	"[R].TAEKTPSLTK.[K]"	"1xBiotin [K4]"	"0.000964917"	"0.000586377"	"1"	"1"	"10"	"Q60989"	"Q60989 [354-363]"	"Q60989 1xBiotin [K357]"	"E3 ubiquitin-protein ligase XIAP [OS=Mus musculus]"	"1"	"1301.67696"	"0.21"	"0.09"	"0.29"	"0.32"	"0.04"	"-0.18"	"-0.06"	"89.3"	"103.4"	"95.3"	"109.4"	"111.2"	"91.5"	"90831.75"	"105185.109375"	"96965.625"	"111281.3359375"	"113147.2578125"	"93090.421875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"651.34201"	"0.0001108"	"2.055E-05"	"2.98"	"29.82"
"24895"	"[K].TAAKSVWETR.[V]"	"1xBiotin [K4]"	"0.000712571"	"0.000586377"	"1"	"1"	"9"	"Q91WC9"	"Q91WC9 [187-196]"	"Q91WC9 1xBiotin [K190]"	"Sn1-specific diacylglycerol lipase beta [OS=Mus musculus]"	"1"	"1374.68345"	"0.54"	"-0.15"	"-0.06"	"-0.07"	"0.34"	"-0.21"	"0.48"	"91.8"	"133.9"	"82.9"	"87.9"	"87.4"	"116.0"	"152137.5625"	"221853.59375"	"137402.734375"	"145579.1875"	"144895.078125"	"192277.96875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"687.84554"	"0.0001108"	"1.326E-05"	"3.34"	"37.00"
"24873"	"[K].SYLYFTQFK.[A]"	""	"0.0363784"	"0.00104877"	"1"	"1"	"5"	"Q9CPT4"	"Q9CPT4 [94-102]"	""	"Myeloid-derived growth factor [OS=Mus musculus]"	"0"	"1196.59864"	"0.13"	"-9.97"	"-9.97"	"-0.77"	"-9.97"	"-9.97"	""	"223.7"	"245.4"	""	""	"130.9"	""	"11551.9423828125"	"12670.99609375"	""	""	"6758.71923828125"	""	""	"High"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"2"	"598.80319"	"0.0001873"	"0.004218"	"1.83"	"46.49"
"24864"	"[R].SYETMLSFGKR.[S]"	"1xBiotin [K10]; 1xOxidation [M5]"	"0.000889291"	"0.000586377"	"1"	"1"	"42"	"Q8K072"	"Q8K072 [114-124]"	"Q8K072 1xBiotin [K123]"	"Receptor expression-enhancing protein 4 [OS=Mus musculus]"	"1"	"1560.71851"	"0.15"	"0.01"	"-0.14"	"-1.26"	"0.17"	"0.01"	"0.15"	"107.7"	"119.8"	"108.8"	"97.8"	"44.9"	"121.0"	"757044.6171875"	"841602.173828125"	"764211.53515625"	"687035.580078125"	"315570.2578125"	"850343.431640625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"780.86277"	"0.0001108"	"1.828E-05"	"3.30"	"41.66"
"24863"	"[R].SYETMLSFGKR.[S]"	"1xBiotin [K10]"	"0.000388574"	"0.000586377"	"1"	"1"	"18"	"Q8K072"	"Q8K072 [114-124]"	"Q8K072 1xBiotin [K123]"	"Receptor expression-enhancing protein 4 [OS=Mus musculus]"	"1"	"1544.72360"	"0.93"	"0.85"	"0.06"	"-0.27"	"0.79"	"-0.14"	"-0.06"	"72.2"	"137.4"	"130.5"	"75.1"	"59.9"	"124.9"	"232784.177734375"	"442969.15234375"	"420630.9140625"	"241994.4140625"	"193156.330078125"	"402635.6640625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"772.86518"	"0.0001108"	"5.469E-06"	"3.52"	"48.07"
"24862"	"[K].SYENQKPPFDAKNPFLAAVTTNR.[K]"	"1xBiotin [K12]"	"0.0011696"	"0.000586377"	"1"	"1"	"3"	"P37040"	"P37040 [268-290]"	"P37040 1xBiotin [K279]"	"NADPH--cytochrome P450 reductase [OS=Mus musculus]"	"1"	"2834.39302"	"-9.97"	"1.13"	"-9.97"	"-9.97"	"1.48"	"9.97"	"0.36"	"100.4"	""	"219.2"	""	""	"280.4"	"6702.8603515625"	""	"14630.8359375"	""	""	"18714.216796875"	""	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"945.47086"	"0.0001108"	"2.735E-05"	"4.27"	"52.67"
"24846"	"[R].SWSIKSAAK.[E]"	"1xBiotin [K5]"	"0.0153746"	"0.000586377"	"1"	"2"	"6"	"Q3U1N2-1"	"Q3U1N2-1 [763-771]"	"Q3U1N2-1 1xBiotin [K767]"	"Sterol regulatory element-binding protein 2 [OS=Mus musculus]"	"1"	"1203.61905"	"9.97"	""	""	"9.97"	""	"-9.97"	""	""	"339.2"	""	""	"260.8"	""	""	"32015.25"	""	""	"24617.7734375"	""	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"602.31325"	"0.0001108"	"0.00118"	"2.08"	"39.48"
"1850"	"[R].ATSTEPSNSASSSKSEK.[R]"	"1xBiotin [K]"	"0.000441759"	"0.000586377"	"1"	"1"	"16"	"Q8VCH8"	"Q8VCH8 [444-460]"	"Q8VCH8 1xBiotin [K]"	"UBX domain-containing protein 4 [OS=Mus musculus]"	"1"	"1923.86003"	"0.35"	"-0.03"	"0.40"	"0.42"	"0.55"	"0.20"	"0.57"	"81.4"	"103.6"	"79.9"	"107.2"	"108.8"	"119.0"	"26340.130859375"	"33522.6611328125"	"25842.078125"	"34679.6376953125"	"35184.2841796875"	"38484.8212890625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"962.43411"	"0.0001108"	"6.587E-06"	"2.63"	"20.22"
"25123"	"[R].TEVDTGKK.[Q]"	"1xBiotin [K]"	"0.0459009"	"0.00154748"	"1"	"2"	"6"	"Q4FZC9-1"	"Q4FZC9-1 [758-765]"	"Q4FZC9-1 1xBiotin [K]"	"Nesprin-3 [OS=Mus musculus]"	"1"	"1103.54014"	"0.63"	"0.71"	"0.87"	"0.73"	"0.43"	"-0.20"	"-0.28"	"66.7"	"103.0"	"109.1"	"121.5"	"110.2"	"89.6"	"9784.0947265625"	"15118.583984375"	"16008.109375"	"17826.55859375"	"16181.2138671875"	"13146.7392578125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"552.27382"	"0.0002716"	"0.00596"	"1.77"	"22.57"
"1793"	"[K].ATEDGTPHDPYKALWFER.[K]"	"1xBiotin [K12]"	"0.000424091"	"0.000586377"	"1"	"2"	"4"	"Q3B7Z2"	"Q3B7Z2 [755-772]"	"Q3B7Z2 1xBiotin [K766]"	"Oxysterol-binding protein 1 [OS=Mus musculus]"	"1"	"2359.08119"	"0.23"	"-0.13"	"-9.97"	"-9.97"	"-9.97"	"-9.97"	"-9.97"	"194.8"	"227.7"	"177.4"	""	""	""	"13204.125"	"15436.3232421875"	"12027.4326171875"	""	""	""	""	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"787.03233"	"0.0001108"	"6.177E-06"	"2.75"	"50.17"
"25130"	"[K].TEWLDGKHVVFGK.[V]"	"1xBiotin [K7]"	"0.000976234"	"0.000586377"	"1"	"1"	"7"	"P17742"	"P17742 [119-131]"	"P17742 1xBiotin [K125]"	"peptidyl-prolyl cis-trans isomerase A [OS=Mus musculus]"	"1"	"1741.87304"	"0.21"	"0.71"	"-0.97"	"-2.86"	"0.30"	"0.09"	"-0.41"	"105.8"	"122.6"	"172.9"	"53.9"	"14.5"	"130.3"	"33654.265625"	"39018.1640625"	"55006.4765625"	"17166.625"	"4620.51171875"	"41461.79296875"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"3"	"581.29577"	"0.0001108"	"2.086E-05"	"3.26"	"47.35"
"25339"	"[R].TKAITEIYLTR.[L]"	"1xBiotin [K2]"	"0.00341697"	"0.000586377"	"1"	"1"	"1"	"B2RXS4"	"B2RXS4 [1618-1628]"	"B2RXS4 1xBiotin [K1619]"	"Plexin-B2 [OS=Mus musculus]"	"1"	"1534.82978"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"767.91869"	"0.0001108"	"0.0001307"	"2.61"	""
"25253"	"[K].TGSKSVDAAK.[L]"	"1xBiotin [K4]"	"0.000544939"	"0.000586377"	"1"	"1"	"13"	"Q61712"	"Q61712 [190-199]"	"Q61712 1xBiotin [K193]"	"DnaJ homolog subfamily C member 1 [OS=Mus musculus]"	"1"	"1189.58815"	"0.70"	"0.67"	"0.59"	"0.53"	"0.62"	"-0.08"	"-0.05"	"69.0"	"111.7"	"110.1"	"103.7"	"99.4"	"106.1"	"346545.71875"	"561075"	"553068.0625"	"520580.9375"	"498879.53125"	"532603.5625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"595.29770"	"0.0001108"	"8.963E-06"	"3.53"	"22.63"
"25238"	"[R].TGPPGPTAAYHKQVSLSHV.[-]"	"1xBiotin [K12]"	"0.00025239"	"0.000586377"	"1"	"1"	"6"	"Q9EQD0"	"Q9EQD0 [567-585]"	"Q9EQD0 1xBiotin [K578]"	"Frizzled-5 [OS=Mus musculus]"	"1"	"2173.08588"	"0.76"	"0.53"	"0.36"	"-0.60"	"0.69"	"-0.07"	"0.16"	"78.0"	"132.2"	"112.7"	"100.0"	"51.4"	"125.8"	"39335.546875"	"66681.203125"	"56877.46875"	"50438.1796875"	"25935.158203125"	"63450.54296875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"725.03308"	"0.0001108"	"2.899E-06"	"3.78"	"39.54"
"25223"	"[K].TGLLIAAGGGGAAKTGIK.[N]"	"1xBiotin [K14]"	"1.76371E-07"	"0.000586377"	"1"	"1"	"25"	"Q9WUQ2"	"Q9WUQ2 [25-42]"	"Q9WUQ2 1xBiotin [K38]"	"Prolactin regulatory element-binding protein [OS=Mus musculus]"	"1"	"1781.99421"	"0.16"	"-0.06"	"0.03"	"-0.43"	"0.30"	"0.14"	"0.37"	"98.8"	"110.6"	"94.5"	"100.9"	"73.3"	"122.0"	"826706.34375"	"925479.0625"	"790994.34375"	"844316.0625"	"613289.375"	"1020669.375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"891.50134"	"0.0001108"	"7.177E-11"	"6.21"	"43.75"
"1733"	"[R].ASSHSSQSQGGGSVTKK.[R]"	"1xBiotin [K]"	"0.000656717"	"0.000586377"	"1"	"3"	"7"	"P48678-1"	"P48678-1 [402-418]"	"P48678-1 1xBiotin [K]"	"Prelamin-A/C [OS=Mus musculus]"	"1"	"1858.87120"	"0.48"	"0.38"	"0.52"	"0.63"	"0.48"	"0.01"	"0.10"	"74.4"	"103.5"	"96.7"	"106.7"	"114.9"	"103.9"	"19358.408203125"	"26920.498046875"	"25153.759765625"	"27766.30859375"	"29882.978515625"	"27031.927734375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"620.29539"	"0.0001108"	"1.174E-05"	"3.60"	"16.85"
"25217"	"[R].TGKTSTWSGESK.[T]"	"1xBiotin [K3]"	"0.000511085"	"0.000586377"	"1"	"1"	"6"	"P09405"	"P09405 [476-487]"	"P09405 1xBiotin [K478]"	"Nucleolin [OS=Mus musculus]"	"1"	"1494.68932"	"0.17"	"-0.11"	"-0.09"	"0.16"	"0.28"	"0.11"	"0.39"	"94.9"	"106.8"	"87.9"	"89.3"	"106.1"	"115.0"	"17073.859375"	"19222.927734375"	"15810.1337890625"	"16077.3037109375"	"19098.595703125"	"20687.388671875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"747.84815"	"0.0001108"	"8.116E-06"	"3.12"	"29.88"
"25210"	"[K].TGKDVR.[K]"	"1xBiotin [K3]"	"0.110368"	"0.00731053"	"1"	"1"	"5"	"P20029"	"P20029 [275-280]"	"P20029 1xBiotin [K277]"	"78 kDa glucose-regulated protein [OS=Mus musculus]"	"1"	"901.45601"	"0.20"	"0.58"	"0.04"	"0.07"	"0.70"	"0.50"	"0.12"	"81.7"	"93.9"	"122.2"	"83.8"	"85.9"	"132.5"	"10341.13671875"	"11893.0703125"	"15476.275390625"	"10611.4365234375"	"10876.734375"	"16782.76171875"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"2"	"451.23160"	"0.001478"	"0.02246"	"1.76"	"21.49"
"1751"	"[K].ASTDKYAVFK.[G]"	"1xBiotin [K5]"	"0.00188624"	"0.000586377"	"1"	"2"	"6"	"Q5SV85"	"Q5SV85 [505-514]"	"Q5SV85 1xBiotin [K509]"	"Synergin gamma [OS=Mus musculus]"	"1"	"1355.66640"	"0.33"	"0.14"	"0.37"	"0.54"	"-0.03"	"-0.35"	"-0.16"	"84.7"	"106.2"	"93.2"	"109.5"	"123.1"	"83.2"	"31180.0859375"	"39084.015625"	"34290.65234375"	"40291.2421875"	"45309.0390625"	"30632.978515625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"678.33653"	"0.0001108"	"5.499E-05"	"2.97"	"41.12"
"1757"	"[R].ASTVAVTKEYSFLR.[T]"	"1xBiotin [K8]"	"0.000484956"	"0.000586377"	"1"	"2"	"6"	"P55937"	"P55937 [201-214]"	"P55937 1xBiotin [K208]"	"Golgin subfamily A member 3 [OS=Mus musculus]"	"1"	"1797.92038"	"0.29"	"0.46"	"0.30"	"-1.24"	"0.13"	"-0.16"	"-0.33"	"94.5"	"115.8"	"129.6"	"116.6"	"39.9"	"103.5"	"20102.490234375"	"24638.884765625"	"27567.4140625"	"24805.087890625"	"8489.814453125"	"22004.76171875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"899.46383"	"0.0001108"	"7.546E-06"	"4.02"	"48.46"
"25176"	"[K].TGAKTDCALHR.[I]"	"1xBiotin [K4]; 1xCarbamidomethyl [C7]"	"0.0130005"	"0.000586377"	"1"	"3"	"6"	"Q9DBR4-1"	"Q9DBR4-1 [239-249]"	"Q9DBR4-1 1xBiotin [K242]"	"Amyloid-beta A4 precursor protein-binding family B member 2 [OS=Mus musculus]"	"1"	"1455.68313"	"0.37"	"0.23"	"0.10"	"-0.27"	"0.27"	"-0.11"	"0.03"	"91.4"	"118.2"	"107.3"	"97.7"	"75.7"	"109.8"	"15211.765625"	"19678.7109375"	"17863.232421875"	"16266.740234375"	"12599.2353515625"	"18287.181640625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"485.89911"	"0.0001108"	"0.0009266"	"2.22"	"24.84"
"25175"	"[R].TGAGKSSLTLGLFR.[I]"	"1xBiotin [K5]"	"0.00557106"	"0.000586377"	"1"	"1"	"3"	"O35379"	"O35379 [1326-1339]"	"O35379 1xBiotin [K1330]"	"Multidrug resistance-associated protein 1 [OS=Mus musculus]"	"1"	"1633.87304"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"2"	"817.44061"	"0.0001108"	"0.0002664"	"3.19"	""
"1764"	"[K].ASVKLVNFQQSENTSANEK.[E]"	"1xBiotin [K4]"	"5.77206E-05"	"0.000586377"	"1"	"1"	"14"	"Q60664"	"Q60664 [174-192]"	"Q60664 1xBiotin [K177]"	"Lymphoid-restricted membrane protein [OS=Mus musculus]"	"1"	"2320.12378"	"0.15"	"0.08"	"0.30"	"-0.02"	"0.16"	"0.01"	"0.09"	"92.3"	"102.6"	"97.3"	"113.4"	"91.2"	"103.2"	"246259.4765625"	"273832.2578125"	"259623.1796875"	"302485.015625"	"243317.5546875"	"275408.90625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"1160.56488"	"0.0001108"	"3.369E-07"	"4.11"	"40.97"
"25171"	"[K].TFVSITPAEVGVLVGKDR.[S]"	"1xBiotin [K16]"	"0.00250948"	"0.000586377"	"1"	"1"	"5"	"P62962"	"P62962 [39-56]"	"P62962 1xBiotin [K54]"	"profilin-1 [OS=Mus musculus]"	"1"	"2114.13144"	"-0.55"	"-0.36"	"-9.97"	"-9.97"	"1.06"	"1.61"	"1.43"	"131.8"	"90.1"	"102.4"	""	""	"275.7"	"7141.88720703125"	"4881.63916015625"	"5550.56201171875"	""	""	"14936.125"	""	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"705.38219"	"0.0001108"	"8.305E-05"	"3.08"	"58.39"
"25164"	"[R].TFSPSKPAK.[S]"	"1xBiotin [K6]"	"0.0172571"	"0.000586377"	"1"	"1"	"8"	"Q8C1Y8"	"Q8C1Y8 [72-80]"	"Q8C1Y8 1xBiotin [K77]"	"vacuolar fusion protein CCZ1 homolog [OS=Mus musculus]"	"0"	"1188.60816"	"0.68"	"0.09"	"0.18"	"0.45"	"0.66"	"-0.01"	"0.58"	"77.5"	"124.0"	"82.2"	"88.0"	"105.5"	"122.8"	"39309.4453125"	"62880.171875"	"41701.03515625"	"44641.93359375"	"53513.79296875"	"62317.20703125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"594.80765"	"0.0001108"	"0.001399"	"1.89"	"30.50"
"25148"	"[R].TFIAIKPDGVQR.[G]"	"1xBiotin [K6]"	"0.00851453"	"0.000586377"	"1"	"2"	"4"	"Q01768"	"Q01768 [7-18]"	"Q01768 1xBiotin [K12]"	"nucleoside diphosphate kinase b [OS=Mus musculus]"	"0"	"1570.84101"	"-1.15"	"-0.50"	"-0.56"	"-1.37"	"-1.10"	"0.05"	"-0.60"	"162.8"	"73.2"	"115.0"	"110.1"	"63.0"	"75.9"	"21325.185546875"	"9596.0732421875"	"15069.4189453125"	"14423.2216796875"	"8248.0478515625"	"9945.49609375"	""	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"2"	"785.92458"	"0.0001108"	"0.0004948"	"2.74"	"44.16"
"19654"	"[R].NKVFASSAER.[H]"	"1xBiotin [K2]"	"0.00381664"	"0.000586377"	"1"	"2"	"9"	"Q8R570"	"Q8R570 [312-321]"	"Q8R570 1xBiotin [K313]"	"Synaptosomal-associated protein 47 [OS=Mus musculus]"	"1"	"1334.65215"	"0.62"	"0.08"	"0.29"	"0.21"	"0.34"	"-0.28"	"0.25"	"82.9"	"127.1"	"87.9"	"101.2"	"96.1"	"104.8"	"144635.984375"	"221662.1875"	"153353.515625"	"176491.375"	"167601.90625"	"182854.28125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"667.82969"	"0.0001108"	"0.0001538"	"2.70"	"32.63"
"25142"	"[R].TFFPKCSSLYEER.[Y]"	"1xBiotin [K5]; 1xCarbamidomethyl [C6]"	"0.00239521"	"0.000586377"	"1"	"1"	"6"	"Q3UH93"	"Q3UH93 [1358-1370]"	"Q3UH93 1xBiotin [K1362]"	"plexin-D1 [OS=Mus musculus]"	"1"	"1889.85607"	"0.26"	"-0.03"	"-0.34"	"-9.97"	"0.24"	"-0.02"	"0.27"	"116.5"	"139.4"	"114.4"	"91.7"	""	"138.0"	"12235.15234375"	"14644.517578125"	"12015.25390625"	"9636.853515625"	""	"14490.462890625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"945.43220"	"0.0001108"	"7.767E-05"	"2.25"	"46.96"
"1768"	"[R].ASVVSLMTWKPSK.[S]"	"1xBiotin [K10]; 1xOxidation [M7]"	"0.000278692"	"0.000586377"	"1"	"1"	"6"	"Q8VD58"	"Q8VD58 [268-280]"	"Q8VD58 1xBiotin [K277]"	"Protein EVI2B [OS=Mus musculus]"	"0"	"1675.85461"	"-0.08"	"-0.11"	"-0.33"	"-2.29"	"0.10"	"0.18"	"0.22"	"121.3"	"115.0"	"112.3"	"96.2"	"24.8"	"130.4"	"11927.4306640625"	"11305.7060546875"	"11034.822265625"	"9457.283203125"	"2436.97265625"	"12813.8310546875"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"2"	"838.43109"	"0.0001108"	"3.359E-06"	"2.76"	"45.84"
"1784"	"[R].ATDFIDQALAHKNGR.[V]"	"1xBiotin [K12]"	"2.0442E-05"	"0.000586377"	"1"	"1"	"7"	"Q9D7X3"	"Q9D7X3 [105-119]"	"Q9D7X3 1xBiotin [K116]"	"dual specificity protein phosphatase 3 [OS=Mus musculus]"	"1"	"1882.92284"	"0.79"	"0.30"	"0.15"	"-1.21"	"0.85"	"0.06"	"0.55"	"82.0"	"141.9"	"101.1"	"91.2"	"35.5"	"148.2"	"25969.76171875"	"44938.55859375"	"32000.912109375"	"28872.48828125"	"11255.296875"	"46936.76171875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"628.31246"	"0.0001108"	"7.417E-08"	"4.50"	"47.78"
"25343"	"[R].TKDDIIICEIGEVFK.[A]"	"1xBiotin [K2]; 1xCarbamidomethyl [C8]"	"0.00185355"	"0.000586377"	"1"	"1"	"4"	"Q8BGH2"	"Q8BGH2 [58-72]"	"Q8BGH2 1xBiotin [K59]"	"sorting and assembly machinery component 50 homolog [OS=Mus musculus]"	"1"	"2005.99731"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"2"	"1003.50218"	"0.0001108"	"5.358E-05"	"2.89"	""
"24814"	"[R].SVSLYYTGEKGQR.[Q]"	"1xBiotin [K10]"	"0.00291982"	"0.000586377"	"1"	"1"	"6"	"P09405"	"P09405 [460-472]"	"P09405 1xBiotin [K469]"	"Nucleolin [OS=Mus musculus]"	"1"	"1713.82648"	"-9.97"	"-9.97"	"-9.97"	"-0.18"	"-9.97"	""	""	"319.0"	""	""	""	"281.0"	""	"14203.5009765625"	""	""	""	"12510.7763671875"	""	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"857.41771"	"0.0001108"	"0.0001033"	"2.44"	"38.42"
"25796"	"[K].TPVTLKQR.[R]"	"1xBiotin [K6]"	"0.0103113"	"0.000586377"	"1"	"5"	"10"	"Q61029"	"Q61029 [207-214]"	"Q61029 1xBiotin [K212]"	"Lamina-associated polypeptide 2, isoforms beta/delta/epsilon/gamma [OS=Mus musculus]"	"1"	"1168.65069"	"0.05"	"0.24"	"-0.02"	"-0.17"	"0.18"	"0.13"	"-0.06"	"96.4"	"99.9"	"113.6"	"95.1"	"85.9"	"109.1"	"174448.84375"	"180710.1875"	"205660.515625"	"172176.296875"	"155485.421875"	"197386.625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"584.82886"	"0.0001108"	"0.0006584"	"3.03"	"31.60"
"25809"	"[R].TQGSAAPGSKDHLNEKPCAEAGSAR.[T]"	"1xBiotin [K10]; 1xCarbamidomethyl [C18]"	"7.59214E-05"	"0.000586377"	"1"	"1"	"9"	"Q8K1A5"	"Q8K1A5 [27-51]"	"Q8K1A5 1xBiotin [K36]"	"Transmembrane protein 41B [OS=Mus musculus]"	"1"	"2765.27299"	"0.52"	"0.28"	"-0.01"	"0.47"	"0.07"	"-0.45"	"-0.21"	"84.8"	"121.5"	"102.8"	"84.3"	"117.8"	"88.8"	"28246.43359375"	"40468.53515625"	"34244.625"	"28088.287109375"	"39242.646484375"	"29576.50390625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"4"	"692.07409"	"0.0001108"	"5.011E-07"	"3.45"	"25.68"
"26492"	"[R].VEPSHKSK.[I]"	"1xBiotin [K6]"	"0.0226234"	"0.00104877"	"1"	"3"	"22"	"O55143-1"	"O55143-1 [678-685]"	"O55143-1 1xBiotin [K683]"	"Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 [OS=Mus musculus]"	"1"	"1137.57210"	"0.71"	"0.86"	"0.57"	"0.71"	"1.00"	"0.29"	"0.14"	"62.7"	"102.3"	"114.0"	"93.3"	"102.5"	"125.2"	"77187.99609375"	"125870.76953125"	"140321.953125"	"114753.2890625"	"126103.1015625"	"154087.578125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"569.28956"	"0.0001873"	"0.002084"	"1.79"	"15.02"
"802"	"[R].AKTPVTLK.[Q]"	"1xBiotin [K2]"	"0.015286"	"0.000586377"	"1"	"5"	"9"	"Q61029"	"Q61029 [205-212]"	"Q61029 1xBiotin [K206]"	"Lamina-associated polypeptide 2, isoforms beta/delta/epsilon/gamma [OS=Mus musculus]"	"1"	"1083.62308"	"0.10"	"0.34"	"0.33"	"0.36"	"0.13"	"0.03"	"-0.21"	"86.0"	"92.3"	"109.1"	"107.9"	"110.6"	"94.1"	"283003.40625"	"303470.46875"	"358861.75"	"354763.5"	"363884.40625"	"309456.3125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"542.31523"	"0.0001108"	"0.001169"	"2.70"	"32.97"
"809"	"[K].AKVPAKK.[A]"	"1xBiotin [K]"	"0.0558919"	"0.0019826"	"1"	"1"	"7"	"Q9CR57"	"Q9CR57 [161-167]"	"Q9CR57 1xBiotin [K]"	"60S ribosomal protein L14 [OS=Mus musculus]"	"2"	"967.57573"	"0.65"	"0.32"	"0.47"	"1.14"	"0.77"	"0.12"	"0.46"	"65.9"	"103.5"	"82.0"	"91.0"	"145.0"	"112.6"	"16507.47265625"	"25939.36328125"	"20551.62109375"	"22806.31640625"	"36341.94921875"	"28207.916015625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"484.29124"	"0.0003442"	"0.008007"	"2.26"	"19.13"
"26456"	"[R].VEKLKPVPIAR.[E]"	"1xBiotin [K3]"	"0.00749337"	"0.000586377"	"1"	"1"	"6"	"P24452"	"P24452 [26-36]"	"P24452 1xBiotin [K28]"	"Macrophage-capping protein [OS=Mus musculus]"	"1"	"1475.87667"	"0.63"	"0.58"	"0.78"	"0.18"	"-9.97"	"-9.97"	"-9.97"	"87.1"	"135.1"	"129.9"	"149.5"	"98.5"	""	"18782.271484375"	"29129.03125"	"28018.7109375"	"32231.677734375"	"21237.396484375"	""	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"492.63038"	"0.0001108"	"0.0004125"	"2.45"	"35.46"
"26443"	"[R].VEENFLKLTHVQR.[Q]"	"1xBiotin [K7]"	"0.000166826"	"0.000586377"	"1"	"3"	"9"	"Q9D024"	"Q9D024 [413-425]"	"Q9D024 1xBiotin [K419]"	"Coiled-coil domain-containing protein 47 [OS=Mus musculus]"	"1"	"1838.95816"	"0.34"	"-0.17"	"-0.23"	"-1.13"	"0.41"	"0.07"	"0.58"	"103.6"	"131.4"	"92.1"	"88.0"	"47.2"	"137.7"	"66154.921875"	"83946.9453125"	"58837.6875"	"56231.140625"	"30149.703125"	"87987.7890625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"919.98295"	"0.0001108"	"1.588E-06"	"3.29"	"43.90"
"815"	"[K].ALAAAGYDVEKNNSR.[I]"	"1xBiotin [K11]"	"4.96002E-05"	"0.000586377"	"3"	"4"	"6"	"P43274; P15864; P43277"	"P43274 [65-79]; P15864 [65-79]; P43277 [66-80]"	"P43274 1xBiotin [K75]; P15864 1xBiotin [K75]; P43277 1xBiotin [K76]"	"Histone H1.4 [OS=Mus musculus];Histone H1.2 [OS=Mus musculus];Histone H1.3 [OS=Mus musculus]"	"1"	"1804.86466"	"9.97"	""	"9.97"	""	"9.97"	"0.09"	"9.97"	""	"176.6"	""	"235.5"	""	"187.9"	""	"15828.33984375"	""	"21109.279296875"	""	"16838.91015625"	"NotUnique"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"902.93613"	"0.0001108"	"2.705E-07"	"3.62"	"35.23"
"26425"	"[K].VEALTYKK.[A]"	"1xBiotin [K7]"	"0.0200481"	"0.000586377"	"1"	"1"	"4"	"Q9CY18"	"Q9CY18 [299-306]"	"Q9CY18 1xBiotin [K305]"	"sorting nexin-7 [OS=Mus musculus]"	"1"	"1177.62856"	"0.24"	"-0.11"	"0.54"	"0.22"	"-0.40"	"-0.63"	"-0.29"	"92.6"	"109.1"	"85.9"	"134.5"	"107.6"	"70.3"	"11321.3544921875"	"13337.6923828125"	"10495.150390625"	"16435.548828125"	"13154.9013671875"	"8589.787109375"	""	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"2"	"589.31782"	"0.0001108"	"0.001739"	"2.31"	"34.12"
"26419"	"[K].VEAKFINYVK.[N]"	"1xBiotin [K4]"	"0.00040951"	"0.000586377"	"1"	"1"	"6"	"Q61937"	"Q61937 [262-271]"	"Q61937 1xBiotin [K265]"	"Nucleophosmin [OS=Mus musculus]"	"1"	"1436.76063"	"0.06"	"0.09"	"-0.01"	"-0.81"	"-0.18"	"-0.24"	"-0.26"	"108.1"	"112.6"	"114.7"	"107.6"	"61.6"	"95.5"	"29831.796875"	"31075.56640625"	"31656.748046875"	"29690.07421875"	"17003.2109375"	"26368.287109375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"718.88412"	"0.0001108"	"5.909E-06"	"3.77"	"45.55"
"797"	"[K].AKTASLFEQR.[S]"	"1xBiotin [K2]"	"0.000676144"	"0.000586377"	"1"	"2"	"6"	"Q69ZN7-1"	"Q69ZN7-1 [1922-1931]"	"Q69ZN7-1 1xBiotin [K1923]"	"Myoferlin [OS=Mus musculus]"	"1"	"1376.69910"	"0.83"	"0.42"	"0.96"	"0.79"	"0.75"	"-0.07"	"0.33"	"63.4"	"112.3"	"84.8"	"123.0"	"109.6"	"106.9"	"38609.1953125"	"68422.7578125"	"51642.97265625"	"74932.328125"	"66757.8125"	"65113.28125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"688.85297"	"0.0001108"	"1.222E-05"	"2.79"	"39.00"
"26401"	"[K].VDPGETSVGTYPDKGR.[N]"	"1xBiotin [K14]"	"5.44022E-06"	"0.000586377"	"1"	"2"	"9"	"Q6P1H6-1"	"Q6P1H6-1 [696-711]"	"Q6P1H6-1 1xBiotin [K709]"	"ankyrin repeat and LEM domain-containing protein 2 [OS=Mus musculus]"	"1"	"1903.88545"	"0.51"	"0.04"	"0.86"	"0.65"	"0.07"	"-0.45"	"0.03"	"76.0"	"108.5"	"77.9"	"138.3"	"119.7"	"79.6"	"54909.1484375"	"78383.8046875"	"56295.84375"	"99928.6640625"	"86450.6640625"	"57521.45703125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"952.44638"	"0.0001108"	"1.073E-08"	"4.22"	"34.04"
"833"	"[K].AIAKGVGIISEGNETVEDIAAR.[L]"	"1xBiotin [K4]"	"5.73337E-06"	"0.000586377"	"1"	"3"	"11"	"Q8VDN2"	"Q8VDN2 [626-647]"	"Q8VDN2 1xBiotin [K629]"	"Sodium/potassium-transporting ATPase subunit alpha-1 [OS=Mus musculus]"	"1"	"2439.25480"	"0.07"	"-0.14"	"-0.94"	"-3.87"	"0.16"	"0.08"	"0.30"	"128.7"	"135.2"	"116.6"	"67.2"	"8.8"	"143.5"	"82485.9296875"	"86714.375"	"74775.57421875"	"43113.40625"	"5627.6640625"	"91973.828125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"813.75671"	"0.0001108"	"1.163E-08"	"5.53"	"52.07"
"26357"	"[K].VDCKGAGTNGLPTKGPTEVSDK.[K]"	"2xBiotin [K4; K14]; 1xCarbamidomethyl [C3]"	"0.00600852"	"0.000586377"	"1"	"1"	"5"	"Q91WE4"	"Q91WE4 [48-69]"	"Q91WE4 2xBiotin [K51; K61]"	"UPF0729 protein C18orf32 homolog [OS=Mus musculus]"	"2"	"2683.25243"	"0.42"	"0.44"	"0.13"	"-9.97"	"0.46"	"0.04"	"0.02"	"97.4"	"130.3"	"132.0"	"106.5"	""	"133.7"	"30974.841796875"	"41414.24609375"	"41974.41015625"	"33865.6796875"	""	"42493.94140625"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"895.08956"	"0.0001108"	"0.0002988"	"2.82"	"39.87"
"26356"	"[K].VDCKGAGTNGLPTK.[G]"	"1xBiotin [K4]; 1xCarbamidomethyl [C3]"	"2.57893E-06"	"0.000586377"	"1"	"1"	"22"	"Q91WE4"	"Q91WE4 [48-61]"	"Q91WE4 1xBiotin [K51]"	"UPF0729 protein C18orf32 homolog [OS=Mus musculus]"	"1"	"1643.78799"	"0.38"	"0.45"	"0.37"	"0.40"	"0.48"	"0.10"	"0.02"	"78.2"	"101.8"	"107.1"	"101.1"	"102.9"	"108.9"	"974639.34375"	"1269206.3203125"	"1335885.75"	"1260418.68359375"	"1282799.44287109"	"1358465.71875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"822.39808"	"0.0001108"	"3.607E-09"	"4.13"	"30.24"
"26310"	"[R].VAVEEVDEEGKFVR.[L]"	"1xBiotin [K11]"	"0.000220711"	"0.000586377"	"1"	"3"	"4"	"P48678-1"	"P48678-1 [440-453]"	"P48678-1 1xBiotin [K450]"	"Prelamin-A/C [OS=Mus musculus]"	"1"	"1831.88947"	""	""	"9.97"	"9.97"	""	""	""	""	""	""	"378.2"	"221.8"	""	""	""	""	"11868.521484375"	"6959.92724609375"	""	""	"High"	"High"	"Not Found"	"High"	"High"	"Not Found"	"High"	"2"	"916.44833"	"0.0001108"	"2.385E-06"	"3.11"	"42.39"
"26302"	"[R].VATAKDLR.[T]"	"1xBiotin [K5]"	"0.0522522"	"0.00154748"	"1"	"2"	"2"	"Q4FZC9-1"	"Q4FZC9-1 [830-837]"	"Q4FZC9-1 1xBiotin [K834]"	"Nesprin-3 [OS=Mus musculus]"	"1"	"1099.59284"	"0.30"	"-9.97"	"0.13"	"0.23"	"-0.21"	"-0.51"	"9.97"	"111.6"	"137.7"	""	"122.5"	"131.3"	"96.8"	"10172.4716796875"	"12553.865234375"	""	"11167.5634765625"	"11970.26171875"	"8818.39453125"	""	"High"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"2"	"550.30012"	"0.0002716"	"0.007224"	"1.95"	"29.81"
"26299"	"[K].VASDWMSNLGFKR.[R]"	"1xBiotin [K12]; 1xOxidation [M6]"	"0.000379615"	"0.000586377"	"1"	"2"	"5"	"Q9JL26"	"Q9JL26 [100-112]"	"Q9JL26 1xBiotin [K111]"	"formin-like protein 1 [OS=Mus musculus]"	"1"	"1752.81962"	"-0.63"	"-0.48"	"-1.25"	"-2.83"	"-0.14"	"0.49"	"0.34"	"156.6"	"101.1"	"112.4"	"66.0"	"22.0"	"141.9"	"46502.8984375"	"30030.3203125"	"33379.06640625"	"19607.09765625"	"6548.79345703125"	"42155.96875"	""	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"2"	"876.91282"	"0.0001108"	"5.268E-06"	"3.30"	"45.64"
"26298"	"[K].VASDWMSNLGFKR.[R]"	"1xBiotin [K12]"	"0.000101033"	"0.000586377"	"1"	"2"	"4"	"Q9JL26"	"Q9JL26 [100-112]"	"Q9JL26 1xBiotin [K111]"	"formin-like protein 1 [OS=Mus musculus]"	"1"	"1736.82471"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"2"	"868.91603"	"0.0001108"	"7.639E-07"	"3.02"	""
"26278"	"[R].VAPEEHPVLLTEAPLNPKANR.[E]"	"1xBiotin [K18]"	"4.08806E-06"	"0.000586377"	"1"	"2"	"9"	"P60710"	"P60710 [96-116]"	"P60710 1xBiotin [K113]"	"Actin, cytoplasmic 1 [OS=Mus musculus]"	"1"	"2521.32315"	"0.01"	"0.07"	"-0.07"	"-1.78"	"0.11"	"0.10"	"0.04"	"111.6"	"112.5"	"117.0"	"106.2"	"32.4"	"120.3"	"112252.7734375"	"113114.3359375"	"117653.1328125"	"106871.5078125"	"32631.2109375"	"120987.96875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"841.11257"	"0.0001108"	"7.059E-09"	"4.80"	"44.26"
"26383"	"[R].VDKSAVGFNEMEAPTTAYK.[K]"	"1xBiotin [K3]; 1xOxidation [M11]"	"0.00918183"	"0.000586377"	"1"	"1"	"4"	"P49710"	"P49710 [205-223]"	"P49710 1xBiotin [K207]"	"Hematopoietic lineage cell-specific protein [OS=Mus musculus]"	"1"	"2300.05735"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"2"	"1150.53240"	"0.0001108"	"0.0005534"	"1.78"	""
"793"	"[K].AKSPSSDSWTCADASTGR.[R]"	"1xBiotin [K2]; 1xCarbamidomethyl [C11]"	"3.129E-05"	"0.000586377"	"1"	"2"	"12"	"Q9EPJ9"	"Q9EPJ9 [340-357]"	"Q9EPJ9 1xBiotin [K341]"	"ADP-ribosylation factor GTPase-activating protein 1 [OS=Mus musculus]"	"1"	"2109.89643"	"9.97"	""	""	"9.97"	""	"-9.97"	""	""	"401.4"	""	""	"198.6"	""	""	"40622.591796875"	""	""	"20101.263671875"	""	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"1055.45281"	"0.0001108"	"1.379E-07"	"3.90"	"33.71"
"790"	"[K].AKSIIPNK.[V]"	"1xBiotin [K2]"	"0.0308326"	"0.00104877"	"1"	"1"	"1"	"P70261"	"P70261 [51-58]"	"P70261 1xBiotin [K52]"	"paladin [OS=Mus musculus]"	"1"	"1096.61833"	"0.28"	"0.06"	"0.91"	"0.24"	"0.44"	"0.16"	"0.38"	"78.2"	"95.2"	"81.5"	"146.6"	"92.4"	"106.1"	"14461.2626953125"	"17614.62109375"	"15067.134765625"	"27114.9921875"	"17090.42578125"	"19626.904296875"	""	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"2"	"548.81265"	"0.0001873"	"0.003292"	"2.34"	"34.13"
"762"	"[K].AKMQASIEK.[G]"	"1xBiotin [K2]; 1xOxidation [M3]"	"0.0109268"	"0.000586377"	"1"	"1"	"5"	"Q61937"	"Q61937 [247-255]"	"Q61937 1xBiotin [K248]"	"Nucleophosmin [OS=Mus musculus]"	"1"	"1247.61226"	"-9.97"	"-0.20"	"-0.16"	"-9.97"	"-9.97"	""	"-9.97"	"216.9"	""	"189.3"	"193.8"	""	""	"27149.541015625"	""	"23695.708984375"	"24258.62890625"	""	""	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"2"	"624.31004"	"0.0001108"	"0.0007181"	"2.20"	"23.50"
"26647"	"[K].VGVNGFGR.[I]"	""	"0.0502349"	"0.00154748"	"1"	"1"	"3"	"P16858"	"P16858 [4-11]"	""	"glyceraldehyde-3-phosphate dehydrogenase [OS=Mus musculus]"	"0"	"805.43151"	"0.25"	"0.33"	"0.73"	"0.26"	"0.44"	"0.19"	"0.11"	"78.4"	"93.0"	"98.5"	"130.2"	"93.8"	"106.1"	"31313.232421875"	"37169.12109375"	"39368.65625"	"52026.1875"	"37487.7109375"	"42405.5078125"	""	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"2"	"403.21925"	"0.0002716"	"0.006806"	"1.51"	"24.81"
"740"	"[K].AKKPAAAAGAK.[K]"	"1xBiotin [K2]"	"0.0161952"	"0.000586377"	"2"	"2"	"6"	"P43274; P43277"	"P43274 [158-168]; P43277 [159-169]"	"P43274 1xBiotin [K159]; P43277 1xBiotin [K160]"	"Histone H1.4 [OS=Mus musculus];Histone H1.3 [OS=Mus musculus]"	"1"	"1209.67724"	"0.74"	"0.56"	"0.49"	"0.57"	"0.65"	"-0.09"	"0.09"	"69.7"	"116.6"	"102.9"	"97.8"	"103.7"	"109.4"	"40897.1391601563"	"68459.765625"	"60383.8515625"	"57402.45703125"	"60859.3017578125"	"64244.0546875"	"NotUnique"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"2"	"605.34282"	"0.0001108"	"0.001271"	"1.91"	"16.42"
"26612"	"[R].VGKVEHGSVALPAIMR.[S]"	"1xBiotin [K3]; 1xOxidation [M15]"	"0.00164004"	"0.000586377"	"1"	"1"	"1"	"P26039"	"P26039 [439-454]"	"P26039 1xBiotin [K441]"	"Talin-1 [OS=Mus musculus]"	"1"	"1906.00373"	"-0.09"	"-9.97"	"-9.97"	"-9.97"	"0.79"	"0.87"	"9.97"	"163.7"	"154.0"	""	""	""	"282.3"	"15087.03515625"	"14190.0810546875"	""	""	""	"26012.5078125"	""	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"3"	"636.00562"	"0.0001108"	"4.459E-05"	"3.87"	"38.30"
"26603"	"[R].VGKDNFWAK.[A]"	"1xBiotin [K3]"	"0.00258365"	"0.000586377"	"1"	"3"	"6"	"Q62418"	"Q62418 [174-182]"	"Q62418 1xBiotin [K176]"	"Drebrin-like protein [OS=Mus musculus]"	"1"	"1290.62995"	"0.13"	"0.34"	"-0.22"	"-0.65"	"0.19"	"0.06"	"-0.14"	"100.0"	"109.7"	"126.3"	"86.0"	"63.6"	"114.4"	"32765.43359375"	"35915.06640625"	"41364.38671875"	"28163.791015625"	"20839.841796875"	"37451.77734375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"645.81865"	"0.0001108"	"8.671E-05"	"2.84"	"42.20"
"745"	"[K].AKLEEDMLCLLYGKNR.[G]"	"1xBiotin [K14]; 1xCarbamidomethyl [C9]"	"0.00383893"	"0.000586377"	"1"	"2"	"2"	"Q3TNL8-1"	"Q3TNL8-1 [259-274]"	"Q3TNL8-1 1xBiotin [K272]"	"Inositol 1,4,5-trisphosphate receptor-interacting protein [OS=Mus musculus]"	"2"	"2179.07083"	""	"9.97"	""	""	""	""	"-9.97"	""	""	"600.0"	""	""	""	""	""	"8540.66796875"	""	""	""	""	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"3"	"727.02838"	"0.0001108"	"0.0001542"	"2.99"	"55.38"
"26584"	"[K].VGEFSGANKEK.[L]"	"1xBiotin [K]"	"0.00172836"	"0.000586377"	"1"	"1"	"6"	"P10639"	"P10639 [86-96]"	"P10639 1xBiotin [K]"	"thioredoxin [OS=Mus musculus]"	"1"	"1391.66238"	"0.47"	"-0.46"	"0.12"	"0.10"	"0.41"	"-0.06"	"0.87"	"90.8"	"126.3"	"66.0"	"98.4"	"97.4"	"121.0"	"14987.412109375"	"20831.2734375"	"10896.62890625"	"16233.6748046875"	"16073.6240234375"	"19967.173828125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"696.33442"	"0.0001108"	"4.823E-05"	"2.85"	"30.29"
"26582"	"[R].VGDVQGQELESQLPTKIILTGQK.[T]"	"1xBiotin [K]"	"0.00243744"	"0.000586377"	"1"	"2"	"5"	"Q8CDG3"	"Q8CDG3 [675-697]"	"Q8CDG3 1xBiotin [K]"	"Deubiquitinating protein VCIP135 [OS=Mus musculus]"	"1"	"2707.43349"	""	"9.97"	"9.97"	""	"9.97"	"9.97"	"0.58"	""	""	"201.5"	"97.5"	""	"301.0"	""	""	"17953.7578125"	"8683.0595703125"	""	"26822.67578125"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"903.14830"	"0.0001108"	"7.953E-05"	"4.22"	"53.38"
"26577"	"[R].VGDGSPVLPDKR.[N]"	"1xBiotin [K11]"	"0.000111562"	"0.000586377"	"1"	"1"	"16"	"Q8BH07"	"Q8BH07 [76-87]"	"Q8BH07 1xBiotin [K86]"	"ADP-ribosylation factor-like protein 6-interacting protein 6 [OS=Mus musculus]"	"1"	"1465.74677"	"0.62"	"0.41"	"0.53"	"0.89"	"0.77"	"0.15"	"0.36"	"67.8"	"103.9"	"89.8"	"97.9"	"125.3"	"115.4"	"185914.21875"	"284903.96875"	"246229.078125"	"268311.875"	"343498.53125"	"316313.1875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"733.37738"	"0.0001108"	"8.794E-07"	"3.31"	"36.74"
"26565"	"[K].VFVVKGLSSSSR.[R]"	"1xBiotin [K5]"	"0.000114863"	"0.000586377"	"1"	"1"	"6"	"D3Z6Q9"	"D3Z6Q9 [246-257]"	"D3Z6Q9 1xBiotin [K250]"	"Bridging integrator 2 [OS=Mus musculus]"	"1"	"1491.79881"	"0.27"	"0.24"	"0.31"	"-0.05"	"0.47"	"0.20"	"0.24"	"85.9"	"103.7"	"101.4"	"106.3"	"83.2"	"119.4"	"31479.697265625"	"37994.62890625"	"37128.12890625"	"38936.5"	"30484.65234375"	"43752.10546875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"746.40298"	"0.0001108"	"9.221E-07"	"3.10"	"43.14"
"26564"	"[K].VFVSVTKYPDEK.[R]"	"1xBiotin [K7]"	"0.00368563"	"0.000586377"	"1"	"2"	"6"	"Q9D6K9"	"Q9D6K9 [95-106]"	"Q9D6K9 1xBiotin [K101]"	"Ceramide synthase 5 [OS=Mus musculus]"	"1"	"1637.82436"	"0.35"	"-0.11"	"-0.22"	"-0.36"	"0.21"	"-0.13"	"0.33"	"100.1"	"127.3"	"92.4"	"85.8"	"78.2"	"116.1"	"14440.8037109375"	"18365.986328125"	"13336.5625"	"12386.1982421875"	"11282.115234375"	"16757.458984375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"819.41566"	"0.0001108"	"0.0001461"	"2.79"	"41.54"
"26561"	"[K].VFVEKSR.[R]"	"1xBiotin [K5]"	"0.0469494"	"0.00154748"	"1"	"3"	"5"	"Q3V0J1-1"	"Q3V0J1-1 [201-207]"	"Q3V0J1-1 1xBiotin [K205]"	"transmembrane protein 237 [OS=Mus musculus]"	"1"	"1090.57138"	"0.63"	"0.61"	"0.45"	"0.36"	"0.67"	"0.05"	"0.07"	"72.1"	"111.6"	"109.9"	"98.6"	"92.7"	"115.1"	"67135.3515625"	"103823.2734375"	"102271.296875"	"91773.234375"	"86232.2578125"	"107119.3828125"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"2"	"545.78922"	"0.0002716"	"0.006137"	"2.10"	"32.34"
"746"	"[K].AKLEEDMLCLLYGKNR.[G]"	"1xBiotin [K14]; 1xCarbamidomethyl [C9]; 1xOxidation [M7]"	"0.000243712"	"0.000586377"	"1"	"2"	"5"	"Q3TNL8-1"	"Q3TNL8-1 [259-274]"	"Q3TNL8-1 1xBiotin [K272]"	"Inositol 1,4,5-trisphosphate receptor-interacting protein [OS=Mus musculus]"	"2"	"2195.06574"	"-0.21"	"0.22"	"-0.49"	"-9.97"	"0.03"	"0.25"	"-0.19"	"126.1"	"108.7"	"146.9"	"89.5"	""	"128.9"	"74080.875"	"63852.6953125"	"86290.171875"	"52567.0390625"	""	"75733.4921875"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"732.36022"	"0.0001108"	"2.767E-06"	"3.95"	"44.93"
"26559"	"[R].VFSWGFGGYGR.[L]"	""	"0.00291982"	"0.000586377"	"1"	"1"	"13"	"Q8BK67"	"Q8BK67 [349-359]"	""	"Protein RCC2 [OS=Mus musculus]"	"0"	"1232.58472"	"0.08"	"0.04"	"-0.10"	"-2.53"	"-0.02"	"-0.09"	"-0.05"	"115.9"	"122.3"	"119.0"	"108.1"	"20.1"	"114.6"	"444560.84375"	"469052.71875"	"456415.46875"	"414568.3125"	"77036.484375"	"439566.03125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"616.79583"	"0.0001108"	"0.000104"	"3.02"	"48.41"
"26557"	"[R].VFSKFPIK.[D]"	"1xBiotin [K4]"	"0.0109903"	"0.000586377"	"1"	"3"	"6"	"P06800"	"P06800 [650-657]"	"P06800 1xBiotin [K653]"	"Receptor-type tyrosine-protein phosphatase C [OS=Mus musculus]"	"1"	"1191.65946"	"0.36"	"0.05"	"0.35"	"-2.12"	"0.29"	"-0.07"	"0.24"	"99.3"	"127.3"	"102.9"	"126.3"	"22.9"	"121.4"	"50871.19921875"	"65224.65234375"	"52704.00390625"	"64698.875"	"11723.6005859375"	"62232.93359375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"596.33313"	"0.0001108"	"0.000723"	"2.46"	"46.22"
"26549"	"[R].VFLWGSFR.[D]"	""	"0.0163833"	"0.000586377"	"1"	"1"	"6"	"Q8VE37"	"Q8VE37 [140-147]"	""	"Regulator of chromosome condensation [OS=Mus musculus]"	"0"	"1011.54106"	"0.06"	"0.05"	"-0.23"	"-2.79"	"-0.24"	"-0.30"	"-0.29"	"122.1"	"127.1"	"126.2"	"103.7"	"17.7"	"103.3"	"147833.375"	"153939.46875"	"152824.734375"	"125631.3046875"	"21382.796875"	"125096.5234375"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"2"	"506.27382"	"0.0001108"	"0.001294"	"2.51"	"51.09"
"26547"	"[R].VFLPNKQR.[T]"	"1xBiotin [K6]"	"0.0387264"	"0.00104877"	"1"	"3"	"6"	"P28028-1"	"P28028-1 [143-150]"	"P28028-1 1xBiotin [K148]"	"serine/threonine-protein kinase B-raf [OS=Mus musculus]"	"1"	"1227.66667"	"0.14"	"0.08"	"0.07"	"0.01"	"0.23"	"0.09"	"0.15"	"93.9"	"103.8"	"99.2"	"98.6"	"94.4"	"110.2"	"43789.9375"	"48384.98046875"	"46256.1015625"	"45956.5"	"44012.59375"	"51376.1796875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"614.33694"	"0.0001873"	"0.004627"	"1.52"	"37.27"
"754"	"[K].AKLVTLLTR.[E]"	"1xBiotin [K2]"	"0.00309491"	"0.000586377"	"1"	"1"	"6"	"Q9QZK7-1"	"Q9QZK7-1 [424-432]"	"Q9QZK7-1 1xBiotin [K425]"	"Docking protein 3 [OS=Mus musculus]"	"1"	"1240.74459"	"0.17"	"0.13"	"0.05"	"-1.56"	"0.31"	"0.14"	"0.18"	"102.8"	"115.9"	"112.4"	"106.4"	"34.9"	"127.6"	"72228.6328125"	"81466.875"	"79018.390625"	"74819.09375"	"24548.76953125"	"89691.15625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"620.87541"	"0.0001108"	"0.0001125"	"3.03"	"49.09"
"26535"	"[K].VFHGLKSTEVAK.[T]"	"1xBiotin [K6]"	"0.00020105"	"0.000586377"	"1"	"1"	"12"	"Q61233"	"Q61233 [77-88]"	"Q61233 1xBiotin [K82]"	"Plastin-2 [OS=Mus musculus]"	"1"	"1541.81446"	"0.65"	"0.25"	"0.52"	"0.43"	"0.50"	"-0.16"	"0.25"	"75.5"	"118.7"	"89.6"	"108.1"	"101.5"	"106.5"	"128928.7734375"	"202631.609375"	"152924.62890625"	"184475.28125"	"173305.69921875"	"181831.73046875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"771.41128"	"0.0001108"	"2.079E-06"	"4.57"	"33.48"
"26534"	"[K].VFGWVHR.[L]"	""	"0.0584513"	"0.0019826"	"1"	"1"	"6"	"Q8BP47"	"Q8BP47 [141-147]"	""	"Asparagine--tRNA ligase, cytoplasmic [OS=Mus musculus]"	"0"	"900.48388"	"0.35"	"0.19"	"0.19"	"0.87"	"0.01"	"-0.33"	"-0.18"	"81.2"	"103.3"	"92.5"	"92.4"	"148.6"	"82.0"	"18283.09765625"	"23275.4609375"	"20847.974609375"	"20825.5546875"	"33464.4765625"	"18465.666015625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"450.74540"	"0.0003442"	"0.008583"	"1.76"	"31.85"
"26277"	"[K].VAPAPAVVKK.[Q]"	"1xBiotin [K]"	"0.0100749"	"0.000586377"	"1"	"1"	"6"	"P12970"	"P12970 [12-21]"	"P12970 1xBiotin [K]"	"60S ribosomal protein L7a [OS=Mus musculus]"	"1"	"1205.70748"	""	""	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	""	""	""	"223.2"	"204.6"	"172.2"	""	""	""	"12465.6630859375"	"11429.12109375"	"9615.4677734375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"603.35787"	"0.0001108"	"0.0006328"	"2.12"	"30.86"
"25804"	"[R].TQCNSLAPVSKSSLGR.[S]"	"1xBiotin [K11]; 1xCarbamidomethyl [C3]"	"0.00573543"	"0.000586377"	"1"	"1"	"5"	"Q7TPN9"	"Q7TPN9 [344-359]"	"Q7TPN9 1xBiotin [K354]"	"Proline-rich protein 14 [OS=Mus musculus]"	"1"	"1930.94734"	"-9.97"	"1.00"	"0.83"	"0.51"	"-9.97"	""	"-9.97"	"97.0"	""	"193.3"	"171.8"	"137.9"	""	"9362.1875"	""	"18660.841796875"	"16592.875"	"13319.13671875"	""	""	"High"	"Not Found"	"High"	"High"	"High"	"Not Found"	"High"	"2"	"965.97722"	"0.0001108"	"0.0002784"	"3.33"	"38.81"
"26276"	"[K].VAPAPARPSGPSKALK.[L]"	"1xBiotin [K13]"	"0.000424091"	"0.000586377"	"1"	"1"	"10"	"Q5XJY5"	"Q5XJY5 [212-227]"	"Q5XJY5 1xBiotin [K224]"	"Coatomer subunit delta [OS=Mus musculus]"	"1"	"1772.98398"	"0.32"	"0.24"	"0.32"	"-0.05"	"0.31"	"-0.02"	"0.07"	"87.2"	"109.1"	"102.8"	"108.8"	"84.1"	"107.9"	"119811.505859375"	"149932.23828125"	"141282.107421875"	"149521.80078125"	"115545.8515625"	"148231.428710938"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"591.66604"	"0.0001108"	"6.208E-06"	"3.61"	"28.99"
"882"	"[K].AIEKFIR.[Q]"	"1xBiotin [K4]"	"0.0604437"	"0.0019826"	"1"	"2"	"4"	"Q99KU6"	"Q99KU6 [34-40]"	"Q99KU6 1xBiotin [K37]"	"Bombesin receptor-activated protein C6orf89 homolog [OS=Mus musculus]"	"1"	"1102.60776"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"0.68"	"0.45"	""	"100.9"	"118.6"	"129.2"	"89.4"	"161.9"	""	"16572.884765625"	"19493.73828125"	"21233.2265625"	"14687.107421875"	"26606.125"	""	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"2"	"551.80749"	"0.0003442"	"0.009011"	"1.69"	"41.38"
"26009"	"[K].TTKESLAQTSSSITESLMGISR.[M]"	"1xBiotin [K3]; 1xOxidation [M18]"	"0.0161952"	"0.000586377"	"1"	"1"	"2"	"Q6QD59"	"Q6QD59 [126-147]"	"Q6QD59 1xBiotin [K128]"	"Vesicle transport protein SEC20 [OS=Mus musculus]"	"1"	"2569.24839"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"3"	"857.08827"	"0.0001108"	"0.001273"	"2.84"	""
"26008"	"[R].TTKDGWVYYANHTEEK.[T]"	"1xBiotin [K3]"	"1.59082E-05"	"0.000586377"	"1"	"4"	"27"	"Q91WL8"	"Q91WL8 [26-41]"	"Q91WL8 1xBiotin [K28]"	"WW domain-containing oxidoreductase [OS=Mus musculus]"	"1"	"2167.97533"	"0.11"	"-0.07"	"-0.64"	"-0.79"	"-0.24"	"-0.35"	"-0.17"	"117.7"	"126.6"	"112.2"	"75.7"	"68.0"	"99.7"	"457137.849609375"	"491697.87109375"	"435809.525390625"	"293792.5625"	"264144.63671875"	"386934.84375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"723.33021"	"0.0001108"	"5.132E-08"	"4.07"	"39.92"
"26007"	"[K].TTKAFLPR.[M]"	"1xBiotin [K3]"	"0.017059"	"0.000586377"	"1"	"1"	"6"	"O88876-2"	"O88876-2 [88-95]"	"O88876-2 1xBiotin [K90]"	"Isoform 2 of Short-chain dehydrogenase/reductase 3 [OS=Mus musculus]"	"1"	"1159.62923"	"0.91"	"0.06"	"0.56"	"0.06"	"-0.87"	"-1.78"	"-0.93"	"85.9"	"161.3"	"89.4"	"126.8"	"89.6"	"47.0"	"13169.087890625"	"24727.943359375"	"13699.7734375"	"19442.822265625"	"13739.853515625"	"7201.173828125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"580.31818"	"0.0001108"	"0.00138"	"2.15"	"39.52"
"1202"	"[R].AMTKDNNLLGK.[F]"	"1xBiotin [K4]; 1xOxidation [M2]"	"0.00066442"	"0.000586377"	"1"	"2"	"6"	"P63017"	"P63017 [448-458]"	"P63017 1xBiotin [K451]"	"Heat shock cognate 71 kDa protein [OS=Mus musculus]"	"1"	"1446.70795"	"9.97"	""	"9.97"	""	"9.97"	"-0.16"	"9.97"	""	"191.5"	""	"237.5"	""	"171.0"	""	"23434.37109375"	""	"29052.126953125"	""	"20918.3515625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"723.85734"	"0.0001108"	"1.195E-05"	"3.06"	"33.74"
"25962"	"[K].TSSLVLEKCSLSALVSK.[E]"	"1xBiotin [K8]; 1xCarbamidomethyl [C9]"	"0.000320556"	"0.000586377"	"1"	"1"	"4"	"Q6ZPJ0"	"Q6ZPJ0 [395-411]"	"Q6ZPJ0 1xBiotin [K402]"	"Testis-expressed protein 2 [OS=Mus musculus]"	"1"	"2048.07662"	"9.97"	""	""	""	""	"-9.97"	""	""	"600.0"	""	""	""	""	""	"21932.79296875"	""	""	""	""	""	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"2"	"1024.54293"	"0.0001108"	"4.134E-06"	"3.74"	"55.54"
"1235"	"[R].ANGCVKNGEVR.[N]"	"1xBiotin [K6]; 1xCarbamidomethyl [C4]"	"0.00104697"	"0.000586377"	"1"	"1"	"9"	"P97363"	"P97363 [16-26]"	"P97363 1xBiotin [K21]"	"Serine palmitoyltransferase 2 [OS=Mus musculus]"	"1"	"1429.66748"	"0.40"	"0.13"	"0.55"	"0.50"	"0.56"	"0.16"	"0.43"	"77.1"	"102.0"	"84.7"	"113.1"	"109.3"	"113.7"	"41452.99609375"	"54824.26171875"	"45508.48828125"	"60786.22265625"	"58756.12890625"	"61098.45703125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"715.33697"	"0.0001108"	"2.312E-05"	"2.89"	"25.23"
"1262"	"[K].ANLTCKLAIDNLEK.[A]"	"1xBiotin [K6]; 1xCarbamidomethyl [C5]"	"3.37544E-05"	"0.000586377"	"1"	"1"	"6"	"Q6QD59"	"Q6QD59 [98-111]"	"Q6QD59 1xBiotin [K103]"	"Vesicle transport protein SEC20 [OS=Mus musculus]"	"1"	"1828.92957"	"0.17"	"0.43"	"-0.10"	"-1.42"	"0.35"	"0.18"	"-0.08"	"99.3"	"111.4"	"133.4"	"92.5"	"37.2"	"126.2"	"40297.203125"	"45203.39453125"	"54131.51953125"	"37530.25390625"	"15097.2666015625"	"51229.26171875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"914.96932"	"0.0001108"	"1.54E-07"	"4.90"	"48.41"
"25943"	"[K].TSPEFSQPLKK.[V]"	"1xBiotin [K]"	"0.000434099"	"0.000586377"	"1"	"1"	"17"	"Q8VBT0"	"Q8VBT0 [222-232]"	"Q8VBT0 1xBiotin [K]"	"Thioredoxin-related transmembrane protein 1 [OS=Mus musculus]"	"1"	"1487.75628"	"-0.16"	"-0.10"	"-0.07"	"0.03"	"-0.12"	"0.05"	"-0.02"	"104.8"	"93.6"	"97.9"	"99.9"	"107.2"	"96.6"	"1457290.765625"	"1302222.9140625"	"1361768.390625"	"1389743.8984375"	"1491785.890625"	"1343959.75"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"744.38223"	"0.0001108"	"6.393E-06"	"3.30"	"36.52"
"1194"	"[R].AMPSEFTSAKLR.[S]"	"1xBiotin [K10]; 1xOxidation [M2]"	"0.00107167"	"0.000586377"	"1"	"1"	"12"	"O88829"	"O88829 [27-38]"	"O88829 1xBiotin [K36]"	"Lactosylceramide alpha-2,3-sialyltransferase [OS=Mus musculus]"	"1"	"1579.76071"	"0.26"	"0.30"	"0.68"	"-0.61"	"0.36"	"0.10"	"0.06"	"86.0"	"102.9"	"106.2"	"137.9"	"56.5"	"110.5"	"95661.6328125"	"114418.953125"	"118034.1953125"	"153300.1875"	"62834.337890625"	"122799.1640625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"527.25827"	"0.0001108"	"2.404E-05"	"3.23"	"38.85"
"1267"	"[K].ANNLSSLSKK.[Y]"	"1xBiotin [K9]"	"0.00573543"	"0.000586377"	"1"	"1"	"6"	"O08547"	"O08547 [170-179]"	"O08547 1xBiotin [K178]"	"Vesicle-trafficking protein SEC22b [OS=Mus musculus]"	"1"	"1287.67255"	"0.51"	"0.36"	"0.60"	"0.72"	"0.71"	"0.20"	"0.35"	"70.6"	"100.4"	"90.7"	"106.9"	"116.0"	"115.4"	"31879.140625"	"45340.08984375"	"40967.0625"	"48301.6328125"	"52417.30078125"	"52113.0625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"644.34010"	"0.0001108"	"0.0002779"	"2.82"	"32.69"
"1268"	"[K].ANPFGGASHAKGIVLEK.[V]"	"1xBiotin [K11]"	"0.0271851"	"0.00104877"	"1"	"1"	"4"	"P62267"	"P62267 [38-54]"	"P62267 1xBiotin [K48]"	"40S ribosomal protein S23 [OS=Mus musculus]"	"1"	"1921.99528"	"9.97"	"9.97"	"9.97"	""	"9.97"	"-0.01"	"-0.33"	""	"146.5"	"183.6"	"124.1"	""	"145.8"	""	"14757.8359375"	"18489.697265625"	"12497.8466796875"	""	"14684.8564453125"	""	"High"	"High"	"High"	"High"	"Not Found"	"Peak Found"	"High"	"3"	"641.33691"	"0.0001873"	"0.002735"	"2.32"	"41.88"
"1281"	"[K].ANSWWLR.[H]"	""	"0.0543468"	"0.0019826"	"1"	"1"	"6"	"Q9CWJ9"	"Q9CWJ9 [462-468]"	""	"bifunctional purine biosynthesis protein purH [OS=Mus musculus]"	"0"	"932.47371"	"0.14"	"0.08"	"0.32"	"0.50"	"0.00"	"-0.14"	"-0.08"	"87.9"	"97.0"	"92.9"	"109.4"	"124.5"	"88.2"	"51423.515625"	"56745.765625"	"54335.59375"	"64007.53125"	"72837.3359375"	"51581.1171875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"466.74024"	"0.0003442"	"0.007657"	"2.30"	"41.25"
"1286"	"[R].ANVLNKVEYAQQR.[W]"	"1xBiotin [K6]"	"1.18847E-05"	"0.000586377"	"1"	"1"	"25"	"Q9JJR8"	"Q9JJR8 [167-179]"	"Q9JJR8 1xBiotin [K172]"	"transmembrane protein 9B [OS=Mus musculus]"	"1"	"1758.89556"	"0.24"	"-0.01"	"0.15"	"-0.43"	"0.04"	"-0.19"	"0.05"	"99.1"	"116.8"	"98.3"	"110.0"	"73.8"	"102.1"	"632571.125"	"745697"	"627665.34375"	"702158.484375"	"471085.390625"	"652030.703125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"879.95174"	"0.0001108"	"3.346E-08"	"4.29"	"43.60"
"1304"	"[K].APAQKAAGQK.[A]"	"1xBiotin [K5]"	"0.00155623"	"0.000586377"	"1"	"1"	"7"	"Q9CR57"	"Q9CR57 [180-189]"	"Q9CR57 1xBiotin [K184]"	"60S ribosomal protein L14 [OS=Mus musculus]"	"1"	"1195.62520"	"0.81"	"0.55"	"0.51"	"0.62"	"0.53"	"-0.28"	"-0.02"	"69.5"	"121.9"	"102.0"	"99.1"	"107.1"	"100.4"	"19818.818359375"	"34739.765625"	"29070.83203125"	"28245.58984375"	"30513.33203125"	"28619.78515625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"598.31625"	"0.0001108"	"4.12E-05"	"2.62"	"18.83"
"1323"	"[R].APFDLFENKK.[K]"	"1xBiotin [K]"	"0.00719476"	"0.000586377"	"1"	"1"	"4"	"P11499"	"P11499 [339-348]"	"P11499 1xBiotin [K]"	"Heat shock protein HSP 90-beta [OS=Mus musculus]"	"1"	"1434.70860"	""	"9.97"	""	"9.97"	""	""	"-9.97"	""	""	"424.6"	""	"175.4"	""	""	""	"10538.67578125"	""	"4354.93603515625"	""	""	"High"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"High"	"2"	"717.85806"	"0.0001108"	"0.0003882"	"2.34"	"50.40"
"1372"	"[R].APPNATLEHFYQTSGKQPK.[Q]"	"1xBiotin [K16]"	"0.00349748"	"0.000586377"	"1"	"1"	"3"	"Q924Z4"	"Q924Z4 [78-96]"	"Q924Z4 1xBiotin [K93]"	"Ceramide synthase 2 [OS=Mus musculus]"	"1"	"2340.14413"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"3"	"780.71945"	"0.0001108"	"0.000135"	"3.37"	""
"25827"	"[R].TQQEAAAKK.[F]"	"1xBiotin [K]"	"0.0267216"	"0.00104877"	"1"	"1"	"5"	"Q9D0F3"	"Q9D0F3 [507-515]"	"Q9D0F3 1xBiotin [K]"	"Protein ERGIC-53 [OS=Mus musculus]"	"1"	"1200.60413"	"0.91"	"0.85"	"0.89"	"1.17"	"0.67"	"-0.23"	"-0.18"	"57.8"	"108.4"	"104.4"	"107.5"	"129.8"	"92.1"	"7944.189453125"	"14885.6494140625"	"14336.69140625"	"14766.7431640625"	"17834.359375"	"12657.2275390625"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"2"	"600.80575"	"0.0001873"	"0.002675"	"2.20"	"18.28"
"1378"	"[K].APPSSVPKSR.[L]"	"1xBiotin [K8]"	"0.00723668"	"0.000586377"	"1"	"2"	"19"	"Q9JL26"	"Q9JL26 [191-200]"	"Q9JL26 1xBiotin [K198]"	"formin-like protein 1 [OS=Mus musculus]"	"1"	"1251.65142"	"0.44"	"0.35"	"0.24"	"0.19"	"0.50"	"0.06"	"0.15"	"81.4"	"110.7"	"103.8"	"96.1"	"92.5"	"115.4"	"23592.21484375"	"32106.55078125"	"30081.89453125"	"27872.24609375"	"26827.77734375"	"33468.40625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"626.32923"	"0.0001108"	"0.0003907"	"2.40"	"25.51"
"25925"	"[K].TSLFSPKLSTPNVSSPFGTPFGSSVVNR.[M]"	"1xBiotin [K7]"	"1.99528E-06"	"0.000586377"	"1"	"1"	"4"	"Q8VCB1"	"Q8VCB1 [430-457]"	"Q8VCB1 1xBiotin [K436]"	"Nucleoporin Ndc1 [OS=Mus musculus]"	"1"	"3136.57720"	"-0.16"	"-0.36"	"-9.97"	"-9.97"	"0.37"	"0.53"	"0.73"	"151.1"	"135.3"	"117.9"	""	""	"195.7"	"79226.3671875"	"70944.453125"	"61781.125"	""	""	"102566.421875"	""	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"1046.19721"	"0.0001108"	"2.488E-09"	"5.32"	"58.73"
"26022"	"[K].TTPLLSPVKAVPLGGSDGLK.[AD]"	"1xBiotin [K9]"	"3.31393E-06"	"0.000586377"	"1"	"4"	"30"	"Q6P1H6-1"	"Q6P1H6-1 [270-289]"	"Q6P1H6-1 1xBiotin [K278]"	"ankyrin repeat and LEM domain-containing protein 2 [OS=Mus musculus]"	"1"	"2176.20460"	"0.51"	"0.17"	"0.01"	"-3.06"	"0.42"	"-0.08"	"0.26"	"99.7"	"141.9"	"111.9"	"100.7"	"12.0"	"133.8"	"221364.53125"	"314839.09375"	"248241.53125"	"223567.578125"	"26574.029296875"	"296998.4765625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"1088.60608"	"0.0001108"	"5.186E-09"	"4.25"	"52.71"
"26038"	"[R].TTTGNKVFGALK.[G]"	"1xBiotin [K6]"	"0.00375057"	"0.000586377"	"1"	"1"	"3"	"P47962"	"P47962 [153-164]"	"P47962 1xBiotin [K158]"	"60S ribosomal protein L5 [OS=Mus musculus]"	"1"	"1462.77226"	"-9.97"	"-9.97"	"-9.97"	"-9.97"	"-9.97"	""	""	"600.0"	""	""	""	""	""	"11345.3662109375"	""	""	""	""	""	""	"High"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"High"	"2"	"731.89006"	"0.0001108"	"0.0001497"	"2.65"	"42.44"
"26041"	"[R].TTVQKSDHPS.[-]"	"1xBiotin [K5]"	"0.0291188"	"0.00104877"	"1"	"1"	"6"	"O88736"	"O88736 [325-334]"	"O88736 1xBiotin [K329]"	"3-keto-steroid reductase [OS=Mus musculus]"	"1"	"1325.61543"	"0.53"	"0.25"	"-0.22"	"0.34"	"0.04"	"-0.48"	"-0.20"	"88.4"	"127.6"	"104.8"	"76.0"	"112.0"	"91.2"	"19933.3671875"	"28761.931640625"	"23635.880859375"	"17127.1640625"	"25261.083984375"	"20559.98828125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"663.31168"	"0.0001873"	"0.003019"	"2.02"	"23.33"
"26242"	"[K].VAHSDKPGSTSAVSFR.[D]"	"1xBiotin [K6]"	"6.9844E-07"	"0.000586377"	"1"	"1"	"24"	"Q9WV55"	"Q9WV55 [206-221]"	"Q9WV55 1xBiotin [K211]"	"vesicle-associated membrane protein-associated protein A [OS=Mus musculus]"	"0"	"1871.90686"	"0.50"	"0.43"	"0.51"	"0.04"	"0.57"	"0.07"	"0.14"	"77.9"	"110.3"	"105.0"	"111.2"	"79.8"	"115.7"	"571295.0234375"	"809292.9296875"	"770281.46875"	"815910.8203125"	"585776.9140625"	"849083.453125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"936.45758"	"0.0001108"	"5.367E-10"	"3.88"	"32.38"
"26235"	"[R].VAGIFPCPTFKDK.[S]"	"1xBiotin [K11]; 1xCarbamidomethyl [C7]"	"0.00196477"	"0.000586377"	"1"	"1"	"7"	"Q8VBZ3"	"Q8VBZ3 [448-460]"	"Q8VBZ3 1xBiotin [K458]"	"cleft lip and palate transmembrane protein 1 homolog [OS=Mus musculus]"	"1"	"1705.84405"	"0.21"	"0.19"	"0.19"	"-0.94"	"0.35"	"0.14"	"0.16"	"96.2"	"111.1"	"109.9"	"110.1"	"50.2"	"122.6"	"27287.052734375"	"31491.072265625"	"31151.349609375"	"31221.984375"	"14229.7802734375"	"34761.02734375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"853.42591"	"0.0001108"	"5.809E-05"	"2.51"	"48.38"
"26230"	"[R].VAGGSGSESPLLKGR.[R]"	"1xBiotin [K13]"	"4.41003E-06"	"0.000586377"	"1"	"2"	"7"	"Q9Z1X2-1"	"Q9Z1X2-1 [8-22]"	"Q9Z1X2-1 1xBiotin [K20]"	"phosphatidylserine synthase 2 [OS=Mus musculus]"	"1"	"1640.84247"	"0.84"	"0.49"	"0.55"	"-0.35"	"0.47"	"-0.36"	"-0.01"	"76.6"	"137.1"	"107.4"	"112.2"	"60.2"	"106.5"	"28292.951171875"	"50613.75"	"39662.609375"	"41412.88671875"	"22206.345703125"	"39303.015625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"820.92427"	"0.0001108"	"7.919E-09"	"4.35"	"36.60"
"26203"	"[R].VAASGSPGKSSTHASVSPASEPSR.[M]"	"1xBiotin [K9]"	"6.86945E-06"	"0.000586377"	"1"	"2"	"12"	"Q3UPF5-1"	"Q3UPF5-1 [548-571]"	"Q3UPF5-1 1xBiotin [K556]"	"zinc finger CCCH-type antiviral protein 1 [OS=Mus musculus]"	"1"	"2480.18342"	"0.29"	"0.00"	"0.01"	"0.06"	"0.24"	"-0.04"	"0.24"	"92.9"	"113.5"	"93.2"	"93.6"	"96.8"	"110.1"	"59606.34765625"	"72766.3828125"	"59759.92578125"	"60008.02734375"	"62095.80859375"	"70584.2890625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"827.40016"	"0.0001108"	"1.514E-08"	"4.23"	"25.61"
"26186"	"[K].TYSECEDGTYSPEISWHHGKGSK.[G]"	"1xBiotin [K]; 1xCarbamidomethyl [C5]"	"2.478E-05"	"0.000586377"	"1"	"1"	"12"	"Q99LH2"	"Q99LH2 [415-437]"	"Q99LH2 1xBiotin [K]"	"phosphatidylserine synthase 1 [OS=Mus musculus]"	"1"	"2881.21922"	"0.45"	"0.10"	"-0.88"	"-2.55"	"0.21"	"-0.24"	"0.11"	"113.0"	"154.7"	"121.0"	"61.3"	"19.3"	"130.7"	"121631.9375"	"166425.3515625"	"130145.72265625"	"66006.7265625"	"20791.0546875"	"140584.75"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"961.07744"	"0.0001108"	"9.805E-08"	"4.61"	"35.10"
"26178"	"[K].TYKNAWADNANACAK.[Q]"	"1xBiotin [K3]; 1xCarbamidomethyl [C13]"	"5.38195E-05"	"0.000586377"	"1"	"1"	"6"	"Q9EP69"	"Q9EP69 [433-447]"	"Q9EP69 1xBiotin [K435]"	"Phosphatidylinositide phosphatase SAC1 [OS=Mus musculus]"	"1"	"1923.84763"	"0.73"	"0.16"	"0.39"	"-9.97"	"-9.97"	"-9.97"	"-9.97"	"118.1"	"195.5"	"132.0"	"154.5"	""	""	"22412.958984375"	"37115.64453125"	"25053.37890625"	"29331.69921875"	""	""	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"962.42720"	"0.0001108"	"3.041E-07"	"2.71"	"36.21"
"26175"	"[K].TYGEPESVGMSKSFR.[Q]"	"1xBiotin [K12]; 1xOxidation [M10]"	"2.26841E-06"	"0.000586377"	"1"	"1"	"59"	"O08579"	"O08579 [105-119]"	"O08579 1xBiotin [K116]"	"Emerin [OS=Mus musculus]"	"1"	"1916.85171"	"-0.07"	"-0.37"	"-0.05"	"-1.03"	"-0.06"	"0.01"	"0.31"	"116.6"	"111.4"	"90.1"	"112.7"	"57.0"	"112.1"	"2133686.14111328"	"2037642.76708984"	"1649238.88330078"	"2062641.35742188"	"1042730.70410156"	"2051161.40234375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"958.92937"	"0.0001108"	"2.993E-09"	"2.79"	"36.91"
"26174"	"[K].TYGEPESVGMSKSFR.[Q]"	"1xBiotin [K12]"	"2.13991E-06"	"0.000586377"	"1"	"1"	"19"	"O08579"	"O08579 [105-119]"	"O08579 1xBiotin [K116]"	"Emerin [OS=Mus musculus]"	"1"	"1900.85679"	"0.90"	"0.58"	"0.42"	"1.45"	"0.60"	"-0.30"	"0.02"	"60.3"	"112.3"	"90.3"	"80.7"	"165.1"	"91.3"	"249810.0859375"	"465183.8984375"	"373930.7890625"	"334481.0625"	"683965.046875"	"378089.6953125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"950.93232"	"0.0001108"	"2.757E-09"	"3.51"	"41.04"
"26144"	"[K].TVYLQSALSSSSSAEKFPSPHPSPAK.[L]"	"1xBiotin [K16]"	"1.8621E-05"	"0.000586377"	"1"	"1"	"7"	"Q61070"	"Q61070 [308-333]"	"Q61070 1xBiotin [K323]"	"Etoposide-induced protein 2.4 [OS=Mus musculus]"	"1"	"2929.44003"	"0.55"	"0.41"	"-0.29"	"-9.97"	"0.66"	"0.10"	"0.25"	"97.0"	"142.1"	"128.6"	"79.5"	""	"152.8"	"33039.30859375"	"48390.1640625"	"43780.78515625"	"27062.904296875"	""	"52026.3359375"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"977.15126"	"0.0001108"	"6.449E-08"	"5.13"	"43.86"
"26142"	"[K].TVYFFSPWR.[G]"	""	"0.0660763"	"0.0019826"	"1"	"1"	"5"	"P09581"	"P09581 [152-160]"	""	"Macrophage colony-stimulating factor 1 receptor [OS=Mus musculus]"	"0"	"1202.59931"	"0.35"	"0.32"	"-0.46"	"-9.97"	"0.33"	"-0.02"	"0.01"	"108.9"	"139.0"	"135.9"	"79.1"	""	"137.1"	"21638.529296875"	"27619.24609375"	"27007.46875"	"15725.96484375"	""	"27253.099609375"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"2"	"601.80353"	"0.0003442"	"0.01024"	"2.15"	"52.64"
"26130"	"[K].TVTKGPAVNGEQPLKV.[-]"	"1xBiotin [K4]"	"4.02077E-05"	"0.000586377"	"1"	"2"	"9"	"Q9DCC3-1"	"Q9DCC3-1 [227-242]"	"Q9DCC3-1 1xBiotin [K230]"	"Coiled-coil domain-containing protein 107 [OS=Mus musculus]"	"2"	"1863.99969"	"-1.76"	"0.15"	"-0.08"	"-0.18"	"0.35"	"2.10"	"0.19"	"109.0"	"32.3"	"121.3"	"102.8"	"96.2"	"138.5"	"67763.03515625"	"20063.205078125"	"75440.716796875"	"63908.93359375"	"59830.775390625"	"86115.685546875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"932.50398"	"0.0001108"	"1.985E-07"	"4.32"	"39.89"
"26127"	"[K].TVTAMDVVYALKR.[Q]"	"1xBiotin [K12]; 1xOxidation [M5]"	"0.000164891"	"0.000586377"	"1"	"1"	"11"	"P62806"	"P62806 [81-93]"	"P62806 1xBiotin [K92]"	"histone H4 [OS=Mus musculus]"	"1"	"1708.87607"	"-1.17"	"-0.13"	"-1.96"	"-9.97"	"-1.27"	"-0.09"	"-1.14"	"198.2"	"87.8"	"180.9"	"50.9"	""	"82.2"	"34963.9111328125"	"15489.5546875"	"31905.8393554688"	"8976.4853515625"	""	"14508.1564941406"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"2"	"854.94173"	"0.0001108"	"1.566E-06"	"3.56"	"52.69"
"1075"	"[R].AIRPEKQAPAAALGQDR.[Q]"	"1xBiotin [K6]"	"8.3759E-06"	"0.000586377"	"1"	"1"	"32"	"O08579"	"O08579 [206-222]"	"O08579 1xBiotin [K211]"	"Emerin [OS=Mus musculus]"	"1"	"2018.06000"	"0.56"	"0.25"	"0.45"	"0.55"	"0.45"	"-0.11"	"0.20"	"76.2"	"112.6"	"90.9"	"104.4"	"111.5"	"104.4"	"805621.5546875"	"1189551.19213867"	"960477.361328125"	"1103700.67871094"	"1178390.75830078"	"1103431.55761719"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"673.35779"	"0.0001108"	"2.02E-08"	"5.54"	"33.81"
"26110"	"[K].TVPKPIALEPCFGNK.[A]"	"1xBiotin [K4]; 1xCarbamidomethyl [C11]"	"0.00057096"	"0.000586377"	"1"	"1"	"10"	"Q9WU60"	"Q9WU60 [1350-1364]"	"Q9WU60 1xBiotin [K1353]"	"Attractin [OS=Mus musculus]"	"0"	"1896.97104"	"0.23"	"0.18"	"0.05"	"-1.00"	"0.03"	"-0.19"	"-0.15"	"102.4"	"119.7"	"115.8"	"106.2"	"51.2"	"104.6"	"48333.736328125"	"56502.919921875"	"54675.333984375"	"50117.029296875"	"24178.2333984375"	"49388.0478515625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"632.99489"	"0.0001108"	"9.554E-06"	"3.65"	"48.40"
"26109"	"[R].TVPFCSTFAAFFTR.[A]"	"1xCarbamidomethyl [C5]"	"0.00195335"	"0.000586377"	"1"	"1"	"1"	"P40142"	"P40142 [382-395]"	""	"Transketolase [OS=Mus musculus]"	"0"	"1651.79372"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"826.40006"	"0.0001108"	"5.787E-05"	"2.02"	""
"1097"	"[R].ALSTGEKGFGYK.[G]"	"1xBiotin [K7]"	"0.00126905"	"0.000586377"	"1"	"1"	"3"	"P17742"	"P17742 [38-49]"	"P17742 1xBiotin [K44]"	"peptidyl-prolyl cis-trans isomerase A [OS=Mus musculus]"	"1"	"1483.72498"	"0.23"	"-0.06"	"0.04"	"0.25"	"0.13"	"-0.09"	"0.19"	"93.1"	"109.0"	"89.4"	"95.8"	"110.6"	"102.1"	"51000.3515625"	"59694.32421875"	"48988.14453125"	"52463.31640625"	"60584.625"	"55955.6640625"	""	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"2"	"742.36660"	"0.0001108"	"3.058E-05"	"2.68"	"37.69"
"1162"	"[K].AMEAVAAQGKVK.[K]"	"1xBiotin [K10]; 1xOxidation [M2]"	"0.000637849"	"0.000586377"	"1"	"1"	"6"	"Q9DBJ1"	"Q9DBJ1 [242-253]"	"Q9DBJ1 1xBiotin [K251]"	"Phosphoglycerate mutase 1 [OS=Mus musculus]"	"1"	"1444.72868"	"0.43"	"0.11"	"-0.20"	"-0.97"	"0.11"	"-0.32"	"0.00"	"101.9"	"137.1"	"110.3"	"88.6"	"52.0"	"110.1"	"11285.67578125"	"15180.0009765625"	"12217.9794921875"	"9806.443359375"	"5760.25244140625"	"12188.42578125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"722.86809"	"0.0001108"	"1.121E-05"	"3.19"	"27.81"
"26055"	"[K].TVDGPSGKLWR.[D]"	"1xBiotin [K8]"	"0.00117644"	"0.000586377"	"1"	"1"	"7"	"P16858"	"P16858 [185-195]"	"P16858 1xBiotin [K192]"	"glyceraldehyde-3-phosphate dehydrogenase [OS=Mus musculus]"	"1"	"1441.72564"	"0.29"	"-0.15"	"-0.36"	"-0.25"	"0.12"	"-0.17"	"0.27"	"103.0"	"125.7"	"92.7"	"80.1"	"86.6"	"111.9"	"45099.85546875"	"55035.0546875"	"40601.84765625"	"35080.48828125"	"37906.0546875"	"49021.0234375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"721.36629"	"0.0001108"	"2.751E-05"	"2.80"	"41.63"
"26043"	"[K].TTVSGPSHSYQGSQDLSKLTQR.[R]"	"1xBiotin [K18]"	"1.97214E-06"	"0.000586377"	"1"	"2"	"6"	"Q5SS80-1"	"Q5SS80-1 [345-366]"	"Q5SS80-1 1xBiotin [K362]"	"Dehydrogenase/reductase SDR family member 13 [OS=Mus musculus]"	"1"	"2603.25184"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"0.06"	"0.37"	""	"139.7"	"112.6"	"128.4"	"73.3"	"146.0"	""	"41422.1171875"	"33406.5546875"	"38080.64453125"	"21751.955078125"	"43304.4921875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"868.42111"	"0.0001108"	"2.443E-09"	"6.25"	"37.39"
"26274"	"[K].VANLCGINQKLLAEALNQVTQR.[S]"	"1xBiotin [K10]; 1xCarbamidomethyl [C5]"	"0.000240886"	"0.000586377"	"1"	"2"	"2"	"P28867-1"	"P28867-1 [276-297]"	"P28867-1 1xBiotin [K285]"	"protein kinase C delta type [OS=Mus musculus]"	"1"	"2679.40690"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"3"	"893.80730"	"0.0001108"	"2.719E-06"	"4.51"	""
"19648"	"[K].NKTFDTLR.[N]"	"1xBiotin [K2]"	"0.0239615"	"0.00104877"	"1"	"1"	"6"	"Q8K273"	"Q8K273 [78-85]"	"Q8K273 1xBiotin [K79]"	"Membrane magnesium transporter 1 [OS=Mus musculus]"	"1"	"1220.60922"	"0.10"	"-0.04"	"-0.23"	"0.07"	"0.05"	"-0.06"	"0.09"	"100.3"	"107.8"	"97.5"	"85.7"	"105.2"	"103.6"	"77747.8984375"	"83561.8046875"	"75586.9453125"	"66391.140625"	"81501.8828125"	"80264.078125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"610.80813"	"0.0001873"	"0.002269"	"2.68"	"37.70"
"19266"	"[K].NATPYKDKQER.[I]"	"1xBiotin [K8]"	"0.00538001"	"0.000586377"	"1"	"1"	"22"	"Q3U9G9"	"Q3U9G9 [152-162]"	"Q3U9G9 1xBiotin [K159]"	"Lamin-B receptor [OS=Mus musculus]"	"2"	"1575.75840"	"0.21"	"0.26"	"0.34"	"0.70"	"0.26"	"0.05"	"0.00"	"80.6"	"93.3"	"96.3"	"102.2"	"131.2"	"96.3"	"183473.294921875"	"212354.935546875"	"219184.08984375"	"232553.240234375"	"298501.24609375"	"219101.958984375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"525.92437"	"0.0001108"	"0.0002536"	"3.41"	"22.25"
"19645"	"[K].NKSNVYSK.[I]"	"1xBiotin [K2]"	"0.00740682"	"0.000586377"	"1"	"1"	"7"	"Q91YX0"	"Q91YX0 [603-610]"	"Q91YX0 1xBiotin [K604]"	"protein THEMIS2 [OS=Mus musculus]"	"1"	"1165.56702"	"0.41"	"0.22"	"0.19"	"-0.01"	"0.01"	"-0.40"	"-0.21"	"90.3"	"120.3"	"105.5"	"103.3"	"89.6"	"91.0"	"45859.83984375"	"61091.5"	"53580.01171875"	"52448"	"45471.71875"	"46196.375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"583.28692"	"0.0001108"	"0.000405"	"2.85"	"24.42"
"7825"	"[K].GAWSNVLR.[G]"	""	"0.0322742"	"0.00104877"	"2"	"2"	"6"	"P48962; P51881"	"P48962 [273-280]; P51881 [273-280]"	""	"ADP/ATP translocase 1 [OS=Mus musculus];ADP/ATP translocase 2 [OS=Mus musculus]"	"0"	"902.48428"	"0.51"	"0.30"	"0.53"	"0.86"	"-0.05"	"-0.56"	"-0.35"	"76.0"	"108.3"	"93.6"	"110.2"	"138.3"	"73.6"	"55037.35546875"	"78378.6328125"	"67788.4765625"	"79737.3046875"	"100084.421875"	"53309.71875"	"NotUnique"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"451.74555"	"0.0001873"	"0.003528"	"1.66"	"35.65"
"12197"	"[R].KTDLSSHSQTSGILLSSMPSTSKMG.[-]"	"1xBiotin [K23]; 2xOxidation [M18; M24]"	"0.000782241"	"0.000586377"	"1"	"1"	"5"	"Q61549"	"Q61549 [907-931]"	"Q61549 1xBiotin [K929]"	"Adhesion G protein-coupled receptor E1 [OS=Mus musculus]"	"2"	"2838.33181"	"0.65"	"-0.14"	"-0.34"	"-9.97"	"0.64"	"0.00"	"0.79"	"103.1"	"161.2"	"93.3"	"81.3"	""	"161.1"	"70454.9765625"	"110196.3828125"	"63788.92578125"	"55606.2734375"	""	"110120.5859375"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"946.78224"	"0.0001108"	"1.512E-05"	"5.00"	"36.79"
"7847"	"[R].GCSCILEKASSGWGNATAGK.[C]"	"1xBiotin [K8]; 2xCarbamidomethyl [C2; C4]"	"2.85026E-05"	"0.000586377"	"1"	"2"	"9"	"Q8K078"	"Q8K078 [552-571]"	"Q8K078 1xBiotin [K559]"	"solute carrier organic anion transporter family member 4A1 [OS=Mus musculus]"	"1"	"2280.02058"	"0.42"	"0.24"	"-0.12"	"-1.35"	"0.62"	"0.21"	"0.38"	"94.2"	"125.7"	"111.4"	"86.9"	"36.8"	"145.1"	"57768.73828125"	"77062.6015625"	"68289.09375"	"53272.0078125"	"22592.4038085938"	"88980.384765625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"1140.51393"	"0.0001108"	"1.206E-07"	"4.21"	"47.82"
"12193"	"[K].KTDAPQPDVK.[D]"	"1xBiotin [K1]"	"0.00871455"	"0.000586377"	"1"	"1"	"6"	"P35564"	"P35564 [517-526]"	"P35564 1xBiotin [K517]"	"Calnexin [OS=Mus musculus]"	"1"	"1324.65656"	"0.39"	"0.07"	"0.38"	"0.16"	"0.05"	"-0.34"	"-0.02"	"88.1"	"115.4"	"92.4"	"114.4"	"98.6"	"91.0"	"39965.26171875"	"52330.859375"	"41909.1796875"	"51879.60546875"	"44710.74609375"	"41262.43359375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"662.83211"	"0.0001108"	"0.0005145"	"3.48"	"25.50"
"7856"	"[K].GCYAHVLGSKSFQTSDWPQK.[A]"	"1xBiotin [K10]; 1xCarbamidomethyl [C2]"	"2.75225E-05"	"0.000586377"	"1"	"1"	"7"	"P06339"	"P06339 [337-356]"	"P06339 1xBiotin [K346]"	"H-2 class I histocompatibility antigen, D-37 alpha chain [OS=Mus musculus]"	"1"	"2522.15912"	"0.20"	"0.28"	"-2.40"	"-9.97"	"0.62"	"0.42"	"0.34"	"118.1"	"135.4"	"143.0"	"22.4"	""	"181.0"	"60733.19921875"	"69593.234375"	"73542.7421875"	"11525.1533203125"	""	"93071.2109375"	""	"High"	"High"	"High"	"Peak Found"	"Not Found"	"High"	"High"	"3"	"841.39133"	"0.0001108"	"1.148E-07"	"4.75"	"43.66"
"12168"	"[K].KSTVLQQQYNR.[V]"	"1xBiotin [K1]"	"0.000544939"	"0.000586377"	"1"	"1"	"6"	"P26039"	"P26039 [428-438]"	"P26039 1xBiotin [K428]"	"Talin-1 [OS=Mus musculus]"	"1"	"1590.80569"	"-9.97"	"-0.29"	"-0.46"	"-0.92"	"-0.61"	"9.97"	"-0.32"	"160.9"	""	"131.6"	"117.0"	"85.0"	"105.5"	"55978.0029296875"	""	"45806.646484375"	"40720.71484375"	"29560.720703125"	"36708.98828125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"795.90654"	"0.0001108"	"8.917E-06"	"3.11"	"31.86"
"7920"	"[R].GDLTTEPFLPKSVLVK.[-]"	"1xBiotin [K11]"	"0.000177877"	"0.000586377"	"1"	"1"	"10"	"Q9R0M8"	"Q9R0M8 [375-390]"	"Q9R0M8 1xBiotin [K385]"	"UDP-galactose translocator [OS=Mus musculus]"	"1"	"1970.06671"	"0.16"	"0.45"	"0.12"	"-3.25"	"0.72"	"0.56"	"0.27"	"94.9"	"106.2"	"129.8"	"102.9"	"10.0"	"156.2"	"54670.98046875"	"61160.53125"	"74789.310546875"	"59285.0673828125"	"5744.80615234375"	"89992.517578125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"985.53700"	"0.0001108"	"1.748E-06"	"3.44"	"55.41"
"12155"	"[R].KSSTPEEVK.[K]"	"1xBiotin [K1]"	"0.00794148"	"0.000586377"	"1"	"1"	"5"	"P18760"	"P18760 [22-30]"	"P18760 1xBiotin [K22]"	"Cofilin-1 [OS=Mus musculus]"	"1"	"1230.60346"	"0.52"	"0.40"	"0.31"	"0.60"	"0.56"	"0.04"	"0.16"	"75.1"	"107.9"	"99.2"	"93.1"	"114.2"	"110.6"	"14302.333984375"	"20553.107421875"	"18888.41015625"	"17733.931640625"	"21744.6640625"	"21066.09375"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"2"	"615.80597"	"0.0001108"	"0.0004467"	"2.18"	"23.16"
"12205"	"[R].KTEPSAWTQDTGDTNANGKDWGR.[N]"	"1xBiotin [K19]"	"1.3047E-05"	"0.000586377"	"1"	"1"	"6"	"Q80WJ7"	"Q80WJ7 [313-335]"	"Q80WJ7 1xBiotin [K331]"	"protein LYRIC [OS=Mus musculus]"	"2"	"2761.22708"	"0.06"	"-0.50"	"0.18"	"-0.43"	"0.22"	"0.16"	"0.73"	"103.6"	"108.1"	"73.1"	"117.4"	"76.7"	"121.0"	"21085.49609375"	"22004.55859375"	"14886.86328125"	"23892.837890625"	"15619.3134765625"	"24627.111328125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"921.08044"	"0.0001108"	"3.853E-08"	"4.33"	"37.56"
"12147"	"[K].KSSGFLSNLLGGH.[-]"	"1xBiotin [K1]"	"6.95004E-06"	"0.000586377"	"1"	"4"	"7"	"Q8VE91-1"	"Q8VE91-1 [352-364]"	"Q8VE91-1 1xBiotin [K352]"	"Isoform 1 of Reticulophagy regulator 1 [OS=Mus musculus]"	"1"	"1542.77332"	"0.44"	"0.61"	"-1.58"	"-9.97"	"0.50"	"0.06"	"-0.11"	"106.7"	"144.7"	"162.3"	"35.8"	""	"150.5"	"75233.3359375"	"102077.9765625"	"114478.5546875"	"25239.291015625"	""	"106116.484375"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"2"	"771.89030"	"0.0001108"	"1.54E-08"	"3.75"	"55.50"
"7978"	"[R].GDVQNKPSGLWGMLK.[S]"	"1xBiotin [K6]"	"0.000441759"	"0.000586377"	"1"	"1"	"5"	"Q8BS95"	"Q8BS95 [218-232]"	"Q8BS95 1xBiotin [K223]"	"Golgi pH regulator [OS=Mus musculus]"	"0"	"1855.91934"	"0.81"	"0.51"	"-1.21"	"-9.97"	"0.80"	"-0.01"	"0.28"	"94.5"	"165.5"	"135.0"	"40.7"	""	"164.3"	"21027.12109375"	"36817.96875"	"30046.748046875"	"9061.486328125"	""	"36545.9296875"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"2"	"928.46355"	"0.0001108"	"6.587E-06"	"3.13"	"53.43"
"7979"	"[R].GDVQNKPSGLWGMLK.[S]"	"1xBiotin [K6]; 1xOxidation [M13]"	"0.00152926"	"0.000586377"	"1"	"1"	"16"	"Q8BS95"	"Q8BS95 [218-232]"	"Q8BS95 1xBiotin [K223]"	"Golgi pH regulator [OS=Mus musculus]"	"0"	"1871.91425"	"-0.25"	"-0.22"	"-0.61"	"-2.99"	"0.26"	"0.51"	"0.48"	"128.3"	"107.6"	"110.4"	"84.1"	"16.2"	"153.5"	"83393.390625"	"69928.904296875"	"71760.296875"	"54675.203125"	"10504.2224121094"	"99751.23046875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"936.46066"	"0.0001108"	"4.026E-05"	"3.52"	"46.66"
"12097"	"[K].KSLAAAGYDVEK.[N]"	"1xBiotin [K1]"	"0.000137622"	"0.000586377"	"1"	"1"	"5"	"P43275"	"P43275 [66-77]"	"P43275 1xBiotin [K66]"	"Histone H1.1 [OS=Mus musculus]"	"1"	"1477.73554"	"-9.97"	"-0.44"	"-0.30"	"-0.97"	"-0.01"	"9.97"	"0.43"	"148.0"	""	"109.3"	"120.3"	"75.4"	"146.9"	"18259.8828125"	""	"13483.1552734375"	"14842.8837890625"	"9307.2734375"	"18122.8828125"	""	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"2"	"739.37171"	"0.0001108"	"1.202E-06"	"3.13"	"30.28"
"12081"	"[R].KSGSISSSPSR.[R]"	"1xBiotin [K1]"	"0.000449555"	"0.000586377"	"1"	"1"	"7"	"Q3U9G9"	"Q3U9G9 [64-74]"	"Q3U9G9 1xBiotin [K64]"	"Lamin-B receptor [OS=Mus musculus]"	"1"	"1318.64197"	"0.26"	"0.23"	"0.12"	"0.12"	"0.38"	"0.12"	"0.16"	"87.7"	"105.1"	"102.5"	"95.3"	"95.2"	"114.2"	"51302.6875"	"61527.91796875"	"59995.140625"	"55747.3515625"	"55715.46484375"	"66807.3203125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"659.82470"	"0.0001108"	"6.749E-06"	"2.81"	"22.68"
"12070"	"[K].KSGCPEER.[R]"	"1xBiotin [K1]; 1xCarbamidomethyl [C4]"	"0.00897115"	"0.000586377"	"1"	"1"	"6"	"Q80UJ7"	"Q80UJ7 [916-923]"	"Q80UJ7 1xBiotin [K916]"	"Rab3 GTPase-activating protein catalytic subunit [OS=Mus musculus]"	"1"	"1188.51360"	"0.79"	"0.68"	"0.57"	"0.77"	"0.52"	"-0.27"	"-0.16"	"67.0"	"116.0"	"107.4"	"99.3"	"114.1"	"96.3"	"62854.484375"	"108776.0625"	"100689.90625"	"93111.953125"	"106994.15625"	"90315.7109375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"594.76055"	"0.0001108"	"0.000538"	"2.04"	"19.16"
"12057"	"[K].KSEIGIAMGSGTAVAK.[T]"	"1xBiotin [K1]; 1xOxidation [M8]"	"4.35498E-07"	"0.000586377"	"1"	"2"	"10"	"O55143-1"	"O55143-1 [712-727]"	"O55143-1 1xBiotin [K712]"	"Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 [OS=Mus musculus]"	"1"	"1761.88737"	"-0.28"	"-0.75"	"0.13"	"-1.54"	"-9.97"	"-9.97"	"-9.97"	"155.7"	"128.5"	"92.3"	"169.9"	"53.6"	""	"72375.802734375"	"59727.251953125"	"42900.84765625"	"78989.466796875"	"24935.962890625"	""	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"881.44685"	"0.0001108"	"2.69E-10"	"4.85"	"34.44"
"7998"	"[R].GEALSALDSKANNLSSLSK.[K]"	"1xBiotin [K10]"	"2.1028E-06"	"0.000586377"	"1"	"1"	"85"	"O08547"	"O08547 [160-178]"	"O08547 1xBiotin [K169]"	"Vesicle-trafficking protein SEC22b [OS=Mus musculus]"	"1"	"2131.06996"	"0.50"	"-0.14"	"-1.13"	"-3.44"	"-0.49"	"-0.99"	"-0.35"	"130.9"	"185.2"	"118.8"	"59.9"	"12.1"	"93.1"	"6479887.07128906"	"9167529.27148438"	"5877901.57763672"	"2965737.80371094"	"598822.1328125"	"4606830.49267578"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"1066.03880"	"0.0001108"	"2.684E-09"	"5.67"	"51.34"
"12053"	"[K].KSDPVVSYR.[E]"	"1xBiotin [K1]"	"0.00803425"	"0.000586377"	"1"	"1"	"6"	"P58252"	"P58252 [572-580]"	"P58252 1xBiotin [K572]"	"Elongation factor 2 [OS=Mus musculus]"	"1"	"1276.63543"	"-9.97"	"0.50"	"0.77"	"0.76"	"0.78"	"9.97"	"0.28"	"79.7"	""	"112.3"	"136.2"	"135.1"	"136.7"	"10567.9716796875"	""	"14895.0107421875"	"18058.416015625"	"17925.1796875"	"18133.134765625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"638.82108"	"0.0001108"	"0.0004578"	"2.53"	"33.41"
"12142"	"[K].KSSATVGPK.[A]"	"1xBiotin [K1]"	"0.00727885"	"0.000586377"	"1"	"1"	"4"	"P27661"	"P27661 [120-128]"	"P27661 1xBiotin [K120]"	"Histone H2AX [OS=Mus musculus]"	"1"	"1100.57686"	"0.40"	"0.17"	"0.11"	"0.25"	"0.22"	"-0.18"	"0.05"	"87.2"	"115.2"	"98.3"	"94.0"	"103.8"	"101.5"	"10694.2578125"	"14131.451171875"	"12053.60546875"	"11530.291015625"	"12731.1318359375"	"12455.552734375"	""	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"2"	"550.79198"	"0.0001108"	"0.0003932"	"1.62"	"21.96"
"12208"	"[K].KTEVKPSSNGSASSASK.[R]"	"1xBiotin [K1]"	"0.000720928"	"0.000586377"	"1"	"1"	"8"	"Q9DAV9"	"Q9DAV9 [259-275]"	"Q9DAV9 1xBiotin [K259]"	"Trimeric intracellular cation channel type B [OS=Mus musculus]"	"1"	"1890.92257"	"0.52"	"0.61"	"0.27"	"-0.46"	"0.42"	"-0.10"	"-0.19"	"83.0"	"119.1"	"126.5"	"100.0"	"60.3"	"111.0"	"15258.7749023438"	"21903.658203125"	"23260.140625"	"18384.6137695313"	"11089.2900390625"	"20414.904296875"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"3"	"630.97898"	"0.0001108"	"1.34E-05"	"2.40"	"19.37"
"7821"	"[R].GAVSNPAFGKTVR.[D]"	"1xBiotin [K10]"	"0.000246571"	"0.000586377"	"1"	"2"	"7"	"Q8K078"	"Q8K078 [360-372]"	"Q8K078 1xBiotin [K369]"	"solute carrier organic anion transporter family member 4A1 [OS=Mus musculus]"	"1"	"1529.78931"	"0.79"	"0.02"	"-0.05"	"-0.11"	"0.62"	"-0.18"	"0.60"	"83.6"	"144.9"	"84.9"	"80.7"	"77.6"	"128.3"	"85149.75"	"147621.90625"	"86541.25"	"82241.0546875"	"79053.4765625"	"130724.8359375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"765.39847"	"0.0001108"	"2.814E-06"	"3.90"	"36.85"
"7786"	"[K].GAQAPVKAP.[-]"	"1xBiotin [K7]"	"0.0671862"	"0.0019826"	"1"	"1"	"4"	"P47915"	"P47915 [152-160]"	"P47915 1xBiotin [K158]"	"60S ribosomal protein L29 [OS=Mus musculus]"	"1"	"1064.55573"	"0.43"	"-0.22"	"0.06"	"0.47"	"0.23"	"-0.20"	"0.46"	"88.2"	"118.8"	"75.5"	"91.9"	"121.9"	"103.7"	"39110.29296875"	"52673.66796875"	"33469.734375"	"40720.41796875"	"54040.60546875"	"45951.0078125"	""	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"2"	"532.78135"	"0.0003442"	"0.01056"	"2.73"	"33.21"
"12326"	"[R].KVESLQEEIAFLK.[K]"	"1xBiotin [K1]"	"0.021606"	"0.00104877"	"1"	"1"	"2"	"P20152"	"P20152 [223-235]"	"P20152 1xBiotin [K223]"	"Vimentin [OS=Mus musculus]"	"1"	"1759.92988"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"2"	"880.46863"	"0.0001873"	"0.001952"	"2.18"	""
"12325"	"[K].KVEPVLVTKQPAPPPPLEAAALK.[K]"	"1xBiotin [K]"	"0.00426296"	"0.000586377"	"1"	"16"	"5"	"Q61595"	"Q61595 [142-164]"	"Q61595 1xBiotin [K]"	"Kinectin [OS=Mus musculus]"	"2"	"2619.49424"	"0.70"	"0.45"	"0.58"	"-9.97"	"0.38"	"-0.32"	"-0.06"	"88.3"	"143.8"	"120.5"	"132.3"	""	"115.2"	"13646.3642578125"	"22224.10546875"	"18622.712890625"	"20443.521484375"	""	"17805.498046875"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"873.83618"	"0.0001108"	"0.0001802"	"3.46"	"47.39"
"7721"	"[K].GAGTNGLPTKGPTEVSDK.[K]"	"1xBiotin [K10]"	"9.31119E-05"	"0.000586377"	"1"	"1"	"16"	"Q91WE4"	"Q91WE4 [52-69]"	"Q91WE4 1xBiotin [K61]"	"UPF0729 protein C18orf32 homolog [OS=Mus musculus]"	"1"	"1954.95387"	"0.08"	"-0.26"	"0.21"	"0.02"	"-0.06"	"-0.14"	"0.21"	"99.7"	"105.6"	"83.0"	"115.1"	"100.9"	"95.7"	"432573.03125"	"458078.375"	"360057.953125"	"499434.875"	"437607.515625"	"415386.359375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"977.98089"	"0.0001108"	"6.756E-07"	"3.83"	"34.73"
"12313"	"[K].KVATVPGTLK.[K]"	"1xBiotin [K1]"	"0.000390846"	"0.000586377"	"1"	"1"	"9"	"P14148"	"P14148 [10-19]"	"P14148 1xBiotin [K10]"	"60S ribosomal protein L7 [OS=Mus musculus]"	"1"	"1239.71295"	"0.07"	"0.03"	"0.15"	"0.25"	"0.20"	"0.13"	"0.17"	"92.1"	"96.4"	"94.3"	"101.9"	"109.5"	"105.8"	"266152.59375"	"278569.5"	"272467.21875"	"294404.53125"	"316245.5"	"305671.40625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"620.36001"	"0.0001108"	"5.496E-06"	"3.19"	"34.43"
"12312"	"[R].KVASDWMSNLGFK.[R]"	"1xBiotin [K1]; 1xOxidation [M7]"	"0.026417"	"0.00104877"	"1"	"2"	"1"	"Q9JL26"	"Q9JL26 [99-111]"	"Q9JL26 1xBiotin [K99]"	"formin-like protein 1 [OS=Mus musculus]"	"1"	"1724.81347"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"862.90985"	"0.0001873"	"0.002614"	"1.90"	""
"12308"	"[K].KVAPAPAVVK.[K]"	"1xBiotin [K1]"	"0.00304131"	"0.000586377"	"1"	"1"	"5"	"P12970"	"P12970 [11-20]"	"P12970 1xBiotin [K11]"	"60S ribosomal protein L7a [OS=Mus musculus]"	"1"	"1205.70748"	"-9.97"	"-0.22"	"-0.32"	"-0.22"	"0.10"	"9.97"	"0.32"	"130.7"	""	"112.3"	"104.4"	"112.4"	"140.2"	"21142.669921875"	""	"18174.482421875"	"16894.05078125"	"18194.724609375"	"22686.041015625"	""	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"2"	"603.35736"	"0.0001108"	"0.0001101"	"2.22"	"31.70"
"12305"	"[R].KVAHSDKPGSTSAVSFR.[D]"	"1xBiotin [K1]"	"5.21792E-07"	"0.000586377"	"1"	"1"	"16"	"Q9WV55"	"Q9WV55 [205-221]"	"Q9WV55 1xBiotin [K205]"	"vesicle-associated membrane protein-associated protein A [OS=Mus musculus]"	"1"	"2000.00182"	"0.61"	"0.61"	"0.51"	"0.68"	"0.44"	"-0.17"	"-0.17"	"71.2"	"108.8"	"108.6"	"101.3"	"113.7"	"96.4"	"209811.0078125"	"320777.546875"	"320139.1015625"	"298533.5078125"	"335047.28125"	"284303.3828125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"667.33888"	"0.0001108"	"3.51E-10"	"4.95"	"25.90"
"12296"	"[R].KTVTAMDVVYALK.[R]"	"1xBiotin [K1]; 1xOxidation [M6]"	"1.26721E-05"	"0.000586377"	"1"	"1"	"11"	"P62806"	"P62806 [80-92]"	"P62806 1xBiotin [K80]"	"histone H4 [OS=Mus musculus]"	"1"	"1680.86993"	"0.19"	"0.23"	"-0.37"	"-3.64"	"0.41"	"0.22"	"0.19"	"109.2"	"124.7"	"127.8"	"84.2"	"8.7"	"145.4"	"61194.728515625"	"69877.5078125"	"71648.1171875"	"47217.189453125"	"4903.02734375"	"81512.73046875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"840.93790"	"0.0001108"	"3.686E-08"	"4.07"	"47.72"
"12295"	"[R].KTVTAMDVVYALK.[R]"	"1xBiotin [K1]"	"3.3363E-05"	"0.000586377"	"1"	"1"	"5"	"P62806"	"P62806 [80-92]"	"P62806 1xBiotin [K80]"	"histone H4 [OS=Mus musculus]"	"1"	"1664.87501"	"1.09"	"0.76"	"-0.01"	"-2.96"	"0.83"	"-0.25"	"0.07"	"77.6"	"164.9"	"131.8"	"77.3"	"10.0"	"138.4"	"17566.7265625"	"37320.21875"	"29837.818359375"	"17498.056640625"	"2262.11669921875"	"31333.2578125"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"2"	"832.94138"	"0.0001108"	"1.518E-07"	"3.47"	"53.98"
"12289"	"[R].KTVGVEPAADGK.[G]"	"1xBiotin [K1]"	"0.000397743"	"0.000586377"	"1"	"1"	"6"	"P41105"	"P41105 [47-58]"	"P41105 1xBiotin [K47]"	"60S ribosomal protein L28 [OS=Mus musculus]"	"1"	"1397.70933"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"-0.21"	"0.13"	""	"131.3"	"103.8"	"130.0"	"121.4"	"113.5"	""	"14804.82421875"	"11701.578125"	"14662.0224609375"	"13683.318359375"	"12800.69140625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"699.35779"	"0.0001108"	"5.661E-06"	"2.64"	"30.11"
"12287"	"[R].KTVFDR.[H]"	"1xBiotin [K1]"	"0.11579"	"0.00731053"	"1"	"1"	"5"	"Q9CR23"	"Q9CR23 [173-178]"	"Q9CR23 1xBiotin [K173]"	"Transmembrane protein 9 [OS=Mus musculus]"	"1"	"991.50296"	"0.71"	"0.34"	"0.59"	"0.07"	"0.55"	"-0.16"	"0.21"	"75.8"	"123.8"	"96.2"	"113.7"	"79.6"	"110.9"	"20720.466796875"	"33871.20703125"	"26316.998046875"	"31084.634765625"	"21761.09375"	"30337.416015625"	""	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"2"	"496.25502"	"0.001478"	"0.02406"	"1.33"	"33.69"
"7727"	"[K].GAKEHGAVAVER.[V]"	"1xBiotin [K3]"	"0.000529282"	"0.000586377"	"1"	"3"	"4"	"Q9CZ44-1"	"Q9CZ44-1 [125-136]"	"Q9CZ44-1 1xBiotin [K127]"	"NSFL1 cofactor p47 [OS=Mus musculus]"	"1"	"1449.72671"	""	"9.97"	"9.97"	""	""	""	"-9.97"	""	""	"364.0"	"236.0"	""	""	""	""	"5472.27001953125"	"3548.197265625"	""	""	""	"High"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"3"	"483.91373"	"0.0001108"	"8.559E-06"	"3.11"	"23.74"
"12274"	"[K].KTSPEFSQPLKK.[V]"	"1xBiotin [K]"	"0.00011689"	"0.000586377"	"1"	"1"	"26"	"Q8VBT0"	"Q8VBT0 [221-232]"	"Q8VBT0 1xBiotin [K]"	"Thioredoxin-related transmembrane protein 1 [OS=Mus musculus]"	"2"	"1615.85124"	"0.15"	"0.07"	"0.88"	"1.03"	"0.66"	"0.52"	"0.60"	"69.5"	"77.0"	"72.8"	"128.3"	"142.3"	"110.1"	"161471.969726563"	"178969.63671875"	"169314.599609375"	"298190.525390625"	"330719.90234375"	"255981.38671875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"808.42966"	"0.0001108"	"9.412E-07"	"3.74"	"32.05"
"12273"	"[K].KTSPEFSQPLK.[K]"	"1xBiotin [K1]"	"0.000490645"	"0.000586377"	"1"	"1"	"3"	"Q8VBT0"	"Q8VBT0 [221-231]"	"Q8VBT0 1xBiotin [K221]"	"Thioredoxin-related transmembrane protein 1 [OS=Mus musculus]"	"1"	"1487.75628"	"-0.15"	"-0.10"	"-0.05"	"0.06"	"-0.12"	"0.03"	"-0.02"	"104.0"	"93.7"	"97.4"	"100.4"	"108.6"	"95.9"	"1358242.625"	"1223162.875"	"1271054.125"	"1311210.5"	"1418251.75"	"1251627.5"	""	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"2"	"744.38189"	"0.0001108"	"7.667E-06"	"3.39"	"36.52"
"12266"	"[R].KTSGPPVSELITK.[A]"	"1xBiotin [K1]"	"0.000884122"	"0.000586377"	"1"	"1"	"10"	"P43274"	"P43274 [34-46]"	"P43274 1xBiotin [K34]"	"Histone H1.4 [OS=Mus musculus]"	"1"	"1582.85090"	"-0.25"	"-0.17"	"-0.20"	"-0.30"	"-0.50"	"-0.25"	"-0.34"	"117.1"	"98.5"	"104.4"	"102.1"	"95.2"	"82.7"	"31707.640625"	"26661.857421875"	"28256.501953125"	"27632.265625"	"25784.146484375"	"22381.623046875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"791.92955"	"0.0001108"	"1.806E-05"	"4.45"	"40.74"
"12251"	"[R].KTPSVSLTSVHPDLMK.[I]"	"1xBiotin [K1]; 1xOxidation [M15]"	"0.00152037"	"0.000586377"	"1"	"1"	"5"	"Q8C1Y8"	"Q8C1Y8 [394-409]"	"Q8C1Y8 1xBiotin [K394]"	"vacuolar fusion protein CCZ1 homolog [OS=Mus musculus]"	"1"	"1982.00854"	"0.62"	"0.52"	"0.63"	"0.45"	"0.73"	"0.11"	"0.20"	"70.2"	"107.9"	"100.8"	"108.8"	"96.2"	"116.1"	"8088.91064453125"	"12421.69921875"	"11611.7041015625"	"12523.3095703125"	"11074.3828125"	"13372.5"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"3"	"661.34116"	"0.0001108"	"4.004E-05"	"2.65"	"38.87"
"12250"	"[R].KTPSQATSSQAKEK.[L]"	"1xBiotin [K]"	"0.0252322"	"0.00104877"	"1"	"1"	"4"	"Q8CHK3"	"Q8CHK3 [456-469]"	"Q8CHK3 1xBiotin [K]"	"Lysophospholipid acyltransferase 7 [OS=Mus musculus]"	"2"	"1716.85851"	"0.40"	"0.34"	"0.31"	"0.57"	"0.34"	"-0.06"	"0.01"	"79.2"	"104.6"	"100.0"	"98.4"	"117.4"	"100.5"	"5343.82861328125"	"7054.08349609375"	"6743.78173828125"	"6636.90625"	"7921.8251953125"	"6778.49267578125"	""	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"3"	"572.95787"	"0.0001873"	"0.00246"	"2.40"	"17.44"
"12248"	"[R].KTPSAAAEDTR.[W]"	"1xBiotin [K1]"	"0.00451841"	"0.000586377"	"1"	"1"	"8"	"Q8VCL5"	"Q8VCL5 [18-28]"	"Q8VCL5 1xBiotin [K18]"	"Solute carrier family 17 member 9 [OS=Mus musculus]"	"1"	"1372.65254"	"0.41"	"0.11"	"0.05"	"0.20"	"0.00"	"-0.41"	"-0.11"	"91.1"	"120.9"	"98.1"	"94.3"	"104.4"	"91.2"	"27082.390625"	"35962.0703125"	"29177.369140625"	"28025.025390625"	"31042.505859375"	"27113.921875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"686.83021"	"0.0001108"	"0.0001969"	"1.66"	"23.86"
"7785"	"[K].GAQAPKGAQAPVK.[A]"	"1xBiotin [K6]"	"0.00659418"	"0.000586377"	"1"	"1"	"7"	"P47915"	"P47915 [146-158]"	"P47915 1xBiotin [K151]"	"60S ribosomal protein L29 [OS=Mus musculus]"	"1"	"1448.76784"	"0.68"	"0.61"	"0.18"	"0.46"	"0.56"	"-0.12"	"-0.05"	"73.9"	"118.5"	"113.1"	"83.9"	"101.7"	"108.9"	"16135.9892578125"	"25877.583984375"	"24703.4140625"	"18334.185546875"	"22217.1640625"	"23796.5859375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"724.88522"	"0.0001108"	"0.00034"	"3.43"	"25.98"
"12051"	"[K].KSDIDEIVLVGGSTR.[I]"	"1xBiotin [K1]"	"0.00343692"	"0.000586377"	"1"	"1"	"4"	"P20029"	"P20029 [354-368]"	"P20029 1xBiotin [K354]"	"78 kDa glucose-regulated protein [OS=Mus musculus]"	"1"	"1814.93167"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"High"	"Not Found"	"High"	"Not Found"	"High"	"High"	"2"	"907.96952"	"0.0001108"	"0.0001316"	"2.78"	""
"12334"	"[R].KVGGAEHSPASQPSLAR.[D]"	"1xBiotin [K1]"	"0.00409277"	"0.000586377"	"1"	"3"	"3"	"Q3U3R4"	"Q3U3R4 [19-35]"	"Q3U3R4 1xBiotin [K19]"	"Lipase maturation factor 1 [OS=Mus musculus]"	"1"	"1917.95995"	"-9.97"	"-0.47"	"-0.63"	"-9.97"	"-9.97"	""	"-9.97"	"253.3"	""	"183.5"	"163.2"	""	""	"25016.8017578125"	""	"18123.81640625"	"16122.060546875"	""	""	""	"High"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"3"	"639.99100"	"0.0001108"	"0.0001695"	"3.98"	"26.67"
"8003"	"[K].GEAPAKSSTHR.[D]"	"1xBiotin [K6]"	"0.00275461"	"0.000586377"	"1"	"2"	"6"	"A2AKQ0"	"A2AKQ0 [14-24]"	"A2AKQ0 1xBiotin [K19]"	"UDP-glucuronic acid/UDP-N-acetylgalactosamine transporter [OS=Mus musculus]"	"1"	"1366.65321"	"0.41"	"0.52"	"0.32"	"0.31"	"0.27"	"-0.13"	"-0.25"	"80.5"	"106.7"	"115.7"	"100.3"	"99.6"	"97.2"	"42791.23828125"	"56715.90625"	"61462.328125"	"53274.0390625"	"52916.2421875"	"51672.1015625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"456.22249"	"0.0001108"	"9.54E-05"	"3.09"	"18.13"
"8007"	"[K].GECFGLLGFNGAGKTTTFK.[M]"	"1xBiotin [K14]; 1xCarbamidomethyl [C3]"	"9.20322E-05"	"0.000586377"	"1"	"1"	"6"	"Q8R420"	"Q8R420 [1409-1427]"	"Q8R420 1xBiotin [K1422]"	"ATP-binding cassette sub-family A member 3 [OS=Mus musculus]"	"1"	"2231.06237"	"-9.97"	"0.11"	"-2.82"	"-9.97"	"0.29"	"9.97"	"0.18"	"174.5"	""	"187.8"	"24.7"	""	"213.0"	"36876.837890625"	""	"39688.7626953125"	"5225.158203125"	""	"45018.306640625"	""	"High"	"High"	"Peak Found"	"High"	"Not Found"	"High"	"High"	"3"	"744.35857"	"0.0001108"	"6.677E-07"	"4.36"	"54.56"
"11726"	"[K].KPFYLYTGR.[G]"	""	"0.038507"	"0.00104877"	"1"	"2"	"4"	"P32921"	"P32921 [158-166]"	""	"Tryptophan--tRNA ligase, cytoplasmic [OS=Mus musculus]"	"0"	"1144.61496"	"0.50"	"-0.12"	"0.36"	"0.25"	"-0.40"	"-0.89"	"-0.27"	"91.5"	"129.0"	"84.0"	"117.5"	"108.5"	"69.4"	"10410.2333984375"	"14674.1591796875"	"9556.03125"	"13361.2294921875"	"12341.080078125"	"7898.7001953125"	""	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"2"	"572.81108"	"0.0001873"	"0.004575"	"2.13"	"32.56"
"8175"	"[K].GFGYKGSSFHR.[I]"	"1xBiotin [K5]"	"0.0578012"	"0.0019826"	"1"	"1"	"7"	"P17742"	"P17742 [45-55]"	"P17742 1xBiotin [K49]"	"peptidyl-prolyl cis-trans isomerase A [OS=Mus musculus]"	"1"	"1468.67903"	"0.85"	"0.64"	"1.28"	"0.33"	"1.01"	"0.17"	"0.38"	"59.7"	"107.2"	"92.8"	"144.6"	"75.2"	"120.4"	"17793.92578125"	"31986.55078125"	"27679.955078125"	"43143.49609375"	"22436.125"	"35919.12109375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"490.23097"	"0.0003442"	"0.008375"	"1.49"	"35.06"
"11693"	"[K].KPDDGKMK.[G]"	"1xBiotin [K6]; 1xOxidation [M7]"	"0.0304821"	"0.00104877"	"1"	"1"	"11"	"Q9CPU0"	"Q9CPU0 [152-159]"	"Q9CPU0 1xBiotin [K157]"	"lactoylglutathione lyase [OS=Mus musculus]"	"1"	"1160.54384"	"0.10"	"0.26"	"0.31"	"-1.25"	"0.26"	"0.15"	"0.00"	"97.9"	"105.3"	"117.4"	"121.2"	"41.1"	"117.2"	"45096.6015625"	"48490.9453125"	"54079.083984375"	"55820.84765625"	"18918.7504882813"	"53984.623046875"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"2"	"580.77566"	"0.0001873"	"0.003235"	"2.38"	"14.48"
"11692"	"[K].KPDDGKMK.[G]"	"1xBiotin [K6]"	"0.00593905"	"0.000586377"	"1"	"1"	"8"	"Q9CPU0"	"Q9CPU0 [152-159]"	"Q9CPU0 1xBiotin [K157]"	"lactoylglutathione lyase [OS=Mus musculus]"	"1"	"1144.54893"	"1.30"	"0.70"	"0.62"	"2.05"	"0.64"	"-0.66"	"-0.06"	"48.7"	"120.0"	"78.8"	"74.7"	"202.0"	"75.8"	"11730.107421875"	"28931.2509765625"	"18995.5732421875"	"17998.21484375"	"48680.4755859375"	"18270.6567382813"	""	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"2"	"572.77795"	"0.0001108"	"0.000293"	"2.62"	"19.74"
"11691"	"[R].KPCPYEQALGGDGPEEQ.[-]"	"1xBiotin [K1]; 1xCarbamidomethyl [C3]"	"0.000490645"	"0.000586377"	"1"	"2"	"25"	"Q8VCW4"	"Q8VCW4 [582-598]"	"Q8VCW4 1xBiotin [K582]"	"Protein unc-93 homolog B1 [OS=Mus musculus]"	"0"	"2100.90012"	"0.23"	"-0.13"	"-0.04"	"-0.24"	"0.01"	"-0.23"	"0.13"	"101.4"	"119.2"	"92.8"	"98.7"	"85.9"	"101.9"	"145898.52734375"	"171503.03515625"	"133558.6796875"	"142026.46875"	"123528.9140625"	"146644.58984375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"1050.95396"	"0.0001108"	"7.637E-06"	"4.10"	"41.02"
"11685"	"[R].KPAVTK.[G]"	"1xBiotin [K1]"	"0.0738148"	"0.00241047"	"1"	"1"	"3"	"Q91V04"	"Q91V04 [337-342]"	"Q91V04 1xBiotin [K337]"	"Translocating chain-associated membrane protein 1 [OS=Mus musculus]"	"0"	"869.49134"	"0.53"	"0.58"	"0.44"	"0.49"	"0.26"	"-0.28"	"-0.33"	"76.0"	"109.9"	"113.9"	"103.0"	"106.5"	"90.7"	"29238.431640625"	"42280.69921875"	"43837.53125"	"39622.5390625"	"40987.78125"	"34897.33984375"	""	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"2"	"435.24916"	"0.000415"	"0.01213"	"2.32"	"22.39"
"11677"	"[R].KPANEFPAKFPK.[K]"	"1xBiotin [K9]"	"0.0133822"	"0.000586377"	"1"	"1"	"6"	"Q8BN21"	"Q8BN21 [350-361]"	"Q8BN21 1xBiotin [K358]"	"serine/threonine-protein kinase VRK2 [OS=Mus musculus]"	"1"	"1599.83520"	"0.21"	"-0.22"	"0.08"	"0.30"	"-0.04"	"-0.25"	"0.18"	"95.6"	"110.6"	"82.2"	"100.7"	"118.0"	"92.9"	"24125.27734375"	"27909.875"	"20732.76171875"	"25421.703125"	"29785.0703125"	"23435.2734375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"533.94965"	"0.0001108"	"0.0009653"	"3.38"	"37.76"
"11674"	"[K].KPAKAAAPR.[K]"	"1xBiotin [K4]"	"0.00667128"	"0.000586377"	"1"	"1"	"4"	"P43275"	"P43275 [26-34]"	"P43275 1xBiotin [K29]"	"Histone H1.1 [OS=Mus musculus]"	"1"	"1135.64046"	"0.47"	"-0.41"	"-0.12"	"-0.30"	"0.48"	"0.01"	"0.88"	"95.8"	"132.4"	"72.3"	"88.2"	"77.9"	"133.3"	"5763.7685546875"	"7965.158203125"	"4346.9306640625"	"5303.93994140625"	"4686.693359375"	"8019.75537109375"	""	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"3"	"379.21844"	"0.0001108"	"0.0003484"	"3.17"	"17.99"
"11737"	"[K].KPGPPVLSSDPNMLSNEEAGHHFEQMLK.[L]"	"1xBiotin [K1]; 1xOxidation [M]"	"0.00711164"	"0.000586377"	"1"	"1"	"2"	"Q99P88"	"Q99P88 [998-1025]"	"Q99P88 1xBiotin [K998]"	"nuclear pore complex protein nup155 [OS=Mus musculus]"	"0"	"3331.55443"	"-0.38"	"-0.53"	"-9.97"	"-9.97"	"-0.27"	"0.11"	"0.27"	"182.4"	"140.3"	"125.9"	""	""	"151.3"	"14125.1865234375"	"10860.9267578125"	"9751.06640625"	""	""	"11717.3173828125"	""	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"4"	"833.64495"	"0.0001108"	"0.0003812"	"3.30"	"43.69"
"11673"	"[K].KPAGATPKKPK.[K]"	"1xBiotin [K]"	"0.000259857"	"0.000586377"	"1"	"1"	"9"	"P43276"	"P43276 [130-140]"	"P43276 1xBiotin [K]"	"Histone H1.5 [OS=Mus musculus]"	"1"	"1348.77695"	"0.53"	"0.64"	"0.49"	"0.50"	"0.75"	"0.21"	"0.10"	"70.5"	"102.2"	"110.0"	"99.3"	"99.6"	"118.3"	"11019.11328125"	"15965.21875"	"17191.919921875"	"15520.822265625"	"15558.32421875"	"18482.1875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"450.26384"	"0.0001108"	"3.024E-06"	"4.71"	"14.05"
"11665"	"[K].KPAAAGVKK.[V]"	"1xBiotin [K8]"	"0.0100166"	"0.000586377"	"1"	"1"	"4"	"P43276"	"P43276 [158-166]"	"P43276 1xBiotin [K165]"	"Histone H1.5 [OS=Mus musculus]"	"1"	"1095.63431"	"0.56"	"0.33"	"0.42"	"0.76"	"0.33"	"-0.23"	"0.00"	"74.7"	"110.4"	"94.2"	"100.0"	"126.8"	"93.9"	"6564.1064453125"	"9699.8896484375"	"8277.6611328125"	"8783.1513671875"	"11138.3662109375"	"8252.0830078125"	""	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"2"	"548.32101"	"0.0001108"	"0.0006284"	"2.25"	"17.79"
"8197"	"[K].GFPTIYFSPANK.[K]"	""	"0.0236878"	"0.00104877"	"1"	"1"	"6"	"P27773"	"P27773 [449-460]"	""	"Protein disulfide-isomerase A3 [OS=Mus musculus]"	"0"	"1341.68376"	"-0.35"	"-0.27"	"0.32"	"-0.31"	"-0.34"	"0.00"	"-0.07"	"110.0"	"86.6"	"91.3"	"136.8"	"88.6"	"86.7"	"10945.083984375"	"8616.998046875"	"9082.5322265625"	"13616.044921875"	"8819.9208984375"	"8624.6015625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"671.34556"	"0.0001873"	"0.002231"	"1.92"	"45.98"
"8209"	"[R].GFVFITFK.[E]"	""	"0.0282973"	"0.00104877"	"1"	"1"	"6"	"Q99020"	"Q99020 [201-208]"	""	"Heterogeneous nuclear ribonucleoprotein A/B [OS=Mus musculus]"	"0"	"958.53967"	"0.46"	"0.29"	"0.11"	"-0.50"	"0.24"	"-0.23"	"-0.05"	"91.4"	"126.1"	"111.5"	"98.7"	"64.6"	"107.6"	"56830.19921875"	"78423.1171875"	"69329.203125"	"61341.6484375"	"40160.09375"	"66921.0703125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"479.77324"	"0.0001873"	"0.002914"	"2.15"	"51.93"
"11661"	"[K].KPAAAAVTK.[K]"	"1xBiotin [K1]"	"0.000858722"	"0.000586377"	"1"	"1"	"6"	"P15864"	"P15864 [160-168]"	"P15864 1xBiotin [K160]"	"Histone H1.2 [OS=Mus musculus]"	"0"	"1082.60268"	"0.29"	"0.55"	"0.55"	"0.45"	"0.57"	"0.28"	"0.02"	"75.0"	"91.8"	"109.5"	"110.1"	"102.3"	"111.2"	"27998.419921875"	"34273.1328125"	"40876.75390625"	"41096.1328125"	"38202.13671875"	"41518.16015625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"541.80494"	"0.0001108"	"1.741E-05"	"3.00"	"24.79"
"11660"	"[K].KPAAAAGAKK.[AV]"	"1xBiotin [K]"	"0.000564341"	"0.000586377"	"2"	"2"	"14"	"P43274; P43277"	"P43274 [160-169]; P43277 [161-170]"	"P43274 1xBiotin [K]; P43277 1xBiotin [K]"	"Histone H1.4 [OS=Mus musculus];Histone H1.3 [OS=Mus musculus]"	"1"	"1138.64012"	"0.93"	"0.97"	"0.85"	"0.78"	"0.81"	"-0.12"	"-0.15"	"59.2"	"112.9"	"115.9"	"106.5"	"101.5"	"104.1"	"31837.3369140625"	"60692.384765625"	"62305.31640625"	"57265.498046875"	"54563.54296875"	"55993.169921875"	"NotUnique"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"569.82343"	"0.0001108"	"9.374E-06"	"3.07"	"15.26"
"11659"	"[K].KPAAAAGAK.[K]"	"1xBiotin [K1]"	"0.00121123"	"0.000586377"	"2"	"2"	"8"	"P43274; P43277"	"P43274 [160-168]; P43277 [161-169]"	"P43274 1xBiotin [K160]; P43277 1xBiotin [K161]"	"Histone H1.4 [OS=Mus musculus];Histone H1.3 [OS=Mus musculus]"	"0"	"1010.54516"	"0.66"	"0.77"	"0.46"	"0.42"	"0.36"	"-0.30"	"-0.41"	"72.5"	"114.4"	"123.4"	"99.6"	"97.2"	"92.9"	"49824.7421875"	"78540.2578125"	"84733.96875"	"68428.96875"	"66753.59375"	"63785.8203125"	"NotUnique"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"505.77610"	"0.0001108"	"2.862E-05"	"2.67"	"19.65"
"11628"	"[R].KNPTDPKLAHLK.[T]"	"1xBiotin [K7]"	"0.0230169"	"0.00104877"	"1"	"1"	"5"	"Q3U9G9"	"Q3U9G9 [524-535]"	"Q3U9G9 1xBiotin [K530]"	"Lamin-B receptor [OS=Mus musculus]"	"2"	"1587.86756"	"1.38"	"0.62"	"0.81"	"0.49"	"0.33"	"-1.05"	"-0.29"	"62.7"	"163.4"	"96.5"	"110.2"	"88.4"	"78.8"	"8645.494140625"	"22528.630859375"	"13302.220703125"	"15188.857421875"	"12183.8388671875"	"10858.6630859375"	""	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"3"	"529.96030"	"0.0001873"	"0.002149"	"2.31"	"30.09"
"8214"	"[K].GFYDKDSSGWSSSK.[D]"	"1xBiotin [K5]"	"0.00105309"	"0.000586377"	"1"	"1"	"5"	"Q62167"	"Q62167 [51-64]"	"Q62167 1xBiotin [K55]"	"ATP-dependent RNA helicase DDX3X [OS=Mus musculus]"	"1"	"1776.75338"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"2"	"888.87932"	"0.0001108"	"2.339E-05"	"1.96"	""
"11671"	"[K].KPAGAAKKPK.[K]"	"1xBiotin [K7]"	"0.000746594"	"0.000586377"	"3"	"3"	"9"	"P43274; P15864; P43277"	"P43274 [130-139]; P15864 [130-139]; P43277 [131-140]"	"P43274 1xBiotin [K136]; P15864 1xBiotin [K136]; P43277 1xBiotin [K137]"	"Histone H1.4 [OS=Mus musculus];Histone H1.2 [OS=Mus musculus];Histone H1.3 [OS=Mus musculus]"	"1"	"1221.71362"	"1.17"	"0.96"	"1.27"	"0.92"	"1.17"	"0.00"	"0.22"	"51.0"	"114.9"	"99.1"	"123.4"	"96.5"	"115.1"	"12569.4697265625"	"28305.46484375"	"24403.271484375"	"30403.38671875"	"23778.14453125"	"28351.9140625"	"NotUnique"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"407.90937"	"0.0001108"	"1.416E-05"	"3.71"	"12.09"
"11738"	"[K].KPGPPVLSSDPNMLSNEEAGHHFEQMLK.[L]"	"1xBiotin [K1]; 2xOxidation [M13; M26]"	"0.00100511"	"0.000586377"	"1"	"1"	"1"	"Q99P88"	"Q99P88 [998-1025]"	"Q99P88 1xBiotin [K998]"	"nuclear pore complex protein nup155 [OS=Mus musculus]"	"0"	"3347.54934"	"-0.20"	"-0.17"	"-0.87"	"-9.97"	"0.09"	"0.29"	"0.26"	"137.1"	"119.7"	"122.1"	"75.1"	""	"146.0"	"25988.56640625"	"22700.234375"	"23141.716796875"	"14238.197265625"	""	"27679.140625"	""	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"4"	"837.64295"	"0.0001108"	"2.182E-05"	"3.96"	"40.66"
"8170"	"[R].GFGGKYGVER.[D]"	"1xBiotin [K5]"	"0.00423822"	"0.000586377"	"1"	"1"	"4"	"P49710"	"P49710 [119-128]"	"P49710 1xBiotin [K123]"	"Hematopoietic lineage cell-specific protein [OS=Mus musculus]"	"1"	"1295.62012"	"-0.25"	"-0.05"	"0.22"	"0.15"	"-0.06"	"0.18"	"-0.02"	"99.3"	"83.6"	"96.1"	"115.8"	"110.2"	"95.0"	"64736.35546875"	"54496.4375"	"62617.7890625"	"75509.140625"	"71841.3046875"	"61890.890625"	""	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"2"	"648.31389"	"0.0001108"	"0.0001784"	"2.62"	"36.41"
"11790"	"[R].KPISTHTVDFAFNK.[F]"	"1xBiotin [K1]"	"1.5451E-05"	"0.000586377"	"1"	"1"	"8"	"O70309"	"O70309 [776-789]"	"O70309 1xBiotin [K776]"	"Integrin beta-5 [OS=Mus musculus]"	"0"	"1830.92072"	"0.62"	"0.16"	"0.19"	"-1.32"	"0.35"	"-0.27"	"0.19"	"92.9"	"142.3"	"103.7"	"105.7"	"37.2"	"118.2"	"61809.0078125"	"94699.3671875"	"68984.375"	"70298.36328125"	"24765.693359375"	"78643.125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"610.97840"	"0.0001108"	"4.931E-08"	"4.65"	"41.46"
"12009"	"[R].KRPTSASSSPEPPEFSTFR.[A]"	"1xBiotin [K1]"	"0.000364433"	"0.000586377"	"1"	"2"	"6"	"Q75VT8"	"Q75VT8 [201-219]"	"Q75VT8 1xBiotin [K201]"	"Protein HIDE1 [OS=Mus musculus]"	"1"	"2334.11831"	"0.19"	"-0.04"	"0.34"	"-0.37"	"0.42"	"0.23"	"0.46"	"92.4"	"105.7"	"89.9"	"116.8"	"71.3"	"123.9"	"20229.98046875"	"23154.6796875"	"19693.345703125"	"25578.68359375"	"15625.580078125"	"27150.125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"778.71074"	"0.0001108"	"4.975E-06"	"2.95"	"37.65"
"11999"	"[R].KRPDEVPDDDEPAGPMKTNSTNNHK.[D]"	"1xBiotin [K]; 1xOxidation [M16]"	"4.78947E-05"	"0.000586377"	"1"	"3"	"19"	"P97300"	"P97300 [363-387]"	"P97300 1xBiotin [K]"	"Neuroplastin [OS=Mus musculus]"	"2"	"3034.36292"	"0.20"	"-0.01"	"0.36"	"-0.45"	"0.05"	"-0.15"	"0.06"	"96.9"	"111.5"	"96.1"	"124.4"	"70.8"	"100.2"	"85406.1411132813"	"98300.171875"	"84710.580078125"	"109658.669433594"	"62435.41796875"	"88315.88671875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"4"	"759.34640"	"0.0001108"	"2.569E-07"	"5.48"	"24.37"
"11960"	"[K].KQVFTNNIPK.[A]"	"1xBiotin [K1]"	"0.000538621"	"0.000586377"	"1"	"2"	"6"	"Q4FZC9-1"	"Q4FZC9-1 [765-774]"	"Q4FZC9-1 1xBiotin [K765]"	"Nesprin-3 [OS=Mus musculus]"	"1"	"1414.75113"	"0.43"	"0.14"	"0.22"	"0.17"	"0.09"	"-0.35"	"-0.05"	"88.0"	"119.0"	"97.2"	"102.8"	"99.3"	"93.7"	"42802.9921875"	"57852.3125"	"47283.6640625"	"49970.46875"	"48271.328125"	"45545.34765625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"707.87925"	"0.0001108"	"8.793E-06"	"3.20"	"37.80"
"11936"	"[K].KQNMILSDEAVK.[Y]"	"1xBiotin [K1]; 1xOxidation [M4]"	"0.000676144"	"0.000586377"	"1"	"2"	"5"	"Q8BI84-1"	"Q8BI84-1 [1280-1291]"	"Q8BI84-1 1xBiotin [K1280]"	"Transport and Golgi organization protein 1 homolog [OS=Mus musculus]"	"1"	"1617.79749"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"2"	"809.40261"	"0.0001108"	"1.223E-05"	"2.65"	""
"8142"	"[K].GEVSGLTKEFR.[N]"	"1xBiotin [K8]"	"0.00064533"	"0.000586377"	"1"	"1"	"8"	"Q91WE6"	"Q91WE6 [508-518]"	"Q91WE6 1xBiotin [K515]"	"threonylcarbamoyladenosine tRNA methylthiotransferase [OS=Mus musculus]"	"1"	"1448.72023"	"0.18"	"0.01"	"0.23"	"0.27"	"0.05"	"-0.13"	"0.04"	"91.5"	"103.5"	"92.3"	"107.6"	"110.4"	"94.6"	"120231.9296875"	"136000.484375"	"121269.234375"	"141400.03125"	"145028.90625"	"124321.7421875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"724.86389"	"0.0001108"	"1.149E-05"	"3.50"	"41.01"
"11906"	"[R].KQLATKAAR.[K]"	"1xBiotin [K6]"	"0.00364297"	"0.000586377"	"1"	"3"	"12"	"P68433"	"P68433 [19-27]"	"P68433 1xBiotin [K24]"	"Histone H3.1 [OS=Mus musculus]"	"2"	"1212.68814"	"0.67"	"0.25"	"0.24"	"0.26"	"0.30"	"-0.37"	"0.05"	"81.2"	"128.9"	"96.8"	"95.8"	"97.4"	"100.0"	"79087.693359375"	"125535.64453125"	"94243.21484375"	"93270.33203125"	"94851.775390625"	"97423.1640625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"606.84780"	"0.0001108"	"0.0001437"	"2.41"	"21.58"
"11905"	"[R].KQLATK.[A]"	"1xBiotin [K1]"	"0.11579"	"0.00731053"	"1"	"4"	"6"	"P68433"	"P68433 [19-24]"	"P68433 1xBiotin [K19]"	"Histone H3.1 [OS=Mus musculus]"	"1"	"914.51280"	"0.48"	"0.08"	"-0.03"	"0.29"	"0.25"	"-0.23"	"0.17"	"87.8"	"122.2"	"92.8"	"85.9"	"107.3"	"104.1"	"180430.375"	"251186.109375"	"190746.203125"	"176638.984375"	"220667.125"	"214010.25"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"457.75994"	"0.001478"	"0.02408"	"2.25"	"23.64"
"8153"	"[R].GFCFITFK.[E]"	"1xCarbamidomethyl [C3]"	"0.027975"	"0.00104877"	"1"	"4"	"6"	"Q60668-1"	"Q60668-1 [224-231]"	""	"heterogeneous nuclear ribonucleoprotein D0 [OS=Mus musculus]"	"0"	"1019.50190"	"0.80"	"0.60"	"0.69"	"0.34"	"0.30"	"-0.50"	"-0.29"	"71.7"	"125.0"	"108.5"	"115.6"	"90.7"	"88.5"	"62653.98046875"	"109193.046875"	"94786.84375"	"100941.6640625"	"79194.171875"	"77260.3984375"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"2"	"510.25429"	"0.0001873"	"0.002857"	"2.26"	"49.58"
"11876"	"[K].KQAGPASVPLR.[T]"	"1xBiotin [K1]"	"0.00156533"	"0.000586377"	"1"	"1"	"3"	"P27773"	"P27773 [130-140]"	"P27773 1xBiotin [K130]"	"Protein disulfide-isomerase A3 [OS=Mus musculus]"	"1"	"1349.73582"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"2"	"675.37147"	"0.0001108"	"4.179E-05"	"2.48"	""
"11864"	"[R].KPVVATISKGGYLQGNMSGR.[L]"	"1xBiotin [K9]; 1xOxidation [M17]"	"1.22364E-05"	"0.000586377"	"1"	"1"	"4"	"Q9WTR6"	"Q9WTR6 [4-23]"	"Q9WTR6 1xBiotin [K12]"	"Cystine/glutamate transporter [OS=Mus musculus]"	"1"	"2305.17913"	"-0.30"	"0.16"	"0.11"	"-1.61"	"0.23"	"0.53"	"0.07"	"109.1"	"88.4"	"121.5"	"117.5"	"35.7"	"127.7"	"276726.6875"	"224149.75"	"308213.6875"	"298015.53125"	"90540.0546875"	"323834.75"	""	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"3"	"769.06498"	"0.0001108"	"3.518E-08"	"5.19"	"38.25"
"11863"	"[R].KPVVATISKGGYLQGNMSGR.[L]"	"1xBiotin [K9]"	"1.11363E-06"	"0.000586377"	"1"	"1"	"6"	"Q9WTR6"	"Q9WTR6 [4-23]"	"Q9WTR6 1xBiotin [K12]"	"Cystine/glutamate transporter [OS=Mus musculus]"	"1"	"2289.18422"	"1.06"	"0.66"	"0.47"	"-0.57"	"0.93"	"-0.13"	"0.27"	"69.5"	"144.7"	"110.1"	"96.4"	"46.8"	"132.5"	"37997.80859375"	"79060.828125"	"60193.1171875"	"52669.9140625"	"25581.06640625"	"72399.703125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"763.73283"	"0.0001108"	"1.059E-09"	"4.81"	"40.83"
"11862"	"[R].KPVVATISK.[G]"	"1xBiotin [K1]"	"0.00106544"	"0.000586377"	"1"	"1"	"6"	"Q9WTR6"	"Q9WTR6 [4-12]"	"Q9WTR6 1xBiotin [K4]"	"Cystine/glutamate transporter [OS=Mus musculus]"	"0"	"1168.67584"	"0.57"	"0.14"	"0.93"	"0.80"	"0.50"	"-0.08"	"0.36"	"69.4"	"103.3"	"76.4"	"132.3"	"120.6"	"97.9"	"15620.716796875"	"23239.94921875"	"17194.302734375"	"29760.171875"	"27132.58203125"	"22021.841796875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"584.84132"	"0.0001108"	"2.379E-05"	"3.65"	"33.50"
"8159"	"[R].GFENVELGVMGKK.[K]"	"1xBiotin [K12]"	"5.63898E-05"	"0.000586377"	"1"	"1"	"6"	"Q8BR63"	"Q8BR63 [33-45]"	"Q8BR63 1xBiotin [K44]"	"Protein FAM177A1 [OS=Mus musculus]"	"1"	"1633.80766"	"0.96"	"0.74"	"0.35"	"0.48"	"0.83"	"-0.13"	"0.09"	"66.2"	"129.1"	"110.7"	"84.2"	"92.0"	"117.8"	"44158.4375"	"86064.6328125"	"73825.1875"	"56124.015625"	"61380.171875"	"78583.0703125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"817.40788"	"0.0001108"	"3.249E-07"	"4.19"	"47.52"
"8160"	"[R].GFENVELGVMGKK.[K]"	"1xBiotin [K]; 1xOxidation [M10]"	"3.72722E-05"	"0.000586377"	"1"	"1"	"23"	"Q8BR63"	"Q8BR63 [33-45]"	"Q8BR63 1xBiotin [K]"	"Protein FAM177A1 [OS=Mus musculus]"	"1"	"1649.80257"	"-0.03"	"-0.08"	"-0.14"	"-0.82"	"0.14"	"0.17"	"0.22"	"109.2"	"107.0"	"103.1"	"98.9"	"61.7"	"120.2"	"245435.724609375"	"240396.9765625"	"231612.490234375"	"222143.20703125"	"138664.879882813"	"270080.276367188"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"825.40567"	"0.0001108"	"1.779E-07"	"4.58"	"41.71"
"8167"	"[R].GFGFILFK.[D]"	""	"0.0562059"	"0.0019826"	"1"	"1"	"7"	"Q99020"	"Q99020 [117-124]"	""	"Heterogeneous nuclear ribonucleoprotein A/B [OS=Mus musculus]"	"0"	"928.52910"	"0.16"	"0.25"	"-0.06"	"-1.94"	"0.07"	"-0.09"	"-0.17"	"107.5"	"120.5"	"127.6"	"103.0"	"28.1"	"113.2"	"339209.75"	"380180.5625"	"402474.8125"	"324830.3125"	"88628.9765625"	"357163.96875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"464.76786"	"0.0003442"	"0.008049"	"1.87"	"55.63"
"11826"	"[R].KPSELNGEASKSQEMVHLVNK.[E]"	"1xBiotin [K11]; 1xOxidation [M15]"	"0.00431287"	"0.000586377"	"1"	"11"	"8"	"P15379-14"	"P15379-14 [731-751]"	"P15379-14 1xBiotin [K741]"	"CD44 antigen [OS=Mus musculus]"	"1"	"2567.25923"	"-9.97"	"-9.97"	"-9.97"	"-9.97"	"1.09"	"9.97"	"9.97"	"191.5"	""	""	""	""	"408.5"	"12081.283203125"	""	""	""	""	"25773.59765625"	""	"High"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"4"	"642.57008"	"0.0001108"	"0.0001838"	"3.28"	"31.72"
"11816"	"[R].KPQQQYAKK.[T]"	"1xBiotin [K]"	"0.001136"	"0.000586377"	"1"	"1"	"21"	"Q8VBT0"	"Q8VBT0 [213-221]"	"Q8VBT0 1xBiotin [K]"	"Thioredoxin-related transmembrane protein 1 [OS=Mus musculus]"	"1"	"1344.70927"	"0.40"	"0.36"	"0.28"	"0.23"	"0.43"	"0.03"	"0.07"	"81.8"	"107.9"	"104.7"	"99.5"	"95.9"	"110.2"	"159615.17578125"	"210544.19140625"	"204254.93359375"	"194109.99609375"	"187156.10546875"	"215020.65625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"672.85829"	"0.0001108"	"2.605E-05"	"2.80"	"18.64"
"11807"	"[R].KPPLQPKPVVLTTVPVPPR.[A]"	"1xBiotin [K]"	"0.00125434"	"0.000586377"	"1"	"1"	"7"	"O35451"	"O35451 [238-256]"	"O35451 1xBiotin [K]"	"Cyclic AMP-dependent transcription factor ATF-6 beta [OS=Mus musculus]"	"0"	"2289.35154"	"-0.71"	"-0.25"	"0.02"	"-9.97"	"-0.60"	"0.11"	"-0.35"	"145.4"	"88.8"	"122.6"	"147.1"	""	"96.1"	"25909.345703125"	"15820.6708984375"	"21835.158203125"	"26204.912109375"	""	"17130.01953125"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"763.78893"	"0.0001108"	"3.009E-05"	"4.04"	"46.31"
"8168"	"[R].GFGFVLFK.[ED]"	""	"0.0451294"	"0.00154748"	"1"	"5"	"6"	"Q60668-1"	"Q60668-1 [139-146]"	""	"heterogeneous nuclear ribonucleoprotein D0 [OS=Mus musculus]"	"0"	"914.51345"	"0.09"	"0.30"	"0.15"	"-1.36"	"-0.12"	"-0.20"	"-0.42"	"105.1"	"111.4"	"129.4"	"116.3"	"40.9"	"96.9"	"218812.171875"	"232108.90625"	"269602.875"	"242151.0625"	"85092.2578125"	"201845.171875"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"2"	"457.76013"	"0.0002716"	"0.005793"	"1.92"	"53.63"
"12033"	"[R].KSAPATGGVK.[K]"	"1xBiotin [K1]"	"0.00278689"	"0.000586377"	"1"	"2"	"6"	"P68433"	"P68433 [28-37]"	"P68433 1xBiotin [K28]"	"Histone H3.1 [OS=Mus musculus]"	"1"	"1141.60340"	"0.19"	"-0.03"	"0.12"	"0.34"	"-0.08"	"-0.27"	"-0.05"	"93.6"	"106.4"	"91.6"	"101.6"	"118.4"	"88.4"	"44780.99609375"	"50925.2734375"	"43813.9375"	"48625.1328125"	"56669.7265625"	"42324.78125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"571.30529"	"0.0001108"	"9.65E-05"	"2.91"	"23.63"
"8217"	"[R].GGAESHTFK.[-]"	"1xBiotin [K9]"	"0.00341697"	"0.000586377"	"1"	"1"	"11"	"P63254"	"P63254 [69-77]"	"P63254 1xBiotin [K77]"	"Cysteine-rich protein 1 [OS=Mus musculus]"	"0"	"1159.52007"	"0.31"	"-0.15"	"0.03"	"0.02"	"0.16"	"-0.15"	"0.31"	"95.5"	"118.0"	"86.0"	"97.5"	"96.5"	"106.5"	"118880.3515625"	"146956.015625"	"107037.453125"	"121422.203125"	"120207.1953125"	"132541.109375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"580.26370"	"0.0001108"	"0.0001308"	"2.21"	"30.26"
"12335"	"[R].KVGLIAAR.[R]"	"1xBiotin [K1]"	"0.0502349"	"0.00154748"	"1"	"1"	"4"	"P62918"	"P62918 [234-241]"	"P62918 1xBiotin [K234]"	"60S ribosomal protein L8 [OS=Mus musculus]"	"1"	"1053.62375"	"-9.97"	"-0.26"	"0.14"	"-0.07"	"0.39"	"9.97"	"0.64"	"115.5"	""	"96.6"	"126.8"	"110.1"	"151.0"	"12005.9267578125"	""	"10048.490234375"	"13184.091796875"	"11450.60546875"	"15700.9375"	""	"High"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"High"	"2"	"527.31537"	"0.0002716"	"0.006834"	"1.44"	"36.64"
"7691"	"[R].GAEPSGGAKR.[H]"	"1xBiotin [K9]"	"0.00711164"	"0.000586377"	"1"	"1"	"10"	"Q9DAV9"	"Q9DAV9 [277-286]"	"Q9DAV9 1xBiotin [K285]"	"Trimeric intracellular cation channel type B [OS=Mus musculus]"	"1"	"1155.55752"	"0.24"	"0.25"	"0.07"	"0.21"	"0.10"	"-0.13"	"-0.14"	"90.2"	"106.4"	"107.0"	"94.9"	"104.5"	"97.0"	"19934.15625"	"23519.357421875"	"23639.39453125"	"20962.095703125"	"23099.5390625"	"21433.49609375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"578.28222"	"0.0001108"	"0.0003806"	"2.16"	"19.44"
"7389"	"[R].FPLFGGWK.[T]"	""	"0.0282973"	"0.00104877"	"1"	"1"	"11"	"Q91YQ5"	"Q91YQ5 [321-328]"	""	"Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 [OS=Mus musculus]"	"0"	"951.50870"	"0.34"	"-0.05"	"-0.10"	"-1.72"	"0.13"	"-0.21"	"0.17"	"107.8"	"136.5"	"104.5"	"100.7"	"32.8"	"117.6"	"140069.6875"	"177300.265625"	"135737.15625"	"130767.890625"	"42648.93359375"	"152769.90625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"476.25758"	"0.0001873"	"0.002911"	"2.14"	"51.61"
"12983"	"[K].LDSFIKAPECSSK.[D]"	"1xBiotin [K6]; 1xCarbamidomethyl [C10]"	"0.0297929"	"0.00104877"	"1"	"1"	"2"	"P49070"	"P49070 [112-124]"	"P49070 1xBiotin [K117]"	"calcium signal-modulating cyclophilin ligand [OS=Mus musculus]"	"1"	"1707.80805"	"-9.97"	"-0.68"	"0.04"	"-0.52"	"-9.97"	""	"-9.97"	"179.1"	""	"111.8"	"183.9"	"125.3"	""	"13354.5966796875"	""	"8332.373046875"	"13709.216796875"	"9338.736328125"	""	""	"High"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"High"	"2"	"854.40807"	"0.0001873"	"0.003136"	"1.81"	"40.70"
"12951"	"[K].LDMSAKTTR.[H]"	"1xBiotin [K6]; 1xOxidation [M3]"	"0.00566911"	"0.000586377"	"1"	"1"	"7"	"Q01965"	"Q01965 [516-524]"	"Q01965 1xBiotin [K521]"	"T-lymphocyte surface antigen Ly-9 [OS=Mus musculus]"	"1"	"1264.60242"	"0.12"	"0.06"	"0.11"	"-0.83"	"0.21"	"0.09"	"0.15"	"101.3"	"109.8"	"105.6"	"109.2"	"56.9"	"117.2"	"56404.73046875"	"61126.3203125"	"58802.046875"	"60781.36328125"	"31683.7109375"	"65244.81640625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"632.80507"	"0.0001108"	"0.0002745"	"2.51"	"24.31"
"12950"	"[K].LDMSAKTTR.[H]"	"1xBiotin [K6]"	"0.00861397"	"0.000586377"	"1"	"1"	"6"	"Q01965"	"Q01965 [516-524]"	"Q01965 1xBiotin [K521]"	"T-lymphocyte surface antigen Ly-9 [OS=Mus musculus]"	"1"	"1248.60750"	"0.82"	"0.83"	"0.21"	"1.42"	"0.36"	"-0.46"	"-0.47"	"62.1"	"109.9"	"110.6"	"72.0"	"165.7"	"79.7"	"31209.1796875"	"55233.66015625"	"55569.16796875"	"36205.43359375"	"83283.0234375"	"40081.2890625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"624.80736"	"0.0001108"	"0.0005048"	"2.66"	"33.00"
"12933"	"[K].LDLISKGEEPK.[G]"	"1xBiotin [K]"	"0.00104697"	"0.000586377"	"1"	"1"	"8"	"Q9JIM1-1"	"Q9JIM1-1 [250-260]"	"Q9JIM1-1 1xBiotin [K]"	"Equilibrative nucleoside transporter 1 [OS=Mus musculus]"	"1"	"1454.75594"	"0.49"	"-0.05"	"0.32"	"0.39"	"0.36"	"-0.13"	"0.41"	"83.2"	"116.8"	"80.2"	"103.8"	"109.2"	"106.7"	"35746.19921875"	"50194.60546875"	"34456.8359375"	"44609.20703125"	"46930.54296875"	"45862.4921875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"727.88169"	"0.0001108"	"2.323E-05"	"2.65"	"42.02"
"7407"	"[K].FPSPHPSPAKLK.[A]"	"1xBiotin [K10]"	"0.000149329"	"0.000586377"	"1"	"1"	"20"	"Q61070"	"Q61070 [324-335]"	"Q61070 1xBiotin [K333]"	"Etoposide-induced protein 2.4 [OS=Mus musculus]"	"1"	"1531.80898"	"0.24"	"0.28"	"0.18"	"0.14"	"0.10"	"-0.14"	"-0.18"	"89.5"	"105.6"	"108.4"	"101.7"	"98.9"	"95.8"	"111965.423828125"	"131999.27734375"	"135607.216796875"	"127234.69140625"	"123618.89453125"	"119857.71875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"511.27439"	"0.0001108"	"1.354E-06"	"3.43"	"34.00"
"12921"	"[K].LDKSQIHDIVLVGGSTR.[I]"	"1xBiotin [K3]"	"6.21551E-07"	"0.000586377"	"1"	"1"	"6"	"P63017"	"P63017 [326-342]"	"P63017 1xBiotin [K328]"	"Heat shock cognate 71 kDa protein [OS=Mus musculus]"	"1"	"2064.09063"	"0.49"	"0.44"	"-0.38"	"-2.80"	"0.48"	"-0.02"	"0.03"	"98.8"	"139.1"	"134.3"	"76.0"	"14.2"	"137.5"	"29867.369140625"	"42017.5078125"	"40584.921875"	"22977.755859375"	"4299.25341796875"	"41542.4296875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"688.70165"	"0.0001108"	"4.518E-10"	"6.04"	"47.19"
"12919"	"[K].LDKNDR.[A]"	"1xBiotin [K3]"	"0.106881"	"0.00731053"	"1"	"1"	"7"	"P51150"	"P51150 [192-197]"	"P51150 1xBiotin [K194]"	"ras-related protein Rab-7a [OS=Mus musculus]"	"1"	"986.47239"	"0.39"	"0.14"	"-0.10"	"0.20"	"0.41"	"0.02"	"0.27"	"87.9"	"115.0"	"96.9"	"82.2"	"101.0"	"116.9"	"128236.8125"	"167693.171875"	"141365.703125"	"119893.515625"	"147356.609375"	"170573.046875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"493.73979"	"0.001426"	"0.02134"	"1.94"	"23.64"
"13062"	"[K].LEDKSASPGLPK.[G]"	"1xBiotin [K4]"	"0.000179964"	"0.000586377"	"1"	"2"	"9"	"Q9EQU5"	"Q9EQU5 [24-35]"	"Q9EQU5 1xBiotin [K27]"	"Protein SET [OS=Mus musculus]"	"1"	"1467.75119"	"0.53"	"0.10"	"0.58"	"0.70"	"0.42"	"-0.11"	"0.31"	"75.3"	"108.6"	"80.9"	"112.3"	"122.4"	"100.5"	"56209.75"	"81114.265625"	"60403.234375"	"83871.515625"	"91422.65625"	"75060.640625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"734.37991"	"0.0001108"	"1.773E-06"	"3.16"	"34.08"
"12918"	"[KR].IDKIWPK.[L]"	"1xBiotin [K3]"	"0.0224937"	"0.00104877"	"2"	"4"	"5"	"Q6Q477; G5E829"	"Q6Q477 [744-750]; G5E829 [755-761]"	"Q6Q477 1xBiotin [K746]; G5E829 1xBiotin [K757]"	"Plasma membrane calcium-transporting ATPase 4 [OS=Mus musculus];Plasma membrane calcium-transporting ATPase 1 [OS=Mus musculus]"	"1"	"1125.61251"	"0.28"	"0.69"	"0.07"	"0.16"	"0.26"	"-0.02"	"-0.43"	"83.3"	"101.5"	"134.7"	"87.5"	"93.2"	"99.8"	"15038.5380859375"	"18319.91015625"	"24302.501953125"	"15793.388671875"	"16818.037109375"	"18013.86328125"	"NotUnique"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"2"	"563.30976"	"0.0001873"	"0.00207"	"2.64"	"42.61"
"12895"	"[K].LDDLVSKSEVLGTQSK.[A]"	"1xBiotin [K7]"	"2.40679E-05"	"0.000586377"	"1"	"1"	"5"	"Q9CQW1"	"Q9CQW1 [167-182]"	"Q9CQW1 1xBiotin [K173]"	"Synaptobrevin homolog YKT6 [OS=Mus musculus]"	"1"	"1944.99467"	"1.02"	"0.30"	"0.79"	"-0.10"	"0.67"	"-0.35"	"0.37"	"70.6"	"142.8"	"86.8"	"122.0"	"65.7"	"112.1"	"22264.849609375"	"45048.3359375"	"27394.310546875"	"38494.4609375"	"20740.576171875"	"35366.21875"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"2"	"973.00091"	"0.0001108"	"9.391E-08"	"4.31"	"47.52"
"12866"	"[R].LCQLKGSSCQYR.[A]"	"1xBiotin [K5]; 2xCarbamidomethyl [C2; C9]"	"0.00235371"	"0.000586377"	"3"	"3"	"5"	"O88839-2; O88839-1; O88839-3"	"O88839-2 [726-737]; O88839-1 [726-737]; O88839-3 [726-737]"	"O88839-2 1xBiotin [K730]; O88839-1 1xBiotin [K730]; O88839-3 1xBiotin [K730]"	"Isoform 2 of Disintegrin and metalloproteinase domain-containing protein 15 [OS=Mus musculus];Disintegrin and metalloproteinase domain-containing protein 15 [OS=Mus musculus];Isoform 3 of Disintegrin and metalloproteinase domain-containing protein 15 [OS=Mus musculus]"	"1"	"1725.78694"	"-9.97"	"-9.97"	"-9.97"	"-9.97"	"-9.97"	""	""	"600.0"	""	""	""	""	""	"6443.607421875"	""	""	""	""	""	"NotUnique"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"2"	"863.39750"	"0.0001108"	"7.573E-05"	"2.59"	"33.34"
"7409"	"[K].FPSSGLATPQPTALTFAKSSWAR.[Q]"	"1xBiotin [K18]"	"7.85548E-06"	"0.000586377"	"1"	"1"	"14"	"P70295"	"P70295 [360-382]"	"P70295 1xBiotin [K377]"	"Ancient ubiquitous protein 1 [OS=Mus musculus]"	"1"	"2647.33372"	"-0.39"	"-0.22"	"-3.64"	"-9.97"	"0.36"	"0.75"	"0.58"	"150.6"	"115.0"	"129.1"	"12.1"	""	"193.2"	"91403.640625"	"69810.40625"	"78392.5390625"	"7325.66552734375"	""	"117294.265625"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"883.11588"	"0.0001108"	"1.841E-08"	"5.46"	"56.52"
"12831"	"[K].ICDELIAKLGK.[T]"	"1xBiotin [K8]; 1xCarbamidomethyl [C2]"	"0.000557798"	"0.000586377"	"1"	"2"	"5"	"Q6Y685-2"	"Q6Y685-2 [356-366]"	"Q6Y685-2 1xBiotin [K363]"	"Isoform 2 of Transforming acidic coiled-coil-containing protein 1 [OS=Mus musculus]"	"1"	"1485.78038"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"2"	"743.39428"	"0.0001108"	"9.215E-06"	"2.18"	""
"7417"	"[R].FPVPTYAAKQPAQFPSRPPPPQPK.[I]"	"1xBiotin [K9]"	"0.00383893"	"0.000586377"	"1"	"1"	"6"	"Q61072"	"Q61072 [799-822]"	"Q61072 1xBiotin [K807]"	"disintegrin and metalloproteinase domain-containing protein 9 [OS=Mus musculus]"	"1"	"2872.49670"	"0.35"	"0.51"	"-1.50"	"-9.97"	"0.46"	"0.11"	"-0.05"	"110.5"	"141.0"	"157.3"	"38.9"	""	"152.2"	"26361.1782226563"	"33635.5263671875"	"37517.51953125"	"9288.3701171875"	""	"36304.83984375"	""	"High"	"High"	"High"	"Peak Found"	"Not Found"	"High"	"High"	"3"	"958.16989"	"0.0001108"	"0.0001544"	"3.56"	"43.43"
"7445"	"[K].FQTSKSGSLPLGQK.[V]"	"1xBiotin [K5]"	"7.94049E-07"	"0.000586377"	"1"	"2"	"10"	"Q6P1H6-1"	"Q6P1H6-1 [682-695]"	"Q6P1H6-1 1xBiotin [K686]"	"ankyrin repeat and LEM domain-containing protein 2 [OS=Mus musculus]"	"1"	"1703.87852"	"0.70"	"0.53"	"0.80"	"0.15"	"0.50"	"-0.21"	"-0.03"	"72.0"	"117.4"	"103.7"	"125.4"	"79.9"	"101.5"	"61540.1962890625"	"100315.33984375"	"88630.763671875"	"107156.251953125"	"68254.875"	"86737.240234375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"852.44316"	"0.0001108"	"6.451E-10"	"5.00"	"38.85"
"12815"	"[K].LAWLSSMTK.[-]"	"1xBiotin [K9]; 1xOxidation [M7]"	"0.0964872"	"0.00379267"	"1"	"1"	"1"	"Q9Z160"	"Q9Z160 [972-980]"	"Q9Z160 1xBiotin [K980]"	"conserved oligomeric Golgi complex subunit 1 [OS=Mus musculus]"	"0"	"1278.62209"	"0.04"	"0.20"	"-0.23"	"-1.08"	"0.00"	"-0.04"	"-0.20"	"109.1"	"112.1"	"125.2"	"93.0"	"51.6"	"109.0"	"6094.11181640625"	"6263.6728515625"	"6993.90283203125"	"5197.90673828125"	"2882.0517578125"	"6087.3603515625"	""	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"2"	"639.81435"	"0.0008081"	"0.01829"	"1.42"	"48.99"
"12801"	"[R].LAVLKGQDPSR.[V]"	"1xBiotin [K5]"	"0.000729384"	"0.000586377"	"1"	"1"	"6"	"Q9DAZ9"	"Q9DAZ9 [259-269]"	"Q9DAZ9 1xBiotin [K263]"	"Abscission/NoCut checkpoint regulator [OS=Mus musculus]"	"1"	"1409.75694"	"0.45"	"0.14"	"0.35"	"0.36"	"0.56"	"0.11"	"0.41"	"80.0"	"109.3"	"88.4"	"102.2"	"102.4"	"117.8"	"29400.14453125"	"40195.9296875"	"32494.255859375"	"37577.22265625"	"37633.82421875"	"43314.55859375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"705.38209"	"0.0001108"	"1.362E-05"	"2.81"	"36.35"
"12916"	"[R].LDKAALNALQPPEFR.[N]"	"1xBiotin [K3]"	"3.39214E-06"	"0.000586377"	"1"	"2"	"273"	"Q78T54"	"Q78T54 [4-18]"	"Q78T54 1xBiotin [K6]"	"Vacuolar ATPase assembly integral membrane protein vma21 [OS=Mus musculus]"	"1"	"1909.00003"	"0.28"	"0.32"	"-0.65"	"-3.59"	"0.33"	"0.04"	"0.01"	"110.3"	"134.3"	"137.6"	"70.4"	"9.2"	"138.3"	"18530211.5322266"	"22561608.1333008"	"23121366.1757813"	"11838474.6945801"	"1537804.26928711"	"23240730.6582031"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"955.00369"	"0.0001108"	"5.372E-09"	"4.85"	"52.46"
"13080"	"[K].LEEDMLCLLYGKNR.[G]"	"1xBiotin [K12]; 1xCarbamidomethyl [C7]"	"1.24523E-05"	"0.000586377"	"1"	"2"	"14"	"Q3TNL8-1"	"Q3TNL8-1 [261-274]"	"Q3TNL8-1 1xBiotin [K272]"	"Inositol 1,4,5-trisphosphate receptor-interacting protein [OS=Mus musculus]"	"1"	"1979.93875"	"0.35"	"0.25"	"-1.91"	"-9.97"	"0.49"	"0.14"	"0.24"	"116.9"	"149.2"	"138.7"	"31.2"	""	"164.0"	"161380.734375"	"205913.3828125"	"191444.1796875"	"42997.072265625"	""	"226421.1015625"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"2"	"990.47318"	"0.0001108"	"3.598E-08"	"4.15"	"56.29"
"13081"	"[K].LEEDMLCLLYGKNR.[G]"	"1xBiotin [K12]; 1xCarbamidomethyl [C7]; 1xOxidation [M5]"	"2.00875E-05"	"0.000586377"	"1"	"2"	"27"	"Q3TNL8-1"	"Q3TNL8-1 [261-274]"	"Q3TNL8-1 1xBiotin [K272]"	"Inositol 1,4,5-trisphosphate receptor-interacting protein [OS=Mus musculus]"	"1"	"1995.93367"	"-0.14"	"0.01"	"-0.24"	"-2.58"	"0.07"	"0.22"	"0.06"	"120.4"	"108.9"	"121.6"	"102.2"	"20.1"	"126.8"	"317544.638671875"	"287262.236328125"	"320750.604492188"	"269455.7734375"	"53117.6411132813"	"334401.625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"998.47017"	"0.0001108"	"7.241E-08"	"3.09"	"48.51"
"13087"	"[R].IEEELGSKAK.[F]"	"1xBiotin [K8]"	"0.00331892"	"0.000586377"	"1"	"1"	"5"	"P17182"	"P17182 [413-422]"	"P17182 1xBiotin [K420]"	"alpha-enolase [OS=Mus musculus]"	"1"	"1329.67188"	"-9.97"	"-9.97"	"0.23"	"0.05"	"0.00"	"9.97"	"9.97"	"142.5"	""	""	"167.3"	"147.6"	"142.6"	"18564.283203125"	""	""	"21804.033203125"	"19225.349609375"	"18580.5703125"	""	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"2"	"665.33968"	"0.0001108"	"0.0001247"	"2.85"	"31.91"
"7301"	"[K].FIVKGMVER.[F]"	"1xBiotin [K4]; 1xOxidation [M6]"	"0.0313657"	"0.00104877"	"1"	"1"	"3"	"Q9CY18"	"Q9CY18 [100-108]"	"Q9CY18 1xBiotin [K103]"	"sorting nexin-7 [OS=Mus musculus]"	"1"	"1320.68028"	"-0.14"	"-0.16"	"-0.35"	"-1.68"	"-0.05"	"0.09"	"0.11"	"123.4"	"111.8"	"110.5"	"96.6"	"38.5"	"119.3"	"41664.39453125"	"37755.71484375"	"37311.47265625"	"32610.7109375"	"12986.7705078125"	"40284.73046875"	""	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"2"	"660.84331"	"0.0001873"	"0.003388"	"1.51"	"37.31"
"13372"	"[R].IFGPIWNR.[D]"	""	"0.0180723"	"0.000586377"	"1"	"1"	"5"	"Q00612"	"Q00612 [220-227]"	""	"Glucose-6-phosphate 1-dehydrogenase X [OS=Mus musculus]"	"0"	"1002.55196"	"0.31"	"0.10"	"0.48"	"0.02"	"0.05"	"-0.26"	"-0.05"	"88.9"	"110.4"	"94.9"	"123.9"	"89.9"	"91.9"	"78076.3046875"	"96961.6953125"	"83390.84375"	"108862.171875"	"78997.0625"	"80714.9765625"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"2"	"501.77952"	"0.0001108"	"0.001493"	"1.91"	"43.70"
"13368"	"[R].IFGINKY.[-]"	"1xBiotin [K6]"	"0.0970105"	"0.00379267"	"1"	"4"	"8"	"Q9CPZ6"	"Q9CPZ6 [147-153]"	"Q9CPZ6 1xBiotin [K152]"	"ORM1-like protein 3 [OS=Mus musculus]"	"1"	"1080.55466"	"0.09"	"0.05"	"-0.22"	"-1.83"	"0.21"	"0.13"	"0.17"	"111.2"	"118.1"	"114.9"	"95.4"	"31.4"	"129.0"	"84414.482421875"	"89599.42578125"	"87176.595703125"	"72417.50390625"	"23803.919921875"	"97937.578125"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"2"	"540.78082"	"0.0008081"	"0.01835"	"2.01"	"55.04"
"13356"	"[R].IFDDVSSGVSQLASKVQGVGSK.[G]"	"1xBiotin [K15]"	"1.25984E-05"	"0.000586377"	"1"	"1"	"5"	"Q9EPJ9"	"Q9EPJ9 [264-285]"	"Q9EPJ9 1xBiotin [K278]"	"ADP-ribosylation factor GTPase-activating protein 1 [OS=Mus musculus]"	"1"	"2434.22825"	"-0.40"	"-0.52"	"-9.97"	"-9.97"	"0.85"	"1.25"	"1.37"	"140.9"	"106.9"	"98.3"	""	""	"253.9"	"38314.57421875"	"29063.712890625"	"26710.26171875"	""	""	"69015.3125"	""	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"812.08083"	"0.0001108"	"3.654E-08"	"4.52"	"56.99"
"7318"	"[K].FMDQHPEMDFSKAK.[F]"	"1xBiotin [K]; 2xOxidation [M2; M8]"	"0.0119882"	"0.000586377"	"1"	"1"	"5"	"O35685"	"O35685 [317-330]"	"O35685 1xBiotin [K]"	"nuclear migration protein nudC [OS=Mus musculus]"	"1"	"1968.82887"	"-0.17"	"-0.38"	"-0.30"	"-1.86"	"-0.29"	"-0.12"	"0.09"	"131.6"	"116.9"	"101.1"	"106.6"	"36.2"	"107.6"	"39987.37109375"	"35539.24609375"	"30720.064453125"	"32391.486328125"	"11006.115234375"	"32705.130859375"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"3"	"656.94857"	"0.0001108"	"0.0008209"	"2.87"	"31.81"
"13342"	"[R].IEYLHAKLLEK.[R]"	"1xBiotin [K7]"	"0.00122543"	"0.000586377"	"1"	"3"	"8"	"Q7TNJ0-1"	"Q7TNJ0-1 [417-427]"	"Q7TNJ0-1 1xBiotin [K423]"	"Dendritic cell-specific transmembrane protein [OS=Mus musculus]"	"1"	"1582.86616"	"0.05"	"0.35"	"-3.78"	"-9.97"	"-3.06"	"-3.10"	"-3.41"	"171.3"	"176.8"	"218.8"	"12.5"	""	"20.6"	"29947.375"	"30914.0454101563"	"38245.0803222656"	"2179.58203125"	""	"3602.42407226563"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"528.29338"	"0.0001108"	"2.907E-05"	"4.06"	"42.46"
"13295"	"[R].LESLSTKLCSR.[A]"	"1xBiotin [K7]; 1xCarbamidomethyl [C9]"	"0.000381836"	"0.000586377"	"1"	"1"	"6"	"P43883"	"P43883 [218-228]"	"P43883 1xBiotin [K224]"	"perilipin-2 [OS=Mus musculus]"	"1"	"1519.76071"	"0.36"	"0.27"	"0.10"	"-0.63"	"0.59"	"0.23"	"0.32"	"89.3"	"114.9"	"107.8"	"96.0"	"57.6"	"134.5"	"33538.47265625"	"43155.7421875"	"40477.98046875"	"36051.7265625"	"21626.19921875"	"50526.80859375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"760.38407"	"0.0001108"	"5.337E-06"	"3.22"	"43.96"
"13288"	"[R].IESKSISAPVIFDR.[S]"	"1xBiotin [K4]"	"0.00170833"	"0.000586377"	"1"	"1"	"3"	"Q9CWK8"	"Q9CWK8 [113-126]"	"Q9CWK8 1xBiotin [K116]"	"Sorting nexin-2 [OS=Mus musculus]"	"1"	"1787.93603"	"0.16"	"-0.04"	"-9.97"	"-2.05"	"-9.97"	"-9.97"	"-9.97"	"180.1"	"201.4"	"175.1"	""	"43.4"	""	"13168.31640625"	"14720.5009765625"	"12798.9697265625"	""	"3175.99829101563"	""	""	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"High"	"2"	"894.47259"	"0.0001108"	"4.732E-05"	"2.34"	"49.05"
"7320"	"[K].FMEENEKLK.[L]"	"1xBiotin [K7]; 1xOxidation [M2]"	"0.00267554"	"0.000586377"	"1"	"1"	"6"	"Q61334"	"Q61334 [151-159]"	"Q61334 1xBiotin [K157]"	"B-cell receptor-associated protein 29 [OS=Mus musculus]"	"1"	"1409.64395"	"0.22"	"0.17"	"0.57"	"-9.97"	"0.22"	"0.00"	"0.05"	"101.1"	"117.5"	"113.4"	"150.4"	""	"117.7"	"11152.3369140625"	"12957.2216796875"	"12507.8017578125"	"16588.01171875"	""	"12985.9033203125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"705.32536"	"0.0001108"	"9.094E-05"	"2.18"	"32.32"
"13227"	"[K].LENKMEGIGLK.[K]"	"1xBiotin [K4]; 1xOxidation [M5]"	"0.000190771"	"0.000586377"	"1"	"1"	"20"	"Q8R5J9"	"Q8R5J9 [148-158]"	"Q8R5J9 1xBiotin [K151]"	"PRA1 family protein 3 [OS=Mus musculus]"	"1"	"1473.74400"	"0.09"	"-0.09"	"0.37"	"-0.75"	"0.09"	"0.00"	"0.17"	"100.7"	"107.3"	"94.9"	"130.1"	"60.0"	"106.9"	"243842.4765625"	"259746.0625"	"229848.20703125"	"315019.255859375"	"145145.35546875"	"258891.1953125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"737.37557"	"0.0001108"	"1.925E-06"	"3.60"	"36.22"
"13226"	"[K].LENKMEGIGLK.[K]"	"1xBiotin [K4]"	"0.000137622"	"0.000586377"	"1"	"1"	"10"	"Q8R5J9"	"Q8R5J9 [148-158]"	"Q8R5J9 1xBiotin [K151]"	"PRA1 family protein 3 [OS=Mus musculus]"	"1"	"1457.74908"	"1.03"	"0.74"	"0.31"	"1.44"	"0.50"	"-0.53"	"-0.24"	"59.4"	"121.8"	"99.6"	"73.7"	"161.3"	"84.2"	"79835.5"	"163583"	"133726.96875"	"98922.3515625"	"216628.546875"	"113078.484375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"729.37818"	"0.0001108"	"1.201E-06"	"4.18"	"44.06"
"13224"	"[K].IENKIESIGLK.[R]"	"1xBiotin [K4]"	"0.000246571"	"0.000586377"	"1"	"1"	"7"	"Q9JIG8"	"Q9JIG8 [149-159]"	"Q9JIG8 1xBiotin [K152]"	"PRA1 family protein 2 [OS=Mus musculus]"	"1"	"1469.80323"	"0.31"	"0.32"	"0.39"	"0.15"	"0.05"	"-0.27"	"-0.27"	"86.5"	"107.5"	"107.8"	"112.9"	"95.8"	"89.5"	"51589.2421875"	"64173.51953125"	"64336.640625"	"67371.4453125"	"57169.56640625"	"53402.92578125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"735.40545"	"0.0001108"	"2.803E-06"	"3.76"	"45.97"
"7326"	"[R].FMGKGVSQAVEHINK.[T]"	"1xBiotin [K4]; 1xOxidation [M2]"	"0.000476547"	"0.000586377"	"1"	"1"	"7"	"P17182"	"P17182 [57-71]"	"P17182 1xBiotin [K60]"	"alpha-enolase [OS=Mus musculus]"	"1"	"1886.92515"	"0.13"	"0.36"	"0.24"	"-1.48"	"0.15"	"0.02"	"-0.21"	"99.6"	"108.8"	"128.0"	"117.5"	"35.6"	"110.5"	"43244.6953125"	"47216.25390625"	"55561.89453125"	"51000.62109375"	"15463.5224609375"	"47945.6328125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"629.64615"	"0.0001108"	"7.34E-06"	"3.51"	"35.43"
"13173"	"[K].LEKSIQANLTPNENCLK.[Q]"	"1xBiotin [K3]; 1xCarbamidomethyl [C15]"	"3.88251E-05"	"0.000586377"	"1"	"2"	"11"	"E9Q9A9-1"	"E9Q9A9-1 [37-53]"	"E9Q9A9-1 1xBiotin [K39]"	"2'-5'-oligoadenylate synthase 2 [OS=Mus musculus]"	"1"	"2198.09440"	"-0.51"	"0.12"	"-0.61"	"-2.38"	"0.03"	"0.55"	"-0.09"	"128.8"	"90.1"	"140.0"	"84.7"	"24.8"	"131.7"	"41947.177734375"	"29361.486328125"	"45598.578125"	"27577.37109375"	"8065.130859375"	"42891.234375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"733.36926"	"0.0001108"	"1.894E-07"	"5.02"	"42.38"
"7355"	"[K].FNDKHITTLQASFLTK.[K]"	"1xBiotin [K4]"	"5.13204E-06"	"0.000586377"	"1"	"1"	"10"	"P35282"	"P35282 [42-57]"	"P35282 1xBiotin [K45]"	"Ras-related protein Rab-21 [OS=Mus musculus]"	"1"	"2090.07392"	"0.15"	"0.24"	"-1.14"	"-4.23"	"0.33"	"0.18"	"0.09"	"118.5"	"131.7"	"140.3"	"53.7"	"6.3"	"149.5"	"235240.03125"	"261472.671875"	"278360.5625"	"106599.15625"	"12502.1396484375"	"296651.28125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"697.36285"	"0.0001108"	"9.866E-09"	"5.86"	"46.63"
"13167"	"[R].IEKNILSSADYVER.[G]"	"1xBiotin [K3]"	"0.000144195"	"0.000586377"	"1"	"1"	"6"	"P70452"	"P70452 [241-254]"	"P70452 1xBiotin [K243]"	"Syntaxin-4 [OS=Mus musculus]"	"1"	"1862.93167"	"-9.97"	"-9.97"	"-9.97"	"-0.48"	"0.52"	"9.97"	"9.97"	"190.8"	""	""	""	"136.6"	"272.6"	"11158.716796875"	""	""	""	"7986.48583984375"	"15945.982421875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"931.97062"	"0.0001108"	"1.284E-06"	"3.41"	"46.07"
"13133"	"[R].LEGLSKQLDWDVR.[S]"	"1xBiotin [K6]"	"1.35116E-05"	"0.000586377"	"1"	"1"	"10"	"Q8C172"	"Q8C172 [99-111]"	"Q8C172 1xBiotin [K104]"	"Ceramide synthase 6 [OS=Mus musculus]"	"1"	"1784.89998"	"0.20"	"-0.05"	"-0.68"	"-3.05"	"0.08"	"-0.11"	"0.13"	"121.9"	"139.9"	"118.0"	"76.2"	"14.8"	"129.2"	"130635.8515625"	"149867.9453125"	"126457.8515625"	"81639.953125"	"15808.521484375"	"138400.720703125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"892.95375"	"0.0001108"	"4.051E-08"	"4.83"	"50.73"
"7357"	"[K].FNGTVKAENGK.[L]"	"1xBiotin [K6]"	"0.000436637"	"0.000586377"	"1"	"1"	"6"	"P16858"	"P16858 [54-64]"	"P16858 1xBiotin [K59]"	"glyceraldehyde-3-phosphate dehydrogenase [OS=Mus musculus]"	"1"	"1390.67836"	"0.20"	"0.18"	"0.08"	"0.44"	"0.19"	"-0.01"	"0.02"	"87.7"	"100.8"	"99.2"	"92.8"	"119.1"	"100.4"	"11924.4150390625"	"13703.6435546875"	"13479.228515625"	"12618.1259765625"	"16181.134765625"	"13644.36328125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"695.84335"	"0.0001108"	"6.459E-06"	"2.61"	"28.07"
"7365"	"[R].FNISPDEDSSSYSSNSDFNYSYPTKQAALK.[S]"	"1xBiotin [K25]"	"0.000181017"	"0.000586377"	"1"	"1"	"4"	"Q8CFE6"	"Q8CFE6 [9-38]"	"Q8CFE6 1xBiotin [K33]"	"sodium-coupled neutral amino acid transporter 2 [OS=Mus musculus]"	"1"	"3588.57475"	"-0.36"	"-0.55"	"-1.76"	"-9.97"	"0.24"	"0.60"	"0.79"	"152.5"	"118.6"	"104.0"	"45.0"	""	"179.9"	"110649.0703125"	"86045.5859375"	"75439.7578125"	"32634.71875"	""	"130537.3515625"	""	"High"	"High"	"High"	"Peak Found"	"Not Found"	"High"	"High"	"3"	"1196.86311"	"0.0001108"	"1.795E-06"	"4.23"	"48.65"
"12774"	"[K].LASTSSCAQKSAGAGVK.[G]"	"1xBiotin [K10]; 1xCarbamidomethyl [C7]"	"0.00224653"	"0.000586377"	"1"	"2"	"5"	"Q6Y685-2"	"Q6Y685-2 [100-116]"	"Q6Y685-2 1xBiotin [K109]"	"Isoform 2 of Transforming acidic coiled-coil-containing protein 1 [OS=Mus musculus]"	"1"	"1848.89424"	"-9.97"	"0.80"	"0.95"	"1.08"	"-9.97"	""	"-9.97"	"88.4"	""	"154.0"	"170.3"	"187.2"	""	"23588.72265625"	""	"41092.265625"	"45440.0234375"	"49954.65234375"	""	""	"High"	"Not Found"	"Peak Found"	"High"	"High"	"Not Found"	"High"	"2"	"924.94702"	"0.0001108"	"7.074E-05"	"4.02"	"26.67"
"12343"	"[K].KVHVIFNYK.[G]"	""	"0.0117817"	"0.000586377"	"1"	"1"	"7"	"P14211"	"P14211 [143-151]"	""	"Calreticulin [OS=Mus musculus]"	"1"	"1147.66224"	"-9.97"	"0.34"	"0.75"	"0.40"	"-9.97"	""	"-9.97"	"113.9"	""	"143.8"	"191.6"	"150.8"	""	"77575.0712890625"	""	"97942.734375"	"130488.70703125"	"102683.8984375"	""	""	"High"	"Not Found"	"High"	"High"	"High"	"Not Found"	"High"	"2"	"574.33449"	"0.0001108"	"0.0008006"	"2.83"	"26.49"
"7447"	"[R].FQVDFQLGNSLKPR.[A]"	"1xBiotin [K12]"	"1.14094E-05"	"0.000586377"	"1"	"1"	"5"	"Q9JL15"	"Q9JL15 [45-58]"	"Q9JL15 1xBiotin [K56]"	"Galectin-8 [OS=Mus musculus]"	"0"	"1874.95816"	"-9.97"	"-0.17"	"-9.97"	"-9.97"	"-9.97"	""	"-9.97"	"318.0"	""	"282.0"	""	""	""	"22219.376953125"	""	"19700.33984375"	""	""	""	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"2"	"937.98222"	"0.0001108"	"3.178E-08"	"4.08"	"53.07"
"12721"	"[K].IAPMFGKK.[A]"	"1xBiotin [K7]; 1xOxidation [M4]"	"0.0531403"	"0.0019826"	"1"	"1"	"5"	"Q8R3R5"	"Q8R3R5 [318-325]"	"Q8R3R5 1xBiotin [K324]"	"transmembrane protein 185B [OS=Mus musculus]"	"1"	"1133.58458"	"-1.36"	"-1.31"	"-1.26"	"-2.23"	"-0.93"	"0.43"	"0.39"	"203.5"	"79.2"	"81.8"	"85.0"	"43.5"	"106.9"	"78958.580078125"	"30716.79296875"	"31740.1796875"	"32981.24609375"	"16885.03515625"	"41467.6953125"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"2"	"567.29606"	"0.0002716"	"0.007398"	"1.64"	"34.25"
"12486"	"[K].KYGVGTCGPR.[G]"	"1xBiotin [K1]; 1xCarbamidomethyl [C7]"	"0.00161162"	"0.000586377"	"1"	"1"	"6"	"O35704"	"O35704 [127-136]"	"O35704 1xBiotin [K127]"	"serine palmitoyltransferase 1 [OS=Mus musculus]"	"1"	"1320.61874"	"0.80"	"0.64"	"0.85"	"0.42"	"0.72"	"-0.08"	"0.08"	"66.0"	"115.1"	"102.9"	"118.6"	"88.5"	"108.8"	"32595.931640625"	"56838.03125"	"50825.59765625"	"58573.7109375"	"43713.27734375"	"53733.69921875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"660.81310"	"0.0001108"	"4.352E-05"	"2.35"	"30.79"
"7542"	"[K].FTPKYVLR.[A]"	"1xBiotin [K4]"	"0.0485655"	"0.00154748"	"1"	"2"	"6"	"P21619"	"P21619 [493-500]"	"P21619 1xBiotin [K496]"	"Lamin-B2 [OS=Mus musculus]"	"1"	"1249.67618"	"0.69"	"0.17"	"0.34"	"-0.45"	"0.23"	"-0.46"	"0.06"	"86.9"	"140.2"	"97.5"	"110.0"	"63.5"	"101.9"	"52469.24609375"	"84695.3828125"	"58888.07421875"	"66448.9140625"	"38373.1875"	"61537.84375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"625.34172"	"0.0002716"	"0.006498"	"1.84"	"43.08"
"7562"	"[K].FVETSPSGLDPNASVYQPLKK.[-]"	"1xBiotin [K]"	"0.00057096"	"0.000586377"	"1"	"1"	"5"	"Q7TQE6"	"Q7TQE6 [644-664]"	"Q7TQE6 1xBiotin [K]"	"macoilin [OS=Mus musculus]"	"1"	"2503.25374"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"835.08990"	"0.0001108"	"9.53E-06"	"3.26"	""
"12471"	"[K].KYDAFLASESLIK.[Q]"	"1xBiotin [K1]"	"0.0516681"	"0.00154748"	"1"	"1"	"1"	"P53026"	"P53026 [106-118]"	"P53026 1xBiotin [K106]"	"60S ribosomal protein L10A [OS=Mus musculus]"	"1"	"1710.87712"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"855.94393"	"0.0002716"	"0.007096"	"1.76"	""
"7566"	"[R].FVKVPLK.[N]"	"1xBiotin [K3]"	"0.0273413"	"0.00104877"	"1"	"1"	"40"	"P21855"	"P21855 [12-18]"	"P21855 1xBiotin [K14]"	"B-cell differentiation antigen CD72 [OS=Mus musculus]"	"1"	"1056.62743"	"-0.19"	"0.26"	"-0.10"	"-0.16"	"0.14"	"0.33"	"-0.12"	"99.9"	"87.9"	"119.4"	"92.9"	"89.6"	"110.3"	"2989554.27636719"	"2628910.58789063"	"3572485.96875"	"2779797.5"	"2681679.22070313"	"3298522.75"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"528.81730"	"0.0001873"	"0.002763"	"2.50"	"39.88"
"7595"	"[R].FWSFFLR.[D]"	""	"0.0683137"	"0.0019826"	"1"	"1"	"3"	"Q6ZQ58-1"	"Q6ZQ58-1 [895-901]"	""	"La-related protein 1 [OS=Mus musculus]"	"0"	"1002.51960"	"-0.01"	"0.31"	"-2.26"	"-9.97"	"0.27"	"0.28"	"-0.05"	"129.2"	"128.1"	"160.4"	"27.0"	""	"155.3"	"25285.44921875"	"25078.2734375"	"31395.908203125"	"5284.12060546875"	""	"30388.759765625"	""	"High"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"2"	"501.76328"	"0.0003442"	"0.01083"	"1.56"	"57.61"
"7637"	"[R].FYQMTGETWKLTAGHR.[L]"	"1xBiotin [K10]; 1xOxidation [M4]"	"2.80083E-05"	"0.000586377"	"1"	"1"	"5"	"Q9QZ49"	"Q9QZ49 [118-133]"	"Q9QZ49 1xBiotin [K127]"	"UBX domain-containing protein 8 [OS=Mus musculus]"	"1"	"2168.00519"	"-0.55"	"-0.35"	"-0.84"	"-9.97"	"-0.35"	"0.21"	"0.00"	"157.3"	"107.3"	"123.7"	"88.1"	""	"123.6"	"41839.71875"	"28535.193359375"	"32917.06640625"	"23436.05859375"	""	"32894.890625"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"723.33988"	"0.0001108"	"1.169E-07"	"4.37"	"40.74"
"7643"	"[R].FYSSFSGGFKGPQPR.[S]"	"1xBiotin [K10]"	"1.4491E-05"	"0.000586377"	"1"	"1"	"12"	"Q99KC8"	"Q99KC8 [621-635]"	"Q99KC8 1xBiotin [K630]"	"von Willebrand factor A domain-containing protein 5A [OS=Mus musculus]"	"1"	"1887.88466"	"0.42"	"0.24"	"-2.28"	"-9.97"	"0.09"	"-0.33"	"-0.14"	"125.3"	"167.6"	"147.6"	"25.8"	""	"133.7"	"59264.970703125"	"79240.443359375"	"69800.17578125"	"12217.5107421875"	""	"63224.642578125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"944.44653"	"0.0001108"	"4.491E-08"	"4.60"	"44.35"
"12508"	"[K].KYVIVPSLQLTPK.[E]"	"1xBiotin [K1]"	"2.15436E-05"	"0.000586377"	"1"	"4"	"10"	"Q7TNJ0-1"	"Q7TNJ0-1 [276-288]"	"Q7TNJ0-1 1xBiotin [K276]"	"Dendritic cell-specific transmembrane protein [OS=Mus musculus]"	"1"	"1711.98153"	"0.39"	"0.08"	"-0.48"	"-4.09"	"0.26"	"-0.13"	"0.18"	"112.4"	"147.2"	"118.9"	"80.5"	"6.6"	"134.4"	"52026.93359375"	"68133.9765625"	"55065.234375"	"37258.4609375"	"3054.4248046875"	"62218.9375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"856.49472"	"0.0001108"	"7.982E-08"	"3.80"	"52.26"
"12426"	"[R].KVVDCSR.[E]"	"1xBiotin [K1]; 1xCarbamidomethyl [C5]"	"0.0513783"	"0.00154748"	"1"	"1"	"5"	"Q09143"	"Q09143 [17-23]"	"Q09143 1xBiotin [K17]"	"High affinity cationic amino acid transporter 1 [OS=Mus musculus]"	"1"	"1089.51796"	"0.13"	"0.14"	"0.22"	"0.19"	"0.21"	"0.08"	"0.07"	"90.1"	"98.7"	"99.3"	"104.7"	"102.8"	"104.4"	"22250.609375"	"24386.369140625"	"24522.4765625"	"25868.306640625"	"25383.57421875"	"25800.033203125"	""	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"2"	"545.26257"	"0.0002716"	"0.007025"	"1.45"	"23.53"
"7653"	"[R].FYTNPIAKPIPQTPESVGNK.[N]"	"1xBiotin [K8]"	"0.00418918"	"0.000586377"	"1"	"1"	"6"	"Q6PFD9"	"Q6PFD9 [658-677]"	"Q6PFD9 1xBiotin [K665]"	"nuclear pore complex protein Nup98-Nup96 [OS=Mus musculus]"	"0"	"2427.23769"	"0.03"	"0.30"	"0.20"	"-1.32"	"0.42"	"0.39"	"0.12"	"97.7"	"99.9"	"120.6"	"111.9"	"39.2"	"130.7"	"22702.78125"	"23221.08984375"	"28043.79296875"	"26010.5859375"	"9101.5537109375"	"30384.23046875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"809.75074"	"0.0001108"	"0.0001763"	"3.44"	"45.89"
"12415"	"[R].KVTAAMGK.[K]"	"1xBiotin [K1]; 1xOxidation [M6]"	"0.0200481"	"0.000586377"	"1"	"1"	"3"	"P61358"	"P61358 [52-59]"	"P61358 1xBiotin [K52]"	"60S ribosomal protein L27 [OS=Mus musculus]"	"1"	"1047.53255"	"0.06"	"0.20"	"0.17"	"-1.56"	"-0.06"	"-0.12"	"-0.26"	"107.0"	"111.3"	"122.9"	"120.3"	"36.2"	"102.4"	"9024.8466796875"	"9386.6591796875"	"10370.17578125"	"10147.734375"	"3054.72729492188"	"8640.0361328125"	""	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"2"	"524.27010"	"0.0001108"	"0.001753"	"1.43"	"19.27"
"7657"	"[R].FYYSSGSSSPTHAKSAHV.[-]"	"1xBiotin [K14]"	"6.25749E-06"	"0.000586377"	"1"	"1"	"18"	"Q60771"	"Q60771 [190-207]"	"Q60771 1xBiotin [K203]"	"Claudin-11 [OS=Mus musculus]"	"1"	"2138.96001"	"0.70"	"0.31"	"0.54"	"-0.22"	"0.64"	"-0.06"	"0.33"	"77.7"	"125.8"	"96.1"	"112.7"	"66.8"	"121.0"	"604131.30078125"	"978387.671875"	"747447.7421875"	"877029.5703125"	"519351.953125"	"941075.390625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"1069.98394"	"0.0001108"	"1.317E-08"	"5.05"	"33.43"
"7674"	"[R].GAAQNIIPASTGAAKAVGK.[V]"	"1xBiotin [K15]"	"4.65184E-05"	"0.000586377"	"1"	"1"	"10"	"P16858"	"P16858 [199-217]"	"P16858 1xBiotin [K213]"	"glyceraldehyde-3-phosphate dehydrogenase [OS=Mus musculus]"	"1"	"1951.04296"	"-9.97"	"0.50"	"0.65"	"0.49"	"-9.97"	""	"-9.97"	"111.4"	""	"157.4"	"174.6"	"156.6"	""	"38566.1953125"	""	"54478.572265625"	"60421.609375"	"54199.09765625"	""	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"651.01926"	"0.0001108"	"2.454E-07"	"5.29"	"39.46"
"12386"	"[K].KVPAGPKTLK.[K]"	"1xBiotin [K]"	"0.00846525"	"0.000586377"	"1"	"1"	"10"	"P14148"	"P14148 [21-30]"	"P14148 1xBiotin [K]"	"60S ribosomal protein L7 [OS=Mus musculus]"	"2"	"1264.74459"	"0.49"	"0.16"	"0.66"	"0.47"	"0.61"	"0.13"	"0.46"	"75.0"	"105.0"	"83.5"	"118.4"	"103.5"	"114.6"	"122595.63671875"	"171777.22265625"	"136563.234375"	"193628.1484375"	"169261.92578125"	"187392.6796875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"422.25284"	"0.0001108"	"0.0004921"	"3.38"	"27.73"
"12385"	"[K].KVNVVEQEK.[I]"	"1xBiotin [K1]"	"0.000773173"	"0.000586377"	"1"	"1"	"6"	"P17182"	"P17182 [81-89]"	"P17182 1xBiotin [K81]"	"alpha-enolase [OS=Mus musculus]"	"1"	"1298.67730"	"0.24"	"0.07"	"0.03"	"0.30"	"0.36"	"0.12"	"0.30"	"88.7"	"105.0"	"92.8"	"90.6"	"108.9"	"114.0"	"43836.3046875"	"51905.1328125"	"45883.25390625"	"44780.015625"	"53843.7265625"	"56371.5"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"649.84235"	"0.0001108"	"1.488E-05"	"3.26"	"29.10"
"12371"	"[K].KVLSGQDTEDR.[S]"	"1xBiotin [K1]"	"0.00155623"	"0.000586377"	"1"	"1"	"6"	"Q8VD57"	"Q8VD57 [6-16]"	"Q8VD57 1xBiotin [K6]"	"Vesicle transport protein SFT2B [OS=Mus musculus]"	"1"	"1473.70022"	"0.69"	"0.24"	"0.40"	"0.43"	"0.41"	"-0.29"	"0.16"	"76.9"	"124.4"	"91.0"	"101.9"	"103.9"	"101.9"	"25242.12109375"	"40821.70703125"	"29850.841796875"	"33412.03515625"	"34070.6015625"	"33422.890625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"737.35330"	"0.0001108"	"4.146E-05"	"1.97"	"28.17"
"7677"	"[K].GAATPAKGAK.[N]"	"1xBiotin [K7]"	"0.0860801"	"0.00288886"	"1"	"1"	"4"	"P09405"	"P09405 [126-135]"	"P09405 1xBiotin [K132]"	"Nucleolin [OS=Mus musculus]"	"1"	"1097.57719"	"0.60"	"0.51"	"0.31"	"0.11"	"0.33"	"-0.27"	"-0.18"	"79.9"	"121.2"	"113.4"	"99.3"	"86.0"	"100.2"	"11979.5078125"	"18181.71875"	"17007.201171875"	"14893.93359375"	"12894.654296875"	"15028.265625"	""	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"2"	"549.29233"	"0.0004957"	"0.01537"	"2.44"	"20.67"
"12417"	"[K].KVTAVPSQNQK.[Q]"	"1xBiotin [K1]"	"0.0443703"	"0.00104877"	"1"	"1"	"5"	"Q8BM55"	"Q8BM55 [94-104]"	"Q8BM55 1xBiotin [K94]"	"Transmembrane protein 214 [OS=Mus musculus]"	"1"	"1425.75186"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"2"	"713.37999"	"0.0001873"	"0.005643"	"1.57"	""
"12509"	"[R].KYVSISVPSK.[T]"	"1xBiotin [K1]"	"0.000465561"	"0.000586377"	"1"	"1"	"6"	"Q922Q5"	"Q922Q5 [10-19]"	"Q922Q5 1xBiotin [K10]"	"Adenosine 3'-phospho 5'-phosphosulfate transporter 2 [OS=Mus musculus]"	"1"	"1333.71843"	"0.82"	"0.32"	"0.46"	"0.16"	"0.47"	"-0.35"	"0.15"	"76.0"	"134.3"	"95.0"	"104.8"	"84.8"	"105.1"	"35456.39453125"	"62674.47265625"	"44323.7109375"	"48913.79296875"	"39578.05859375"	"49025.2421875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"667.36307"	"0.0001108"	"7.094E-06"	"3.24"	"39.20"
"12519"	"[R].LAADVGKAGAER.[E]"	"1xBiotin [K7]"	"0.000195273"	"0.000586377"	"1"	"1"	"6"	"P51881"	"P51881 [141-152]"	"P51881 1xBiotin [K147]"	"ADP/ATP translocase 2 [OS=Mus musculus]"	"1"	"1383.70491"	"-9.97"	"0.17"	"0.49"	"0.82"	"0.21"	"9.97"	"0.04"	"92.9"	""	"104.4"	"130.9"	"164.3"	"107.5"	"17116.37109375"	""	"19235.0234375"	"24117.734375"	"30271.568359375"	"19814.337890625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"692.35600"	"0.0001108"	"2.003E-06"	"2.91"	"30.74"
"7520"	"[K].FTDVTLSPWSSDSKCHQR.[R]"	"1xBiotin [K14]; 1xCarbamidomethyl [C15]"	"0.000149329"	"0.000586377"	"1"	"3"	"4"	"Q8VEF1-1"	"Q8VEF1-1 [405-422]"	"Q8VEF1-1 1xBiotin [K418]"	"GRAM domain-containing protein 1A [OS=Mus musculus]"	"1"	"2377.06998"	"9.97"	""	"9.97"	""	""	"-9.97"	""	""	"357.0"	""	"243.0"	""	""	""	"11117.1904296875"	""	"7564.7744140625"	""	""	""	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"3"	"793.02843"	"0.0001108"	"1.346E-06"	"3.89"	"42.63"
"7476"	"[R].FSFLSKPVDENNQQDGEDDSLVSR.[F]"	"1xBiotin [K6]"	"5.63898E-05"	"0.000586377"	"1"	"1"	"4"	"Q6PFD9"	"Q6PFD9 [634-657]"	"Q6PFD9 1xBiotin [K639]"	"nuclear pore complex protein Nup98-Nup96 [OS=Mus musculus]"	"0"	"2952.33160"	"9.97"	"9.97"	"9.97"	""	"9.97"	"-0.09"	"-0.04"	""	"186.0"	"179.8"	"58.9"	""	"175.3"	""	"37602.3828125"	"36336.19921875"	"11904.0341796875"	""	"35434.57421875"	""	"High"	"High"	"High"	"Peak Found"	"Not Found"	"High"	"High"	"3"	"984.78321"	"0.0001108"	"3.259E-07"	"4.02"	"51.87"
"12701"	"[R].IAMSKDQHNGSLTDPSSVHEK.[K]"	"1xBiotin [K5]; 1xOxidation [M3]"	"1.86042E-06"	"0.000586377"	"1"	"1"	"21"	"Q99KU0"	"Q99KU0 [13-33]"	"Q99KU0 1xBiotin [K17]"	"Vacuole membrane protein 1 [OS=Mus musculus]"	"1"	"2523.16025"	"0.14"	"0.06"	"0.04"	"-0.78"	"-0.05"	"-0.19"	"-0.11"	"104.9"	"115.7"	"109.5"	"107.7"	"61.1"	"101.2"	"374872.803710938"	"413187.8046875"	"391131.53125"	"384622.25"	"218176.34375"	"361443.5703125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"841.72496"	"0.0001108"	"2.233E-09"	"4.74"	"26.31"
"12700"	"[R].IAMSKDQHNGSLTDPSSVHEK.[K]"	"1xBiotin [K5]"	"1.63642E-06"	"0.000586377"	"1"	"1"	"13"	"Q99KU0"	"Q99KU0 [13-33]"	"Q99KU0 1xBiotin [K17]"	"Vacuole membrane protein 1 [OS=Mus musculus]"	"1"	"2507.16533"	"0.38"	"0.21"	"0.10"	"1.10"	"0.01"	"-0.37"	"-0.19"	"78.1"	"102.0"	"90.3"	"83.5"	"167.2"	"78.9"	"185356.125"	"241975.8046875"	"214124.9609375"	"198011.59375"	"396600.40625"	"187217.4140625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"836.39402"	"0.0001108"	"1.86E-09"	"4.58"	"30.97"
"12659"	"[R].LAKYNQILR.[I]"	"1xBiotin [K3]"	"0.00270689"	"0.000586377"	"1"	"1"	"6"	"P17182"	"P17182 [404-412]"	"P17182 1xBiotin [K406]"	"alpha-enolase [OS=Mus musculus]"	"1"	"1344.74565"	"0.51"	"0.21"	"0.26"	"-0.17"	"0.12"	"-0.39"	"-0.09"	"88.8"	"126.8"	"102.8"	"106.5"	"78.8"	"96.4"	"37669.39453125"	"53790.25390625"	"43607.20703125"	"45184.33984375"	"33454.21484375"	"40913.1953125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"672.87656"	"0.0001108"	"9.321E-05"	"2.77"	"41.27"
"12651"	"[R].LAKLSDGVAVLK.[V]"	"1xBiotin [K3]"	"0.000193009"	"0.000586377"	"1"	"2"	"5"	"P63038-1"	"P63038-1 [394-405]"	"P63038-1 1xBiotin [K396]"	"60 kDa heat shock protein, mitochondrial [OS=Mus musculus]"	"1"	"1439.82905"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"2"	"720.41896"	"0.0001108"	"1.96E-06"	"3.05"	""
"12650"	"[K].LAKLQAQVR.[I]"	"1xBiotin [K3]"	"0.0161019"	"0.000586377"	"1"	"3"	"3"	"Q9CQH7"	"Q9CQH7 [6-14]"	"Q9CQH7 1xBiotin [K8]"	"transcription factor BTF3 homolog 4 [OS=Mus musculus]"	"1"	"1252.71944"	""	"9.97"	""	"9.97"	"9.97"	"9.97"	"-0.19"	""	""	"233.2"	""	"161.8"	"205.0"	""	""	"13753.24609375"	""	"9543.0048828125"	"12087.4921875"	""	"High"	"Not Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"2"	"626.86292"	"0.0001108"	"0.001264"	"2.28"	"34.95"
"7483"	"[R].FSGTYTCMNTFKGR.[T]"	"1xBiotin [K12]; 1xCarbamidomethyl [C7]; 1xOxidation [M8]"	"0.000190771"	"0.000586377"	"1"	"2"	"6"	"O88876-2"	"O88876-2 [222-235]"	"O88876-2 1xBiotin [K233]"	"Isoform 2 of Short-chain dehydrogenase/reductase 3 [OS=Mus musculus]"	"1"	"1911.81864"	"-9.97"	"-9.97"	"-9.97"	"-9.97"	"0.35"	"9.97"	"9.97"	"263.9"	""	""	""	""	"336.1"	"20034.15625"	""	""	""	""	"25512.76171875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"956.41168"	"0.0001108"	"1.925E-06"	"3.37"	"36.76"
"12640"	"[R].IAKAASEK.[S]"	"1xBiotin [K3]"	"0.0124121"	"0.000586377"	"1"	"1"	"7"	"P17182"	"P17182 [328-335]"	"P17182 1xBiotin [K330]"	"alpha-enolase [OS=Mus musculus]"	"1"	"1043.55539"	"0.28"	"0.21"	"0.09"	"0.30"	"0.38"	"0.10"	"0.17"	"86.2"	"104.5"	"99.5"	"91.6"	"106.0"	"112.2"	"39255.69921875"	"47595.61328125"	"45328.38671875"	"41721.69140625"	"48256.3671875"	"51119.34765625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"522.28128"	"0.0001108"	"0.0008649"	"2.52"	"21.92"
"12639"	"[R].LAHYNKR.[S]"	"1xBiotin [K6]"	"0.0746337"	"0.00241047"	"2"	"13"	"15"	"Q64525; P10854"	"Q64525 [81-87]; P10854 [81-87]"	"Q64525 1xBiotin [K86]; P10854 1xBiotin [K86]"	"Histone H2B type 2-B [OS=Mus musculus];Histone H2B type 1-M [OS=Mus musculus]"	"1"	"1127.57786"	"0.67"	"0.48"	"0.42"	"0.62"	"0.38"	"-0.29"	"-0.10"	"73.6"	"116.8"	"102.5"	"98.2"	"113.1"	"95.8"	"122163.78125"	"193837.0625"	"170166.9453125"	"162947.77734375"	"187776.328125"	"158961.921875"	"NotUnique"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"376.53075"	"0.000415"	"0.0123"	"1.81"	"22.49"
"7484"	"[R].FSKSADER.[Q]"	"1xBiotin [K3]"	"0.026417"	"0.00104877"	"1"	"2"	"3"	"Q9R049"	"Q9R049 [571-578]"	"Q9R049 1xBiotin [K573]"	"E3 ubiquitin-protein ligase AMFR [OS=Mus musculus]"	"1"	"1165.53063"	"0.65"	"0.39"	"0.50"	"0.57"	"0.53"	"-0.12"	"0.14"	"73.0"	"114.4"	"95.6"	"103.3"	"108.3"	"105.4"	"28915.494140625"	"45313.890625"	"37866.02734375"	"40890.44140625"	"42880.4765625"	"41722.5546875"	""	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"2"	"583.26893"	"0.0001873"	"0.002634"	"1.41"	"27.51"
"12609"	"[R].LAGKGTAEPHSASDAGMKR.[A]"	"1xBiotin [K4]; 1xOxidation [M17]"	"6.99693E-05"	"0.000586377"	"1"	"1"	"13"	"Q99LR1"	"Q99LR1 [42-60]"	"Q99LR1 1xBiotin [K45]"	"Monoacylglycerol lipase ABHD12 [OS=Mus musculus]"	"2"	"2126.01173"	"0.14"	"-0.05"	"0.00"	"-0.24"	"-0.02"	"-0.15"	"0.03"	"101.7"	"111.8"	"98.4"	"101.4"	"86.2"	"100.5"	"198070.1953125"	"217674.8359375"	"191744.75"	"197523.171875"	"167833.3125"	"195851.6328125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"4"	"532.25851"	"0.0001108"	"4.484E-07"	"4.15"	"22.03"
"7490"	"[K].FSLKSILSPK.[N]"	"1xBiotin [K4]"	"0.00145111"	"0.000586377"	"1"	"1"	"5"	"Q09143"	"Q09143 [468-477]"	"Q09143 1xBiotin [K471]"	"High affinity cationic amino acid transporter 1 [OS=Mus musculus]"	"1"	"1345.75482"	"0.92"	"0.66"	"-0.56"	"-2.79"	"1.12"	"0.20"	"0.46"	"80.3"	"152.1"	"126.9"	"54.3"	"11.6"	"174.8"	"24278.49609375"	"46014.94921875"	"38399.19140625"	"16426.103515625"	"3512.484375"	"52877.640625"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"2"	"673.38097"	"0.0001108"	"3.725E-05"	"3.48"	"55.70"
"12607"	"[R].LAGKGTAEPHSASDAGMK.[R]"	"1xBiotin [K4]; 1xOxidation [M17]"	"1.18847E-05"	"0.000586377"	"1"	"1"	"77"	"Q99LR1"	"Q99LR1 [42-59]"	"Q99LR1 1xBiotin [K45]"	"Monoacylglycerol lipase ABHD12 [OS=Mus musculus]"	"1"	"1969.91062"	"0.13"	"-0.21"	"0.13"	"-0.75"	"0.24"	"0.11"	"0.46"	"102.9"	"112.8"	"88.7"	"112.9"	"61.0"	"121.8"	"2094244.2265625"	"2296380.765625"	"1805177.265625"	"2298804.83203125"	"1241028.43359375"	"2480595.31640625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"985.45949"	"0.0001108"	"3.346E-08"	"4.23"	"24.04"
"12606"	"[R].LAGKGTAEPHSASDAGMK.[R]"	"1xBiotin [K4]"	"1.14658E-06"	"0.000586377"	"1"	"1"	"17"	"Q99LR1"	"Q99LR1 [42-59]"	"Q99LR1 1xBiotin [K45]"	"Monoacylglycerol lipase ABHD12 [OS=Mus musculus]"	"1"	"1953.91571"	"2.21"	"0.70"	"-1.03"	"2.52"	"2.05"	"-0.16"	"1.35"	"34.1"	"157.4"	"55.3"	"16.8"	"195.7"	"140.8"	"138266.859375"	"637966.875"	"224148.25"	"67932.4875488281"	"793318.348632813"	"570915.299072266"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"651.97673"	"0.0001108"	"1.102E-09"	"3.84"	"27.23"
"12597"	"[R].LAFGGGGYTPSKYAVEGFNDSLR.[R]"	"1xBiotin [K12]"	"0.0842191"	"0.00241047"	"1"	"1"	"1"	"Q58NB6"	"Q58NB6 [169-191]"	"Q58NB6 1xBiotin [K180]"	"Dehydrogenase/reductase SDR family member 9 [OS=Mus musculus]"	"1"	"2632.25005"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"3"	"878.08814"	"0.000415"	"0.01484"	"1.99"	""
"7492"	"[K].FSNQYKATIGADFLTK.[E]"	"1xBiotin [K6]"	"0.00134522"	"0.000586377"	"1"	"1"	"4"	"P51150"	"P51150 [33-48]"	"P51150 1xBiotin [K38]"	"ras-related protein Rab-7a [OS=Mus musculus]"	"1"	"2030.00517"	"0.37"	"0.09"	"-1.44"	"-9.97"	"0.40"	"0.03"	"0.31"	"118.9"	"153.8"	"126.6"	"43.7"	""	"156.9"	"29074.15625"	"37605.86328125"	"30951.0859375"	"10687.5390625"	""	"38371.3203125"	""	"High"	"High"	"High"	"Peak Found"	"Not Found"	"High"	"High"	"3"	"677.33956"	"0.0001108"	"3.356E-05"	"3.20"	"52.76"
"7504"	"[R].FSSLTETLHPLKGR.[H]"	"1xBiotin [K12]"	"0.000431575"	"0.000586377"	"1"	"1"	"11"	"Q99LE3"	"Q99LE3 [114-127]"	"Q99LE3 1xBiotin [K125]"	"LysM and putative peptidoglycan-binding domain-containing protein 3 [OS=Mus musculus]"	"1"	"1811.94726"	"0.74"	"0.36"	"-0.63"	"-9.97"	"0.16"	"-0.58"	"-0.20"	"104.8"	"175.7"	"134.5"	"67.7"	""	"117.3"	"92818.26953125"	"155515.005859375"	"119072.638671875"	"59937.3203125"	""	"103830.90625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"604.65404"	"0.0001108"	"6.336E-06"	"4.59"	"43.31"
"7512"	"[R].FSWNVWPSSR.[L]"	""	"0.00311299"	"0.000586377"	"1"	"2"	"8"	"Q01405"	"Q01405 [19-28]"	""	"protein transport protein Sec23A [OS=Mus musculus]"	"0"	"1265.60618"	"0.66"	"0.76"	"0.40"	"-0.87"	"0.53"	"-0.13"	"-0.23"	"79.2"	"125.0"	"134.3"	"104.2"	"43.2"	"114.1"	"11122.26171875"	"17564.671875"	"18862.802734375"	"14634.318359375"	"6075.20703125"	"16031.5537109375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"633.30705"	"0.0001108"	"0.0001142"	"2.25"	"49.29"
"7516"	"[R].FTAPTGVSQPVGKVFVEK.[S]"	"1xBiotin [K13]"	"0.000109627"	"0.000586377"	"1"	"3"	"11"	"Q3V0J1-1"	"Q3V0J1-1 [188-205]"	"Q3V0J1-1 1xBiotin [K200]"	"transmembrane protein 237 [OS=Mus musculus]"	"1"	"2117.10997"	""	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"1.20"	""	""	"110.0"	"202.4"	"35.5"	"252.1"	""	""	"23644.255859375"	"43522.634765625"	"7635.7919921875"	"54207.431640625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"706.37494"	"0.0001108"	"8.628E-07"	"4.06"	"46.98"
"12723"	"[R].IAPPDSKLFR.[S]"	"1xBiotin [K7]"	"0.0109268"	"0.000586377"	"1"	"1"	"6"	"Q8K3Z9"	"Q8K3Z9 [250-259]"	"Q8K3Z9 1xBiotin [K256]"	"Nuclear envelope pore membrane protein POM 121 [OS=Mus musculus]"	"1"	"1369.72967"	"-0.04"	"0.10"	"0.09"	"-0.11"	"0.22"	"0.26"	"0.12"	"96.7"	"94.2"	"103.8"	"102.7"	"89.8"	"112.8"	"56734.265625"	"55270.6640625"	"60845.90625"	"60217.4296875"	"52656.69921875"	"66134.8515625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"685.36842"	"0.0001108"	"0.0007141"	"2.36"	"44.22"
"7294"	"[K].FITIFGTR.[S]"	""	"0.119536"	"0.00731053"	"1"	"1"	"7"	"P48036"	"P48036 [192-199]"	""	"annexin A5 [OS=Mus musculus]"	"0"	"954.54073"	"0.53"	"0.48"	"0.60"	"0.11"	"0.37"	"-0.16"	"-0.11"	"77.5"	"112.3"	"108.1"	"117.9"	"83.9"	"100.4"	"49232.8671875"	"71305.6015625"	"68618.1953125"	"74853.3203125"	"53252.90625"	"63734.109375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"477.77381"	"0.001478"	"0.02535"	"2.14"	"46.08"
"11620"	"[R].KNPAYLKSVSLQEPR.[G]"	"1xBiotin [K7]"	"0.000107726"	"0.000586377"	"1"	"1"	"4"	"Q80WQ6"	"Q80WQ6 [51-65]"	"Q80WQ6 1xBiotin [K57]"	"Inactive rhomboid protein 2 [OS=Mus musculus]"	"2"	"1956.03714"	"0.63"	"0.56"	"-0.19"	"-0.93"	"0.24"	"-0.38"	"-0.32"	"90.8"	"140.2"	"134.2"	"79.5"	"47.7"	"107.6"	"47670.76171875"	"73598.515625"	"70445.2734375"	"41752.3671875"	"25030.142578125"	"56457.03125"	""	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"3"	"652.68399"	"0.0001108"	"8.398E-07"	"4.06"	"39.30"
"11602"	"[K].KNITPAK.[V]"	"1xBiotin [K1]"	"0.0400685"	"0.00104877"	"1"	"1"	"6"	"P09405"	"P09405 [96-102]"	"P09405 1xBiotin [K96]"	"Nucleolin [OS=Mus musculus]"	"1"	"997.54991"	"0.40"	"0.27"	"-0.12"	"0.18"	"0.23"	"-0.17"	"-0.05"	"89.0"	"117.1"	"107.5"	"81.7"	"100.7"	"104.1"	"21631.841796875"	"28461.22265625"	"26124.216796875"	"19854.93359375"	"24470.544921875"	"25295.107421875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"499.27843"	"0.0001873"	"0.004868"	"2.39"	"25.65"
"10389"	"[K].KAKELKPK.[V]"	"1xBiotin [K3]"	"0.117027"	"0.00731053"	"1"	"2"	"2"	"Q8K4J6-1"	"Q8K4J6-1 [260-267]"	"Q8K4J6-1 1xBiotin [K262]"	"MKL/myocardin-like protein 1 [OS=Mus musculus]"	"2"	"1167.69183"	"-0.47"	"0.06"	"-0.14"	"-1.54"	"-0.75"	"-0.28"	"-0.81"	"130.2"	"94.0"	"135.9"	"117.8"	"44.7"	"77.5"	"7113.32177734375"	"5137.830078125"	"7423.828125"	"6438.9072265625"	"2439.99926757813"	"4233.98876953125"	""	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"2"	"584.34967"	"0.001478"	"0.02456"	"1.53"	"19.40"
"9196"	"[K].GSGGSEHVLTCDTACKGLLQR.[A]"	"1xBiotin [K16]; 2xCarbamidomethyl [C11; C15]"	"0.0975363"	"0.00426615"	"1"	"3"	"1"	"Q8BM55"	"Q8BM55 [454-474]"	"Q8BM55 1xBiotin [K469]"	"Transmembrane protein 214 [OS=Mus musculus]"	"1"	"2472.14282"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"3"	"824.71773"	"0.0008081"	"0.01855"	"2.28"	""
"9205"	"[K].GSGTAEVELKK.[G]"	"1xBiotin [K10]"	"0.00311299"	"0.000586377"	"1"	"2"	"6"	"P52480"	"P52480 [126-136]"	"P52480 1xBiotin [K135]"	"Pyruvate kinase PKM [OS=Mus musculus]"	"1"	"1344.68278"	"0.97"	"0.84"	"0.69"	"0.33"	"0.23"	"-0.75"	"-0.62"	"68.2"	"134.0"	"122.2"	"109.9"	"85.9"	"79.8"	"10183.9228515625"	"20015.40234375"	"18256.162109375"	"16417.359375"	"12837.697265625"	"11912.55078125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"672.84495"	"0.0001108"	"0.0001138"	"2.86"	"32.51"
"10360"	"[R].KAFPLSLGGR.[D]"	"1xBiotin [K1]"	"0.00264455"	"0.000586377"	"1"	"3"	"6"	"Q8BML1"	"Q8BML1 [741-750]"	"Q8BML1 1xBiotin [K741]"	"[F-actin]-monooxygenase MICAL2 [OS=Mus musculus]"	"1"	"1271.69289"	"0.47"	"0.39"	"0.19"	"-0.53"	"0.44"	"-0.03"	"0.05"	"87.1"	"120.3"	"114.4"	"99.4"	"60.5"	"118.2"	"42077.62890625"	"58127.96484375"	"55265.08203125"	"48012.140625"	"29238.458984375"	"57102.703125"	""	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"2"	"636.35002"	"0.0001108"	"8.979E-05"	"2.59"	"47.17"
"9210"	"[R].GSKGGHGAASPSDK.[G]"	"1xBiotin [K3]"	"0.000337828"	"0.000586377"	"1"	"1"	"6"	"Q8BMK4"	"Q8BMK4 [8-21]"	"Q8BMK4 1xBiotin [K10]"	"Cytoskeleton-associated protein 4 [OS=Mus musculus]"	"1"	"1481.68015"	"0.79"	"0.53"	"0.56"	"0.60"	"0.64"	"-0.16"	"0.11"	"68.8"	"119.3"	"99.3"	"101.2"	"104.3"	"107.0"	"27738.5556640625"	"48100.8588867188"	"40034.849609375"	"40813.5241699219"	"42047.8212890625"	"43138.6865234375"	""	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"3"	"494.56490"	"0.0001108"	"4.442E-06"	"2.77"	"15.17"
"10336"	"[R].KAEAMLGPSLSPGQDSEGDSSYKNIHLEK.[K]"	"1xBiotin [K]; 1xOxidation [M5]"	"9.96827E-07"	"0.000586377"	"1"	"1"	"12"	"P09581"	"P09581 [676-704]"	"P09581 1xBiotin [K]"	"Macrophage colony-stimulating factor 1 receptor [OS=Mus musculus]"	"2"	"3330.56168"	"-0.43"	"-0.14"	"-0.30"	"-2.97"	"0.22"	"0.65"	"0.37"	"126.1"	"93.9"	"114.1"	"102.4"	"16.1"	"147.3"	"283270.640625"	"210869.65625"	"256356.75"	"230067.8125"	"36204.73046875"	"330899.859375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"1110.86002"	"0.0001108"	"9E-10"	"4.72"	"39.70"
"10332"	"[K].KADVGFAMGIAGTDVAK.[E]"	"1xBiotin [K1]; 1xOxidation [M8]"	"9.35732E-06"	"0.000586377"	"2"	"4"	"3"	"Q6Q477; G5E829"	"Q6Q477 [796-812]; G5E829 [807-823]"	"Q6Q477 1xBiotin [K796]; G5E829 1xBiotin [K807]"	"Plasma membrane calcium-transporting ATPase 4 [OS=Mus musculus];Plasma membrane calcium-transporting ATPase 1 [OS=Mus musculus]"	"1"	"1892.92448"	"-9.97"	"-0.88"	"-9.97"	"-9.97"	"-0.70"	"9.97"	"0.18"	"277.6"	""	"151.1"	""	""	"171.4"	"11426.46484375"	""	"6219.16650390625"	""	""	"7053.97900390625"	"NotUnique"	"High"	"Not Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"2"	"946.96521"	"0.0001108"	"2.374E-08"	"3.07"	"42.01"
"10331"	"[K].KADIGVAMGIVGSDVSK.[Q]"	"1xBiotin [K1]; 1xOxidation [M8]"	"4.16021E-06"	"0.000586377"	"1"	"1"	"15"	"Q8VDN2"	"Q8VDN2 [727-743]"	"Q8VDN2 1xBiotin [K727]"	"Sodium/potassium-transporting ATPase subunit alpha-1 [OS=Mus musculus]"	"1"	"1888.95070"	"0.41"	"0.48"	"0.81"	"-1.90"	"0.84"	"0.43"	"0.37"	"79.6"	"105.9"	"111.0"	"139.3"	"21.3"	"142.9"	"28666.9384765625"	"38124.18359375"	"39944.888671875"	"50145.947265625"	"7667.81005859375"	"51463.4208984375"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"2"	"944.97829"	"0.0001108"	"7.255E-09"	"3.47"	"41.56"
"10394"	"[K].KALAAAGYDVEK.[N]"	"1xBiotin [K1]"	"1.20945E-05"	"0.000586377"	"3"	"4"	"6"	"P43274; P15864; P43277"	"P43274 [64-75]; P15864 [64-75]; P43277 [65-76]"	"P43274 1xBiotin [K64]; P15864 1xBiotin [K64]; P43277 1xBiotin [K65]"	"Histone H1.4 [OS=Mus musculus];Histone H1.2 [OS=Mus musculus];Histone H1.3 [OS=Mus musculus]"	"1"	"1461.74063"	"0.22"	"-0.07"	"0.45"	"0.13"	"0.06"	"-0.16"	"0.13"	"90.6"	"105.6"	"86.2"	"124.2"	"99.1"	"94.3"	"82865.4296875"	"96505.484375"	"78778.1484375"	"113588.09375"	"90619.1953125"	"86185.2890625"	"NotUnique"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"731.37421"	"0.0001108"	"3.45E-08"	"4.33"	"36.24"
"10330"	"[K].KADIGVAMGIVGSDVSK.[Q]"	"1xBiotin [K1]"	"7.36077E-07"	"0.000586377"	"1"	"1"	"9"	"Q8VDN2"	"Q8VDN2 [727-743]"	"Q8VDN2 1xBiotin [K727]"	"Sodium/potassium-transporting ATPase subunit alpha-1 [OS=Mus musculus]"	"1"	"1872.95578"	"9.97"	"9.97"	""	"9.97"	"9.97"	"-0.91"	"0.24"	""	"261.7"	"117.6"	""	"81.9"	"138.8"	""	"33272.78125"	"14951.8505859375"	""	"10411.5424804688"	"17653.84375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"936.98220"	"0.0001108"	"5.791E-10"	"4.42"	"49.33"
"9214"	"[R].GSKLVTLEAK.[S]"	"1xBiotin [K3]"	"0.00239521"	"0.000586377"	"1"	"2"	"6"	"Q920B0"	"Q920B0 [388-397]"	"Q920B0 1xBiotin [K390]"	"FERM domain-containing protein 4B [OS=Mus musculus]"	"1"	"1271.70278"	"0.55"	"0.38"	"0.41"	"0.06"	"0.95"	"0.39"	"0.56"	"74.3"	"109.1"	"96.9"	"98.8"	"77.7"	"143.2"	"62028.18359375"	"91015.25"	"80823.34375"	"82409.3515625"	"64862.97265625"	"119458.71875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"636.35473"	"0.0001108"	"7.789E-05"	"3.40"	"39.52"
"9223"	"[R].GSLLQIPVKTLK.[Y]"	"1xBiotin [K9]"	"0.00711164"	"0.000586377"	"1"	"1"	"6"	"Q8BTY2"	"Q8BTY2 [959-970]"	"Q8BTY2 1xBiotin [K967]"	"Sodium bicarbonate cotransporter 3 [OS=Mus musculus]"	"1"	"1522.90255"	"0.82"	"0.77"	"-0.42"	"-1.81"	"0.86"	"0.04"	"0.10"	"82.0"	"144.6"	"139.5"	"61.5"	"23.4"	"149.0"	"32482.8828125"	"57304.44921875"	"55290.63671875"	"24361.259765625"	"9268.685546875"	"59065.83984375"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"2"	"761.95491"	"0.0001108"	"0.000381"	"2.71"	"52.51"
"10317"	"[K].KAASGEAKPQAK.[K]"	"1xBiotin [K1]"	"0.000668305"	"0.000586377"	"1"	"1"	"8"	"P15864"	"P15864 [110-121]"	"P15864 1xBiotin [K110]"	"Histone H1.2 [OS=Mus musculus]"	"1"	"1411.73621"	"1.02"	"0.71"	"0.29"	"0.86"	"1.12"	"0.10"	"0.41"	"60.8"	"123.1"	"99.5"	"74.3"	"110.0"	"132.2"	"18880.068359375"	"38239.1533203125"	"30910.1809082031"	"23077.408203125"	"34180.5561523438"	"41077.3681640625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"471.25021"	"0.0001108"	"1.206E-05"	"3.25"	"15.16"
"9233"	"[R].GSPECVGLTETKSMIFSPASR.[V]"	"1xBiotin [K12]; 1xCarbamidomethyl [C5]"	"0.000324316"	"0.000586377"	"1"	"1"	"8"	"P83093"	"P83093 [649-669]"	"P83093 1xBiotin [K660]"	"Stromal interaction molecule 2 [OS=Mus musculus]"	"1"	"2480.16183"	"0.53"	"0.16"	"-1.15"	"-9.97"	"0.90"	"0.38"	"0.74"	"102.0"	"147.1"	"114.1"	"46.1"	""	"190.8"	"27380.830078125"	"39491.24609375"	"30630.326171875"	"12372.40625"	""	"51244.8203125"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"827.39197"	"0.0001108"	"4.183E-06"	"3.66"	"55.26"
"9234"	"[R].GSPECVGLTETKSMIFSPASR.[V]"	"1xBiotin [K12]; 1xCarbamidomethyl [C5]; 1xOxidation [M14]"	"0.000219428"	"0.000586377"	"1"	"1"	"21"	"P83093"	"P83093 [649-669]"	"P83093 1xBiotin [K660]"	"Stromal interaction molecule 2 [OS=Mus musculus]"	"1"	"2496.15674"	"-0.01"	"0.15"	"-0.83"	"-3.32"	"-0.06"	"-0.05"	"-0.21"	"127.2"	"126.0"	"140.7"	"71.7"	"12.7"	"121.7"	"169855.76171875"	"168325.16015625"	"187931.575195313"	"95824.544921875"	"17010.685546875"	"162517.932617188"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"3"	"832.72401"	"0.0001108"	"2.378E-06"	"3.08"	"50.94"
"10306"	"[K].KAAGTATAK.[K]"	"1xBiotin [K1]"	"0.022885"	"0.00104877"	"1"	"1"	"6"	"P43274"	"P43274 [140-148]"	"P43274 1xBiotin [K140]"	"Histone H1.4 [OS=Mus musculus]"	"1"	"1044.55064"	"0.67"	"0.49"	"0.62"	"0.59"	"0.60"	"-0.06"	"0.11"	"70.1"	"111.3"	"98.5"	"108.1"	"105.4"	"106.5"	"15031.8916015625"	"23865.8203125"	"21119.201171875"	"23181.064453125"	"22599.04296875"	"22824.306640625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"522.77895"	"0.0001873"	"0.002124"	"1.67"	"16.83"
"10304"	"[R].KAADVHEVR.[K]"	"1xBiotin [K1]"	"0.00129144"	"0.000586377"	"1"	"2"	"5"	"P52480"	"P52480 [247-255]"	"P52480 1xBiotin [K247]"	"Pyruvate kinase PKM [OS=Mus musculus]"	"1"	"1250.63102"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"3"	"417.54828"	"0.0001108"	"3.151E-05"	"3.62"	""
"10292"	"[K].HYKSTVGVDFALK.[V]"	"1xBiotin [K3]"	"1.71611E-05"	"0.000586377"	"1"	"1"	"12"	"Q91YQ1"	"Q91YQ1 [35-47]"	"Q91YQ1 1xBiotin [K37]"	"Ras-related protein Rab-7L1 [OS=Mus musculus]"	"1"	"1690.86214"	"0.66"	"0.55"	"0.36"	"-0.95"	"0.90"	"0.24"	"0.35"	"77.8"	"123.0"	"113.8"	"100.1"	"40.3"	"145.0"	"83750.8515625"	"132280.16796875"	"122484.982421875"	"107661.130859375"	"43344.8681640625"	"156004.2578125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"845.93477"	"0.0001108"	"5.725E-08"	"4.52"	"41.68"
"10323"	"[K].KAAVTPGK.[K]"	"1xBiotin [K1]"	"0.0064802"	"0.000586377"	"1"	"1"	"6"	"P09405"	"P09405 [80-87]"	"P09405 1xBiotin [K80]"	"Nucleolin [OS=Mus musculus]"	"1"	"997.54991"	"0.63"	"-0.15"	"0.44"	"0.50"	"0.65"	"0.02"	"0.81"	"77.0"	"119.2"	"69.2"	"104.7"	"108.7"	"121.2"	"32660.57421875"	"50558.984375"	"29354.16796875"	"44404.96875"	"46126.8642578125"	"51406.28515625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"499.27877"	"0.0001108"	"0.0003329"	"2.88"	"23.00"
"10395"	"[K].KALAAGGYDVEK.[N]"	"1xBiotin [K1]"	"2.31052E-05"	"0.000586377"	"1"	"1"	"6"	"P43276"	"P43276 [64-75]"	"P43276 1xBiotin [K64]"	"Histone H1.5 [OS=Mus musculus]"	"1"	"1447.72498"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"-0.16"	"-0.08"	""	"127.5"	"120.5"	"107.2"	"131.1"	"113.7"	""	"37210.9140625"	"35165.0859375"	"31282.580078125"	"38254.2578125"	"33196.65234375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"724.36628"	"0.0001108"	"8.901E-08"	"3.83"	"35.10"
"9096"	"[R].GQWINLPVLHLTKDPLK.[A]"	"1xBiotin [K13]"	"0.00018314"	"0.000586377"	"1"	"1"	"13"	"P58742"	"P58742 [40-56]"	"P58742 1xBiotin [K52]"	"Aladin [OS=Mus musculus]"	"1"	"2198.21544"	"0.29"	"0.09"	"-9.97"	"-9.97"	"-0.05"	"-0.34"	"-0.14"	"140.8"	"172.5"	"150.3"	""	""	"136.3"	"135519.413085938"	"166037.930664063"	"144653.268554688"	""	""	"131192.484375"	""	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"733.41002"	"0.0001108"	"1.823E-06"	"4.32"	"58.41"
"10425"	"[R].KAMEAVAAQGK.[VA]"	"1xBiotin [K1]; 1xOxidation [M3]"	"0.00102284"	"0.000586377"	"1"	"2"	"4"	"Q9DBJ1"	"Q9DBJ1 [241-251]"	"Q9DBJ1 1xBiotin [K241]"	"Phosphoglycerate mutase 1 [OS=Mus musculus]"	"1"	"1345.66027"	"0.06"	"0.07"	"-0.04"	"-9.97"	"0.37"	"0.31"	"0.30"	"112.0"	"116.9"	"117.4"	"108.9"	""	"144.8"	"7654.21875"	"7994.40478515625"	"8027.1025390625"	"7445.73828125"	""	"9899.28125"	""	"High"	"High"	"High"	"Peak Found"	"Not Found"	"High"	"High"	"2"	"673.33356"	"0.0001108"	"2.239E-05"	"2.47"	"22.01"
"10583"	"[K].KDLLEIDR.[F]"	"1xBiotin [K1]"	"0.00659418"	"0.000586377"	"1"	"1"	"7"	"Q4VBD2"	"Q4VBD2 [548-555]"	"Q4VBD2 1xBiotin [K548]"	"Transmembrane anterior posterior transformation protein 1 [OS=Mus musculus]"	"1"	"1227.64018"	"0.00"	"0.01"	"0.04"	"-0.03"	"0.31"	"0.31"	"0.30"	"95.9"	"96.0"	"96.7"	"98.4"	"94.2"	"118.9"	"124719.8671875"	"124914.0703125"	"125786.2578125"	"128030.390625"	"122513.640625"	"154676.21875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"614.32339"	"0.0001108"	"0.0003416"	"3.04"	"43.67"
"10580"	"[R].KDIESYKSGSGVNNR.[R]"	"1xBiotin [K7]"	"5.76691E-06"	"0.000586377"	"1"	"1"	"12"	"O88630"	"O88630 [144-158]"	"O88630 1xBiotin [K150]"	"Golgi SNAP receptor complex member 1 [OS=Mus musculus]"	"2"	"1879.89669"	"-0.14"	"-0.22"	"0.02"	"-0.16"	"0.25"	"0.39"	"0.47"	"102.2"	"92.9"	"87.7"	"103.8"	"91.6"	"121.8"	"92012.5654296875"	"83639.025390625"	"78957.4765625"	"93500.6791992188"	"82490.203125"	"109671.26171875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"940.45157"	"0.0001108"	"1.168E-08"	"4.11"	"30.42"
"10579"	"[R].KDIESYK.[S]"	"1xBiotin [K1]"	"0.0142615"	"0.000586377"	"1"	"1"	"10"	"O88630"	"O88630 [144-150]"	"O88630 1xBiotin [K144]"	"Golgi SNAP receptor complex member 1 [OS=Mus musculus]"	"1"	"1108.53432"	"0.69"	"0.13"	"0.02"	"-0.11"	"0.46"	"-0.24"	"0.33"	"85.4"	"138.2"	"93.3"	"86.5"	"79.2"	"117.4"	"186750"	"302233.25"	"204099.25"	"189093.9375"	"173174.984375"	"256721.84375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"554.77083"	"0.0001108"	"0.001056"	"2.83"	"31.55"
"8992"	"[K].GPQKVVAESLATHSGR.[L]"	"1xBiotin [K4]"	"8.58121E-05"	"0.000586377"	"1"	"1"	"6"	"Q8CJF7"	"Q8CJF7 [1292-1307]"	"Q8CJF7 1xBiotin [K1295]"	"protein elys [OS=Mus musculus]"	"1"	"1862.95414"	"0.56"	"-0.47"	"0.54"	"-0.55"	"-0.21"	"-0.77"	"0.26"	"96.7"	"142.8"	"69.9"	"140.7"	"66.1"	"83.7"	"12967.8291015625"	"19140.439453125"	"9374.828125"	"18870.1171875"	"8868.9423828125"	"11227.052734375"	""	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"3"	"621.65607"	"0.0001108"	"6.043E-07"	"3.36"	"36.21"
"10557"	"[R].KDFLAMFSPK.[C]"	"1xBiotin [K1]; 1xOxidation [M6]"	"0.00148534"	"0.000586377"	"1"	"1"	"5"	"Q99N69"	"Q99N69 [260-269]"	"Q99N69 1xBiotin [K260]"	"Leupaxin [OS=Mus musculus]"	"1"	"1425.69051"	"-0.23"	"-0.56"	"-0.99"	"-3.20"	"-0.38"	"-0.15"	"0.18"	"153.5"	"130.9"	"103.8"	"77.2"	"16.7"	"117.9"	"20401.5546875"	"17402.451171875"	"13799.3291015625"	"10258.9619140625"	"2216.84887695313"	"15665.921875"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"2"	"713.34907"	"0.0001108"	"3.867E-05"	"2.85"	"50.56"
"10553"	"[K].KDESLVSR.[A]"	"1xBiotin [K1]"	"0.0103113"	"0.000586377"	"1"	"1"	"6"	"Q8R4R6"	"Q8R4R6 [310-317]"	"Q8R4R6 1xBiotin [K310]"	"Nucleoporin NUP53 [OS=Mus musculus]"	"1"	"1159.57758"	"0.51"	"0.40"	"0.42"	"0.42"	"0.46"	"-0.05"	"0.06"	"76.9"	"109.5"	"101.6"	"103.1"	"102.9"	"106.0"	"19672.53515625"	"28033.310546875"	"26008.267578125"	"26396.09375"	"26337.728515625"	"27125.671875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"580.29245"	"0.0001108"	"0.0006556"	"1.88"	"30.08"
"10544"	"[R].KDDLLQQAR.[K]"	"1xBiotin [K1]"	"0.00242328"	"0.000586377"	"1"	"2"	"6"	"Q9R049"	"Q9R049 [586-594]"	"Q9R049 1xBiotin [K586]"	"E3 ubiquitin-protein ligase AMFR [OS=Mus musculus]"	"1"	"1312.66780"	"0.24"	"0.22"	"0.49"	"0.46"	"0.36"	"0.12"	"0.14"	"81.0"	"95.7"	"94.2"	"113.5"	"111.7"	"103.9"	"57596.46875"	"68054.84375"	"67030.3671875"	"80756.90625"	"79444.40625"	"73923.3203125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"656.83744"	"0.0001108"	"7.874E-05"	"2.93"	"36.38"
"10513"	"[R].KCPFYAAQPDK.[G]"	"1xBiotin [K1]; 1xCarbamidomethyl [C2]"	"0.00016977"	"0.000586377"	"1"	"1"	"59"	"O70252"	"O70252 [263-273]"	"O70252 1xBiotin [K263]"	"Heme oxygenase 2 [OS=Mus musculus]"	"1"	"1550.71303"	"0.21"	"0.18"	"0.20"	"0.45"	"0.18"	"-0.03"	"0.00"	"86.5"	"99.8"	"97.8"	"99.6"	"118.3"	"97.9"	"5483910.38769531"	"6325999.33886719"	"6198335.82226563"	"6312090.04296875"	"7495243.33105469"	"6205611.53710938"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"775.86028"	"0.0001108"	"1.628E-06"	"3.01"	"36.42"
"9024"	"[R].GPYHFR.[A]"	""	"0.111552"	"0.00731053"	"1"	"1"	"9"	"P19253"	"P19253 [69-74]"	""	"60S ribosomal protein L13a [OS=Mus musculus]"	"0"	"776.38383"	"0.40"	"0.56"	"0.70"	"1.34"	"0.46"	"0.06"	"-0.10"	"64.4"	"85.0"	"94.9"	"104.5"	"162.8"	"88.4"	"73357.0703125"	"96884.6484375"	"108178.9765625"	"119039.0390625"	"185555.671875"	"100703.484375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"388.69532"	"0.001478"	"0.02279"	"1.70"	"18.08"
"9055"	"[K].GQKVGEFSGANK.[E]"	"1xBiotin [K3]"	"0.0628496"	"0.0019826"	"1"	"1"	"1"	"P10639"	"P10639 [83-94]"	"P10639 1xBiotin [K85]"	"thioredoxin [OS=Mus musculus]"	"1"	"1447.69982"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"724.35334"	"0.0003442"	"0.009509"	"2.17"	""
"10483"	"[R].KATGPPVSELITK.[A]"	"1xBiotin [K1]"	"0.000594746"	"0.000586377"	"1"	"1"	"11"	"P43276"	"P43276 [34-46]"	"P43276 1xBiotin [K34]"	"Histone H1.5 [OS=Mus musculus]"	"1"	"1566.85599"	"0.31"	"0.03"	"-0.02"	"-0.10"	"0.34"	"0.03"	"0.32"	"93.1"	"115.6"	"94.8"	"91.6"	"86.9"	"118.0"	"23097.984375"	"28690.2578125"	"23517.025390625"	"22741.138671875"	"21565.20703125"	"29289.78515625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"783.93193"	"0.0001108"	"1.013E-05"	"3.41"	"41.55"
"9058"	"[K].GQLDLKAACNAIYCCQPK.[H]"	"1xBiotin [K6]; 3xCarbamidomethyl [C9; C14; C15]"	"0.00129144"	"0.000586377"	"1"	"2"	"7"	"Q8K078"	"Q8K078 [498-515]"	"Q8K078 1xBiotin [K503]"	"solute carrier organic anion transporter family member 4A1 [OS=Mus musculus]"	"1"	"2336.06542"	"9.97"	"9.97"	"9.97"	""	""	"-9.97"	"-9.97"	""	"141.0"	"286.5"	"172.5"	""	""	""	"11966.361328125"	"24316.9697265625"	"14636.11328125"	""	""	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"779.36014"	"0.0001108"	"3.149E-05"	"3.36"	"45.97"
"9064"	"[K].GQLTEASSATSKAYCVYR.[R]"	"1xBiotin [K12]; 1xCarbamidomethyl [C15]"	"3.29466E-06"	"0.000586377"	"1"	"3"	"8"	"Q9Z329-1"	"Q9Z329-1 [1865-1882]"	"Q9Z329-1 1xBiotin [K1876]"	"Inositol 1,4,5-trisphosphate receptor type 2 [OS=Mus musculus]"	"1"	"2218.02671"	"-9.97"	"-9.97"	"-9.97"	"-9.97"	"-9.97"	""	""	"600.0"	""	""	""	""	""	"31953.03125"	""	""	""	""	""	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"1109.51729"	"0.0001108"	"5.156E-09"	"3.92"	"40.35"
"9069"	"[K].GQPLCVLSAMKMETVVTSPMEGTIR.[K]"	"1xBiotin [K11]; 1xCarbamidomethyl [C5]; 1xOxidation [M]"	"0.00063414"	"0.000586377"	"1"	"1"	"6"	"Q05920"	"Q05920 [1134-1158]"	"Q05920 1xBiotin [K1144]"	"pyruvate carboxylase, mitochondrial [OS=Mus musculus]"	"1"	"2977.43239"	"0.25"	"0.55"	"-9.97"	"-9.97"	"1.26"	"1.00"	"0.71"	"99.3"	"118.4"	"145.0"	""	""	"237.3"	"25112.306640625"	"29928.068359375"	"36650.2578125"	""	""	"59995.0947265625"	""	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"993.14913"	"0.0001108"	"1.116E-05"	"3.98"	"59.36"
"10468"	"[R].KASGPPVSELITK.[A]"	"1xBiotin [K1]"	"4.874E-05"	"0.000586377"	"2"	"2"	"13"	"P15864; P43277"	"P15864 [34-46]; P43277 [35-47]"	"P15864 1xBiotin [K34]; P43277 1xBiotin [K35]"	"Histone H1.2 [OS=Mus musculus];Histone H1.3 [OS=Mus musculus]"	"1"	"1552.84034"	"0.48"	"0.21"	"0.23"	"0.05"	"0.15"	"-0.33"	"-0.06"	"87.5"	"121.8"	"100.9"	"102.3"	"90.4"	"97.1"	"47512.07421875"	"66165.078125"	"54824.69921875"	"55581.91796875"	"49084.296875"	"52742.453125"	"NotUnique"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"776.92411"	"0.0001108"	"2.64E-07"	"3.66"	"40.84"
"9070"	"[K].GQPLCVLSAMKMETVVTSPMEGTIR.[K]"	"1xBiotin [K11]; 1xCarbamidomethyl [C5]; 2xOxidation [M12; M]"	"0.000270684"	"0.000586377"	"1"	"1"	"21"	"Q05920"	"Q05920 [1134-1158]"	"Q05920 1xBiotin [K1144]"	"pyruvate carboxylase, mitochondrial [OS=Mus musculus]"	"1"	"2993.42730"	"-0.52"	"-0.35"	"-2.92"	"-9.97"	"0.07"	"0.59"	"0.42"	"163.9"	"114.2"	"128.7"	"21.6"	""	"171.6"	"116310.26171875"	"81015.41015625"	"91291.599609375"	"15316.0517578125"	""	"121776.484375"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"998.48068"	"0.0001108"	"3.232E-06"	"4.17"	"56.70"
"10437"	"[R].KANLTCKLAIDNLEK.[A]"	"1xBiotin [K]; 1xCarbamidomethyl [C6]"	"0.000668305"	"0.000586377"	"1"	"1"	"3"	"Q6QD59"	"Q6QD59 [97-111]"	"Q6QD59 1xBiotin [K]"	"Vesicle transport protein SEC20 [OS=Mus musculus]"	"2"	"1957.02453"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"653.01296"	"0.0001108"	"1.201E-05"	"3.42"	""
"10430"	"[R].KAMPSNSPVAALAATGK.[E]"	"1xBiotin [K1]; 1xOxidation [M3]"	"7.24608E-05"	"0.000586377"	"1"	"1"	"16"	"Q9QY76"	"Q9QY76 [200-216]"	"Q9QY76 1xBiotin [K200]"	"vesicle-associated membrane protein-associated protein B [OS=Mus musculus]"	"1"	"1855.94047"	"0.13"	"0.10"	"0.05"	"-0.69"	"0.45"	"0.32"	"0.35"	"96.9"	"106.0"	"104.3"	"100.1"	"60.2"	"132.5"	"66482.1259765625"	"72718.7890625"	"71494.490234375"	"68654.248046875"	"41260.8237304688"	"90841.24609375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"928.47372"	"0.0001108"	"4.719E-07"	"3.40"	"38.68"
"9071"	"[K].GQPLCVLSAMKMETVVTSPMEGTIR.[K]"	"1xBiotin [K11]; 1xCarbamidomethyl [C5]; 3xOxidation [M10; M12; M20]"	"0.000158296"	"0.000586377"	"1"	"1"	"12"	"Q05920"	"Q05920 [1134-1158]"	"Q05920 1xBiotin [K1144]"	"pyruvate carboxylase, mitochondrial [OS=Mus musculus]"	"1"	"3009.42222"	"-1.27"	"-0.49"	"-1.00"	"-3.33"	"0.17"	"1.44"	"0.66"	"155.7"	"64.6"	"110.8"	"78.1"	"15.5"	"175.2"	"113374.078125"	"47053.546875"	"80690.8359375"	"56862.88671875"	"11291.0576171875"	"127525.640625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"1003.81247"	"0.0001108"	"1.473E-06"	"3.12"	"47.67"
"10279"	"[R].HWGGNVLGPK.[S]"	""	"0.00313117"	"0.000586377"	"1"	"1"	"6"	"P12970"	"P12970 [236-245]"	""	"60S ribosomal protein L7a [OS=Mus musculus]"	"0"	"1064.56359"	"0.91"	"0.57"	"1.08"	"1.09"	"0.54"	"-0.37"	"-0.03"	"59.6"	"112.1"	"88.4"	"126.3"	"126.7"	"86.9"	"15162.1103515625"	"28527.234375"	"22505.69921875"	"32150.470703125"	"32236.14453125"	"22107.115234375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"532.78528"	"0.0001108"	"0.000115"	"2.98"	"26.34"
"8952"	"[R].GPGPKGPSGTVSEAQLAR.[R]"	"1xBiotin [K5]"	"4.20523E-07"	"0.000586377"	"1"	"4"	"20"	"Q69ZN7-1"	"Q69ZN7-1 [163-180]"	"Q69ZN7-1 1xBiotin [K167]"	"Myoferlin [OS=Mus musculus]"	"1"	"1934.97527"	"-0.05"	"-0.12"	"0.10"	"-0.18"	"-0.06"	"-0.01"	"0.06"	"103.6"	"99.9"	"95.3"	"110.7"	"91.3"	"99.2"	"254264.7421875"	"245228.4140625"	"234055.21875"	"271898.0390625"	"224171.8203125"	"243429.421875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"967.99145"	"0.0001108"	"2.568E-10"	"4.15"	"34.80"
"10274"	"[K].HVVFGKVK.[E]"	"1xBiotin [K6]"	"0.0140162"	"0.000586377"	"1"	"1"	"6"	"P17742"	"P17742 [126-133]"	"P17742 1xBiotin [K131]"	"peptidyl-prolyl cis-trans isomerase A [OS=Mus musculus]"	"1"	"1139.63940"	"0.51"	"0.43"	"0.06"	"-0.09"	"0.25"	"-0.26"	"-0.19"	"86.4"	"123.1"	"116.6"	"90.1"	"81.3"	"102.5"	"40113.73046875"	"57135.8125"	"54115.93359375"	"41829.5546875"	"37730.28515625"	"47566.89453125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"570.32334"	"0.0001108"	"0.001031"	"2.07"	"32.51"
"10271"	"[K].HVSTSSDEGSPSASTPMINKTGFK.[F]"	"1xBiotin [K20]"	"4.83697E-07"	"0.000586377"	"1"	"1"	"7"	"Q8BGR2"	"Q8BGR2 [238-261]"	"Q8BGR2 1xBiotin [K257]"	"volume-regulated anion channel subunit LRRC8D [OS=Mus musculus]"	"1"	"2691.23889"	"0.49"	"0.30"	"0.02"	"0.97"	"-0.16"	"-0.65"	"-0.46"	"80.0"	"112.0"	"98.2"	"81.4"	"156.8"	"71.6"	"86323.203125"	"120873.8203125"	"105943.75"	"87817.1875"	"169128.703125"	"77235.828125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"897.75076"	"0.0001108"	"3.129E-10"	"6.97"	"39.35"
"9963"	"[K].HMNSAMEDSSSKMFLK.[V]"	"1xBiotin [K12]; 2xOxidation [M6; M]"	"0.000149329"	"0.000586377"	"1"	"1"	"16"	"Q61168"	"Q61168 [217-232]"	"Q61168 1xBiotin [K228]"	"Lysosomal-associated transmembrane protein 5 [OS=Mus musculus]"	"1"	"2100.88573"	"-0.13"	"0.23"	"0.47"	"0.20"	"0.54"	"0.67"	"0.31"	"84.7"	"77.5"	"99.6"	"117.6"	"97.1"	"123.4"	"82370.61328125"	"75331.83984375"	"96823.611328125"	"114355.208007813"	"94418.94921875"	"119898.234375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"700.96687"	"0.0001108"	"1.346E-06"	"4.41"	"36.81"
"9962"	"[K].HMNSAMEDSSSKMFLK.[V]"	"1xBiotin [K12]; 1xOxidation [M2]"	"0.000145038"	"0.000586377"	"1"	"1"	"4"	"Q61168"	"Q61168 [217-232]"	"Q61168 1xBiotin [K228]"	"Lysosomal-associated transmembrane protein 5 [OS=Mus musculus]"	"1"	"2084.89081"	"1.04"	"0.64"	"0.87"	"1.64"	"0.57"	"-0.47"	"-0.07"	"54.3"	"111.7"	"84.4"	"99.5"	"169.3"	"80.6"	"14688.7431640625"	"30211.533203125"	"22836.79296875"	"26918.953125"	"45789.7578125"	"21809.712890625"	""	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"3"	"695.63534"	"0.0001108"	"1.299E-06"	"4.41"	"39.70"
"9936"	"[R].HLSKMQQNGYENPTYK.[F]"	"1xBiotin [K4]; 1xOxidation [M5]"	"0.00343692"	"0.000586377"	"1"	"3"	"8"	"P12023"	"P12023 [748-763]"	"P12023 1xBiotin [K751]"	"Amyloid-beta A4 protein [OS=Mus musculus]"	"1"	"2179.98993"	"0.42"	"-0.13"	"0.01"	"-0.70"	"0.44"	"0.02"	"0.57"	"96.3"	"128.8"	"88.2"	"97.2"	"59.1"	"130.5"	"27478.69140625"	"36759.98828125"	"25161.25390625"	"27730.5078125"	"16864.6015625"	"37257.33984375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"727.33536"	"0.0001108"	"0.0001318"	"3.58"	"28.38"
"9467"	"[R].GVQKILQDYK.[S]"	"1xBiotin [K4]"	"0.00307694"	"0.000586377"	"1"	"1"	"5"	"P56480"	"P56480 [423-432]"	"P56480 1xBiotin [K426]"	"ATP synthase subunit beta, mitochondrial [OS=Mus musculus]"	"1"	"1417.75080"	""	""	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	""	""	""	"266.2"	"133.5"	"200.3"	""	""	""	"15257.802734375"	"7652.359375"	"11483.798828125"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"2"	"709.37857"	"0.0001108"	"0.0001124"	"3.07"	"41.39"
"9481"	"[K].GVSQAVEHINKTIAPALVSK.[K]"	"1xBiotin [K11]"	"0.000712571"	"0.000586377"	"1"	"1"	"4"	"P17182"	"P17182 [61-80]"	"P17182 1xBiotin [K71]"	"alpha-enolase [OS=Mus musculus]"	"1"	"2288.24311"	"9.97"	"9.97"	""	""	"9.97"	"0.30"	"0.50"	""	"193.6"	"168.1"	""	""	"238.3"	""	"21458.6171875"	"18635.69921875"	""	""	"26422.265625"	""	"High"	"High"	"Peak Found"	"High"	"Not Found"	"High"	"High"	"3"	"763.41924"	"0.0001108"	"1.321E-05"	"4.49"	"45.19"
"9920"	"[R].HLNKMQNHGYENPTYK.[Y]"	"1xBiotin [K4]; 1xOxidation [M5]"	"0.0016984"	"0.000586377"	"1"	"2"	"12"	"Q06335"	"Q06335 [685-700]"	"Q06335 1xBiotin [K688]"	"Amyloid-like protein 2 [OS=Mus musculus]"	"1"	"2216.00117"	"0.54"	"0.36"	"0.31"	"-0.52"	"0.44"	"-0.10"	"0.08"	"85.3"	"124.1"	"109.3"	"106.0"	"59.6"	"115.7"	"35651.5537109375"	"51877.76953125"	"45709.716796875"	"44305.373046875"	"24928.697265625"	"48367.27734375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"739.33873"	"0.0001108"	"4.716E-05"	"3.54"	"25.25"
"9511"	"[K].GWNFNYLQFPR.[S]"	""	"0.0136165"	"0.000586377"	"1"	"1"	"2"	"Q8R0X7"	"Q8R0X7 [471-481]"	""	"sphingosine-1-phosphate lyase 1 [OS=Mus musculus]"	"0"	"1441.70114"	"9.97"	""	""	""	"9.97"	"-0.08"	"9.97"	""	"308.6"	""	""	""	"291.4"	""	"11737.8564453125"	""	""	""	"11083.626953125"	""	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"2"	"721.35456"	"0.0001108"	"0.0009915"	"2.13"	"54.75"
"9913"	"[R].HLNDDDVTGSVKSER.[R]"	"1xBiotin [K12]"	"0.00022592"	"0.000586377"	"1"	"1"	"6"	"O70480"	"O70480 [8-22]"	"O70480 1xBiotin [K19]"	"Vesicle-associated membrane protein 4 [OS=Mus musculus]"	"1"	"1897.87086"	"0.28"	"0.00"	"0.17"	"0.46"	"-0.01"	"-0.29"	"-0.01"	"89.3"	"108.8"	"89.6"	"100.4"	"122.9"	"89.0"	"15109.9951171875"	"18400.494140625"	"15161.4169921875"	"16986.396484375"	"20795.697265625"	"15055.0576171875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"633.29495"	"0.0001108"	"2.474E-06"	"3.16"	"31.03"
"9964"	"[K].HMNSAMEDSSSKMFLK.[V]"	"1xBiotin [K12]; 3xOxidation [M2; M6; M13]"	"3.03909E-05"	"0.000586377"	"1"	"1"	"20"	"Q61168"	"Q61168 [217-232]"	"Q61168 1xBiotin [K228]"	"Lysosomal-associated transmembrane protein 5 [OS=Mus musculus]"	"1"	"2116.88064"	"-0.47"	"-0.19"	"-0.06"	"-1.95"	"-0.28"	"0.19"	"-0.09"	"129.2"	"93.5"	"113.3"	"124.0"	"33.4"	"106.6"	"202904.126953125"	"146909.376953125"	"177997.956054688"	"194794.377929688"	"52494.7580566406"	"167436.868164063"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"706.29841"	"0.0001108"	"1.322E-07"	"4.53"	"33.20"
"9858"	"[K].HLDEYASIASSSKGGR.[I]"	"1xBiotin [K13]"	"6.9158E-05"	"0.000586377"	"1"	"2"	"6"	"Q8BYI6-1"	"Q8BYI6-1 [363-378]"	"Q8BYI6-1 1xBiotin [K375]"	"Lysophosphatidylcholine acyltransferase 2 [OS=Mus musculus]"	"1"	"1903.89669"	"0.12"	"-0.26"	"0.31"	"0.07"	"-0.08"	"-0.20"	"0.19"	"97.4"	"106.0"	"81.1"	"120.8"	"102.3"	"92.4"	"112070.1015625"	"121906.763671875"	"93340.796875"	"139036.91015625"	"117708.400390625"	"106275.76953125"	""	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"3"	"635.30432"	"0.0001108"	"4.389E-07"	"3.77"	"34.04"
"9839"	"[K].HKSSLNSSPWSGLMALGNSR.[H]"	"1xBiotin [K2]"	"1.4833E-05"	"0.000586377"	"1"	"1"	"4"	"Q3TDQ1"	"Q3TDQ1 [11-30]"	"Q3TDQ1 1xBiotin [K12]"	"Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B [OS=Mus musculus]"	"1"	"2355.13324"	"9.97"	"9.97"	""	""	"9.97"	"0.26"	"0.45"	""	"195.1"	"171.2"	""	""	"233.7"	""	"71832.7109375"	"63012.7265625"	""	""	"86057.46875"	""	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"785.71639"	"0.0001108"	"4.629E-08"	"4.80"	"51.13"
"9549"	"[R].GYPTLLWFR.[D]"	""	"0.0322742"	"0.00104877"	"1"	"1"	"10"	"Q91W90"	"Q91W90 [247-255]"	""	"Thioredoxin domain-containing protein 5 [OS=Mus musculus]"	"0"	"1152.62004"	"0.00"	"-0.10"	"-0.97"	"-9.97"	"-0.30"	"-0.30"	"-0.20"	"140.8"	"140.8"	"131.6"	"72.1"	""	"114.7"	"62628.2265625"	"62642.8359375"	"58569.0078125"	"32056.62109375"	""	"51045.5390625"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"2"	"576.81354"	"0.0001873"	"0.003514"	"1.93"	"56.06"
"9808"	"[K].HKDSKSTWVILHHK.[V]"	"1xBiotin [K5]"	"0.00141767"	"0.000586377"	"1"	"1"	"7"	"P56395"	"P56395 [20-33]"	"P56395 1xBiotin [K24]"	"Cytochrome b5 [OS=Mus musculus]"	"2"	"1942.01160"	"1.72"	"1.18"	"-9.97"	"-1.96"	"0.89"	"-0.83"	"-0.28"	"69.2"	"228.1"	"156.4"	""	"17.8"	"128.5"	"28434.416015625"	"93714.5546875"	"64232.5390625"	""	"7327.07080078125"	"52782.234375"	""	"High"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"3"	"648.00806"	"0.0001108"	"3.618E-05"	"4.40"	"30.67"
"9785"	"[R].HGSLGFLPR.[K]"	""	"0.00269117"	"0.000586377"	"1"	"1"	"8"	"P27659"	"P27659 [11-19]"	""	"60S ribosomal protein L3 [OS=Mus musculus]"	"0"	"983.54213"	"0.91"	"0.58"	"0.98"	"0.71"	"0.93"	"0.02"	"0.35"	"60.7"	"114.1"	"90.6"	"119.7"	"99.3"	"115.6"	"20163.341796875"	"37874.91796875"	"30064.845703125"	"39741.828125"	"32978.50390625"	"38366.2109375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"492.27457"	"0.0001108"	"9.216E-05"	"2.56"	"32.36"
"9598"	"[K].HASQKDYSHGFGGR.[Y]"	"1xBiotin [K5]"	"0.000121052"	"0.000586377"	"1"	"1"	"6"	"P49710"	"P49710 [147-160]"	"P49710 1xBiotin [K151]"	"Hematopoietic lineage cell-specific protein [OS=Mus musculus]"	"1"	"1772.79216"	"0.91"	"0.11"	"0.33"	"0.03"	"0.22"	"-0.69"	"0.11"	"81.2"	"152.1"	"87.4"	"102.1"	"82.7"	"94.4"	"30568.53125"	"57259.76171875"	"32894.2109375"	"38436.30078125"	"31143.546875"	"35523.6640625"	""	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"3"	"591.60213"	"0.0001108"	"9.902E-07"	"4.50"	"27.63"
"9765"	"[K].HGKGLDK.[S]"	"1xBiotin [K3]"	"0.0243779"	"0.00104877"	"1"	"1"	"9"	"Q9DBG7"	"Q9DBG7 [220-226]"	"Q9DBG7 1xBiotin [K222]"	"signal recognition particle receptor subunit alpha [OS=Mus musculus]"	"1"	"980.49821"	"1.30"	"0.80"	"0.95"	"0.63"	"0.83"	"-0.47"	"0.03"	"57.3"	"141.0"	"99.9"	"110.9"	"88.8"	"102.0"	"67646.2265625"	"166418.515625"	"117917.7421875"	"130876.28125"	"104759.6015625"	"120331.328125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"490.75276"	"0.0001873"	"0.00233"	"2.48"	"20.40"
"9742"	"[K].HFWQHR.[M]"	""	"0.065346"	"0.0019826"	"1"	"1"	"6"	"Q99NB9"	"Q99NB9 [817-822]"	""	"splicing factor 3B subunit 1 [OS=Mus musculus]"	"0"	"910.44308"	"0.27"	"0.33"	"0.31"	"1.27"	"-0.22"	"-0.49"	"-0.55"	"75.3"	"90.6"	"94.4"	"93.3"	"181.8"	"64.6"	"16680.544921875"	"20072.0859375"	"20897.66015625"	"20666.1015625"	"40261.32421875"	"14300.56640625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"455.72517"	"0.0003442"	"0.01009"	"1.57"	"15.64"
"9741"	"[R].HFWGLR.[V]"	""	"0.129378"	"0.00949852"	"1"	"1"	"10"	"P62270"	"P62270 [125-130]"	""	"40S ribosomal protein S18 [OS=Mus musculus]"	"0"	"815.43112"	"0.22"	"-1.09"	"0.23"	"-0.79"	"0.13"	"-0.09"	"1.22"	"109.4"	"127.7"	"51.3"	"128.5"	"63.4"	"119.7"	"841893.1875"	"982791.1875"	"394641.53125"	"988840.9375"	"488114.03125"	"920828"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"408.21910"	"0.001921"	"0.02855"	"1.93"	"32.57"
"9840"	"[K].HKSSLNSSPWSGLMALGNSR.[H]"	"1xBiotin [K2]; 1xOxidation [M14]"	"2.56815E-08"	"0.000586377"	"1"	"1"	"8"	"Q3TDQ1"	"Q3TDQ1 [11-30]"	"Q3TDQ1 1xBiotin [K12]"	"Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B [OS=Mus musculus]"	"1"	"2371.12816"	"0.31"	"0.33"	"-1.54"	"-9.97"	"0.56"	"0.24"	"0.22"	"112.9"	"140.1"	"142.0"	"39.0"	""	"166.0"	"194083.359375"	"240681.53125"	"244074.28125"	"66973.6484375"	""	"285211.71875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"791.04761"	"0.000110791"	"4.323035E-12"	"6.32"	"45.98"
"9447"	"[K].GVIVHTMAAVQALGVKANVEK.[K]"	"1xBiotin [K16]; 1xOxidation [M7]"	"5.38195E-05"	"0.000586377"	"1"	"1"	"2"	"Q9CZW4"	"Q9CZW4 [250-270]"	"Q9CZW4 1xBiotin [K265]"	"long-chain-fatty-acid--CoA ligase 3 [OS=Mus musculus]"	"1"	"2377.27303"	"-0.47"	"-0.69"	"-9.97"	"-9.97"	"-0.73"	"-0.26"	"-0.04"	"203.9"	"147.2"	"126.3"	""	""	"122.6"	"13736.8115234375"	"9917.2412109375"	"8507.103515625"	""	""	"8259.4892578125"	""	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Peak Found"	"High"	"3"	"793.09590"	"0.0001108"	"3.045E-07"	"5.05"	"44.21"
"9367"	"[R].GTQLGDKLDSFIK.[A]"	"1xBiotin [K7]"	"0.00022592"	"0.000586377"	"1"	"1"	"6"	"P49070"	"P49070 [105-117]"	"P49070 1xBiotin [K111]"	"calcium signal-modulating cyclophilin ligand [OS=Mus musculus]"	"1"	"1647.84107"	"0.65"	"0.35"	"-0.64"	"-3.92"	"0.54"	"-0.11"	"0.19"	"99.8"	"156.9"	"127.1"	"64.1"	"6.6"	"145.4"	"49154.44921875"	"77276.0546875"	"62594.01953125"	"31586.205078125"	"3242.13598632813"	"71582.6953125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"824.42432"	"0.0001108"	"2.467E-06"	"4.25"	"55.41"
"9982"	"[K].HNELTGDNVGPLILKK.[K]"	"1xBiotin [K]"	"7.06634E-07"	"0.000586377"	"1"	"1"	"96"	"Q9CQB5"	"Q9CQB5 [117-132]"	"Q9CQB5 1xBiotin [K]"	"CDGSH iron-sulfur domain-containing protein 2 [OS=Mus musculus]"	"1"	"1974.04771"	"0.68"	"0.37"	"0.05"	"-1.43"	"0.25"	"-0.43"	"-0.12"	"92.5"	"148.5"	"119.3"	"95.5"	"34.4"	"109.9"	"5355384.40625"	"8598529.60107422"	"6909851.28125"	"5527918.59448242"	"1992294.14233398"	"6361526.20141602"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"987.52792"	"0.0001108"	"5.473E-10"	"5.66"	"44.63"
"10263"	"[K].HVNKDLGNMEENKK.[L]"	"1xBiotin [K4]; 1xOxidation [M9]"	"0.00278689"	"0.000586377"	"1"	"1"	"5"	"Q61490"	"Q61490 [560-573]"	"Q61490 1xBiotin [K563]"	"CD166 antigen [OS=Mus musculus]"	"2"	"1897.88949"	"0.23"	"-0.07"	"0.00"	"-0.97"	"0.14"	"-0.09"	"0.20"	"104.6"	"122.3"	"99.9"	"104.8"	"53.5"	"114.9"	"17151.376953125"	"20066.517578125"	"16390.09765625"	"17189.158203125"	"8778.62109375"	"18848.083984375"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"3"	"633.30060"	"0.0001108"	"9.697E-05"	"2.97"	"22.36"
"9289"	"[R].GTAKANVGAGK.[K]"	"1xBiotin [K4]"	"0.00984384"	"0.000586377"	"1"	"3"	"6"	"P62849-1"	"P62849-1 [119-129]"	"P62849-1 1xBiotin [K122]"	"40S ribosomal protein S24 [OS=Mus musculus]"	"1"	"1199.62012"	"0.10"	"1.08"	"0.96"	"1.09"	"1.40"	"1.30"	"0.32"	"55.1"	"58.9"	"116.8"	"107.1"	"116.9"	"145.3"	"8719.01000976563"	"9323.974609375"	"18490.5634765625"	"16962.2578125"	"18511.0317382813"	"23016.5849609375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"600.31393"	"0.0001108"	"0.0006124"	"2.11"	"22.98"
"10248"	"[R].HVFGQPAKADQCYEDVR.[V]"	"1xBiotin [K8]; 1xCarbamidomethyl [C12]"	"0.00108424"	"0.000586377"	"1"	"1"	"3"	"O89053"	"O89053 [13-29]"	"O89053 1xBiotin [K20]"	"Coronin-1A [OS=Mus musculus]"	"1"	"2246.01173"	""	""	"9.97"	""	""	""	""	""	""	""	"600.0"	""	""	""	""	""	"11423.6142578125"	""	""	""	"High"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"3"	"749.34161"	"0.0001108"	"2.442E-05"	"3.44"	"34.91"
"10214"	"[K].HTLVKGIIDSTVSEQR.[Q]"	"1xBiotin [K5]"	"0.000178918"	"0.000586377"	"1"	"1"	"4"	"G5E829"	"G5E829 [774-789]"	"G5E829 1xBiotin [K778]"	"Plasma membrane calcium-transporting ATPase 1 [OS=Mus musculus]"	"1"	"2009.04844"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"3"	"670.35387"	"0.0001108"	"1.759E-06"	"3.58"	""
"10186"	"[K].HTAKTCSGLK.[S]"	"1xBiotin [K4]; 1xCarbamidomethyl [C6]"	"0.000554555"	"0.000586377"	"1"	"3"	"6"	"Q8R4V1"	"Q8R4V1 [192-201]"	"Q8R4V1 1xBiotin [K195]"	"NFAT activation molecule 1 [OS=Mus musculus]"	"1"	"1328.64495"	"1.45"	"0.38"	"0.93"	"1.20"	"0.67"	"-0.78"	"0.29"	"55.3"	"151.3"	"72.2"	"105.6"	"127.4"	"88.2"	"9861.9384765625"	"26968.03515625"	"12872.7861328125"	"18818.087890625"	"22708.068359375"	"15713.5244140625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"664.82612"	"0.0001108"	"9.169E-06"	"3.67"	"21.24"
"10128"	"[K].HSLFDSCKMSR.[G]"	"1xBiotin [K8]; 1xCarbamidomethyl [C7]; 1xOxidation [M9]"	"0.00711164"	"0.000586377"	"1"	"1"	"5"	"Q91W98"	"Q91W98 [294-304]"	"Q91W98 1xBiotin [K301]"	"Solute carrier family 15 member 4 [OS=Mus musculus]"	"1"	"1609.69198"	"-0.05"	"0.85"	"0.37"	"-1.57"	"0.59"	"0.64"	"-0.26"	"86.8"	"84.1"	"156.5"	"112.5"	"29.3"	"130.8"	"44529.501953125"	"43150.21484375"	"80238.60546875"	"57672.9013671875"	"15048.017578125"	"67072.822265625"	""	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"2"	"805.34936"	"0.0001108"	"0.0003797"	"3.08"	"33.89"
"9306"	"[K].GTEASTKNIFGR.[Y]"	"1xBiotin [K7]"	"0.000444342"	"0.000586377"	"1"	"1"	"4"	"Q99LM2"	"Q99LM2 [77-88]"	"Q99LM2 1xBiotin [K83]"	"CDK5 regulatory subunit-associated protein 3 [OS=Mus musculus]"	"1"	"1506.73694"	"-0.02"	"0.04"	"-0.23"	"0.18"	"0.31"	"0.33"	"0.27"	"96.2"	"94.6"	"99.0"	"82.0"	"109.1"	"119.1"	"90949.1875"	"89415.5390625"	"93614.9921875"	"77476.0625"	"103123.4375"	"112590.75"	""	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"2"	"753.87218"	"0.0001108"	"6.654E-06"	"3.37"	"40.02"
"10125"	"[R].HSLASTDEKR.[E]"	"1xBiotin [K9]"	"0.000307735"	"0.000586377"	"1"	"1"	"23"	"Q91ZX7"	"Q91ZX7 [4520-4529]"	"Q91ZX7 1xBiotin [K4528]"	"prolow-density lipoprotein receptor-related protein 1 [OS=Mus musculus]"	"1"	"1369.65287"	"0.52"	"0.38"	"0.53"	"0.66"	"0.18"	"-0.34"	"-0.20"	"76.1"	"109.2"	"98.9"	"109.7"	"120.0"	"86.1"	"966254.5"	"1386495.1875"	"1255730.875"	"1393476.375"	"1523684.5"	"1092722.5625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"685.32996"	"0.0001108"	"3.886E-06"	"3.14"	"22.39"
"10121"	"[K].HSKNITQR.[G]"	"1xBiotin [K3]"	"0.00560355"	"0.000586377"	"1"	"3"	"17"	"Q9Z1W5"	"Q9Z1W5 [14-21]"	"Q9Z1W5 1xBiotin [K16]"	"Stress-associated endoplasmic reticulum protein 1 [OS=Mus musculus]"	"1"	"1209.61570"	"1.05"	"0.41"	"0.79"	"0.54"	"0.65"	"-0.40"	"0.24"	"65.6"	"135.8"	"87.1"	"113.4"	"95.2"	"102.9"	"248630.578125"	"514560.3125"	"330250.796875"	"429795.40625"	"360689.359375"	"389837.84375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"605.31141"	"0.0001108"	"0.0002702"	"2.89"	"21.13"
"10119"	"[K].HSKGGDMSEEKPVDPAPTTVPDGENKK.[D]"	"1xBiotin [K3]; 1xOxidation [M7]"	"0.0121279"	"0.000586377"	"1"	"1"	"5"	"Q9D710"	"Q9D710 [267-293]"	"Q9D710 1xBiotin [K269]"	"Thioredoxin-related transmembrane protein 2 [OS=Mus musculus]"	"2"	"3092.42994"	"0.19"	"0.10"	"-0.13"	"-0.89"	"0.43"	"0.24"	"0.32"	"99.8"	"114.0"	"107.3"	"90.9"	"53.7"	"134.4"	"35316.564453125"	"40331.92578125"	"37966.9155273438"	"32172.7734375"	"19004.140625"	"47559.712890625"	""	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"4"	"773.86331"	"0.0001108"	"0.0008373"	"2.80"	"25.14"
"9319"	"[K].GTGASGSFKLNK.[K]"	"1xBiotin [K9]"	"0.000482137"	"0.000586377"	"4"	"4"	"6"	"P43274; P43276; P15864; P43277"	"P43274 [98-109]; P43276 [98-109]; P15864 [98-109]; P43277 [99-110]"	"P43274 1xBiotin [K106]; P43276 1xBiotin [K106]; P15864 1xBiotin [K106]; P43277 1xBiotin [K107]"	"Histone H1.4 [OS=Mus musculus];Histone H1.5 [OS=Mus musculus];Histone H1.2 [OS=Mus musculus];Histone H1.3 [OS=Mus musculus]"	"1"	"1392.69401"	"0.58"	"0.50"	"0.52"	"0.32"	"0.41"	"-0.17"	"-0.09"	"75.7"	"113.3"	"107.2"	"109.0"	"94.3"	"100.5"	"64849.203125"	"97008.8359375"	"91774.03125"	"93312.78125"	"80748.2421875"	"86031.078125"	"NotUnique"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"696.85056"	"0.0001108"	"7.487E-06"	"3.57"	"33.56"
"9325"	"[R].GTGGSESSKANGLTAESK.[A]"	"1xBiotin [K9]"	"0.000231252"	"0.000586377"	"1"	"3"	"7"	"Q8BJS4"	"Q8BJS4 [116-133]"	"Q8BJS4 1xBiotin [K124]"	"SUN domain-containing protein 2 [OS=Mus musculus]"	"1"	"1906.88110"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"-0.25"	"0.02"	""	"120.9"	"100.1"	"135.0"	"142.3"	"101.7"	""	"30677.7978515625"	"25387.8486328125"	"34243.439453125"	"36091.650390625"	"25785.7685546875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"953.94407"	"0.0001108"	"2.549E-06"	"3.71"	"30.04"
"10042"	"[R].HQGVMVGMGQKDSYVGDEAQSK.[R]"	"1xBiotin [K11]; 2xOxidation [M5; M8]"	"6.99693E-05"	"0.000586377"	"1"	"6"	"7"	"P60710"	"P60710 [40-61]"	"P60710 1xBiotin [K50]"	"Actin, cytoplasmic 1 [OS=Mus musculus]"	"1"	"2609.14288"	"-0.04"	"-0.46"	"0.05"	"-1.66"	"-0.16"	"-0.13"	"0.29"	"121.4"	"118.3"	"88.4"	"125.3"	"38.3"	"108.3"	"86735.0078125"	"84504.5859375"	"63161.9140625"	"89552.8515625"	"27374.697265625"	"77377.796875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"870.38600"	"0.0001108"	"4.459E-07"	"3.75"	"31.41"
"10041"	"[R].HQGVMVGMGQKDSYVGDEAQSK.[R]"	"1xBiotin [K11]; 1xOxidation [M]"	"1.85127E-05"	"0.000586377"	"1"	"6"	"12"	"P60710"	"P60710 [40-61]"	"P60710 1xBiotin [K50]"	"Actin, cytoplasmic 1 [OS=Mus musculus]"	"1"	"2593.14797"	"1.03"	"0.96"	"0.72"	"1.30"	"1.29"	"0.26"	"0.34"	"51.9"	"106.1"	"100.9"	"85.6"	"128.1"	"127.3"	"20480.578125"	"41835.9453125"	"39813.08203125"	"33778.51171875"	"50512.044921875"	"50225.88671875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"865.05440"	"0.0001108"	"6.42E-08"	"4.15"	"35.43"
"9355"	"[K].GTLVQTKGTGASGSFK.[L]"	"1xBiotin [K7]"	"1.41569E-05"	"0.000586377"	"3"	"3"	"8"	"P43274; P43276; P43277"	"P43274 [91-106]; P43276 [91-106]; P43277 [92-107]"	"P43274 1xBiotin [K97]; P43276 1xBiotin [K97]; P43277 1xBiotin [K98]"	"Histone H1.4 [OS=Mus musculus];Histone H1.5 [OS=Mus musculus];Histone H1.3 [OS=Mus musculus]"	"1"	"1764.89489"	"0.38"	"0.28"	"0.68"	"0.64"	"0.42"	"0.04"	"0.14"	"74.9"	"97.4"	"91.1"	"120.1"	"116.4"	"100.1"	"115546.439453125"	"150382.61328125"	"140569.16015625"	"185416.765625"	"179606.796875"	"154445.623046875"	"NotUnique"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"882.95135"	"0.0001108"	"4.337E-08"	"3.76"	"36.41"
"10025"	"[K].HPSSFEGKGPHSYVK.[N]"	"1xBiotin [K8]"	"4.2584E-06"	"0.000586377"	"1"	"1"	"12"	"O88822"	"O88822 [256-270]"	"O88822 1xBiotin [K263]"	"lathosterol oxidase [OS=Mus musculus]"	"1"	"1882.89048"	"0.96"	"0.81"	"0.53"	"0.42"	"0.68"	"-0.28"	"-0.12"	"66.1"	"128.6"	"115.8"	"95.1"	"88.2"	"106.2"	"134209.75"	"261161.703125"	"235123.546875"	"193181.0625"	"179076.953125"	"215761.71875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"628.30167"	"0.0001108"	"7.537E-09"	"4.46"	"29.32"
"10002"	"[R].HNWGQGFR.[L]"	""	"0.0372158"	"0.00104877"	"1"	"1"	"6"	"Q99J56"	"Q99J56 [240-247]"	""	"Derlin-1 [OS=Mus musculus]"	"0"	"1001.47002"	"0.39"	"0.42"	"0.42"	"1.09"	"0.38"	"-0.01"	"-0.03"	"71.3"	"93.8"	"95.1"	"95.4"	"151.4"	"93.1"	"19619.005859375"	"25793.962890625"	"26160.78125"	"26242.82421875"	"41657.8984375"	"25601.29296875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"501.23865"	"0.0001873"	"0.004343"	"1.68"	"23.62"
"9360"	"[K].GTPFETPDQGKAR.[L]"	"1xBiotin [K11]"	"0.000649104"	"0.000586377"	"1"	"3"	"17"	"Q9CPZ6"	"Q9CPZ6 [69-81]"	"Q9CPZ6 1xBiotin [K79]"	"ORM1-like protein 3 [OS=Mus musculus]"	"1"	"1629.76897"	"-0.09"	"-0.41"	"0.00"	"-0.12"	"-0.23"	"-0.14"	"0.18"	"109.8"	"102.9"	"82.8"	"110.1"	"100.7"	"93.6"	"863049.3984375"	"809030.234375"	"651169.203125"	"865475.1953125"	"791953.296875"	"735773.125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"543.92768"	"0.0001108"	"1.158E-05"	"3.05"	"34.59"
"9983"	"[K].HNELTGDNVGPLILKKK.[E]"	"2xBiotin [K15; K16]"	"0.00140943"	"0.000586377"	"1"	"1"	"3"	"Q9CQB5"	"Q9CQB5 [117-133]"	"Q9CQB5 2xBiotin [K131; K132]"	"CDGSH iron-sulfur domain-containing protein 2 [OS=Mus musculus]"	"2"	"2328.22027"	"0.48"	"0.13"	"-1.65"	"-9.97"	"0.71"	"0.22"	"0.58"	"110.2"	"154.0"	"120.8"	"35.1"	""	"180.0"	"21859.00390625"	"30545.154296875"	"23957.25"	"6956.1806640625"	""	"35695.734375"	""	"High"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"3"	"776.74498"	"0.0001108"	"3.589E-05"	"4.46"	"48.85"
"10272"	"[K].HVSTSSDEGSPSASTPMINKTGFK.[F]"	"1xBiotin [K20]; 1xOxidation [M17]"	"6.74425E-07"	"0.000586377"	"1"	"1"	"15"	"Q8BGR2"	"Q8BGR2 [238-261]"	"Q8BGR2 1xBiotin [K257]"	"volume-regulated anion channel subunit LRRC8D [OS=Mus musculus]"	"1"	"2707.23381"	"0.23"	"-0.10"	"0.30"	"-0.57"	"0.23"	"0.01"	"0.33"	"97.0"	"113.5"	"90.5"	"119.3"	"65.6"	"114.0"	"173261.71875"	"202794.359375"	"161723.046875"	"213114.234375"	"117107.7109375"	"203605.84375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"903.08303"	"0.0001108"	"5.098E-10"	"6.89"	"36.21"
"8248"	"[R].GGGDPYSDLSKGVLR.[S]"	"1xBiotin [K11]"	"0.00293687"	"0.000586377"	"1"	"2"	"3"	"Q32NY4-1"	"Q32NY4-1 [302-316]"	"Q32NY4-1 1xBiotin [K312]"	"Metal transporter CNNM3 [OS=Mus musculus]"	"1"	"1746.84794"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"High"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"2"	"873.92832"	"0.0001108"	"0.0001045"	"1.93"	""
"10595"	"[R].KDLYANTVLSGGTTMYPGIADR.[M]"	"1xBiotin [K1]; 1xOxidation [M15]"	"9.24051E-07"	"0.000586377"	"1"	"2"	"7"	"P60710"	"P60710 [291-312]"	"P60710 1xBiotin [K291]"	"Actin, cytoplasmic 1 [OS=Mus musculus]"	"1"	"2585.23743"	"9.97"	"9.97"	"9.97"	""	"9.97"	"0.17"	"0.28"	""	"170.4"	"157.3"	"81.0"	""	"191.2"	""	"46441.953125"	"42885.6484375"	"22088.46484375"	""	"52117.41015625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"862.41699"	"0.0001108"	"8.081E-10"	"3.54"	"48.14"
"10600"	"[K].KDNQTLSHSLKMADQNLEK.[L]"	"1xBiotin [K11]"	"6.01256E-05"	"0.000586377"	"1"	"2"	"6"	"Q9CQ56"	"Q9CQ56 [207-225]"	"Q9CQ56 1xBiotin [K217]"	"Vesicle transport protein USE1 [OS=Mus musculus]"	"2"	"2426.18025"	""	"9.97"	""	"9.97"	"9.97"	"9.97"	"0.21"	""	""	"230.3"	""	"103.5"	"266.2"	""	""	"11923.294921875"	""	"5359.873046875"	"13782.330078125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"809.39782"	"0.0001108"	"3.572E-07"	"3.89"	"37.12"
"11208"	"[K].KLEAAATALATK.[S]"	"1xBiotin [K1]"	"0.00128393"	"0.000586377"	"1"	"1"	"4"	"Q9D8E6"	"Q9D8E6 [353-364]"	"Q9D8E6 1xBiotin [K353]"	"60S ribosomal protein L4 [OS=Mus musculus]"	"1"	"1413.77701"	""	""	"9.97"	"9.97"	""	""	""	""	""	""	"258.3"	"341.7"	""	""	""	""	"11713.3193359375"	"15492.029296875"	""	""	"High"	"Not Found"	"High"	"High"	"High"	"Not Found"	"High"	"2"	"707.39243"	"0.0001108"	"3.119E-05"	"2.83"	"37.64"
"8448"	"[K].GKGHTDAEIEAIFTK.[Y]"	"1xBiotin [K2]"	"1.73468E-06"	"0.000586377"	"1"	"2"	"6"	"O35245-1"	"O35245-1 [745-759]"	"O35245-1 1xBiotin [K746]"	"polycystin-2 [OS=Mus musculus]"	"1"	"1842.90546"	"0.22"	"0.62"	"-9.97"	"-9.97"	"0.34"	"0.12"	"-0.28"	"121.0"	"140.8"	"185.4"	""	""	"152.8"	"28713.703125"	"33394.24609375"	"43977.86328125"	""	""	"36253.578125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"614.97339"	"0.0001108"	"2.024E-09"	"5.24"	"45.07"
"8449"	"[K].GKGLSVLLSHAK.[A]"	"1xBiotin [K2]"	"7.6812E-05"	"0.000586377"	"1"	"1"	"15"	"Q99P91"	"Q99P91 [542-553]"	"Q99P91 1xBiotin [K543]"	"Transmembrane glycoprotein NMB [OS=Mus musculus]"	"1"	"1435.80898"	"0.45"	"0.37"	"0.14"	"-1.44"	"0.52"	"0.07"	"0.15"	"91.3"	"125.2"	"118.2"	"100.7"	"33.6"	"131.1"	"479544.828125"	"657227.171875"	"620666.8203125"	"528552.03125"	"176335.91796875"	"688235.15625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"718.40809"	"0.0001108"	"5.118E-07"	"4.10"	"43.00"
"8480"	"[K].GKNEDIDR.[V]"	"1xBiotin [K2]"	"0.0343643"	"0.00104877"	"1"	"2"	"5"	"Q3UPF5-1"	"Q3UPF5-1 [381-388]"	"Q3UPF5-1 1xBiotin [K382]"	"zinc finger CCCH-type antiviral protein 1 [OS=Mus musculus]"	"1"	"1172.53645"	"0.42"	"0.37"	"0.31"	"0.45"	"0.50"	"0.09"	"0.14"	"78.4"	"104.8"	"101.2"	"97.3"	"107.1"	"111.2"	"43900.58984375"	"58657.375"	"56633.4140625"	"54470.1796875"	"59924.890625"	"62251.84765625"	""	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"2"	"586.77182"	"0.0001873"	"0.003888"	"2.23"	"24.83"
"8497"	"[R].GKPSCGLGPKPLK.[G]"	"1xBiotin [K]; 1xCarbamidomethyl [C5]"	"0.00272271"	"0.000586377"	"1"	"1"	"13"	"Q80TN4"	"Q80TN4 [730-742]"	"Q80TN4 1xBiotin [K]"	"DnaJ homolog subfamily C member 16 [OS=Mus musculus]"	"0"	"1564.83382"	"-0.23"	"0.05"	"-0.01"	"-0.16"	"-0.63"	"-0.40"	"-0.67"	"110.7"	"94.6"	"114.2"	"110.0"	"98.8"	"71.7"	"69824.4453125"	"59682.56640625"	"72038.5732421875"	"69434.4404296875"	"62366.564453125"	"45223.392578125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"522.28262"	"0.0001108"	"9.367E-05"	"3.75"	"31.29"
"8498"	"[K].GKPSQGLSTEENLSASVTSQPGHQK.[E]"	"1xBiotin [K2]"	"0.000439191"	"0.000586377"	"1"	"1"	"4"	"Q4VBD2"	"Q4VBD2 [484-508]"	"Q4VBD2 1xBiotin [K485]"	"Transmembrane anterior posterior transformation protein 1 [OS=Mus musculus]"	"0"	"2793.34720"	"9.97"	"9.97"	"9.97"	"9.97"	""	"-9.97"	"-9.97"	""	"136.2"	"150.9"	"139.1"	"173.8"	""	""	"19310.85546875"	"21391.296875"	"19709.599609375"	"24632.298828125"	""	""	"High"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"High"	"3"	"931.78793"	"0.0001108"	"6.499E-06"	"3.35"	"36.02"
"11104"	"[K].KKETITESAGR.[Q]"	"1xBiotin [K2]"	"0.00744997"	"0.000586377"	"1"	"1"	"9"	"Q921L3"	"Q921L3 [53-63]"	"Q921L3 1xBiotin [K54]"	"Calcium load-activated calcium channel [OS=Mus musculus]"	"2"	"1445.74169"	"0.27"	"0.19"	"0.33"	"0.00"	"0.19"	"-0.09"	"0.00"	"88.9"	"107.4"	"101.4"	"112.0"	"89.1"	"101.1"	"35886.94140625"	"43326.3642578125"	"40932.6708984375"	"45199.9169921875"	"35953.310546875"	"40815.203125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"482.58526"	"0.0001108"	"0.0004071"	"3.04"	"24.44"
"8504"	"[R].GKSCLPVGPSLSR.[L]"	"1xBiotin [K2]; 1xCarbamidomethyl [C4]"	"1.62836E-05"	"0.000586377"	"1"	"3"	"9"	"Q3U3D7-1"	"Q3U3D7-1 [947-959]"	"Q3U3D7-1 1xBiotin [K948]"	"Transmembrane protein 131-like [OS=Mus musculus]"	"1"	"1583.80324"	"1.16"	"0.73"	"0.67"	"0.42"	"1.31"	"0.15"	"0.58"	"58.1"	"130.2"	"96.6"	"92.8"	"77.6"	"144.6"	"78587.6953125"	"176054.71875"	"130589.7421875"	"125468.9140625"	"104914.515625"	"195506.125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"792.40505"	"0.0001108"	"5.307E-08"	"3.88"	"39.51"
"11214"	"[K].KLEDGPK.[F]"	"1xBiotin [K1]"	"0.0286231"	"0.00104877"	"1"	"1"	"6"	"P10126"	"P10126 [386-392]"	"P10126 1xBiotin [K386]"	"Elongation factor 1-alpha 1 [OS=Mus musculus]"	"1"	"1012.51319"	"0.28"	"0.15"	"0.13"	"0.12"	"0.34"	"0.06"	"0.20"	"88.5"	"107.7"	"98.0"	"97.0"	"96.5"	"112.4"	"61197.953125"	"74434.6015625"	"67777.90625"	"67035.3125"	"66692.984375"	"77683.1484375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"506.76023"	"0.0001873"	"0.002961"	"2.64"	"23.89"
"8509"	"[R].GKSMISSLSIMGGSSGPPYDR.[A]"	"1xBiotin [K2]; 2xOxidation [M4; M11]"	"0.0174574"	"0.000586377"	"1"	"1"	"2"	"O88572"	"O88572 [1442-1462]"	"O88572 1xBiotin [K1443]"	"Low-density lipoprotein receptor-related protein 6 [OS=Mus musculus]"	"1"	"2385.08833"	"-0.81"	"-0.07"	"-0.26"	"-9.97"	"-0.50"	"0.32"	"-0.43"	"147.7"	"84.0"	"140.6"	"123.1"	""	"104.6"	"9816.0546875"	"5584.36767578125"	"9347.9638671875"	"8179.13037109375"	""	"6954.2578125"	""	"High"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"High"	"3"	"795.70138"	"0.0001108"	"0.001429"	"2.62"	"40.92"
"8512"	"[R].GKSSQITEDFR.[A]"	"1xBiotin [K2]"	"0.000848767"	"0.000586377"	"1"	"1"	"6"	"Q9Z0R9"	"Q9Z0R9 [104-114]"	"Q9Z0R9 1xBiotin [K105]"	"fatty acid desaturase 2 [OS=Mus musculus]"	"1"	"1493.70530"	"0.70"	"0.55"	"0.75"	"0.58"	"0.55"	"-0.15"	"0.00"	"68.8"	"111.5"	"100.5"	"115.6"	"103.1"	"100.5"	"22818.65234375"	"36974.74609375"	"33343.609375"	"38362.109375"	"34185.5546875"	"33344.82421875"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"2"	"747.35624"	"0.0001108"	"1.709E-05"	"2.98"	"37.74"
"8513"	"[R].GKSSSDMPETITSR.[D]"	"1xBiotin [K2]"	"0.000297154"	"0.000586377"	"1"	"4"	"6"	"Q9D8V0-1"	"Q9D8V0-1 [60-73]"	"Q9D8V0-1 1xBiotin [K61]"	"Minor histocompatibility antigen H13 [OS=Mus musculus]"	"1"	"1721.78330"	""	"9.97"	""	"9.97"	"9.97"	"9.97"	"0.20"	""	""	"140.8"	""	"297.8"	"161.4"	""	""	"24277.560546875"	""	"51369.8359375"	"27843.40234375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"861.39518"	"0.0001108"	"3.674E-06"	"3.21"	"33.76"
"11036"	"[K].KGVPIIFADELDDSKPPPSSSMPLILQEEK.[A]"	"1xBiotin [K1]; 1xOxidation [M22]"	"0.00117644"	"0.000586377"	"1"	"1"	"6"	"Q62165"	"Q62165 [792-821]"	"Q62165 1xBiotin [K792]"	"Dystroglycan [OS=Mus musculus]"	"1"	"3522.77463"	"-9.97"	"-0.22"	"-9.97"	"-9.97"	"-0.05"	"9.97"	"0.17"	"212.6"	""	"182.1"	""	""	"205.3"	"39237.14453125"	""	"33604.30859375"	""	""	"37880.84765625"	""	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"1174.92969"	"0.0001108"	"2.743E-05"	"3.54"	"54.85"
"8514"	"[R].GKSSSDMPETITSR.[D]"	"1xBiotin [K2]; 1xOxidation [M7]"	"0.00022592"	"0.000586377"	"1"	"4"	"13"	"Q9D8V0-1"	"Q9D8V0-1 [60-73]"	"Q9D8V0-1 1xBiotin [K61]"	"Minor histocompatibility antigen H13 [OS=Mus musculus]"	"1"	"1737.77821"	"0.30"	"0.15"	"0.22"	"-0.46"	"0.38"	"0.08"	"0.23"	"91.7"	"112.9"	"102.0"	"107.0"	"66.8"	"119.6"	"67419.439453125"	"83021.91015625"	"74977.859375"	"78654.25"	"49140.8125"	"87944.3359375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"869.39287"	"0.0001108"	"2.467E-06"	"3.56"	"27.60"
"8526"	"[K].GKVLGLNR.[G]"	"1xBiotin [K2]"	"0.0675601"	"0.0019826"	"1"	"1"	"4"	"Q61165"	"Q61165 [743-750]"	"Q61165 1xBiotin [K744]"	"Sodium/hydrogen exchanger 1 [OS=Mus musculus]"	"1"	"1082.61391"	"0.52"	"0.27"	"0.40"	"0.32"	"0.28"	"-0.24"	"0.01"	"80.8"	"115.8"	"97.4"	"106.8"	"101.0"	"98.2"	"37219.66015625"	"53330.49609375"	"44867.75"	"49164.01171875"	"46502.01171875"	"45233.28515625"	""	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"2"	"541.81040"	"0.0003442"	"0.01061"	"2.06"	"36.61"
"11019"	"[R].KGTKPPSPYATITVGETSHK.[T]"	"1xBiotin [K1]"	"4.30061E-08"	"0.000586377"	"1"	"2"	"16"	"Q3U7R1"	"Q3U7R1 [801-820]"	"Q3U7R1 1xBiotin [K801]"	"Extended synaptotagmin-1 [OS=Mus musculus]"	"1"	"2325.19074"	"0.62"	"0.17"	"0.35"	"0.10"	"0.26"	"-0.36"	"0.09"	"83.2"	"128.2"	"93.5"	"106.3"	"89.3"	"99.6"	"260073.109375"	"400888.2890625"	"292407.12109375"	"332470.8828125"	"279219.265625"	"311514.046875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"775.73563"	"0.0001108"	"9.209E-12"	"6.62"	"32.88"
"11016"	"[R].KGTDVNVFTTILTSR.[S]"	"1xBiotin [K1]"	"1.35784E-06"	"0.000586377"	"1"	"1"	"7"	"P10107"	"P10107 [214-228]"	"P10107 1xBiotin [K214]"	"annexin A1 [OS=Mus musculus]"	"1"	"1877.97896"	"0.19"	"0.08"	"-1.29"	"-9.97"	"0.24"	"0.04"	"0.15"	"125.3"	"143.1"	"132.8"	"51.3"	""	"147.5"	"34138.2333984375"	"38989.529296875"	"36194.884765625"	"13985.6674804688"	""	"40185.072265625"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"2"	"939.49347"	"0.0001108"	"1.413E-09"	"4.84"	"56.79"
"8550"	"[R].GICDYLPSPNKTTPLLSPVK.[A]"	"1xBiotin [K11]; 1xCarbamidomethyl [C3]"	"0.000132117"	"0.000586377"	"1"	"4"	"5"	"Q6P1H6-1"	"Q6P1H6-1 [259-278]"	"Q6P1H6-1 1xBiotin [K269]"	"ankyrin repeat and LEM domain-containing protein 2 [OS=Mus musculus]"	"1"	"2426.24581"	"-0.03"	"-0.49"	"-1.73"	"-9.97"	"0.36"	"0.39"	"0.85"	"140.3"	"137.6"	"99.8"	"42.3"	""	"180.0"	"23559.64453125"	"23108.791015625"	"16752.203125"	"7106.06494140625"	""	"30225.822265625"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"809.42029"	"0.0001108"	"1.133E-06"	"3.47"	"54.50"
"8511"	"[R].GKSSFFGDR.[G]"	"1xBiotin [K2]"	"0.00808104"	"0.000586377"	"1"	"1"	"6"	"Q62167"	"Q62167 [80-88]"	"Q62167 1xBiotin [K81]"	"ATP-dependent RNA helicase DDX3X [OS=Mus musculus]"	"1"	"1226.56227"	"0.11"	"0.18"	"-0.14"	"0.34"	"0.48"	"0.37"	"0.31"	"88.5"	"95.7"	"100.0"	"80.2"	"111.9"	"123.7"	"50520.18359375"	"54626.1171875"	"57129.6640625"	"45797.25390625"	"63911.75390625"	"70649.515625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"613.78455"	"0.0001108"	"0.0004591"	"2.31"	"40.08"
"11215"	"[K].KLEDGPKFLK.[S]"	"1xBiotin [K7]"	"0.00172836"	"0.000586377"	"1"	"1"	"11"	"P10126"	"P10126 [386-395]"	"P10126 1xBiotin [K392]"	"Elongation factor 1-alpha 1 [OS=Mus musculus]"	"2"	"1400.76063"	"0.13"	"0.28"	"0.15"	"0.07"	"0.26"	"0.13"	"-0.01"	"90.0"	"98.7"	"109.0"	"99.9"	"94.3"	"108.0"	"49798.7734375"	"54635.529296875"	"60342.146484375"	"55291.359375"	"52193.283203125"	"59760.919921875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"700.88408"	"0.0001108"	"4.811E-05"	"3.60"	"37.43"
"11227"	"[K].KLEKSIVLLSQCTAR.[V]"	"1xBiotin [K4]; 1xCarbamidomethyl [C12]"	"0.00137695"	"0.000586377"	"1"	"1"	"5"	"Q60664"	"Q60664 [260-274]"	"Q60664 1xBiotin [K263]"	"Lymphoid-restricted membrane protein [OS=Mus musculus]"	"2"	"1972.07181"	"9.97"	"9.97"	"9.97"	""	""	"-9.97"	"-9.97"	""	"198.0"	"199.2"	"202.8"	""	""	""	"14239.4755859375"	"14331.20703125"	"14588.0107421875"	""	""	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"658.02899"	"0.0001108"	"3.458E-05"	"3.24"	"44.03"
"11235"	"[R].KLESSESR.[S]"	"1xBiotin [K1]"	"0.0145952"	"0.000586377"	"1"	"3"	"6"	"P48678-1"	"P48678-1 [420-427]"	"P48678-1 1xBiotin [K420]"	"Prelamin-A/C [OS=Mus musculus]"	"1"	"1161.55685"	"0.72"	"0.51"	"0.51"	"0.53"	"0.33"	"-0.39"	"-0.18"	"73.2"	"120.7"	"104.1"	"104.1"	"105.8"	"92.1"	"23369.82421875"	"38548.79296875"	"33245.2578125"	"33256.73046875"	"33772.11328125"	"29417.3515625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"581.28207"	"0.0001108"	"0.001094"	"1.48"	"21.28"
"11599"	"[K].KNLSPGAVESDVR.[G]"	"1xBiotin [K1]"	"0.000623145"	"0.000586377"	"1"	"1"	"6"	"Q8CIE6"	"Q8CIE6 [170-182]"	"Q8CIE6 1xBiotin [K170]"	"coatomer subunit alpha [OS=Mus musculus]"	"1"	"1597.80027"	"0.14"	"-0.22"	"0.19"	"-0.46"	"0.42"	"0.28"	"0.64"	"97.5"	"107.2"	"83.5"	"110.8"	"70.9"	"130.2"	"18292.93359375"	"20117.48046875"	"15670.4404296875"	"20800.67578125"	"13303.103515625"	"24429.021484375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"799.40464"	"0.0001108"	"1.091E-05"	"2.75"	"37.64"
"8255"	"[R].GGGGNFGPGPGSNFR.[G]"	""	"0.0039523"	"0.000586377"	"1"	"3"	"6"	"O88569"	"O88569 [214-228]"	""	"heterogeneous nuclear ribonucleoproteins A2/B1 [OS=Mus musculus]"	"0"	"1377.62944"	"0.62"	"0.18"	"0.46"	"0.37"	"0.30"	"-0.32"	"0.12"	"79.3"	"121.6"	"89.7"	"109.4"	"102.7"	"97.4"	"8358.1650390625"	"12816.8857421875"	"9454.2900390625"	"11528.822265625"	"10821.0107421875"	"10266.4755859375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"689.31815"	"0.0001108"	"0.0001608"	"2.22"	"29.31"
"11549"	"[R].KNASCGTR.[S]"	"1xBiotin [K1]; 1xCarbamidomethyl [C5]"	"0.0179684"	"0.000586377"	"1"	"1"	"15"	"Q9CQS8"	"Q9CQS8 [35-42]"	"Q9CQS8 1xBiotin [K35]"	"protein transport protein Sec61 subunit beta [OS=Mus musculus]"	"1"	"1119.50337"	"1.01"	"0.93"	"0.92"	"1.07"	"1.09"	"0.09"	"0.16"	"54.4"	"109.2"	"103.7"	"102.9"	"113.9"	"116.0"	"170647.609375"	"342583.8125"	"325160.46875"	"322773.1875"	"357138.84375"	"363800.34375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"560.25542"	"0.0001108"	"0.001489"	"1.70"	"16.11"
"8265"	"[K].GGHGAASPSDKGAHPSGGADDVAK.[K]"	"1xBiotin [K11]"	"1.7464E-05"	"0.000586377"	"1"	"1"	"14"	"Q8BMK4"	"Q8BMK4 [11-34]"	"Q8BMK4 1xBiotin [K21]"	"Cytoskeleton-associated protein 4 [OS=Mus musculus]"	"1"	"2372.06840"	"0.69"	"0.06"	"0.32"	"0.60"	"0.31"	"-0.38"	"0.26"	"78.4"	"126.5"	"81.4"	"97.6"	"118.7"	"97.4"	"176357.7109375"	"284752.3359375"	"183244.6015625"	"219579.34765625"	"267163.953125"	"219142.859375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"791.36112"	"0.0001108"	"5.894E-08"	"4.41"	"21.58"
"11500"	"[R].KMLGNPSR.[L]"	"1xBiotin [K1]; 1xOxidation [M2]"	"0.0218561"	"0.00104877"	"1"	"2"	"9"	"O35465-1"	"O35465-1 [356-363]"	"O35465-1 1xBiotin [K356]"	"peptidyl-prolyl cis-trans isomerase FKBP8 [OS=Mus musculus]"	"1"	"1144.56016"	"-0.96"	"0.12"	"-0.43"	"-1.32"	"-0.34"	"0.62"	"-0.46"	"132.1"	"67.9"	"144.0"	"98.4"	"53.1"	"104.6"	"390211.07421875"	"200498.484375"	"425247.9140625"	"290609.78125"	"156783.953125"	"309014.25"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"572.78352"	"0.0001873"	"0.00198"	"1.83"	"26.62"
"8276"	"[K].GGKGLGK.[G]"	"1xBiotin [K3]"	"0.0668143"	"0.0019826"	"1"	"1"	"6"	"P62806"	"P62806 [7-13]"	"P62806 1xBiotin [K9]"	"histone H4 [OS=Mus musculus]"	"1"	"842.45528"	"0.53"	"0.24"	"0.17"	"0.25"	"0.31"	"-0.22"	"0.07"	"83.6"	"120.7"	"98.5"	"94.2"	"99.7"	"103.3"	"115052.8515625"	"166086.625"	"135475.8125"	"129592.9453125"	"137176.546875"	"142170.71875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"421.73107"	"0.0003442"	"0.01043"	"2.60"	"23.88"
"11468"	"[R].KMCLFAGFQRK.[A]"	"1xCarbamidomethyl [C3]; 1xOxidation [M2]"	"0.0516681"	"0.00154748"	"1"	"2"	"1"	"Q8VEK3"	"Q8VEK3 [568-578]"	""	"Heterogeneous nuclear ribonucleoprotein U [OS=Mus musculus]"	"2"	"1401.71297"	"-0.48"	"-0.90"	"-0.75"	"-0.99"	"-1.12"	"-0.64"	"-0.22"	"157.6"	"112.8"	"84.3"	"93.6"	"79.3"	"72.4"	"10982.5693359375"	"7863.48095703125"	"5879.1943359375"	"6524.93603515625"	"5530.21630859375"	"5044.5"	""	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"3"	"467.90877"	"0.0002716"	"0.007107"	"2.07"	"29.03"
"11439"	"[R].KLVIIEGDLER.[T]"	"1xBiotin [K1]"	"0.0150233"	"0.000586377"	"1"	"2"	"5"	"P21107-2"	"P21107-2 [132-142]"	"P21107-2 1xBiotin [K132]"	"Isoform 2 of Tropomyosin alpha-3 chain [OS=Mus musculus]"	"1"	"1510.82978"	""	""	"9.97"	"9.97"	""	""	""	""	""	""	"422.0"	"178.0"	""	""	""	""	"8508.8701171875"	"3587.92993164063"	""	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"2"	"755.91853"	"0.0001108"	"0.001138"	"1.86"	"46.75"
"11415"	"[K].KLSSAEETAFQTPKPSQTPSVPPLVKTSLFSPK.[L]"	"1xBiotin [K]"	"0.000404762"	"0.000586377"	"1"	"1"	"8"	"Q8VCB1"	"Q8VCB1 [404-436]"	"Q8VCB1 1xBiotin [K]"	"Nucleoporin Ndc1 [OS=Mus musculus]"	"2"	"3753.97717"	"0.10"	"0.25"	"-9.97"	"-9.97"	"0.35"	"0.25"	"0.10"	"132.3"	"142.1"	"156.9"	""	""	"168.7"	"118141"	"126907.939453125"	"140152.638671875"	""	""	"150669.1484375"	""	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"4"	"939.24974"	"0.0001108"	"5.772E-06"	"4.10"	"51.69"
"8280"	"[K].GGKIGLFGGAGVGK.[T]"	"1xBiotin [K3]"	"0.0306569"	"0.00104877"	"1"	"1"	"3"	"P56480"	"P56480 [199-212]"	"P56480 1xBiotin [K201]"	"ATP synthase subunit beta, mitochondrial [OS=Mus musculus]"	"1"	"1443.77768"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"2"	"722.39264"	"0.0001873"	"0.003264"	"2.03"	""
"11398"	"[R].KLSEADNR.[K]"	"1xBiotin [K1]"	"0.0099011"	"0.000586377"	"1"	"2"	"6"	"Q9DCF9-1"	"Q9DCF9-1 [103-110]"	"Q9DCF9-1 1xBiotin [K103]"	"Translocon-associated protein subunit gamma [OS=Mus musculus]"	"1"	"1158.55718"	"0.17"	"-0.04"	"0.49"	"-0.04"	"0.42"	"0.25"	"0.46"	"88.2"	"99.1"	"85.7"	"123.6"	"85.6"	"117.7"	"41783.98046875"	"46940.87109375"	"40598.7265625"	"58559.8671875"	"40568.86328125"	"55772.65234375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"579.78224"	"0.0001108"	"0.0006216"	"2.17"	"22.74"
"8338"	"[K].GGSKQQSEEDLLLQDFSR.[N]"	"1xBiotin [K4]"	"4.7022E-06"	"0.000586377"	"1"	"2"	"11"	"Q9DCF9-1"	"Q9DCF9-1 [5-22]"	"Q9DCF9-1 1xBiotin [K8]"	"Translocon-associated protein subunit gamma [OS=Mus musculus]"	"1"	"2263.06594"	"0.20"	"0.42"	"-1.32"	"-3.31"	"0.48"	"0.28"	"0.06"	"111.6"	"128.2"	"148.9"	"44.7"	"11.3"	"155.3"	"93953.67578125"	"107932.484375"	"125365.7578125"	"37625.623046875"	"9490.17138671875"	"130708.921875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"1132.03694"	"0.0001108"	"8.708E-09"	"4.40"	"52.51"
"8359"	"[R].GGVSLPALKK.[A]"	"1xBiotin [K9]"	"0.00736391"	"0.000586377"	"1"	"1"	"5"	"P43276"	"P43276 [55-64]"	"P43276 1xBiotin [K63]"	"Histone H1.5 [OS=Mus musculus]"	"1"	"1195.68674"	"0.29"	"0.25"	"0.53"	"-0.02"	"0.64"	"0.35"	"0.39"	"81.1"	"99.1"	"96.3"	"117.5"	"79.9"	"126.0"	"20931.119140625"	"25579.03515625"	"24856.888671875"	"30307.478515625"	"20617.9375"	"32522.537109375"	""	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"2"	"598.34682"	"0.0001108"	"0.0004013"	"3.04"	"42.12"
"8396"	"[K].GHQNGSVAAVNGHTNSFPSLENSVKPR.[K]"	"1xBiotin [K25]"	"1.75503E-06"	"0.000586377"	"1"	"1"	"17"	"Q8BHI7"	"Q8BHI7 [268-294]"	"Q8BHI7 1xBiotin [K292]"	"elongation of very long chain fatty acids protein 5 [OS=Mus musculus]"	"0"	"3030.45987"	"0.37"	"0.02"	"0.02"	"-2.30"	"0.17"	"-0.21"	"0.14"	"106.1"	"137.5"	"108.0"	"107.5"	"21.6"	"119.3"	"189935.83203125"	"246074.0625"	"193224.42578125"	"192422.16796875"	"38658.10546875"	"213415.56640625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"1010.82578"	"0.0001108"	"2.06E-09"	"6.75"	"38.42"
"8414"	"[K].GKALEVAEYLTPVLK.[E]"	"1xBiotin [K2]"	"0.000153747"	"0.000586377"	"1"	"1"	"4"	"Q9CPX6"	"Q9CPX6 [10-24]"	"Q9CPX6 1xBiotin [K11]"	"ubiquitin-like-conjugating enzyme ATG3 [OS=Mus musculus]"	"1"	"1857.01903"	"-9.97"	"-0.34"	"-9.97"	"-9.97"	"-9.97"	""	"-9.97"	"335.5"	""	"264.5"	""	""	""	"9639.2646484375"	""	"7598.97509765625"	""	""	""	""	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"2"	"929.01335"	"0.0001108"	"1.41E-06"	"3.97"	"58.40"
"11248"	"[K].KLFYIPWR.[H]"	""	"0.0242383"	"0.00104877"	"1"	"1"	"3"	"P56477"	"P56477 [41-48]"	""	"interferon regulatory factor 5 [OS=Mus musculus]"	"1"	"1122.64586"	"0.29"	"0.35"	"-9.97"	"-9.97"	"-9.97"	"-9.97"	"-9.97"	"171.2"	"209.9"	"218.9"	""	""	""	"8339.8818359375"	"10226.3623046875"	"10661.107421875"	""	""	""	""	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"561.82645"	"0.0001873"	"0.002314"	"1.87"	"45.77"
"8419"	"[R].GKCSLSQPGPSVSSPK.[S]"	"1xBiotin [K2]; 1xCarbamidomethyl [C3]"	"0.000696145"	"0.000586377"	"1"	"4"	"6"	"Q6ZWR6-1"	"Q6ZWR6-1 [8703-8718]"	"Q6ZWR6-1 1xBiotin [K8704]"	"Nesprin-1 [OS=Mus musculus]"	"1"	"1841.88843"	"-0.04"	"-0.20"	"-0.08"	"-0.17"	"0.02"	"0.05"	"0.22"	"105.4"	"102.9"	"91.6"	"99.8"	"93.5"	"106.7"	"14796.6845703125"	"14440.140625"	"12856.0400390625"	"14009.498046875"	"13129.61328125"	"14979.66796875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"921.44756"	"0.0001108"	"1.279E-05"	"3.06"	"31.61"
"8429"	"[K].GKEDVGK.[T]"	"1xBiotin [K2]"	"0.0431326"	"0.00104877"	"1"	"1"	"8"	"Q9CQU3"	"Q9CQU3 [186-192]"	"Q9CQU3 1xBiotin [K187]"	"Protein RER1 [OS=Mus musculus]"	"1"	"958.46624"	"0.31"	"0.33"	"0.19"	"0.32"	"0.42"	"0.12"	"0.09"	"83.0"	"102.8"	"104.4"	"94.8"	"103.7"	"111.3"	"427286.84375"	"529015.9375"	"537157.9375"	"488055.28125"	"533618"	"573031.625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"479.73675"	"0.0001873"	"0.005448"	"2.44"	"21.97"
"11238"	"[K].KIFEYETQR.[R]"	"1xBiotin [K1]"	"0.0451294"	"0.00154748"	"1"	"1"	"3"	"O08579"	"O08579 [37-45]"	"O08579 1xBiotin [K37]"	"Emerin [OS=Mus musculus]"	"1"	"1439.69876"	"0.10"	"-0.41"	"-0.19"	"0.06"	"-0.01"	"-0.11"	"0.40"	"104.5"	"112.4"	"78.9"	"91.5"	"108.8"	"104.0"	"29281.041015625"	"31480.66796875"	"22093.880859375"	"25649.1015625"	"30479.46875"	"29127.0859375"	""	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"2"	"720.35302"	"0.0002716"	"0.005802"	"1.91"	"38.65"
"11006"	"[R].KGSITEYTATEEK.[G]"	"1xBiotin [K1]"	"1.90433E-06"	"0.000586377"	"1"	"1"	"6"	"O54940"	"O54940 [112-124]"	"O54940 1xBiotin [K112]"	"BCL2/adenovirus E1B 19 kDa protein-interacting protein 2 [OS=Mus musculus]"	"1"	"1682.79418"	"0.13"	"-0.27"	"0.10"	"0.04"	"-0.08"	"-0.21"	"0.19"	"100.5"	"109.9"	"83.3"	"108.0"	"103.4"	"94.9"	"38355.98046875"	"41918.6640625"	"31778.7265625"	"41197.62109375"	"39467.7734375"	"36202.92578125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"841.90123"	"0.0001108"	"2.327E-09"	"4.29"	"34.02"
"10599"	"[K].KDNQTLSHSLK.[M]"	"1xBiotin [K1]"	"0.0011628"	"0.000586377"	"1"	"2"	"6"	"Q9CQ56"	"Q9CQ56 [207-217]"	"Q9CQ56 1xBiotin [K207]"	"Vesicle transport protein USE1 [OS=Mus musculus]"	"1"	"1496.75259"	"-0.12"	"-0.01"	"-9.97"	"0.38"	"0.44"	"0.56"	"0.45"	"107.7"	"99.1"	"106.9"	""	"140.0"	"146.3"	"100081.28125"	"92051.734375"	"99338.93359375"	""	"130136.91796875"	"135961.671875"	""	"High"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"2"	"748.88033"	"0.0001108"	"2.7E-05"	"2.76"	"27.10"
"11000"	"[K].KGSGGSEHVLTCDTACK.[G]"	"1xBiotin [K1]; 2xCarbamidomethyl [C12; C16]"	"0.00030064"	"0.000586377"	"1"	"3"	"6"	"Q8BM55"	"Q8BM55 [453-469]"	"Q8BM55 1xBiotin [K453]"	"Transmembrane protein 214 [OS=Mus musculus]"	"1"	"2032.88851"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"0.10"	"0.39"	""	"116.6"	"95.8"	"136.6"	"125.9"	"125.1"	""	"13833.853515625"	"11358.095703125"	"16198.0322265625"	"14926.7509765625"	"14840.7158203125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"678.30113"	"0.0001108"	"3.752E-06"	"2.49"	"26.06"
"10976"	"[K].KGPEVNPGSR.[G]"	"1xBiotin [K1]"	"0.000281961"	"0.000586377"	"1"	"1"	"11"	"Q64518"	"Q64518 [1020-1029]"	"Q64518 1xBiotin [K1020]"	"Sarcoplasmic/endoplasmic reticulum calcium atpase 3 [OS=Mus musculus]"	"1"	"1266.62593"	"0.57"	"0.43"	"0.45"	"0.01"	"0.42"	"-0.15"	"-0.02"	"79.5"	"118.2"	"107.5"	"108.7"	"79.8"	"106.3"	"41924.859375"	"62325.734375"	"56665.35546875"	"57335"	"42099.640625"	"56033.03125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"633.81677"	"0.0001108"	"3.426E-06"	"2.52"	"26.23"
"10778"	"[R].KESYSVYVYK.[V]"	"1xBiotin [K1]"	"0.000243712"	"0.000586377"	"2"	"9"	"9"	"Q64525; P10854"	"Q64525 [35-44]; P10854 [35-44]"	"Q64525 1xBiotin [K35]; P10854 1xBiotin [K35]"	"Histone H2B type 2-B [OS=Mus musculus];Histone H2B type 1-M [OS=Mus musculus]"	"1"	"1491.71883"	"0.32"	"0.39"	"0.45"	"0.01"	"0.44"	"0.12"	"0.05"	"82.3"	"102.9"	"108.1"	"112.1"	"82.6"	"111.9"	"131037.5625"	"163731"	"172053.359375"	"178424.203125"	"131516.765625"	"178025.578125"	"NotUnique"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"746.36288"	"0.0001108"	"2.773E-06"	"3.15"	"38.75"
"10754"	"[R].KENTSNIFYSK.[N]"	"1xBiotin [K1]"	"0.000397743"	"0.000586377"	"1"	"1"	"6"	"Q9QYE6"	"Q9QYE6 [28-38]"	"Q9QYE6 1xBiotin [K28]"	"Golgin subfamily A member 5 [OS=Mus musculus]"	"1"	"1556.74135"	"0.28"	"0.18"	"0.35"	"0.01"	"0.44"	"0.16"	"0.25"	"85.9"	"104.3"	"97.6"	"109.4"	"86.4"	"116.4"	"21151.826171875"	"25674.939453125"	"24035.27734375"	"26934.33984375"	"21258.33984375"	"28643.005859375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"778.87468"	"0.0001108"	"5.662E-06"	"3.23"	"37.04"
"8751"	"[K].GISTDKPSENPASFGESGDKYSAFR.[E]"	"1xBiotin [K20]"	"1.54372E-06"	"0.000586377"	"1"	"2"	"4"	"Q5SV85"	"Q5SV85 [515-539]"	"Q5SV85 1xBiotin [K534]"	"Synergin gamma [OS=Mus musculus]"	"1"	"2873.30466"	""	"9.97"	"9.97"	""	"9.97"	"9.97"	"0.84"	""	""	"150.9"	"178.4"	""	"270.7"	""	""	"33573.66015625"	"39692.24609375"	""	"60239.6015625"	""	"High"	"High"	"High"	"High"	"Not Found"	"Peak Found"	"High"	"3"	"958.43959"	"0.0001108"	"1.706E-09"	"5.59"	"42.27"
"8772"	"[K].GLVGSKSLSR.[E]"	"1xBiotin [K6]"	"0.0618076"	"0.0019826"	"1"	"1"	"1"	"Q9DBG7"	"Q9DBG7 [324-333]"	"Q9DBG7 1xBiotin [K329]"	"signal recognition particle receptor subunit alpha [OS=Mus musculus]"	"1"	"1229.66707"	"-9.97"	"0.39"	"0.81"	"0.05"	"0.07"	"9.97"	"-0.32"	"97.5"	""	"127.9"	"171.2"	"101.1"	"102.3"	"9363.572265625"	""	"12285.9658203125"	"16440.384765625"	"9706.0751953125"	"9827.8046875"	""	"High"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"2"	"615.33664"	"0.0003442"	"0.009278"	"2.13"	"35.58"
"8778"	"[R].GIYAYGFEKPSAIQQR.[A]"	"1xBiotin [K9]"	"0.0734084"	"0.00241047"	"1"	"4"	"2"	"P60843"	"P60843 [46-61]"	"P60843 1xBiotin [K54]"	"Eukaryotic initiation factor 4A-I [OS=Mus musculus]"	"0"	"2054.01641"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"1027.51169"	"0.000415"	"0.01207"	"1.51"	""
"8780"	"[R].GLYIAKQATGGAAK.[V]"	"1xBiotin [K6]"	"1.85127E-05"	"0.000586377"	"1"	"2"	"13"	"Q8R1X6"	"Q8R1X6 [480-493]"	"Q8R1X6 1xBiotin [K485]"	"Spartin [OS=Mus musculus]"	"1"	"1574.83592"	"0.13"	"-0.21"	"-0.05"	"0.10"	"-0.06"	"-0.19"	"0.15"	"100.7"	"110.5"	"87.1"	"97.1"	"107.7"	"96.9"	"183037.236328125"	"200802.03125"	"158338.654296875"	"176384.712890625"	"195689.41796875"	"176124.857421875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"787.92161"	"0.0001108"	"6.441E-08"	"4.44"	"37.72"
"10705"	"[K].KEGICAIGGTSEQSSVGTQHSYSEEEK.[Y]"	"1xBiotin [K1]; 1xCarbamidomethyl [C5]"	"1.54233E-07"	"0.000586377"	"1"	"1"	"6"	"Q61233"	"Q61233 [97-123]"	"Q61233 1xBiotin [K97]"	"Plastin-2 [OS=Mus musculus]"	"1"	"3124.38338"	"-0.89"	"0.45"	"-0.32"	"0.02"	"-9.97"	"-9.97"	"-9.97"	"127.2"	"68.8"	"173.4"	"101.5"	"129.2"	""	"29843.9921875"	"16144.4951171875"	"40686.66015625"	"23826.6953125"	"30314.4765625"	""	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"1042.13039"	"0.0001108"	"5.923E-11"	"5.43"	"34.90"
"8813"	"[K].GMLQAEKLTSSSEK.[A]"	"1xBiotin [K7]; 1xOxidation [M2]"	"0.000168783"	"0.000586377"	"1"	"1"	"6"	"Q9CQ56"	"Q9CQ56 [81-94]"	"Q9CQ56 1xBiotin [K87]"	"Vesicle transport protein USE1 [OS=Mus musculus]"	"1"	"1750.83500"	"0.09"	"-9.97"	"0.31"	"-0.79"	"0.06"	"-0.03"	"9.97"	"121.8"	"129.8"	""	"151.0"	"70.4"	"127.0"	"15744.685546875"	"16787.396484375"	""	"19523.859375"	"9102.4326171875"	"16427.439453125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"875.92097"	"0.0001108"	"1.62E-06"	"3.24"	"33.94"
"8694"	"[R].GINPADKPAWAR.[E]"	"1xBiotin [K7]"	"0.000454828"	"0.000586377"	"1"	"3"	"6"	"Q9JM52"	"Q9JM52 [512-523]"	"Q9JM52 1xBiotin [K518]"	"Misshapen-like kinase 1 [OS=Mus musculus]"	"0"	"1521.76309"	"-9.97"	"0.08"	"0.19"	"-0.50"	"-9.97"	""	"-9.97"	"153.8"	""	"162.2"	"174.9"	"109.0"	""	"39949.48828125"	""	"42135.98828125"	"45422.16015625"	"28320.3359375"	""	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"761.38530"	"0.0001108"	"6.84E-06"	"3.07"	"42.22"
"8814"	"[R].GMITKQAK.[K]"	"1xBiotin [K5]"	"0.0502349"	"0.00154748"	"1"	"1"	"6"	"P63087"	"P63087 [315-322]"	"P63087 1xBiotin [K319]"	"serine/threonine-protein phosphatase PP1-gamma catalytic subunit [OS=Mus musculus]"	"1"	"1102.57475"	"1.13"	"0.77"	"0.59"	"1.84"	"0.84"	"-0.29"	"0.06"	"51.0"	"111.4"	"87.1"	"76.5"	"183.0"	"91.0"	"19497.291015625"	"42624.58203125"	"33340.91015625"	"29267.744140625"	"70022.203125"	"34833.0625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"551.79112"	"0.0002716"	"0.006818"	"2.01"	"29.71"
"10665"	"[K].KEDALLYQSKDYNDDYYEESYLTTK.[T]"	"2xBiotin [K1; K10]"	"0.0528427"	"0.00154748"	"1"	"1"	"1"	"O08579"	"O08579 [80-104]"	"O08579 2xBiotin [K80; K89]"	"Emerin [OS=Mus musculus]"	"2"	"3546.56034"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"3"	"1182.85819"	"0.0002716"	"0.007373"	"3.32"	""
"10664"	"[K].KEDALLYQSK.[D]"	"1xBiotin [K1]"	"0.000191886"	"0.000586377"	"1"	"1"	"133"	"O08579"	"O08579 [80-89]"	"O08579 1xBiotin [K80]"	"Emerin [OS=Mus musculus]"	"1"	"1420.71408"	"0.31"	"-0.16"	"0.29"	"0.07"	"0.13"	"-0.17"	"0.29"	"92.3"	"114.0"	"82.7"	"113.2"	"96.7"	"101.2"	"24179936.1875"	"29876885.1904297"	"21674263.3427734"	"29659300.4794922"	"25357279.4785156"	"26519183.2402344"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"710.86075"	"0.0001108"	"1.95E-06"	"3.83"	"36.92"
"10655"	"[K].KEANQAPK.[S]"	"1xBiotin [K1]"	"0.0104922"	"0.000586377"	"1"	"1"	"5"	"Q922Q8"	"Q922Q8 [219-226]"	"Q922Q8 1xBiotin [K219]"	"Leucine-rich repeat-containing protein 59 [OS=Mus musculus]"	"1"	"1111.55645"	"0.94"	"0.99"	"0.89"	"0.93"	"0.76"	"-0.18"	"-0.23"	"57.9"	"111.1"	"115.1"	"107.4"	"110.5"	"97.9"	"13532.0859375"	"25946.005859375"	"26893.716796875"	"25097.47265625"	"25816.57421875"	"22862.4140625"	""	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"2"	"556.28184"	"0.0001108"	"0.000672"	"2.24"	"17.73"
"10647"	"[R].KDYLEEPEK.[T]"	"1xBiotin [K1]"	"0.000429066"	"0.000586377"	"1"	"1"	"4"	"Q9JLB9"	"Q9JLB9 [484-492]"	"Q9JLB9 1xBiotin [K484]"	"Nectin-3 [OS=Mus musculus]"	"1"	"1376.64024"	""	"9.97"	"9.97"	"9.97"	""	""	"-9.97"	""	""	"187.7"	"223.1"	"189.2"	""	""	""	"9656.5498046875"	"11481.912109375"	"9734.6689453125"	""	""	"High"	"Not Found"	"High"	"High"	"High"	"Not Found"	"High"	"2"	"688.82377"	"0.0001108"	"6.313E-06"	"3.29"	"34.80"
"10641"	"[R].KDVYVQLYLQHLTAR.[N]"	"1xBiotin [K1]"	"4.20523E-07"	"0.000586377"	"1"	"6"	"4"	"Q61029"	"Q61029 [34-48]"	"Q61029 1xBiotin [K34]"	"Lamina-associated polypeptide 2, isoforms beta/delta/epsilon/gamma [OS=Mus musculus]"	"1"	"2073.09499"	"-9.97"	"0.07"	"-9.97"	"-9.97"	"-0.14"	"9.97"	"-0.21"	"202.8"	""	"212.8"	""	""	"184.5"	"54513.3203125"	""	"57208.87890625"	""	""	"49595.32421875"	""	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"691.70336"	"0.0001108"	"2.569E-10"	"5.45"	"52.42"
"8890"	"[R].GNVAKTSR.[N]"	"1xBiotin [K5]"	"0.0192556"	"0.000586377"	"1"	"1"	"18"	"Q9Z1W5"	"Q9Z1W5 [22-29]"	"Q9Z1W5 1xBiotin [K26]"	"Stress-associated endoplasmic reticulum protein 1 [OS=Mus musculus]"	"1"	"1058.54114"	"0.69"	"0.64"	"0.52"	"0.20"	"0.72"	"0.02"	"0.08"	"71.5"	"115.3"	"111.3"	"102.5"	"82.1"	"117.3"	"171835.828125"	"277286.125"	"267576.25"	"246335.5625"	"197489.40625"	"282122.65625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"529.77417"	"0.0001108"	"0.001642"	"2.44"	"20.09"
"10602"	"[R].KDPDINMHPLFFALGK.[V]"	"1xBiotin [K1]; 1xOxidation [M7]"	"0.00897115"	"0.000586377"	"1"	"1"	"3"	"Q920L1"	"Q920L1 [231-246]"	"Q920L1 1xBiotin [K231]"	"Fatty acid desaturase 1 [OS=Mus musculus]"	"1"	"2085.02961"	"-9.97"	"0.06"	"-9.97"	"-9.97"	"0.13"	"9.97"	"0.07"	"191.6"	""	"199.3"	""	""	"209.1"	"14508.888671875"	""	"15091.1767578125"	""	""	"15832.1865234375"	""	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"3"	"695.68169"	"0.0001108"	"0.0005359"	"2.86"	"50.09"
"8901"	"[R].GPAGSIEQGPYDKMHASK.[R]"	"1xBiotin [K]; 1xOxidation [M14]"	"6.01256E-05"	"0.000586377"	"1"	"1"	"19"	"Q99LI2"	"Q99LI2 [402-419]"	"Q99LI2 1xBiotin [K]"	"chloride channel CLIC-like protein 1 [OS=Mus musculus]"	"1"	"2114.96339"	"0.26"	"0.05"	"0.46"	"-0.63"	"0.22"	"-0.04"	"0.17"	"93.4"	"112.0"	"96.6"	"128.8"	"60.5"	"108.8"	"162151.296875"	"194473.609375"	"167704.625"	"223775.734375"	"105055.3515625"	"188995.796875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"705.65953"	"0.0001108"	"3.579E-07"	"4.62"	"30.68"
"8815"	"[R].GMITKQAK.[K]"	"1xBiotin [K5]; 1xOxidation [M2]"	"0.0151104"	"0.000586377"	"1"	"1"	"11"	"P63087"	"P63087 [315-322]"	"P63087 1xBiotin [K319]"	"serine/threonine-protein phosphatase PP1-gamma catalytic subunit [OS=Mus musculus]"	"1"	"1118.56966"	"-0.03"	"0.25"	"0.14"	"-1.02"	"0.06"	"0.09"	"-0.19"	"103.6"	"101.1"	"122.8"	"113.8"	"51.0"	"107.7"	"55751.40625"	"54432.75390625"	"66096.1640625"	"61225.86328125"	"27471.74609375"	"57948.78125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"559.78847"	"0.0001108"	"0.00115"	"2.13"	"23.45"
"10803"	"[R].KEYCELCKHR.[F]"	"1xBiotin [K8]; 2xCarbamidomethyl [C4; C7]"	"0.0166696"	"0.000586377"	"1"	"3"	"3"	"Q6ZQ89"	"Q6ZQ89 [49-58]"	"Q6ZQ89 1xBiotin [K56]"	"E3 ubiquitin-protein ligase MARCH6 [OS=Mus musculus]"	"2"	"1648.73926"	"-0.23"	"-0.46"	"0.00"	"-0.49"	"-0.17"	"0.06"	"0.29"	"115.6"	"98.6"	"84.3"	"116.0"	"82.3"	"103.1"	"17025.6640625"	"14519.8193359375"	"12416.865234375"	"17071.953125"	"12120.8623046875"	"15177.623046875"	""	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"3"	"550.25137"	"0.0001108"	"0.001335"	"2.62"	"25.45"
"8680"	"[K].GILVQTKGTGASGSFK.[L]"	"1xBiotin [K7]"	"0.000471022"	"0.000586377"	"1"	"1"	"6"	"P15864"	"P15864 [91-106]"	"P15864 1xBiotin [K97]"	"Histone H1.2 [OS=Mus musculus]"	"1"	"1776.93128"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"888.96991"	"0.0001108"	"7.256E-06"	"3.65"	""
"10815"	"[R].KFDSLR.[R]"	"1xBiotin [K1]"	"0.115176"	"0.00731053"	"1"	"1"	"8"	"Q8K273"	"Q8K273 [125-130]"	"Q8K273 1xBiotin [K125]"	"Membrane magnesium transporter 1 [OS=Mus musculus]"	"1"	"991.50296"	"0.44"	"0.15"	"0.04"	"-0.32"	"0.27"	"-0.17"	"0.12"	"92.4"	"125.1"	"102.3"	"94.8"	"74.0"	"111.4"	"228902.671875"	"310021.65625"	"253588.40625"	"234891.375"	"183462.3125"	"276178.90625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"496.25493"	"0.001478"	"0.02398"	"1.73"	"35.08"
"10970"	"[R].KGNYSER.[V]"	"1xBiotin [K1]"	"0.0502349"	"0.00154748"	"1"	"5"	"6"	"Q8BFU2"	"Q8BFU2 [37-43]"	"Q8BFU2 1xBiotin [K37]"	"Histone H2A type 3 [OS=Mus musculus]"	"1"	"1079.49385"	"0.45"	"0.26"	"0.42"	"0.33"	"0.51"	"0.07"	"0.25"	"79.2"	"107.9"	"94.7"	"105.6"	"99.6"	"112.9"	"58850.7109375"	"80246.9296875"	"70437.0234375"	"78512.7890625"	"74037.2578125"	"83956.1171875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"540.25076"	"0.0002716"	"0.006801"	"2.23"	"21.10"
"10969"	"[R].KGNYAER.[V]"	"1xBiotin [K1]"	"0.0525466"	"0.00154748"	"1"	"4"	"3"	"Q64523"	"Q64523 [37-43]"	"Q64523 1xBiotin [K37]"	"Histone H2A type 2-C [OS=Mus musculus]"	"1"	"1063.49894"	"-9.97"	"0.45"	"0.34"	"0.50"	"-9.97"	""	"-9.97"	"118.9"	""	"162.9"	"150.4"	"167.8"	""	"46592.76171875"	""	"63814.8671875"	"58926.73828125"	"65739.5234375"	""	""	"High"	"Not Found"	"Peak Found"	"High"	"High"	"Not Found"	"High"	"2"	"532.25316"	"0.0002716"	"0.007295"	"1.59"	"22.26"
"10963"	"[K].KGNFNYIEFTR.[I]"	"1xBiotin [K1]"	"0.000449555"	"0.000586377"	"1"	"1"	"6"	"Q3THE2"	"Q3THE2 [151-161]"	"Q3THE2 1xBiotin [K151]"	"Myosin regulatory light chain 12B [OS=Mus musculus]"	"1"	"1614.77332"	""	"9.97"	""	"9.97"	"9.97"	"9.97"	"0.54"	""	""	"217.0"	""	"66.9"	"316.1"	""	""	"17888.7734375"	""	"5512.55224609375"	"26051.05078125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"807.88989"	"0.0001108"	"6.76E-06"	"3.20"	"46.75"
"10942"	"[R].KGLGPSQQDPNRFDR.[D]"	"1xBiotin [K1]"	"0.00519549"	"0.000586377"	"1"	"1"	"6"	"Q9WTR1"	"Q9WTR1 [58-72]"	"Q9WTR1 1xBiotin [K58]"	"Transient receptor potential cation channel subfamily V member 2 [OS=Mus musculus]"	"2"	"1940.93955"	"0.34"	"0.32"	"0.05"	"0.11"	"0.44"	"0.10"	"0.12"	"85.9"	"108.9"	"107.2"	"88.7"	"92.7"	"116.7"	"56820.06640625"	"72075.8359375"	"70918.3828125"	"58718.11328125"	"61361.43359375"	"77217.3359375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"647.65094"	"0.0001108"	"0.0002413"	"2.68"	"31.67"
"10941"	"[R].KGLGPSQQDPNR.[F]"	"1xBiotin [K1]"	"8.73266E-05"	"0.000586377"	"1"	"1"	"11"	"Q9WTR1"	"Q9WTR1 [58-69]"	"Q9WTR1 1xBiotin [K58]"	"Transient receptor potential cation channel subfamily V member 2 [OS=Mus musculus]"	"1"	"1522.74309"	"0.76"	"0.09"	"0.15"	"0.52"	"0.57"	"-0.20"	"0.47"	"77.0"	"130.8"	"82.2"	"85.4"	"110.4"	"114.2"	"40658.8359375"	"69087.7890625"	"43395.10546875"	"45096.32421875"	"58265.7109375"	"60296.19140625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"761.87491"	"0.0001108"	"6.189E-07"	"3.32"	"27.86"
"8593"	"[K].GLGDCLVKIYK.[S]"	"1xBiotin [K8]; 1xCarbamidomethyl [C5]"	"0.00184278"	"0.000586377"	"1"	"1"	"4"	"P51881"	"P51881 [156-166]"	"P51881 1xBiotin [K163]"	"ADP/ATP translocase 2 [OS=Mus musculus]"	"1"	"1491.76982"	"-9.97"	"-9.97"	"-9.97"	"-0.96"	"0.27"	"9.97"	"9.97"	"220.6"	""	""	""	"113.5"	"265.9"	"12831.9267578125"	""	""	""	"6603.1962890625"	"15472.359375"	""	"High"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"High"	"2"	"746.38860"	"0.0001108"	"5.289E-05"	"2.45"	"48.26"
"8599"	"[K].GLGKGGAK.[R]"	"1xBiotin [K4]"	"0.0400685"	"0.00104877"	"1"	"1"	"7"	"P62806"	"P62806 [10-17]"	"P62806 1xBiotin [K13]"	"histone H4 [OS=Mus musculus]"	"1"	"913.49240"	"0.53"	"0.64"	"0.30"	"0.46"	"0.56"	"0.03"	"-0.08"	"74.2"	"107.0"	"115.8"	"91.6"	"102.0"	"109.4"	"101831.7890625"	"146890.40625"	"158878.109375"	"125749.6328125"	"139922.828125"	"150087.703125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"457.24959"	"0.0001873"	"0.004862"	"2.11"	"24.22"
"8627"	"[K].GLKGESVNK.[L]"	"1xBiotin [K3]"	"0.0355593"	"0.00104877"	"1"	"1"	"4"	"P47740"	"P47740 [429-437]"	"P47740 1xBiotin [K431]"	"Fatty aldehyde dehydrogenase [OS=Mus musculus]"	"1"	"1157.59832"	"1.82"	"-0.21"	"1.16"	"0.61"	"1.65"	"-0.17"	"1.87"	"48.8"	"172.6"	"42.1"	"108.9"	"74.3"	"153.4"	"12920.4150390625"	"45719.9970703125"	"11150.4248046875"	"28841.04296875"	"19669.119140625"	"40622.1791992188"	""	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"2"	"579.30279"	"0.0001873"	"0.004069"	"2.13"	"27.45"
"10875"	"[R].KGAPPAEK.[K]"	"1xBiotin [K1]"	"0.0639082"	"0.0019826"	"1"	"1"	"2"	"Q9WUQ2"	"Q9WUQ2 [119-126]"	"Q9WUQ2 1xBiotin [K119]"	"Prolactin regulatory element-binding protein [OS=Mus musculus]"	"1"	"1023.52918"	"0.55"	"0.38"	"0.34"	"0.38"	"0.32"	"-0.23"	"-0.06"	"79.2"	"115.9"	"102.8"	"100.1"	"103.3"	"98.7"	"9294.7138671875"	"13608.015625"	"12065.2373046875"	"11756.4111328125"	"12125.3603515625"	"11587.474609375"	""	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"2"	"512.26807"	"0.0003442"	"0.009744"	"1.90"	"20.07"
"10863"	"[K].KGAAEDGDKLDIGNTEMK.[L]"	"1xBiotin [K1]; 1xOxidation [M17]"	"0.00218203"	"0.000586377"	"1"	"1"	"5"	"Q61335"	"Q61335 [159-176]"	"Q61335 1xBiotin [K159]"	"B-cell receptor-associated protein 31 [OS=Mus musculus]"	"2"	"2133.97909"	"-0.25"	"-0.22"	"-0.17"	"-1.28"	"-0.90"	"-0.65"	"-0.67"	"132.3"	"111.2"	"113.2"	"117.7"	"54.5"	"71.0"	"42776.76953125"	"35946.19140625"	"36605.29296875"	"38052.80078125"	"17633.140625"	"22949.63671875"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"3"	"711.99859"	"0.0001108"	"6.783E-05"	"2.63"	"30.93"
"10855"	"[R].KFVEGEVVR.[G]"	"1xBiotin [K1]"	"0.00866411"	"0.000586377"	"1"	"1"	"6"	"Q3U9G9"	"Q3U9G9 [5-13]"	"Q3U9G9 1xBiotin [K5]"	"Lamin-B receptor [OS=Mus musculus]"	"1"	"1288.67182"	"0.02"	"-9.97"	"-9.97"	"-9.97"	"0.19"	"0.17"	"9.97"	"190.0"	"192.9"	""	""	""	"217.1"	"42924.99609375"	"43593.46484375"	""	""	""	"49066.62890625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"644.83958"	"0.0001108"	"0.0005087"	"1.83"	"36.83"
"10854"	"[R].KFVADGIFK.[A]"	"1xBiotin [K1]"	"0.00633127"	"0.000586377"	"1"	"1"	"1"	"P62908"	"P62908 [10-18]"	"P62908 1xBiotin [K10]"	"40S ribosomal protein S3 [OS=Mus musculus]"	"1"	"1250.66019"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"625.83394"	"0.0001108"	"0.0003215"	"2.24"	""
"10849"	"[K].KFQYQLACR.[S]"	"1xBiotin [K1]; 1xCarbamidomethyl [C8]"	"0.00119023"	"0.000586377"	"1"	"3"	"13"	"Q8BRG8"	"Q8BRG8 [288-296]"	"Q8BRG8 1xBiotin [K288]"	"Transmembrane protein 209 [OS=Mus musculus]"	"1"	"1439.69224"	"0.26"	"0.27"	"0.06"	"0.34"	"0.34"	"0.08"	"0.06"	"86.0"	"102.8"	"104.0"	"89.7"	"108.8"	"108.7"	"835076.8125"	"997224.060546875"	"1009342.68554688"	"870582.54296875"	"1055573.75"	"1055354.625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"720.34986"	"0.0001108"	"2.797E-05"	"2.89"	"38.18"
"10839"	"[K].KFMEENEK.[L]"	"1xBiotin [K1]; 1xOxidation [M3]"	"0.00347718"	"0.000586377"	"1"	"1"	"4"	"Q61334"	"Q61334 [150-157]"	"Q61334 1xBiotin [K150]"	"B-cell receptor-associated protein 29 [OS=Mus musculus]"	"1"	"1296.55989"	"0.41"	"0.12"	"0.09"	"-0.48"	"0.12"	"-0.29"	"0.00"	"95.3"	"126.9"	"103.8"	"101.7"	"68.5"	"103.8"	"13424.6328125"	"17885.302734375"	"14622.1103515625"	"14333.48046875"	"9658.0107421875"	"14626.8486328125"	""	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"2"	"648.78358"	"0.0001108"	"0.0001343"	"2.47"	"25.76"
"8641"	"[K].GILAADESTGSIAKR.[L]"	"1xBiotin [K14]"	"0.000101623"	"0.000586377"	"1"	"1"	"6"	"P05064"	"P05064 [29-43]"	"P05064 1xBiotin [K42]"	"fructose-bisphosphate aldolase A [OS=Mus musculus]"	"1"	"1714.87924"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"857.94350"	"0.0001108"	"7.717E-07"	"4.62"	""
"10829"	"[R].KFLDGIYVSEK.[G]"	"1xBiotin [K1]"	"0.00152037"	"0.000586377"	"1"	"1"	"5"	"P51410"	"P51410 [174-184]"	"P51410 1xBiotin [K174]"	"60S ribosomal protein L9 [OS=Mus musculus]"	"1"	"1524.77668"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"0.37"	"-0.21"	""	"108.9"	"163.3"	"113.8"	"72.9"	"141.1"	""	"13024.19921875"	"19536.142578125"	"13610.7578125"	"8717.4306640625"	"16876.52734375"	""	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"2"	"762.89211"	"0.0001108"	"4.012E-05"	"3.13"	"46.09"
"8645"	"[K].GIIDPTKVVR.[T]"	"1xBiotin [K7]"	"0.0664443"	"0.0019826"	"1"	"2"	"3"	"P63038-1"	"P63038-1 [517-526]"	"P63038-1 1xBiotin [K523]"	"60 kDa heat shock protein, mitochondrial [OS=Mus musculus]"	"1"	"1323.74532"	"0.23"	"-0.32"	"0.20"	"-0.31"	"-9.97"	"-9.97"	"-9.97"	"121.8"	"143.0"	"97.3"	"140.0"	"97.9"	""	"10712.2421875"	"12576.6865234375"	"8554.142578125"	"12312.5712890625"	"8613.5625"	""	""	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"2"	"662.37656"	"0.0003442"	"0.01039"	"1.84"	"43.10"
"8664"	"[K].GLLMDCNAVLTLKT.[-]"	"1xBiotin [K13]; 1xCarbamidomethyl [C6]; 1xOxidation [M4]"	"0.111552"	"0.00731053"	"1"	"1"	"2"	"Q8BGF6"	"Q8BGF6 [280-293]"	"Q8BGF6 1xBiotin [K292]"	"ELMO domain-containing protein 2 [OS=Mus musculus]"	"1"	"1790.88492"	"0.05"	"-0.53"	"-0.83"	"-2.95"	"0.00"	"-0.05"	"0.53"	"135.9"	"140.5"	"93.9"	"76.6"	"17.6"	"135.5"	"22442.525390625"	"23214.060546875"	"15514.18359375"	"12657.4365234375"	"2900.48779296875"	"22385.30859375"	""	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"2"	"895.94631"	"0.001478"	"0.02272"	"2.24"	"55.22"
"8665"	"[R].GLINVKGK.[G]"	"1xBiotin [K6]"	"0.0899165"	"0.00334029"	"1"	"2"	"5"	"P51829"	"P51829 [1071-1078]"	"P51829 1xBiotin [K1076]"	"adenylate cyclase type 7 [OS=Mus musculus]"	"1"	"1054.60776"	"0.20"	"-0.11"	"0.17"	"0.02"	"0.12"	"-0.08"	"0.23"	"95.1"	"109.3"	"88.2"	"106.9"	"96.8"	"103.7"	"43517.984375"	"49994.48046875"	"40330.91796875"	"48909.64453125"	"44259.01953125"	"47440.10546875"	""	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"2"	"527.80731"	"0.000655"	"0.01643"	"1.93"	"37.19"
"10983"	"[R].KGPTKTK.[E]"	"1xBiotin [K5]"	"0.0823954"	"0.00241047"	"1"	"1"	"3"	"Q8VE99"	"Q8VE99 [105-111]"	"Q8VE99 1xBiotin [K109]"	"Coiled-coil domain-containing protein 115 [OS=Mus musculus]"	"2"	"985.54991"	"-0.58"	"0.85"	"0.72"	"0.48"	"-0.24"	"0.34"	"-1.09"	"81.6"	"54.5"	"147.1"	"134.3"	"113.5"	"68.9"	"13586.431640625"	"9083.865234375"	"24512.8671875"	"22375.80859375"	"18914.541015625"	"11483.2841796875"	""	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"2"	"493.27847"	"0.000415"	"0.01433"	"1.58"	"13.98"
"13393"	"[R].IFMHHLCR.[A]"	"1xCarbamidomethyl [C7]; 1xOxidation [M3]"	"0.0258179"	"0.00104877"	"1"	"1"	"2"	"Q7TPV4"	"Q7TPV4 [878-885]"	""	"Myb-binding protein 1A [OS=Mus musculus]"	"0"	"1129.53937"	"0.57"	"0.46"	"0.95"	"-0.84"	"0.50"	"-0.08"	"0.04"	"77.3"	"115.2"	"106.4"	"148.9"	"43.1"	"109.0"	"5520.20849609375"	"8222.7802734375"	"7593.47021484375"	"10629.904296875"	"3078.4267578125"	"7781.75439453125"	""	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"3"	"377.18442"	"0.0001873"	"0.002545"	"1.59"	"16.01"
"13394"	"[K].LFNDLFKNNANR.[A]"	"1xBiotin [K7]"	"0.00339713"	"0.000586377"	"1"	"1"	"4"	"Q8BHY8"	"Q8BHY8 [775-786]"	"Q8BHY8 1xBiotin [K781]"	"Sorting nexin-14 [OS=Mus musculus]"	"1"	"1691.83224"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"Not Found"	"High"	"High"	"Not Found"	"High"	"High"	"2"	"846.42041"	"0.0001108"	"0.000129"	"3.12"	""
"13412"	"[R].LFQRPDSTHSSNLSASSSDLPLKF.[-]"	"1xBiotin [K23]"	"0.00190835"	"0.000586377"	"1"	"1"	"4"	"Q8R3L0"	"Q8R3L0 [100-123]"	"Q8R3L0 1xBiotin [K122]"	"Membrane magnesium transporter 2 [OS=Mus musculus]"	"1"	"2860.39342"	"0.51"	"-9.97"	"-9.97"	"-9.97"	"0.59"	"0.08"	"9.97"	"153.0"	"217.4"	""	""	""	"229.6"	"24606.806640625"	"34954.19140625"	""	""	""	"36923.19921875"	""	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"954.13750"	"0.0001108"	"5.594E-05"	"4.47"	"50.75"
"16816"	"[R].MADSLASKVTR.[L]"	"1xBiotin [K8]"	"0.000203409"	"0.000586377"	"1"	"1"	"15"	"O35153"	"O35153 [24-34]"	"O35153 1xBiotin [K31]"	"BET1-like protein [OS=Mus musculus]"	"1"	"1404.69738"	"0.85"	"0.81"	"0.50"	"1.43"	"0.48"	"-0.37"	"-0.33"	"59.7"	"107.3"	"104.4"	"84.6"	"160.7"	"83.2"	"234871.46875"	"421945.4375"	"410655.09375"	"332690.09375"	"631941.181640625"	"327255.84375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"702.85224"	"0.0001108"	"2.128E-06"	"4.11"	"39.42"
"16725"	"[K].LYSKMIVGNHEDR.[S]"	"1xBiotin [K4]; 1xOxidation [M5]"	"0.00300609"	"0.000586377"	"1"	"1"	"7"	"Q8K2C8"	"Q8K2C8 [441-453]"	"Q8K2C8 1xBiotin [K444]"	"glycerol-3-phosphate acyltransferase 4 [OS=Mus musculus]"	"1"	"1803.85165"	"2.02"	"1.40"	"1.60"	"2.25"	"2.60"	"0.58"	"1.21"	"27.9"	"112.9"	"73.3"	"84.2"	"132.4"	"169.3"	"4507.26708984375"	"18256.578125"	"11857.3203125"	"13616.845703125"	"21403.41796875"	"27369.8833007813"	""	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"2"	"902.42971"	"0.0001108"	"0.0001085"	"1.68"	"33.38"
"16724"	"[K].LYSKMIVGNHEDR.[S]"	"1xBiotin [K4]"	"0.000158296"	"0.000586377"	"1"	"1"	"7"	"Q8K2C8"	"Q8K2C8 [441-453]"	"Q8K2C8 1xBiotin [K444]"	"glycerol-3-phosphate acyltransferase 4 [OS=Mus musculus]"	"1"	"1787.85674"	"1.09"	"0.66"	"0.68"	"1.66"	"0.74"	"-0.35"	"0.08"	"53.9"	"114.7"	"84.9"	"86.6"	"170.0"	"89.9"	"14153.126953125"	"30130.560546875"	"22300.396484375"	"22747.818359375"	"44647.1455078125"	"23603.556640625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"596.62374"	"0.0001108"	"1.468E-06"	"2.95"	"37.16"
"16703"	"[K].IYKSDGIK.[G]"	"1xBiotin [K3]"	"0.0349568"	"0.00104877"	"1"	"1"	"2"	"P51881"	"P51881 [164-171]"	"P51881 1xBiotin [K166]"	"ADP/ATP translocase 2 [OS=Mus musculus]"	"1"	"1149.59726"	"0.62"	"-0.02"	"0.35"	"0.05"	"0.11"	"-0.51"	"0.13"	"86.9"	"133.5"	"85.6"	"110.5"	"89.9"	"93.6"	"20212.943359375"	"31060.55078125"	"19927.318359375"	"25703.87890625"	"20920.203125"	"21783.865234375"	""	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"2"	"575.30234"	"0.0001873"	"0.003956"	"1.73"	"31.46"
"16701"	"[K].IYKIGQGYLIK.[D]"	"1xBiotin [K3]"	"0.0122692"	"0.000586377"	"1"	"1"	"3"	"P27659"	"P27659 [284-294]"	"P27659 1xBiotin [K286]"	"60S ribosomal protein L3 [OS=Mus musculus]"	"1"	"1521.84978"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"2"	"761.42853"	"0.0001108"	"0.0008478"	"2.69"	""
"16700"	"[R].LYKHLDV.[-]"	"1xBiotin [K3]"	"0.0679359"	"0.0019826"	"1"	"2"	"6"	"Q3UM18"	"Q3UM18 [638-644]"	"Q3UM18 1xBiotin [K640]"	"Large subunit GTPase 1 homolog [OS=Mus musculus]"	"1"	"1113.57613"	"0.43"	"0.28"	"0.23"	"-0.13"	"0.36"	"-0.08"	"0.08"	"86.6"	"117.0"	"105.1"	"101.4"	"79.0"	"111.0"	"163892.96875"	"221469.84375"	"198972.65625"	"191872.875"	"149466"	"210079.09375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"557.29163"	"0.0003442"	"0.01067"	"2.14"	"42.06"
"5494"	"[R].EIAQDFKTDLR.[F]"	"1xBiotin [K7]"	"0.0019878"	"0.000586377"	"1"	"4"	"5"	"P68433"	"P68433 [74-84]"	"P68433 1xBiotin [K80]"	"Histone H3.1 [OS=Mus musculus]"	"1"	"1561.76790"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"-0.25"	"-0.24"	""	"130.9"	"129.8"	"142.2"	"86.9"	"110.2"	""	"20039.0859375"	"19876.56640625"	"21762.6015625"	"13310.91015625"	"16866.45703125"	""	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"2"	"781.38756"	"0.0001108"	"5.93E-05"	"2.83"	"44.50"
"16663"	"[K].IWHHTFYNELR.[V]"	""	"0.000894491"	"0.000586377"	"1"	"4"	"14"	"P60710"	"P60710 [85-95]"	""	"Actin, cytoplasmic 1 [OS=Mus musculus]"	"0"	"1515.74916"	"1.02"	"0.61"	"-0.23"	"-0.54"	"0.26"	"-0.76"	"-0.35"	"82.3"	"166.7"	"126.0"	"69.9"	"56.5"	"98.6"	"361446.421875"	"732350.390625"	"553410.94140625"	"307159.41015625"	"248311.02734375"	"433132.3984375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"758.37812"	"0.0001108"	"1.838E-05"	"2.74"	"31.56"
"5473"	"[K].ELAALPKATVLDLSCNK.[L]"	"1xBiotin [K7]; 1xCarbamidomethyl [C15]"	"0.000189661"	"0.000586377"	"1"	"1"	"11"	"Q922Q8"	"Q922Q8 [34-50]"	"Q922Q8 1xBiotin [K40]"	"Leucine-rich repeat-containing protein 59 [OS=Mus musculus]"	"1"	"2069.07696"	"1.47"	"1.12"	"1.19"	"-3.14"	"1.35"	"-0.12"	"0.23"	"55.2"	"152.5"	"119.8"	"125.5"	"6.3"	"140.7"	"22900.7265625"	"63249.07421875"	"49708.646484375"	"52075.15234375"	"2596.5654296875"	"58381.5703125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"690.36373"	"0.0001108"	"1.918E-06"	"3.37"	"53.98"
"5573"	"[K].EIESEEQNLVTKGPAPLGTFQVTTPQR.[K]"	"1xBiotin [K12]"	"1.00852E-06"	"0.000586377"	"1"	"1"	"208"	"Q3U9G9"	"Q3U9G9 [189-215]"	"Q3U9G9 1xBiotin [K200]"	"Lamin-B receptor [OS=Mus musculus]"	"1"	"3195.59905"	"0.05"	"0.07"	"-1.02"	"-4.13"	"0.57"	"0.52"	"0.51"	"117.1"	"121.5"	"122.6"	"57.9"	"6.7"	"174.1"	"31286404.6386719"	"32441743.8911133"	"32751897.3740234"	"15467759.2470703"	"1788665.66772461"	"46504593.109375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"1065.87146"	"0.0001108"	"9.151E-10"	"5.82"	"51.15"
"16613"	"[R].LVSLIGSKTQIPTQR.[Y]"	"1xBiotin [K8]"	"2.6888E-05"	"0.000586377"	"1"	"1"	"6"	"Q9R1P4"	"Q9R1P4 [108-122]"	"Q9R1P4 1xBiotin [K115]"	"Proteasome subunit alpha type-1 [OS=Mus musculus]"	"1"	"1867.04698"	"0.31"	"-0.11"	"-0.15"	"-1.61"	"0.58"	"0.27"	"0.70"	"101.8"	"126.2"	"94.3"	"91.7"	"33.5"	"152.6"	"16121.068359375"	"19983.48046875"	"14927.41796875"	"14517.455078125"	"5297.5869140625"	"24169.12109375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"934.02718"	"0.0001108"	"1.105E-07"	"3.75"	"46.63"
"16562"	"[K].IVNLGSSKTDLFYER.[K]"	"1xBiotin [K8]"	"9.58668E-05"	"0.000586377"	"1"	"1"	"4"	"P83870"	"P83870 [88-102]"	"P83870 1xBiotin [K95]"	"PHD finger-like domain-containing protein 5A [OS=Mus musculus]"	"1"	"1967.98952"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"2"	"984.49815"	"0.0001108"	"7.078E-07"	"3.51"	""
"5719"	"[R].ELMKTPSISK.[K]"	"1xBiotin [K4]; 1xOxidation [M3]"	"0.00538001"	"0.000586377"	"1"	"1"	"6"	"Q3TBD2-1"	"Q3TBD2-1 [8-17]"	"Q3TBD2-1 1xBiotin [K11]"	"Rho GTPase-activating protein 45 [OS=Mus musculus]"	"1"	"1375.69598"	"0.21"	"0.02"	"-0.11"	"-0.95"	"0.30"	"0.09"	"0.28"	"102.6"	"118.7"	"104.3"	"94.8"	"53.2"	"126.4"	"21991.58984375"	"25458.26953125"	"22366.892578125"	"20323.333984375"	"11404.966796875"	"27088.994140625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"688.35180"	"0.0001108"	"0.0002524"	"2.71"	"32.71"
"5739"	"[K].EIPHNEKLLSLK.[Y]"	"1xBiotin [K7]"	"0.00326144"	"0.000586377"	"1"	"1"	"8"	"O70496"	"O70496 [80-91]"	"O70496 1xBiotin [K86]"	"H(+)/Cl(-) exchange transporter 7 [OS=Mus musculus]"	"1"	"1646.89344"	"0.42"	"0.83"	"0.59"	"0.16"	"0.44"	"0.01"	"-0.39"	"74.2"	"99.4"	"131.6"	"111.7"	"82.8"	"100.4"	"22827.29296875"	"30555.154296875"	"40457.65234375"	"34347.0024414063"	"25460.67578125"	"30862.27734375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"823.95033"	"0.0001108"	"0.000122"	"2.53"	"40.98"
"16518"	"[K].LVINGKPITIFQER.[D]"	"1xBiotin [K6]"	"0.000111562"	"0.000586377"	"1"	"1"	"5"	"P16858"	"P16858 [65-78]"	"P16858 1xBiotin [K70]"	"glyceraldehyde-3-phosphate dehydrogenase [OS=Mus musculus]"	"0"	"1854.03060"	"9.97"	""	"9.97"	""	"9.97"	"0.06"	"9.97"	""	"263.5"	""	"62.4"	""	"274.1"	""	"16793.015625"	""	"3976.64916992188"	""	"17463.87890625"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"2"	"927.51934"	"0.0001108"	"8.833E-07"	"3.06"	"54.18"
"16512"	"[K].LVIKNQQFHK.[E]"	"1xBiotin [K4]"	"0.0683137"	"0.0019826"	"1"	"1"	"3"	"Q99K48"	"Q99K48 [242-251]"	"Q99K48 1xBiotin [K245]"	"Non-POU domain-containing octamer-binding protein [OS=Mus musculus]"	"1"	"1480.80931"	"0.43"	"0.50"	"0.63"	"0.19"	"0.76"	"0.33"	"0.25"	"73.7"	"99.3"	"104.5"	"113.8"	"84.1"	"124.5"	"9296.552734375"	"12514.1240234375"	"13179.6337890625"	"14350.0986328125"	"10599.11328125"	"15701.0205078125"	""	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"3"	"494.27471"	"0.0003442"	"0.01078"	"1.50"	"33.32"
"16498"	"[R].LVLCKTYR.[L]"	"1xBiotin [K5]; 1xCarbamidomethyl [C4]"	"0.0171578"	"0.000586377"	"1"	"1"	"6"	"Q8VCZ6"	"Q8VCZ6 [611-618]"	"Q8VCZ6 1xBiotin [K615]"	"Small G protein signaling modulator 3 [OS=Mus musculus]"	"1"	"1278.66971"	"0.88"	"-9.97"	"0.27"	"-0.18"	"0.69"	"-0.18"	"9.97"	"91.7"	"168.5"	""	"110.6"	"80.8"	"148.4"	"54546.30078125"	"100192.234375"	""	"65791.6171875"	"48032.17578125"	"88276.4453125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"639.83817"	"0.0001108"	"0.001394"	"2.37"	"39.60"
"5789"	"[K].ELQSTFK.[-]"	"1xBiotin [K7]"	"0.0908999"	"0.00334029"	"1"	"1"	"6"	"Q9D8Y0"	"Q9D8Y0 [234-240]"	"Q9D8Y0 1xBiotin [K240]"	"EF-hand domain-containing protein D2 [OS=Mus musculus]"	"0"	"1078.52376"	"0.21"	"0.03"	"0.09"	"0.44"	"0.18"	"-0.03"	"0.15"	"89.2"	"103.0"	"91.1"	"95.1"	"120.9"	"100.8"	"74035.515625"	"85475.84375"	"75613.46875"	"78942.5390625"	"100355.53125"	"83724.1640625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"539.76537"	"0.0007348"	"0.01659"	"1.52"	"40.46"
"5574"	"[K].EIESEEQNLVTKGPAPLGTFQVTTPQRK.[D]"	"1xBiotin [K12]"	"7.66746E-07"	"0.000586377"	"1"	"1"	"13"	"Q3U9G9"	"Q3U9G9 [189-216]"	"Q3U9G9 1xBiotin [K200]"	"Lamin-B receptor [OS=Mus musculus]"	"2"	"3323.69402"	"0.03"	"-0.41"	"-1.15"	"-4.46"	"0.84"	"0.81"	"1.26"	"118.5"	"121.1"	"88.9"	"53.4"	"5.4"	"212.7"	"557132.77734375"	"569447.421875"	"418089.296875"	"251220.25"	"25306.1040039063"	"1000266.921875"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"3"	"1108.56941"	"0.0001108"	"6.175E-10"	"5.78"	"47.52"
"5465"	"[K].EKYDYVGR.[L]"	"1xBiotin [K2]"	"0.0320905"	"0.00104877"	"1"	"1"	"5"	"Q80UU9"	"Q80UU9 [186-193]"	"Q80UU9 1xBiotin [K187]"	"Membrane-associated progesterone receptor component 2 [OS=Mus musculus]"	"1"	"1255.57758"	"9.97"	""	""	"9.97"	""	"-9.97"	""	""	"397.7"	""	""	"202.3"	""	""	"24898.927734375"	""	""	"12667.2802734375"	""	""	"High"	"High"	"High"	"High"	"High"	"Not Found"	"High"	"2"	"628.29252"	"0.0001873"	"0.00349"	"1.30"	"33.68"
"17037"	"[K].MASTPASYGNTTTKPMGLLSR.[V]"	"1xBiotin [K14]; 1xOxidation [M]"	"0.00129144"	"0.000586377"	"1"	"2"	"9"	"Q8BRF7"	"Q8BRF7 [499-519]"	"Q8BRF7 1xBiotin [K512]"	"Sec1 family domain-containing protein 1 [OS=Mus musculus]"	"0"	"2426.15126"	"2.02"	"1.55"	"0.04"	"-9.97"	"0.38"	"-1.64"	"-1.17"	"58.1"	"235.8"	"170.4"	"59.9"	""	"75.7"	"7161.25048828125"	"29040.9638671875"	"20986.83203125"	"7380.470703125"	""	"9323.212890625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"809.38953"	"0.0001108"	"3.14E-05"	"3.10"	"45.45"
"17038"	"[K].MASTPASYGNTTTKPMGLLSR.[V]"	"1xBiotin [K14]; 2xOxidation [M1; M16]"	"0.00102284"	"0.000586377"	"1"	"2"	"5"	"Q8BRF7"	"Q8BRF7 [499-519]"	"Q8BRF7 1xBiotin [K512]"	"Sec1 family domain-containing protein 1 [OS=Mus musculus]"	"0"	"2442.14618"	"-0.06"	"0.38"	"0.29"	"-9.97"	"0.34"	"0.40"	"-0.04"	"104.2"	"100.2"	"135.8"	"127.7"	""	"132.0"	"29120.65625"	"27998.765625"	"37937.03125"	"35668.04296875"	""	"36887.6171875"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"814.72017"	"0.0001108"	"2.244E-05"	"4.08"	"40.31"
"17639"	"[R-].MGCVKSR.[F]"	"1xBiotin [K5]; 1xCarbamidomethyl [C3]"	"0.0675601"	"0.0019826"	"1"	"2"	"5"	"P08103-1"	"P08103-1 [22-28]"	"P08103-1 1xBiotin [K26]"	"Tyrosine-protein kinase HCK [OS=Mus musculus]"	"1"	"1063.48455"	"0.94"	"0.71"	"-0.21"	"1.11"	"0.77"	"-0.17"	"0.06"	"64.7"	"123.8"	"105.7"	"56.2"	"139.6"	"110.1"	"10102.8525390625"	"19315.78515625"	"16486.81640625"	"8764.0517578125"	"21785.3515625"	"17174.912109375"	""	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"2"	"532.24585"	"0.0003442"	"0.01064"	"1.90"	"24.55"
"17609"	"[K].MFSNCSKQSIYK.[T]"	"1xBiotin [K7]; 1xCarbamidomethyl [C5]; 1xOxidation [M1]"	"0.000275461"	"0.000586377"	"1"	"2"	"6"	"Q9Z0F8"	"Q9Z0F8 [449-460]"	"Q9Z0F8 1xBiotin [K455]"	"Disintegrin and metalloproteinase domain-containing protein 17 [OS=Mus musculus]"	"1"	"1734.76481"	"-0.26"	"-0.14"	"-0.15"	"-0.45"	"-0.26"	"0.00"	"-0.12"	"115.1"	"96.2"	"104.7"	"103.6"	"84.1"	"96.3"	"13642.650390625"	"11405.01171875"	"12409.16015625"	"12272.37890625"	"9961.5849609375"	"11418.29296875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"867.88641"	"0.0001108"	"3.301E-06"	"3.15"	"35.00"
"5382"	"[K].EKLQCLK.[D]"	"1xBiotin [K2]; 1xCarbamidomethyl [C5]"	"0.0333984"	"0.00104877"	"1"	"1"	"8"	"O35316"	"O35316 [5-11]"	"O35316 1xBiotin [K6]"	"Sodium- and chloride-dependent taurine transporter [OS=Mus musculus]"	"1"	"1144.58531"	"0.46"	"0.16"	"0.19"	"0.34"	"0.26"	"-0.19"	"0.11"	"84.5"	"115.9"	"94.3"	"96.7"	"107.1"	"101.5"	"335899.0625"	"460497.28125"	"374854.8125"	"384040.65625"	"425470.1875"	"403319.5"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"572.79631"	"0.0001873"	"0.003709"	"2.74"	"33.08"
"5383"	"[K].EKLQCLKDFHK.[D]"	"1xBiotin [K7]; 1xCarbamidomethyl [C5]"	"0.00956243"	"0.000586377"	"1"	"1"	"4"	"O35316"	"O35316 [5-15]"	"O35316 1xBiotin [K11]"	"Sodium- and chloride-dependent taurine transporter [OS=Mus musculus]"	"2"	"1671.83454"	"0.24"	"0.26"	"0.49"	"-0.24"	"0.01"	"-0.23"	"-0.25"	"90.3"	"107.1"	"108.2"	"126.9"	"76.4"	"91.1"	"28040.939453125"	"33224.79296875"	"33572.53125"	"39397.93359375"	"23708.998046875"	"28273.474609375"	""	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"3"	"557.94957"	"0.0001108"	"0.0005897"	"2.96"	"34.78"
"17585"	"[K].MFLKVALPSYEEALSLPPK.[T]"	"1xBiotin [K4]; 1xOxidation [M1]"	"0.00119023"	"0.000586377"	"1"	"1"	"15"	"Q61168"	"Q61168 [229-247]"	"Q61168 1xBiotin [K232]"	"Lysosomal-associated transmembrane protein 5 [OS=Mus musculus]"	"1"	"2375.23894"	"-0.33"	"0.10"	"-9.97"	"-9.97"	"1.04"	"1.36"	"0.93"	"121.9"	"97.2"	"130.9"	""	""	"249.9"	"18318.734375"	"14601.2333984375"	"19670.5068359375"	""	""	"37547.1376953125"	""	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"792.41745"	"0.0001108"	"2.797E-05"	"3.16"	"57.76"
"17551"	"[K].MEVGQYIFVKCPK.[V]"	"1xBiotin [K10]; 1xCarbamidomethyl [C11]; 1xOxidation [M1]"	"0.000375214"	"0.000586377"	"1"	"1"	"11"	"Q61093"	"Q61093 [319-331]"	"Q61093 1xBiotin [K328]"	"Cytochrome b-245 heavy chain [OS=Mus musculus]"	"1"	"1840.87945"	"-0.11"	"-0.03"	"-0.12"	"-2.60"	"-0.06"	"0.05"	"-0.03"	"121.3"	"112.3"	"118.9"	"111.3"	"20.0"	"116.3"	"32883.6083984375"	"30438.4072265625"	"32227.3662109375"	"30185.751953125"	"5418.984375"	"31519.677734375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"920.94220"	"0.0001108"	"5.197E-06"	"2.50"	"46.39"
"17550"	"[K].MEVGQYIFVKCPK.[V]"	"1xBiotin [K10]; 1xCarbamidomethyl [C11]"	"0.000111562"	"0.000586377"	"1"	"1"	"6"	"Q61093"	"Q61093 [319-331]"	"Q61093 1xBiotin [K328]"	"Cytochrome b-245 heavy chain [OS=Mus musculus]"	"1"	"1824.88453"	"0.20"	"0.16"	"-0.92"	"-2.92"	"0.03"	"-0.17"	"-0.14"	"121.2"	"139.3"	"135.8"	"64.1"	"16.0"	"123.5"	"23394.166015625"	"26884.11328125"	"26222.640625"	"12384.689453125"	"3098.4755859375"	"23851.912109375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"912.94641"	"0.0001108"	"8.818E-07"	"4.02"	"50.32"
"5411"	"[K].EKNLVSWESQTQPQVQVQDEEITEDDLR.[L]"	"1xBiotin [K2]"	"0.000577658"	"0.000586377"	"1"	"1"	"2"	"O70439"	"O70439 [139-166]"	"O70439 1xBiotin [K140]"	"Syntaxin-7 [OS=Mus musculus]"	"1"	"3569.67005"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"3"	"1190.56087"	"0.0001108"	"9.715E-06"	"4.26"	""
"17385"	"[R].MEESFSSKYVPK.[Y]"	"1xBiotin [K]; 1xOxidation [M1]"	"1.12771E-05"	"0.000586377"	"1"	"4"	"131"	"Q61029"	"Q61029 [381-392]"	"Q61029 1xBiotin [K]"	"Lamina-associated polypeptide 2, isoforms beta/delta/epsilon/gamma [OS=Mus musculus]"	"1"	"1673.75496"	"-0.21"	"-0.16"	"-0.02"	"-1.06"	"-0.34"	"-0.13"	"-0.18"	"119.7"	"103.3"	"106.9"	"118.3"	"57.6"	"94.2"	"11332590.5849609"	"9779997.06640625"	"10122061.5380859"	"11202816.1967773"	"5450225.48242188"	"8923189.01953125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"837.38115"	"0.0001108"	"3.119E-08"	"4.48"	"39.29"
"17384"	"[R].MEESFSSKYVPK.[Y]"	"1xBiotin [K8]"	"8.09511E-05"	"0.000586377"	"1"	"4"	"80"	"Q61029"	"Q61029 [381-392]"	"Q61029 1xBiotin [K388]"	"Lamina-associated polypeptide 2, isoforms beta/delta/epsilon/gamma [OS=Mus musculus]"	"1"	"1657.76004"	"0.81"	"0.72"	"0.63"	"1.66"	"0.76"	"-0.06"	"0.03"	"55.5"	"97.6"	"91.6"	"86.0"	"175.4"	"93.9"	"2420783.27050781"	"4256996.36376953"	"3996327.83398438"	"3750326.05566406"	"7651658.47949219"	"4094208.44775391"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"829.38380"	"0.0001108"	"5.512E-07"	"4.85"	"41.13"
"17368"	"[R].MEEFVCKVWEGR.[W]"	"1xBiotin [K7]; 1xCarbamidomethyl [C6]; 1xOxidation [M1]"	"0.00945211"	"0.000586377"	"1"	"2"	"2"	"Q8BQS5-1"	"Q8BQS5-1 [91-102]"	"Q8BQS5-1 1xBiotin [K97]"	"Adiponectin receptor protein 2 [OS=Mus musculus]"	"1"	"1811.79136"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"2"	"906.40130"	"0.0001108"	"0.0005792"	"2.21"	""
"5417"	"[K].EKPFVFNLDDENIR.[T]"	"1xBiotin [K2]"	"0.000931749"	"0.000586377"	"1"	"1"	"5"	"Q9ERS5"	"Q9ERS5 [408-421]"	"Q9ERS5 1xBiotin [K409]"	"Pleckstrin homology domain-containing family A member 2 [OS=Mus musculus]"	"0"	"1961.94257"	"0.01"	"-0.05"	"-1.08"	"-9.97"	"0.37"	"0.36"	"0.42"	"126.7"	"127.8"	"122.0"	"59.8"	""	"163.7"	"22688.04296875"	"22889.376953125"	"21843.146484375"	"10698.5556640625"	""	"29306.41015625"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"2"	"981.47511"	"0.0001108"	"1.964E-05"	"2.53"	"54.33"
"5455"	"[K].EKVFYNIMR.[E]"	"1xBiotin [K2]; 1xOxidation [M8]"	"0.0161019"	"0.000586377"	"1"	"1"	"4"	"Q9D379"	"Q9D379 [287-295]"	"Q9D379 1xBiotin [K288]"	"epoxide hydrolase 1 [OS=Mus musculus]"	"1"	"1441.69665"	"-0.04"	"0.20"	"-0.07"	"-1.46"	"0.06"	"0.09"	"-0.14"	"109.6"	"106.8"	"125.7"	"104.2"	"39.9"	"113.9"	"23124.669921875"	"22539.740234375"	"26537.048828125"	"21987.408203125"	"8424.18359375"	"24034.150390625"	""	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"2"	"721.35177"	"0.0001108"	"0.001266"	"1.85"	"41.29"
"17207"	"[R].MDKSAVGHEYVADVEK.[H]"	"1xBiotin [K3]; 1xOxidation [M1]"	"0.000222002"	"0.000586377"	"1"	"1"	"5"	"P49710"	"P49710 [94-109]"	"P49710 1xBiotin [K96]"	"Hematopoietic lineage cell-specific protein [OS=Mus musculus]"	"1"	"2019.91504"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"0.21"	"0.39"	""	"124.7"	"110.0"	"154.6"	"66.2"	"144.4"	""	"13100.0732421875"	"11551.958984375"	"16238.6083984375"	"6951.78271484375"	"15169.8564453125"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"3"	"673.97673"	"0.0001108"	"2.401E-06"	"3.80"	"35.65"
"17115"	"[K].MCLFAGFQR.[K]"	"1xCarbamidomethyl [C2]; 1xOxidation [M1]"	"0.119536"	"0.00731053"	"1"	"2"	"3"	"Q8VEK3"	"Q8VEK3 [569-577]"	""	"Heterogeneous nuclear ribonucleoprotein U [OS=Mus musculus]"	"0"	"1145.52305"	"0.13"	"-0.06"	"0.51"	"-0.39"	"-0.38"	"-0.51"	"-0.32"	"99.9"	"109.6"	"95.7"	"141.9"	"76.2"	"76.7"	"21319.080078125"	"23378.8828125"	"20427.783203125"	"30276.759765625"	"16262.556640625"	"16373.1015625"	""	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"2"	"573.26471"	"0.001478"	"0.02529"	"1.51"	"40.62"
"5458"	"[R].EKVISFIENSSTPVDR.[H]"	"1xBiotin [K2]"	"0.00467894"	"0.000586377"	"1"	"1"	"5"	"Q8K0F1"	"Q8K0F1 [503-518]"	"Q8K0F1 1xBiotin [K504]"	"TBC1 domain family member 23 [OS=Mus musculus]"	"1"	"2047.01647"	"-9.97"	"0.10"	"-0.61"	"-9.97"	"0.25"	"9.97"	"0.15"	"153.3"	""	"164.0"	"100.4"	""	"182.3"	"21079.470703125"	""	"22541.455078125"	"13800.240234375"	""	"25062.048828125"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"683.01023"	"0.0001108"	"0.000206"	"3.44"	"50.44"
"17083"	"[R].MAYNNIQKSNFGNQSPSTSRPQSAIHHPNEPSVK.[I]"	"1xBiotin [K8]; 1xOxidation [M1]"	"2.68638E-06"	"0.000586377"	"1"	"2"	"29"	"Q921T2-1"	"Q921T2-1 [314-347]"	"Q921T2-1 1xBiotin [K321]"	"Torsin-1A-interacting protein 1 [OS=Mus musculus]"	"1"	"4007.88754"	"0.17"	"0.06"	"-0.18"	"-2.22"	"0.06"	"-0.11"	"0.00"	"113.0"	"127.4"	"117.9"	"99.7"	"24.3"	"117.7"	"1248529.57226563"	"1406775.98730469"	"1302604.078125"	"1100913.25195313"	"268040.7890625"	"1300604.234375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"4"	"1002.72733"	"0.0001108"	"3.838E-09"	"4.94"	"32.09"
"17082"	"[R].MAYNNIQKSNFGNQSPSTSRPQSAIHHPNEPSVK.[I]"	"1xBiotin [K8]"	"3.18137E-06"	"0.000586377"	"1"	"2"	"18"	"Q921T2-1"	"Q921T2-1 [314-347]"	"Q921T2-1 1xBiotin [K321]"	"Torsin-1A-interacting protein 1 [OS=Mus musculus]"	"1"	"3991.89263"	"1.09"	"0.86"	"0.07"	"-2.37"	"1.04"	"-0.05"	"0.19"	"72.8"	"154.8"	"131.7"	"76.7"	"14.1"	"149.8"	"376594.1796875"	"800610.65625"	"681180.078125"	"396392"	"73082.513671875"	"774542"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"4"	"998.72818"	"0.0001108"	"4.923E-09"	"6.24"	"33.75"
"5463"	"[R].EKVVPLYGR.[G]"	"1xBiotin [K2]"	"0.0238243"	"0.00104877"	"1"	"1"	"5"	"O35445"	"O35445 [74-82]"	"O35445 1xBiotin [K75]"	"E3 ubiquitin-protein ligase RNF5 [OS=Mus musculus]"	"1"	"1286.69255"	"0.53"	"0.25"	"0.37"	"0.41"	"0.68"	"0.14"	"0.42"	"76.3"	"110.4"	"91.0"	"98.7"	"101.7"	"121.9"	"48328.73046875"	"69866.390625"	"57591.953125"	"62497.1171875"	"64374.33984375"	"77205.40625"	""	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"2"	"643.85008"	"0.0001873"	"0.002253"	"2.18"	"40.25"
"5824"	"[R].ELSKTYIIGELHPDDR.[S]"	"1xBiotin [K4]"	"6.4861E-05"	"0.000586377"	"1"	"1"	"18"	"P56395"	"P56395 [74-89]"	"P56395 1xBiotin [K77]"	"Cytochrome b5 [OS=Mus musculus]"	"1"	"2112.04302"	"0.42"	"0.46"	"-1.35"	"-4.54"	"0.61"	"0.18"	"0.14"	"105.8"	"141.8"	"145.6"	"41.5"	"4.5"	"160.9"	"361442.44921875"	"484510.65625"	"497498.3984375"	"141956.731445313"	"15534.6904296875"	"549780.27734375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"1056.52506"	"0.0001108"	"3.997E-07"	"4.00"	"50.09"
"17640"	"[R-].MGCVKSR.[F]"	"1xBiotin [K5]; 1xCarbamidomethyl [C3]; 1xOxidation [M1]"	"0.0382889"	"0.00104877"	"1"	"2"	"6"	"P08103-1"	"P08103-1 [22-28]"	"P08103-1 1xBiotin [K26]"	"Tyrosine-protein kinase HCK [OS=Mus musculus]"	"1"	"1079.47947"	"0.02"	"-0.06"	"0.23"	"-1.29"	"0.04"	"0.02"	"0.09"	"107.6"	"109.0"	"103.5"	"125.7"	"43.8"	"110.4"	"23131.7890625"	"23451.259765625"	"22251.822265625"	"27036.83203125"	"9427.4892578125"	"23746.310546875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"540.24355"	"0.0001873"	"0.00453"	"2.45"	"20.04"
"5846"	"[R].EISTDGLGGGDCLKKPGGAGEAR.[L]"	"1xBiotin [K14]; 1xCarbamidomethyl [C12]"	"1.68635E-05"	"0.000586377"	"1"	"1"	"9"	"O35083"	"O35083 [262-284]"	"O35083 1xBiotin [K275]"	"1-acyl-sn-glycerol-3-phosphate acyltransferase alpha [OS=Mus musculus]"	"1"	"2471.16533"	"0.53"	"0.35"	"0.67"	"0.35"	"0.41"	"-0.12"	"0.06"	"75.9"	"109.3"	"96.6"	"120.6"	"96.7"	"100.9"	"41231.6484375"	"59346.5537109375"	"52469.7795410156"	"65515.0009765625"	"52520.2421875"	"54778.26171875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"824.39410"	"0.0001108"	"5.585E-08"	"4.81"	"36.40"
"16436"	"[R].LVEIDNGKQR.[E]"	"1xBiotin [K8]"	"0.001942"	"0.000586377"	"1"	"3"	"6"	"P48678-1"	"P48678-1 [226-235]"	"P48678-1 1xBiotin [K233]"	"Prelamin-A/C [OS=Mus musculus]"	"1"	"1397.72056"	"0.19"	"0.14"	"-0.04"	"0.25"	"0.33"	"0.14"	"0.20"	"90.2"	"103.0"	"99.0"	"87.5"	"106.9"	"113.4"	"25824.712890625"	"29500.6875"	"28363.060546875"	"25066.58984375"	"30632.9296875"	"32473.427734375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"699.36391"	"0.0001108"	"5.723E-05"	"3.09"	"32.80"
"16194"	"[K].LTEPAPVPIHKLSVSNMVHTAK.[K]"	"1xBiotin [K11]"	"0.00711164"	"0.000586377"	"1"	"1"	"6"	"Q80UJ7"	"Q80UJ7 [367-388]"	"Q80UJ7 1xBiotin [K377]"	"Rab3 GTPase-activating protein catalytic subunit [OS=Mus musculus]"	"1"	"2595.37856"	""	"9.97"	""	""	"9.97"	"9.97"	"-0.02"	""	""	"302.4"	""	""	"297.6"	""	""	"48083.51953125"	""	""	"47326.8515625"	""	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"4"	"649.59979"	"0.0001108"	"0.0003805"	"2.53"	"44.36"
"16146"	"[R].ISVYYNEATGGKYVPR.[A]"	"1xBiotin [K12]"	"4.70641E-05"	"0.000586377"	"1"	"1"	"7"	"P99024"	"P99024 [47-62]"	"P99024 1xBiotin [K58]"	"tubulin beta-5 chain [OS=Mus musculus]"	"1"	"2043.00042"	""	"9.97"	"9.97"	""	"9.97"	"9.97"	"-1.33"	""	""	"341.8"	"121.8"	""	"136.4"	""	""	"26314.7119140625"	"9376.8017578125"	""	"10503.423828125"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"2"	"1022.00284"	"0.0001108"	"2.509E-07"	"3.22"	"42.58"
"16144"	"[K].LSVTKPVLQSATR.[S]"	"1xBiotin [K5]"	"0.000404762"	"0.000586377"	"1"	"1"	"5"	"F6VAN0"	"F6VAN0 [273-285]"	"F6VAN0 1xBiotin [K277]"	"Cyclic AMP-dependent transcription factor ATF-6 alpha [OS=Mus musculus]"	"0"	"1625.90434"	"-0.14"	"0.08"	"0.23"	"-0.72"	"-0.05"	"0.09"	"-0.13"	"105.1"	"95.5"	"111.0"	"123.0"	"63.6"	"101.6"	"19912.775390625"	"18099.3984375"	"21033.650390625"	"23306.111328125"	"12048.3125"	"19254.462890625"	""	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"2"	"813.45582"	"0.0001108"	"5.786E-06"	"2.64"	"42.30"
"16127"	"[R].LSVDYGKK.[S]"	"1xBiotin [K]"	"0.0286231"	"0.00104877"	"1"	"5"	"5"	"P05213"	"P05213 [157-164]"	"P05213 1xBiotin [K]"	"Tubulin alpha-1B chain [OS=Mus musculus]"	"1"	"1135.58161"	"0.70"	"0.63"	"1.06"	"0.80"	"0.75"	"0.06"	"0.13"	"62.0"	"100.6"	"95.6"	"129.3"	"108.1"	"104.5"	"13217.2578125"	"21448.6953125"	"20384.3984375"	"27569.326171875"	"23064.935546875"	"22293.275390625"	""	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"2"	"568.29445"	"0.0001873"	"0.002956"	"2.08"	"33.74"
"6106"	"[K].ENPKVVNEINIEDLCLTKAAYCR.[C]"	"1xBiotin [K18]; 2xCarbamidomethyl [C15; C22]"	"0.000144195"	"0.000586377"	"1"	"1"	"3"	"Q9CQB5"	"Q9CQB5 [78-100]"	"Q9CQB5 1xBiotin [K95]"	"CDGSH iron-sulfur domain-containing protein 2 [OS=Mus musculus]"	"2"	"2975.44236"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"992.48548"	"0.0001108"	"1.283E-06"	"4.46"	""
"16101"	"[K].LSSYEQKIK.[E]"	"1xBiotin [K7]"	"0.00418918"	"0.000586377"	"1"	"2"	"9"	"Q8BI84-1"	"Q8BI84-1 [1261-1269]"	"Q8BI84-1 1xBiotin [K1267]"	"Transport and Golgi organization protein 1 homolog [OS=Mus musculus]"	"1"	"1321.68205"	"-0.20"	"-0.29"	"0.27"	"0.22"	"0.01"	"0.21"	"0.31"	"98.9"	"86.3"	"80.7"	"119.0"	"115.3"	"99.8"	"168249.71875"	"146709.265625"	"137316.140625"	"202343.59375"	"196063.453125"	"169659.765625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"661.34448"	"0.0001108"	"0.0001758"	"3.14"	"34.74"
"16098"	"[K].ISSTLYQATAPVLTPAKITGK.[G]"	"1xBiotin [K]"	"0.000117573"	"0.000586377"	"1"	"1"	"11"	"Q5RL79"	"Q5RL79 [111-131]"	"Q5RL79 1xBiotin [K]"	"Keratinocyte-associated protein 2 [OS=Mus musculus]"	"1"	"2386.30504"	"0.27"	"0.61"	"0.33"	"-9.97"	"0.25"	"-0.02"	"-0.36"	"97.2"	"117.1"	"148.0"	"122.4"	""	"115.4"	"41002.28125"	"49370.3515625"	"62405.623046875"	"51597.1162109375"	""	"48646.55859375"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"2"	"1193.65805"	"0.0001108"	"9.554E-07"	"3.15"	"50.88"
"16094"	"[K].LSSQLSEEKWNSVPPASAGK.[R]"	"1xBiotin [K9]"	"0.00313117"	"0.000586377"	"1"	"1"	"3"	"Q80WJ7"	"Q80WJ7 [292-311]"	"Q80WJ7 1xBiotin [K300]"	"protein LYRIC [OS=Mus musculus]"	"1"	"2341.14927"	"-0.39"	"-0.98"	"-0.16"	"-0.91"	"-0.09"	"0.30"	"0.89"	"129.3"	"98.9"	"65.6"	"116.0"	"68.6"	"121.6"	"19731.4116210938"	"15101.59765625"	"10016.896484375"	"17699.32421875"	"10466.185546875"	"18562.662109375"	""	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"3"	"781.05452"	"0.0001108"	"0.0001152"	"1.62"	"42.67"
"16195"	"[K].LTEPAPVPIHKLSVSNMVHTAK.[K]"	"1xBiotin [K11]; 1xOxidation [M17]"	"0.000156461"	"0.000586377"	"1"	"1"	"10"	"Q80UJ7"	"Q80UJ7 [367-388]"	"Q80UJ7 1xBiotin [K377]"	"Rab3 GTPase-activating protein catalytic subunit [OS=Mus musculus]"	"1"	"2611.37347"	"-0.86"	"-0.46"	"-0.31"	"-9.97"	"-0.81"	"0.06"	"-0.35"	"164.1"	"90.2"	"119.3"	"132.7"	""	"93.8"	"195340.27734375"	"107357.1640625"	"141997.94140625"	"157959.048828125"	""	"111645.4921875"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"4"	"653.59872"	"0.0001108"	"1.441E-06"	"4.12"	"39.74"
"6179"	"[R].EPEGVKTTFWQR.[W]"	"1xBiotin [K6]"	"0.00132963"	"0.000586377"	"1"	"2"	"6"	"Q7TN58"	"Q7TN58 [58-69]"	"Q7TN58 1xBiotin [K63]"	"Transmembrane channel-like protein 8 [OS=Mus musculus]"	"1"	"1703.82100"	""	"9.97"	"9.97"	"9.97"	""	""	"-9.97"	""	""	"276.1"	"204.7"	"119.2"	""	""	""	"7449.568359375"	"5522.525390625"	"3215.23828125"	""	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"852.41448"	"0.0001108"	"3.291E-05"	"2.19"	"45.52"
"16065"	"[K].LSSAEETAFQTPKPSQTPSVPPLVKTSLFSPK.[L]"	"1xBiotin [K]"	"2.44707E-06"	"0.000586377"	"1"	"1"	"18"	"Q8VCB1"	"Q8VCB1 [405-436]"	"Q8VCB1 1xBiotin [K]"	"Nucleoporin Ndc1 [OS=Mus musculus]"	"1"	"3625.88221"	"-0.66"	"-0.37"	"-3.58"	"-9.97"	"0.07"	"0.73"	"0.44"	"169.4"	"107.3"	"131.3"	"14.2"	""	"177.7"	"349801.21875"	"221582.953125"	"271097.390625"	"29242.220703125"	""	"366934.515625"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"1209.29827"	"0.0001108"	"3.337E-09"	"5.92"	"54.55"
"6383"	"[K].EQIKWSLLR.[-]"	"1xBiotin [K4]"	"0.00314946"	"0.000586377"	"1"	"1"	"12"	"P61924"	"P61924 [169-177]"	"P61924 1xBiotin [K172]"	"Coatomer subunit zeta-1 [OS=Mus musculus]"	"1"	"1398.75622"	"0.43"	"-0.08"	"-0.94"	"-2.53"	"0.30"	"-0.13"	"0.38"	"114.9"	"155.0"	"108.7"	"59.9"	"19.9"	"141.6"	"531929.375"	"717480.0625"	"503262.28125"	"277476.75"	"92046.796875"	"655384.5625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"699.88176"	"0.0001108"	"0.0001154"	"2.93"	"51.40"
"16039"	"[K].LSPSWESSKPR.[K]"	"1xBiotin [K9]"	"0.00397538"	"0.000586377"	"1"	"2"	"6"	"Q62312"	"Q62312 [222-232]"	"Q62312 1xBiotin [K230]"	"TGF-beta receptor type-2 [OS=Mus musculus]"	"0"	"1499.73112"	"1.28"	"1.02"	"-0.33"	"0.86"	"-0.89"	"-2.17"	"-1.92"	"69.7"	"169.2"	"141.8"	"55.3"	"126.6"	"37.5"	"8933.880859375"	"21701.2265625"	"18179.3159179688"	"7089.12451171875"	"16235.5629882813"	"4808.6201171875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"750.36973"	"0.0001108"	"0.0001629"	"1.82"	"37.80"
"6398"	"[R].EQLVQKAR.[L]"	"1xBiotin [K6]"	"0.0923936"	"0.00379267"	"1"	"1"	"2"	"P61982"	"P61982 [5-12]"	"P61982 1xBiotin [K10]"	"14-3-3 protein gamma [OS=Mus musculus]"	"1"	"1197.64085"	""	""	""	"9.97"	""	""	""	""	""	""	""	"600.0"	""	""	""	""	""	"5267.89306640625"	""	""	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"2"	"599.32302"	"0.0008081"	"0.01706"	"2.21"	"31.26"
"6407"	"[K].EQNKIGVK.[L]"	"1xBiotin [K4]"	"0.0505185"	"0.00154748"	"1"	"1"	"5"	"Q9D0V7"	"Q9D0V7 [204-211]"	"Q9D0V7 1xBiotin [K207]"	"Receptor-binding cancer antigen expressed on SiSo cells [OS=Mus musculus]"	"1"	"1141.60340"	"0.34"	"0.57"	"0.47"	"0.71"	"0.55"	"0.21"	"-0.02"	"73.0"	"92.2"	"108.3"	"100.7"	"119.0"	"106.8"	"32532.54296875"	"41084.484375"	"48301.48828125"	"44909.48046875"	"53047.76953125"	"47619.81640625"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"2"	"571.30542"	"0.0002716"	"0.006868"	"2.43"	"29.40"
"15985"	"[R].LSLGLKCDWFTLEK.[R]"	"1xBiotin [K6]; 1xCarbamidomethyl [C7]"	"0.000782241"	"0.000586377"	"1"	"1"	"4"	"Q60664"	"Q60664 [201-214]"	"Q60664 1xBiotin [K206]"	"Lymphoid-restricted membrane protein [OS=Mus musculus]"	"1"	"1935.97070"	"1.79"	"-0.03"	"-9.97"	"-9.97"	"1.00"	"-0.80"	"1.03"	"80.6"	"279.6"	"78.7"	""	""	"161.0"	"18203.5625"	"63123.69140625"	"17772.0859375"	""	""	"36337.2734375"	""	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"2"	"968.48855"	"0.0001108"	"1.513E-05"	"3.07"	"59.68"
"15971"	"[R].LSKTPQK.[S]"	"1xBiotin [K3]"	"0.0433774"	"0.00104877"	"1"	"3"	"6"	"Q3ZK22-1"	"Q3ZK22-1 [413-419]"	"Q3ZK22-1 1xBiotin [K415]"	"vezatin [OS=Mus musculus]"	"1"	"1027.56048"	"0.40"	"-0.52"	"-0.04"	"-0.13"	"0.33"	"-0.07"	"0.85"	"97.4"	"128.6"	"67.9"	"94.5"	"89.3"	"122.2"	"26409.791015625"	"34872.2578125"	"18406.921875"	"25620.9921875"	"24217.79296875"	"33143.6953125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"514.28394"	"0.0001873"	"0.00549"	"2.50"	"24.08"
"6414"	"[K].EQQPKVR.[G]"	"1xBiotin [K5]"	"0.0837597"	"0.00241047"	"1"	"1"	"8"	"Q9D0K1"	"Q9D0K1 [307-313]"	"Q9D0K1 1xBiotin [K311]"	"Peroxisomal membrane protein pex13 [OS=Mus musculus]"	"1"	"1110.57244"	"0.43"	"0.20"	"0.35"	"0.45"	"0.46"	"0.03"	"0.26"	"79.9"	"107.7"	"91.8"	"101.9"	"109.1"	"109.7"	"18660.69921875"	"25166.705078125"	"21453.251953125"	"23812.203125"	"25480.80078125"	"25622.095703125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"555.79008"	"0.000415"	"0.01468"	"1.96"	"21.89"
"16082"	"[K].LSSKLSAVSLR.[G]"	"1xBiotin [K4]"	"0.000878982"	"0.000586377"	"1"	"1"	"6"	"Q8BVL3"	"Q8BVL3 [432-442]"	"Q8BVL3 1xBiotin [K435]"	"Sorting nexin-17 [OS=Mus musculus]"	"1"	"1386.77735"	"0.08"	"-0.10"	"-9.97"	"-0.51"	"-0.30"	"-0.38"	"-0.20"	"133.4"	"140.6"	"124.1"	""	"93.8"	"108.1"	"19670.384765625"	"20733.673828125"	"18294.8671875"	""	"13828.703125"	"15939.884765625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"693.89136"	"0.0001108"	"1.789E-05"	"2.76"	"44.33"
"16208"	"[R].ITGAQTLPKHVSTSSDEGSPSASTPMINK.[T]"	"1xBiotin [K9]"	"6.26308E-05"	"0.000586377"	"1"	"1"	"5"	"Q8BGR2"	"Q8BGR2 [229-257]"	"Q8BGR2 1xBiotin [K237]"	"volume-regulated anion channel subunit LRRC8D [OS=Mus musculus]"	"1"	"3167.53474"	""	""	"9.97"	"9.97"	""	""	""	""	""	""	"207.9"	"392.1"	""	""	""	""	"13722.0048828125"	"25873.375"	""	""	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"3"	"1056.51746"	"0.0001108"	"3.809E-07"	"4.42"	"36.65"
"16209"	"[R].ITGAQTLPKHVSTSSDEGSPSASTPMINK.[T]"	"1xBiotin [K9]; 1xOxidation [M26]"	"3.90522E-05"	"0.000586377"	"1"	"1"	"6"	"Q8BGR2"	"Q8BGR2 [229-257]"	"Q8BGR2 1xBiotin [K237]"	"volume-regulated anion channel subunit LRRC8D [OS=Mus musculus]"	"1"	"3183.52965"	"-0.23"	"-0.12"	"0.04"	"-1.21"	"-0.40"	"-0.17"	"-0.28"	"120.1"	"102.3"	"110.8"	"123.8"	"51.9"	"91.1"	"52320.1015625"	"44543.8046875"	"48235.7578125"	"53926.6015625"	"22581.0546875"	"39693.51953125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"1061.84856"	"0.0001108"	"1.913E-07"	"4.28"	"34.83"
"16214"	"[K].ITGKGK.[K]"	"1xBiotin [K4]"	"0.109194"	"0.00731053"	"1"	"1"	"2"	"Q5RL79"	"Q5RL79 [128-133]"	"Q5RL79 1xBiotin [K131]"	"Keratinocyte-associated protein 2 [OS=Mus musculus]"	"1"	"829.46003"	"1.07"	"0.89"	"1.02"	"0.72"	"0.96"	"-0.11"	"0.07"	"56.7"	"119.2"	"105.1"	"115.2"	"93.4"	"110.3"	"36237.87890625"	"76274.640625"	"67255.859375"	"73689.3828125"	"59758.015625"	"70558.6796875"	""	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"2"	"415.23349"	"0.001426"	"0.02197"	"1.39"	"19.95"
"16400"	"[R].IVAPGKGILAADESTGSIAK.[R]"	"1xBiotin [K6]"	"5.60619E-05"	"0.000586377"	"1"	"1"	"7"	"P05064"	"P05064 [23-42]"	"P05064 1xBiotin [K28]"	"fructose-bisphosphate aldolase A [OS=Mus musculus]"	"1"	"2124.13692"	"-9.97"	"0.99"	"0.90"	"-0.43"	"-0.66"	"9.97"	"-1.66"	"96.3"	""	"191.7"	"179.7"	"71.4"	"60.9"	"13417.0029296875"	""	"26710.658203125"	"25039.484375"	"9943.22998046875"	"8479.6376953125"	""	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"2"	"1062.57284"	"0.0001108"	"3.238E-07"	"3.04"	"46.46"
"16380"	"[K].LTWASVELGSSTSLETSIQLCGLIR.[A]"	"1xCarbamidomethyl [C21]"	"0.00528695"	"0.000586377"	"1"	"1"	"3"	"P56873"	"P56873 [161-185]"	""	"Sjoegren syndrome/scleroderma autoantigen 1 homolog [OS=Mus musculus]"	"0"	"2721.41276"	"-1.67"	"-0.53"	"-1.48"	"-1.54"	"-0.55"	"1.12"	"-0.02"	"177.0"	"55.6"	"122.2"	"63.6"	"61.0"	"120.5"	"11514.224609375"	"3617.74072265625"	"7950.9287109375"	"4140.92041015625"	"3971.65698242188"	"7842.56787109375"	""	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"3"	"907.80718"	"0.0001108"	"0.0002462"	"3.50"	"61.15"
"16363"	"[R].LTTPVFGKGVAYDVPNAIFLEQK.[K]"	"1xBiotin [K8]"	"0.000295426"	"0.000586377"	"1"	"1"	"4"	"Q8K0C4"	"Q8K0C4 [134-156]"	"Q8K0C4 1xBiotin [K141]"	"lanosterol 14-alpha demethylase [OS=Mus musculus]"	"1"	"2733.43203"	"-0.19"	"-0.33"	"-9.97"	"-9.97"	"0.39"	"0.58"	"0.72"	"150.5"	"132.3"	"119.8"	""	""	"197.4"	"30734.529296875"	"27014.234375"	"24454.935546875"	""	""	"40293.50390625"	""	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"911.81656"	"0.0001108"	"3.658E-06"	"4.77"	"59.31"
"16355"	"[K].LTSSSEKALANQFLAPGR.[V]"	"1xBiotin [K7]"	"3.3169E-05"	"0.000586377"	"1"	"2"	"13"	"Q9CQ56"	"Q9CQ56 [88-105]"	"Q9CQ56 1xBiotin [K94]"	"Vesicle transport protein USE1 [OS=Mus musculus]"	"1"	"2116.08555"	"0.40"	"0.50"	"0.10"	"-2.06"	"0.57"	"0.17"	"0.07"	"91.8"	"121.3"	"130.2"	"98.2"	"22.1"	"136.4"	"83613.921875"	"110560.396484375"	"118647.216796875"	"89469.275390625"	"20118.1840820313"	"124283.82421875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"1058.54666"	"0.0001108"	"1.502E-07"	"4.84"	"49.81"
"16346"	"[R].LTSIKSTTLR.[V]"	"1xBiotin [K5]"	"0.00504656"	"0.000586377"	"1"	"2"	"6"	"O55143-1"	"O55143-1 [165-174]"	"O55143-1 1xBiotin [K169]"	"Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 [OS=Mus musculus]"	"1"	"1345.75080"	"-0.02"	"-0.18"	"-0.21"	"-9.97"	"-9.97"	"-9.97"	"-9.97"	"160.8"	"158.0"	"142.0"	"139.2"	""	""	"17612.453125"	"17309.90234375"	"15552.6494140625"	"15253.728515625"	""	""	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"673.37895"	"0.0001108"	"0.0002299"	"2.24"	"37.72"
"16311"	"[K].LTPLVLKPFGNSVSVYNGEPEHMEKNATPYK.[D]"	"2xBiotin [K7; K25]; 1xOxidation [M23]"	"0.000660557"	"0.000586377"	"1"	"1"	"7"	"Q3U9G9"	"Q3U9G9 [127-157]"	"Q3U9G9 2xBiotin [K133; K151]"	"Lamin-B receptor [OS=Mus musculus]"	"1"	"3927.91181"	"-0.37"	"0.69"	"-9.97"	"-9.97"	"0.06"	"0.43"	"-0.63"	"135.5"	"105.1"	"218.3"	""	""	"141.2"	"56980.02734375"	"44206.32421875"	"91830.6796875"	""	""	"59375.41015625"	""	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"4"	"982.73321"	"0.0001108"	"1.18E-05"	"4.18"	"54.53"
"16309"	"[K].LTPLVLKPFGNSVSVYNGEPEHMEK.[N]"	"1xBiotin [K]; 1xOxidation [M23]"	"3.9475E-06"	"0.000586377"	"1"	"1"	"67"	"Q3U9G9"	"Q3U9G9 [127-151]"	"Q3U9G9 1xBiotin [K]"	"Lamin-B receptor [OS=Mus musculus]"	"0"	"3027.49544"	"-0.25"	"-0.33"	"-2.40"	"-5.67"	"0.33"	"0.58"	"0.67"	"146.2"	"123.2"	"116.1"	"27.6"	"2.9"	"184.1"	"14369782.9145508"	"12109251.3027344"	"11411149.2397461"	"2714463.05175781"	"281809.674804688"	"18102510.9829102"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"1009.83716"	"0.0001108"	"6.733E-09"	"3.83"	"53.12"
"16308"	"[K].LTPLVLKPFGNSVSVYNGEPEHMEK.[N]"	"1xBiotin [K7]"	"6.66604E-07"	"0.000586377"	"1"	"1"	"17"	"Q3U9G9"	"Q3U9G9 [127-151]"	"Q3U9G9 1xBiotin [K133]"	"Lamin-B receptor [OS=Mus musculus]"	"0"	"3011.50053"	"0.01"	"-0.04"	"-3.08"	"-9.97"	"0.44"	"0.43"	"0.48"	"135.0"	"135.5"	"130.9"	"15.9"	""	"182.6"	"2056533.359375"	"2065352.875"	"1994666.578125"	"242979.118164063"	""	"2782650.046875"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"1004.50585"	"0.0001108"	"5.017E-10"	"5.60"	"53.98"
"5851"	"[K].EITALAPSTMKIK.[I]"	"1xBiotin [K11]; 1xOxidation [M10]"	"0.000246571"	"0.000586377"	"1"	"6"	"7"	"P60710"	"P60710 [316-328]"	"P60710 1xBiotin [K326]"	"Actin, cytoplasmic 1 [OS=Mus musculus]"	"1"	"1644.86993"	"-0.07"	"0.10"	"-0.20"	"-1.25"	"0.10"	"0.17"	"0.00"	"111.4"	"106.0"	"119.7"	"96.7"	"46.8"	"119.4"	"60596.03125"	"57657.11328125"	"65105.3203125"	"52583.60546875"	"25469.23046875"	"64927.32421875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"822.93922"	"0.0001108"	"2.816E-06"	"3.65"	"39.90"
"16275"	"[K].ITITNDKGR.[L]"	"1xBiotin [K7]"	"0.00525629"	"0.000586377"	"1"	"5"	"17"	"P63017"	"P63017 [501-509]"	"P63017 1xBiotin [K507]"	"Heat shock cognate 71 kDa protein [OS=Mus musculus]"	"1"	"1243.64633"	"0.10"	"0.30"	"0.33"	"0.45"	"0.27"	"0.17"	"-0.03"	"84.1"	"90.1"	"103.5"	"105.9"	"114.8"	"101.6"	"302749.8125"	"324270.776367188"	"372458.9375"	"381060.021484375"	"413028.982421875"	"365775.526367188"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"622.32677"	"0.0001108"	"0.0002458"	"3.17"	"31.49"
"16259"	"[R].LTLKGTQK.[K]"	"1xBiotin [K4]"	"0.0301356"	"0.00104877"	"1"	"1"	"3"	"O35166"	"O35166 [156-163]"	"O35166 1xBiotin [K159]"	"Golgi SNAP receptor complex member 2 [OS=Mus musculus]"	"1"	"1114.62889"	"0.56"	"0.34"	"0.40"	"0.25"	"0.24"	"-0.32"	"-0.10"	"80.7"	"119.1"	"102.0"	"106.8"	"95.9"	"95.4"	"24435.994140625"	"36046.19921875"	"30875.904296875"	"32343.412109375"	"29042.076171875"	"28880.033203125"	""	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"2"	"557.81796"	"0.0001873"	"0.003179"	"2.09"	"32.88"
"5878"	"[K].ELVDKNIDR.[F]"	"1xBiotin [K5]"	"0.00625808"	"0.000586377"	"1"	"2"	"4"	"Q9CX30-1"	"Q9CX30-1 [91-99]"	"Q9CX30-1 1xBiotin [K95]"	"Protein YIF1B [OS=Mus musculus]"	"1"	"1327.66746"	"0.83"	"-9.97"	"-9.97"	"-9.97"	"-9.97"	"-9.97"	""	"216.2"	"383.8"	""	""	""	""	"8089.1884765625"	"14358.6455078125"	""	""	""	""	""	"High"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"High"	"2"	"664.33713"	"0.0001108"	"0.0003173"	"2.45"	"36.33"
"5888"	"[K].ELVLKSAVEAER.[L]"	"1xBiotin [K5]"	"0.000134449"	"0.000586377"	"1"	"1"	"9"	"Q91YQ5"	"Q91YQ5 [561-572]"	"Q91YQ5 1xBiotin [K565]"	"Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 [OS=Mus musculus]"	"1"	"1569.83050"	"0.36"	"0.21"	"-0.12"	"-0.57"	"0.40"	"0.04"	"0.19"	"94.5"	"120.9"	"109.3"	"86.9"	"63.5"	"124.7"	"209192.78125"	"267734.96875"	"242045.3125"	"192476.390625"	"140641.53125"	"276104.28125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"785.41905"	"0.0001108"	"1.155E-06"	"3.70"	"45.54"
"16237"	"[R].LTKGNSPSVLER.[L]"	"1xBiotin [K3]"	"0.00135308"	"0.000586377"	"1"	"1"	"4"	"Q8VDU0"	"Q8VDU0 [573-584]"	"Q8VDU0 1xBiotin [K575]"	"G-protein-signaling modulator 2 [OS=Mus musculus]"	"1"	"1526.79954"	""	""	""	"9.97"	"9.97"	"9.97"	"9.97"	""	""	""	""	"319.3"	"280.7"	""	""	""	""	"11645.28515625"	"10239.4697265625"	""	"High"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"High"	"2"	"763.90373"	"0.0001108"	"3.384E-05"	"1.86"	"35.39"
"5944"	"[K].EMFGGFFKSVVK.[S]"	"1xBiotin [K8]; 1xOxidation [M2]"	"0.021606"	"0.00104877"	"1"	"1"	"1"	"Q9D8U8"	"Q9D8U8 [181-192]"	"Q9D8U8 1xBiotin [K188]"	"sorting nexin-5 [OS=Mus musculus]"	"1"	"1617.78038"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"809.39378"	"0.0001873"	"0.001948"	"1.78"	""
"5946"	"[R].EMFGLYGQTTGKGSVSLK.[E]"	"1xBiotin [K12]; 1xOxidation [M2]"	"1.66679E-05"	"0.000586377"	"1"	"1"	"10"	"Q9CQC9"	"Q9CQC9 [149-166]"	"Q9CQC9 1xBiotin [K160]"	"GTP-binding protein SAR1b [OS=Mus musculus]"	"1"	"2145.03549"	"0.03"	"-0.20"	"-0.45"	"-3.71"	"-0.18"	"-0.21"	"0.02"	"130.7"	"133.9"	"114.0"	"96.0"	"10.0"	"115.4"	"71311.541015625"	"73056.7890625"	"62177.771484375"	"52342.201171875"	"5432.00634765625"	"62954.5078125"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"2"	"1073.02207"	"0.0001108"	"5.486E-08"	"4.41"	"44.84"
"16227"	"[R].ITGSVGKGLAAITMDK.[E]"	"1xBiotin [K7]; 1xOxidation [M14]"	"3.59906E-05"	"0.000586377"	"1"	"3"	"10"	"Q8BX70-1"	"Q8BX70-1 [3476-3491]"	"Q8BX70-1 1xBiotin [K3482]"	"Vacuolar protein sorting-associated protein 13C [OS=Mus musculus]"	"1"	"1803.93432"	"-9.97"	"-0.56"	"-0.50"	"-2.45"	"0.36"	"9.97"	"0.92"	"155.5"	""	"105.7"	"110.3"	"28.5"	"199.9"	"25164.6669921875"	""	"17112.09375"	"17852.900390625"	"4617.37890625"	"32360.5556640625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"902.47183"	"0.0001108"	"1.689E-07"	"3.62"	"44.97"
"16222"	"[R].LTGNFKHASSILPITEFSDITR.[R]"	"1xBiotin [K6]"	"2.47355E-07"	"0.000586377"	"1"	"3"	"18"	"Q61029"	"Q61029 [297-318]"	"Q61029 1xBiotin [K302]"	"Lamina-associated polypeptide 2, isoforms beta/delta/epsilon/gamma [OS=Mus musculus]"	"1"	"2673.37050"	"-0.07"	"0.13"	"-4.83"	"-9.97"	"0.57"	"0.64"	"0.45"	"131.3"	"125.1"	"143.5"	"4.6"	""	"195.5"	"865264.056640625"	"823971.625"	"945516.473632813"	"30423.658203125"	""	"1287698.07617188"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"891.79531"	"0.0001108"	"1.182E-10"	"5.58"	"55.47"
"6005"	"[R].EMTESQMMIHSKASNGR.[-]"	"1xBiotin [K12]; 3xOxidation [M2; M7; M8]"	"0.0157341"	"0.000586377"	"1"	"1"	"2"	"Q3U6B2"	"Q3U6B2 [341-357]"	"Q3U6B2 1xBiotin [K352]"	"G-protein coupled receptor 183 [OS=Mus musculus]"	"1"	"2210.92972"	"-1.17"	"-9.97"	"0.14"	"-9.97"	"-0.24"	"0.93"	"9.97"	"177.1"	"78.5"	""	"194.5"	""	"149.9"	"9167.8193359375"	"4065.96630859375"	""	"10070.1513671875"	""	"7763.12744140625"	""	"High"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"3"	"737.64912"	"0.0001108"	"0.001227"	"1.93"	"23.57"
"16439"	"[K].IVEIPFNSTNKYQLSIHK.[N]"	"1xBiotin [K11]"	"0.0537403"	"0.0019826"	"1"	"1"	"3"	"Q8VDN2"	"Q8VDN2 [477-494]"	"Q8VDN2 1xBiotin [K487]"	"Sodium/potassium-transporting ATPase subunit alpha-1 [OS=Mus musculus]"	"1"	"2357.23221"	"-9.97"	"0.26"	"-9.97"	"-9.97"	"0.54"	"9.97"	"0.28"	"164.2"	""	"197.0"	""	""	"238.9"	"5210.2626953125"	""	"6249.736328125"	""	""	"7579.30078125"	""	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"786.41454"	"0.0003442"	"0.007528"	"2.79"	"48.41"
"15967"	"[R].LSKSGENPEQDEAQK.[N]"	"1xBiotin [K3]"	"3.25645E-06"	"0.000586377"	"1"	"1"	"69"	"Q61263"	"Q61263 [7-21]"	"Q61263 1xBiotin [K9]"	"sterol O-acyltransferase 1 [OS=Mus musculus]"	"1"	"1885.85963"	"0.47"	"0.13"	"0.07"	"0.31"	"0.32"	"-0.15"	"0.19"	"85.5"	"118.3"	"93.7"	"89.5"	"106.2"	"106.7"	"1780636.47363281"	"2464175.15185547"	"1950267.68554688"	"1864499.8203125"	"2211070.13085938"	"2222622.91308594"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"943.43394"	"0.0001108"	"5.08E-09"	"4.39"	"27.49"
"17732"	"[R].MGPGATAGGAEKSNVK.[I]"	"1xBiotin [K12]"	"2.00695E-06"	"0.000586377"	"1"	"1"	"11"	"P62821"	"P62821 [176-191]"	"P62821 1xBiotin [K187]"	"Ras-related protein Rab-1A [OS=Mus musculus]"	"1"	"1700.80945"	"0.74"	"0.45"	"0.51"	"1.51"	"0.75"	"0.01"	"0.29"	"60.0"	"100.3"	"82.1"	"85.6"	"171.3"	"100.7"	"30946.9453125"	"51703.375"	"42342.82421875"	"44130.7578125"	"88359.09375"	"51933.43359375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"850.90830"	"0.0001108"	"2.5E-09"	"4.03"	"28.46"
"17790"	"[K].MHASKR.[D]"	"1xBiotin [K5]"	"0.128026"	"0.00949852"	"1"	"1"	"6"	"Q99LI2"	"Q99LI2 [415-420]"	"Q99LI2 1xBiotin [K419]"	"chloride channel CLIC-like protein 1 [OS=Mus musculus]"	"1"	"955.46005"	"1.84"	"1.34"	"1.22"	"2.69"	"1.58"	"-0.26"	"0.23"	"31.7"	"113.7"	"80.6"	"73.9"	"205.3"	"94.7"	"12051.029296875"	"43161.6640625"	"30603.3125"	"28040.3359375"	"77940.25"	"35949.875"	""	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"2"	"478.23329"	"0.001921"	"0.02813"	"1.51"	"16.01"
"4756"	"[R].EEAAPPTPAPDDLAQLKNLR.[S]"	"1xBiotin [K17]"	"1.31115E-06"	"0.000586377"	"1"	"1"	"8"	"Q80WJ7"	"Q80WJ7 [90-109]"	"Q80WJ7 1xBiotin [K106]"	"protein LYRIC [OS=Mus musculus]"	"1"	"2372.19147"	"0.17"	"0.11"	"-0.61"	"-2.80"	"0.64"	"0.47"	"0.52"	"107.9"	"121.3"	"116.7"	"70.8"	"15.5"	"167.8"	"37160.73046875"	"41787.29296875"	"40209.95703125"	"24383.146484375"	"5331.61865234375"	"57818.265625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"791.40230"	"0.0001108"	"1.34E-09"	"5.40"	"51.92"
"19267"	"[K].NATPYKDKQER.[I]"	"2xBiotin [K6; K8]"	"0.00744997"	"0.000586377"	"1"	"1"	"6"	"Q3U9G9"	"Q3U9G9 [152-162]"	"Q3U9G9 2xBiotin [K157; K159]"	"Lamin-B receptor [OS=Mus musculus]"	"2"	"1801.83600"	"9.97"	"9.97"	""	"9.97"	""	"-9.97"	"-9.97"	""	"220.8"	"191.6"	""	"187.6"	""	""	"15905.6025390625"	"13802.35546875"	""	"13516.9052734375"	""	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"901.42205"	"0.0001108"	"0.000408"	"2.56"	"34.58"
"9686"	"[K].HEKPPQ.[-]"	"1xBiotin [K3]"	"0.0730042"	"0.00241047"	"1"	"1"	"4"	"P20491"	"P20491 [81-86]"	"P20491 1xBiotin [K83]"	"High affinity immunoglobulin epsilon receptor subunit gamma [OS=Mus musculus]"	"0"	"961.45601"	"1.60"	"1.33"	"1.16"	"1.27"	"0.51"	"-1.09"	"-0.82"	"47.5"	"144.6"	"119.4"	"105.9"	"114.9"	"67.7"	"29292.42578125"	"89098.91796875"	"73588.625"	"65266.466796875"	"70818.4765625"	"41710.82421875"	""	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"2"	"481.23156"	"0.000415"	"0.0119"	"1.66"	"18.93"
"19265"	"[K].NATPYKDK.[Q]"	"1xBiotin [K]"	"0.0333984"	"0.00104877"	"1"	"1"	"18"	"Q3U9G9"	"Q3U9G9 [152-159]"	"Q3U9G9 1xBiotin [K]"	"Lamin-B receptor [OS=Mus musculus]"	"1"	"1162.55612"	"0.45"	"0.36"	"0.54"	"0.43"	"0.57"	"0.12"	"0.22"	"75.7"	"103.4"	"96.8"	"110.0"	"101.7"	"112.4"	"351219.46875"	"480052.379882813"	"449374.6875"	"510659.961425781"	"472230.894042969"	"521715.627685547"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"581.78165"	"0.0001873"	"0.003718"	"2.21"	"25.26"
"19225"	"[K].NAKGGGGNSSSSGSGSGSGSGSPSTGSSGSSSSPGAR.[R]"	"1xBiotin [K3]"	"0.0224937"	"0.00104877"	"1"	"1"	"6"	"Q8BSY0"	"Q8BSY0 [6-42]"	"Q8BSY0 1xBiotin [K8]"	"Aspartyl/Asparaginyl beta-hydroxylase [OS=Mus musculus]"	"1"	"3271.37482"	"-9.97"	"0.74"	"0.74"	"0.39"	"-9.97"	""	"-9.97"	"106.1"	""	"177.8"	"177.4"	"138.8"	""	"6901.451171875"	""	"11566.498046875"	"11538.0693359375"	"9026.3857421875"	""	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"1091.13000"	"0.0001873"	"0.002066"	"2.84"	"19.39"
"19214"	"[K].NAGGEKMEK.[M]"	"1xBiotin [K6]; 1xOxidation [M7]"	"0.0213588"	"0.00104877"	"1"	"1"	"3"	"Q3U9N9-1"	"Q3U9N9-1 [480-488]"	"Q3U9N9-1 1xBiotin [K485]"	"Monocarboxylate transporter 10 [OS=Mus musculus]"	"1"	"1205.52892"	"0.66"	"0.51"	"0.79"	"-0.68"	"0.61"	"-0.06"	"0.10"	"76.0"	"120.4"	"108.5"	"131.7"	"47.5"	"115.9"	"4241.56005859375"	"6723.6845703125"	"6056.15478515625"	"7351.8759765625"	"2652.60766601563"	"6471.857421875"	""	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"2"	"603.26849"	"0.0001873"	"0.001922"	"1.77"	"16.75"
"19212"	"[K].NAGAVIGKGGK.[N]"	"1xBiotin [K8]"	"0.0148506"	"0.000586377"	"1"	"3"	"2"	"P61979"	"P61979 [53-63]"	"P61979 1xBiotin [K60]"	"Heterogeneous nuclear ribonucleoprotein K [OS=Mus musculus]"	"1"	"1197.64085"	"0.66"	"0.65"	"0.42"	"0.45"	"-9.97"	"-9.97"	"-9.97"	"87.5"	"138.3"	"137.2"	"117.4"	"119.6"	""	"7596.3388671875"	"12006.537109375"	"11909.1552734375"	"10193.775390625"	"10379.76171875"	""	""	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"2"	"599.32432"	"0.0001108"	"0.001124"	"2.61"	"29.71"
"19209"	"[K].NAFTEEVTKSMR.[N]"	"1xBiotin [K9]; 1xOxidation [M11]"	"0.00121831"	"0.000586377"	"1"	"1"	"6"	"Q9CXR1"	"Q9CXR1 [244-255]"	"Q9CXR1 1xBiotin [K252]"	"Dehydrogenase/reductase SDR family member 7 [OS=Mus musculus]"	"1"	"1654.75635"	"-0.53"	"-0.10"	"-0.02"	"-9.97"	"0.14"	"0.67"	"0.24"	"127.1"	"88.0"	"118.7"	"125.6"	""	"140.5"	"14251.806640625"	"9866.3271484375"	"13308.4931640625"	"14081.2001953125"	""	"15746.0126953125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"827.88251"	"0.0001108"	"2.89E-05"	"2.61"	"38.67"
"19373"	"[R].NEGEDKIFLINK.[L]"	"1xBiotin [K6]"	"0.00114264"	"0.000586377"	"1"	"3"	"6"	"Q7TN60"	"Q7TN60 [758-769]"	"Q7TN60 1xBiotin [K763]"	"Transmembrane channel-like protein 6 [OS=Mus musculus]"	"1"	"1645.82542"	"0.56"	"-9.97"	"0.46"	"0.36"	"-9.97"	"-9.97"	""	"116.8"	"172.2"	""	"160.8"	"150.2"	""	"9867.13671875"	"14538.41015625"	""	"13576.630859375"	"12683.9482421875"	""	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"823.41573"	"0.0001108"	"2.631E-05"	"2.96"	"47.49"
"4860"	"[R].EEFIQKHGK.[G]"	"1xBiotin [K6]"	"0.0267216"	"0.00104877"	"1"	"1"	"5"	"Q9DBG7"	"Q9DBG7 [214-222]"	"Q9DBG7 1xBiotin [K219]"	"signal recognition particle receptor subunit alpha [OS=Mus musculus]"	"1"	"1341.66198"	"0.72"	"-0.25"	"-0.01"	"0.95"	"0.55"	"-0.16"	"0.80"	"76.2"	"125.1"	"64.1"	"75.9"	"146.9"	"111.9"	"7449.85107421875"	"12232.0966796875"	"6268.63330078125"	"7415.95263671875"	"14358.849609375"	"10936.330078125"	""	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"2"	"671.33477"	"0.0001873"	"0.002679"	"1.95"	"30.26"
"19179"	"[R].MYSSYSVEPKK.[L]"	"1xBiotin [K10]"	"0.00109058"	"0.000586377"	"1"	"1"	"6"	"Q8VCB1"	"Q8VCB1 [394-404]"	"Q8VCB1 1xBiotin [K403]"	"Nucleoporin Ndc1 [OS=Mus musculus]"	"1"	"1544.71236"	"0.24"	"-0.16"	"-9.97"	"0.91"	"0.33"	"0.09"	"0.49"	"96.6"	"114.0"	"86.4"	""	"181.8"	"121.2"	"12280.158203125"	"14504.193359375"	"10983.1103515625"	""	"23118.638671875"	"15419.8876953125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"772.85911"	"0.0001108"	"2.468E-05"	"2.98"	"34.57"
"19099"	"[R].MWGKTENGGGSR.[V]"	"1xBiotin [K4]; 1xOxidation [M1]"	"6.15446E-05"	"0.000586377"	"1"	"2"	"16"	"Q3UVK0"	"Q3UVK0 [45-56]"	"Q3UVK0 1xBiotin [K48]"	"Endoplasmic reticulum metallopeptidase 1 [OS=Mus musculus]"	"1"	"1521.65731"	"-0.15"	"0.01"	"-0.13"	"-0.59"	"0.10"	"0.24"	"0.08"	"107.9"	"97.4"	"109.0"	"98.8"	"71.6"	"115.3"	"181092.234375"	"163510.168457031"	"182845.828125"	"165762.640625"	"120190.06640625"	"193546.03125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"761.33216"	"0.0001108"	"3.698E-07"	"2.32"	"31.20"
"19098"	"[R].MWGKTENGGGSR.[V]"	"1xBiotin [K4]"	"0.000360207"	"0.000586377"	"1"	"2"	"7"	"Q3UVK0"	"Q3UVK0 [45-56]"	"Q3UVK0 1xBiotin [K48]"	"Endoplasmic reticulum metallopeptidase 1 [OS=Mus musculus]"	"1"	"1505.66239"	"0.74"	"0.48"	"0.30"	"1.27"	"0.60"	"-0.14"	"0.12"	"65.0"	"108.6"	"90.7"	"79.8"	"157.2"	"98.7"	"47313.1875"	"78977.9140625"	"65986.1875"	"58050.48828125"	"114374.78125"	"71793.5"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"753.33476"	"0.0001108"	"4.896E-06"	"2.64"	"34.97"
"4907"	"[K].EEIPEFSKIQTTAPPVK.[E]"	"1xBiotin [K8]"	"0.00707044"	"0.000586377"	"1"	"1"	"5"	"P37040"	"P37040 [49-65]"	"P37040 1xBiotin [K56]"	"NADPH--cytochrome P450 reductase [OS=Mus musculus]"	"1"	"2140.09947"	"9.97"	"9.97"	"9.97"	""	"9.97"	"0.04"	"0.05"	""	"144.9"	"143.8"	"162.3"	""	"148.9"	""	"15909.623046875"	"15790.3662109375"	"17816.56640625"	""	"16347.6767578125"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"714.03788"	"0.0001108"	"0.0003791"	"2.57"	"47.96"
"4942"	"[R].EEPSVAPTSTGKTFQPGSWTPEDGKR.[Q]"	"1xBiotin [K12]"	"0.00399858"	"0.000586377"	"1"	"1"	"4"	"Q59J78"	"Q59J78 [140-165]"	"Q59J78 1xBiotin [K151]"	"NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 2 [OS=Mus musculus]"	"2"	"3015.41527"	"9.97"	"9.97"	"9.97"	""	"9.97"	"-0.25"	"0.36"	""	"187.6"	"123.5"	"130.6"	""	"158.3"	""	"21234.298828125"	"13980.4228515625"	"14775.9560546875"	""	"17908.41796875"	""	"High"	"Peak Found"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"1005.80973"	"0.0001108"	"0.0001639"	"3.06"	"41.77"
"19041"	"[R].MVIVGKISFCPK.[D]"	"1xBiotin [K6]; 1xCarbamidomethyl [C10]; 1xOxidation [M1]"	"0.00110337"	"0.000586377"	"1"	"1"	"3"	"Q9EQY0"	"Q9EQY0 [563-574]"	"Q9EQY0 1xBiotin [K568]"	"Serine/threonine-protein kinase/endoribonuclease IRE1 [OS=Mus musculus]"	"1"	"1620.83104"	"-0.27"	"0.04"	"-0.04"	"-9.97"	"0.11"	"0.38"	"0.07"	"122.1"	"101.3"	"125.7"	"118.9"	""	"132.1"	"7798.958984375"	"6475.03173828125"	"8030.07421875"	"7595.31396484375"	""	"8439.3017578125"	""	"High"	"Peak Found"	"High"	"High"	"Not Found"	"Peak Found"	"High"	"2"	"810.91899"	"0.0001108"	"2.503E-05"	"2.85"	"47.32"
"4973"	"[K].EESTEASASKR.[L]"	"1xBiotin [K10]"	"0.000712571"	"0.000586377"	"1"	"2"	"12"	"Q9D8V0-1"	"Q9D8V0-1 [362-372]"	"Q9D8V0-1 1xBiotin [K371]"	"Minor histocompatibility antigen H13 [OS=Mus musculus]"	"1"	"1420.63728"	"0.80"	"0.57"	"0.78"	"1.07"	"0.68"	"-0.12"	"0.11"	"62.3"	"108.2"	"92.1"	"107.2"	"130.7"	"99.4"	"48747"	"84716.5703125"	"72121.38671875"	"83961.96484375"	"102341.163085938"	"77835.416015625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"710.82264"	"0.0001108"	"1.321E-05"	"3.19"	"21.01"
"18985"	"[-].MVAKQR.[I]"	"1xAcetyl [N-Term]; 1xBiotin [K4]"	"0.0928964"	"0.00379267"	"1"	"3"	"8"	"Q9Z1W5"	"Q9Z1W5 [1-6]"	"Q9Z1W5 1xAcetyl [N-Term]; 1xBiotin [K4]"	"Stress-associated endoplasmic reticulum protein 1 [OS=Mus musculus]"	"1"	"1000.50667"	"0.99"	"0.71"	"0.29"	"1.99"	"0.55"	"-0.45"	"-0.17"	"53.2"	"105.7"	"87.1"	"64.8"	"211.6"	"77.6"	"110295.296875"	"219296.125"	"180552.1875"	"134401.25"	"438986.875"	"160940"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"500.75675"	"0.0008081"	"0.01725"	"1.88"	"35.66"
"19196"	"[K].NADPILISLKHGYIPGK.[N]"	"1xBiotin [K10]"	"0.0140162"	"0.000586377"	"1"	"1"	"4"	"Q9WUM4"	"Q9WUM4 [382-398]"	"Q9WUM4 1xBiotin [K391]"	"coronin-1C [OS=Mus musculus]"	"1"	"2062.11539"	"0.02"	"0.29"	"-9.97"	"-9.97"	"0.41"	"0.39"	"0.12"	"131.2"	"133.4"	"160.4"	""	""	"174.9"	"19563.55859375"	"19887.462890625"	"23913.3984375"	""	""	"26076.646484375"	""	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"688.04330"	"0.0001108"	"0.001028"	"2.38"	"52.75"
"19427"	"[K].NFGIGQDIQPKR.[D]"	"1xBiotin [K11]"	"0.0104922"	"0.000586377"	"1"	"1"	"2"	"P12970"	"P12970 [38-49]"	"P12970 1xBiotin [K48]"	"60S ribosomal protein L7a [OS=Mus musculus]"	"1"	"1598.81077"	""	""	""	"9.97"	""	""	""	""	""	""	""	"600.0"	""	""	""	""	""	"6656.99658203125"	""	""	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"2"	"799.90927"	"0.0001108"	"0.0006768"	"2.04"	"40.92"
"19428"	"[K].NFGIWLR.[Y]"	""	"0.0726021"	"0.00241047"	"1"	"1"	"6"	"P62717"	"P62717 [77-83]"	""	"60S ribosomal protein L18a [OS=Mus musculus]"	"0"	"905.49920"	"0.40"	"0.22"	"0.45"	"0.37"	"0.44"	"0.05"	"0.23"	"80.1"	"105.3"	"93.0"	"109.6"	"103.3"	"108.7"	"65934.8671875"	"86734.03125"	"76559.3046875"	"90285.484375"	"85029.609375"	"89540.25"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"453.25301"	"0.000415"	"0.01183"	"2.43"	"47.45"
"4716"	"[R].EDSVKPGAHLTVKK.[I]"	"1xBiotin [K13]"	"0.00124705"	"0.000586377"	"1"	"2"	"5"	"Q8BG05"	"Q8BG05 [114-127]"	"Q8BG05 1xBiotin [K126]"	"Heterogeneous nuclear ribonucleoprotein A3 [OS=Mus musculus]"	"1"	"1734.92072"	"-0.04"	"-0.32"	"-0.32"	"-0.05"	"-0.17"	"-0.12"	"0.15"	"110.5"	"107.2"	"88.7"	"88.3"	"107.0"	"98.3"	"22573.744140625"	"21903.7890625"	"18127.9765625"	"18036.287109375"	"21872.255859375"	"20089.599609375"	""	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"3"	"578.97875"	"0.0001108"	"2.997E-05"	"3.59"	"27.59"
"19640"	"[K].NKSAQTSGLK.[Q]"	"1xBiotin [K2]"	"0.00232645"	"0.000586377"	"1"	"1"	"5"	"Q9QYC7"	"Q9QYC7 [20-29]"	"Q9QYC7 1xBiotin [K21]"	"vitamin K-dependent gamma-carboxylase [OS=Mus musculus]"	"1"	"1259.64125"	"-0.11"	"-0.57"	"-0.12"	"0.02"	"-0.59"	"-0.48"	"-0.03"	"115.4"	"106.6"	"78.0"	"106.4"	"117.3"	"76.5"	"27723.677734375"	"25602.248046875"	"18732.970703125"	"25560.9140625"	"28175.052734375"	"18370.208984375"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"2"	"630.32429"	"0.0001108"	"7.459E-05"	"1.91"	"24.38"
"4326"	"[R].EAEFTKSIAK.[F]"	"1xBiotin [K6]"	"0.0296229"	"0.00104877"	"1"	"1"	"2"	"Q9CYN2"	"Q9CYN2 [186-195]"	"Q9CYN2 1xBiotin [K191]"	"Signal peptidase complex subunit 2 [OS=Mus musculus]"	"1"	"1349.67696"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"2"	"675.34139"	"0.0001873"	"0.003102"	"2.11"	""
"19618"	"[K].NKMLFSHLEGPESPR.[Y]"	"1xBiotin [K2]; 1xOxidation [M3]"	"1.19542E-05"	"0.000586377"	"1"	"1"	"16"	"Q9JHL0-1"	"Q9JHL0-1 [83-97]"	"Q9JHL0-1 1xBiotin [K84]"	"Linker for activation of T-cells family member 2 [OS=Mus musculus]"	"1"	"1983.94153"	"0.07"	"0.15"	"-0.47"	"-1.78"	"0.15"	"0.09"	"0.01"	"113.6"	"118.8"	"125.9"	"82.2"	"33.1"	"126.4"	"151548.140625"	"158597.6640625"	"168066.715820313"	"109744.9765625"	"44130.1484375"	"168678.875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"661.98552"	"0.0001108"	"3.401E-08"	"4.31"	"41.06"
"19617"	"[K].NKMLFSHLEGPESPR.[Y]"	"1xBiotin [K2]"	"2.90056E-05"	"0.000586377"	"1"	"1"	"5"	"Q9JHL0-1"	"Q9JHL0-1 [83-97]"	"Q9JHL0-1 1xBiotin [K84]"	"Linker for activation of T-cells family member 2 [OS=Mus musculus]"	"1"	"1967.94661"	"0.92"	"0.64"	"-0.25"	"-9.97"	"0.42"	"-0.50"	"-0.22"	"90.4"	"171.2"	"141.1"	"76.0"	""	"121.3"	"21651.90625"	"41002.23046875"	"33806.23828125"	"18206.48046875"	""	"29064.650390625"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"656.65382"	"0.0001108"	"1.24E-07"	"4.30"	"43.56"
"4379"	"[K].EALELLKTAIAK.[A]"	"1xBiotin [K7]"	"0.000233964"	"0.000586377"	"1"	"1"	"5"	"P17182"	"P17182 [222-233]"	"P17182 1xBiotin [K228]"	"alpha-enolase [OS=Mus musculus]"	"1"	"1525.86583"	"0.23"	"-0.14"	"-0.58"	"-9.97"	"-0.28"	"-0.51"	"-0.14"	"131.0"	"154.0"	"119.2"	"87.6"	""	"108.2"	"20952.314453125"	"24621.9140625"	"19070.361328125"	"14011.5654296875"	""	"17299.677734375"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"2"	"763.43601"	"0.0001108"	"2.608E-06"	"3.82"	"54.52"
"19607"	"[R].NKIISIFSGTEK.[G]"	"1xBiotin [K2]"	"7.63654E-05"	"0.000586377"	"1"	"1"	"29"	"Q8CIN4"	"Q8CIN4 [51-62]"	"Q8CIN4 1xBiotin [K52]"	"Serine/threonine-protein kinase PAK 2 [OS=Mus musculus]"	"1"	"1562.82469"	"0.36"	"0.12"	"-0.40"	"-1.97"	"0.23"	"-0.14"	"0.11"	"108.0"	"138.9"	"117.3"	"81.9"	"27.5"	"126.4"	"944136.0859375"	"1214584.18066406"	"1025711.78125"	"715968.26171875"	"240396.978515625"	"1104890.0703125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"781.91604"	"0.0001108"	"5.06E-07"	"3.70"	"51.50"
"19604"	"[K].NKLENKMEGIGLK.[K]"	"1xBiotin [K6]; 1xOxidation [M7]"	"3.55733E-05"	"0.000586377"	"1"	"1"	"22"	"Q8R5J9"	"Q8R5J9 [146-158]"	"Q8R5J9 1xBiotin [K151]"	"PRA1 family protein 3 [OS=Mus musculus]"	"2"	"1715.88189"	"-0.26"	"-0.49"	"-0.17"	"-2.12"	"-0.24"	"0.02"	"0.25"	"132.9"	"111.2"	"94.6"	"118.1"	"30.5"	"112.7"	"226191.98828125"	"189293.984375"	"161057.8359375"	"201080.787109375"	"51890.4438476563"	"191786.598632813"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"572.63203"	"0.0001108"	"1.667E-07"	"3.91"	"34.43"
"19603"	"[K].NKLENKMEGIGLK.[K]"	"1xBiotin [K6]"	"1.87299E-05"	"0.000586377"	"1"	"1"	"12"	"Q8R5J9"	"Q8R5J9 [146-158]"	"Q8R5J9 1xBiotin [K151]"	"PRA1 family protein 3 [OS=Mus musculus]"	"2"	"1699.88697"	"0.62"	"0.47"	"-0.15"	"-1.04"	"0.22"	"-0.40"	"-0.25"	"92.7"	"142.4"	"128.2"	"83.5"	"45.1"	"108.0"	"103405.6328125"	"158823.38671875"	"142983.62109375"	"93149.458984375"	"50237.30859375"	"120476.3515625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"567.30050"	"0.0001108"	"6.507E-08"	"3.96"	"44.16"
"19591"	"[K].NKGDSHLNVQVSNFKSGK.[G]"	"1xBiotin [K]"	"0.00137695"	"0.000586377"	"1"	"1"	"5"	"Q80WJ7"	"Q80WJ7 [246-263]"	"Q80WJ7 1xBiotin [K]"	"protein LYRIC [OS=Mus musculus]"	"2"	"2185.08186"	"-9.97"	"1.10"	"-9.97"	"0.90"	"1.44"	"9.97"	"0.34"	"77.6"	""	"166.8"	""	"145.0"	"210.5"	"25194.11328125"	""	"54118.9296875"	""	"47061.423828125"	"68313.26171875"	""	"High"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"3"	"729.03281"	"0.0001108"	"3.445E-05"	"4.21"	"35.29"
"19590"	"[K].NKGDSHLNVQVSNFK.[S]"	"1xBiotin [K2]"	"6.75634E-05"	"0.000586377"	"1"	"1"	"9"	"Q80WJ7"	"Q80WJ7 [246-260]"	"Q80WJ7 1xBiotin [K247]"	"protein LYRIC [OS=Mus musculus]"	"1"	"1912.93341"	"0.67"	"0.26"	"0.03"	"0.15"	"0.55"	"-0.12"	"0.29"	"81.3"	"129.6"	"97.5"	"82.7"	"89.9"	"119.1"	"55009.1328125"	"87744.4921875"	"65998.984375"	"55987.92578125"	"60831.10546875"	"80589.15625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"638.31596"	"0.0001108"	"4.239E-07"	"3.81"	"36.37"
"4396"	"[K].EAIQAYSESLMSPAAKGTVLQEAK.[L]"	"1xBiotin [K16]"	"4.75736E-06"	"0.000586377"	"1"	"1"	"5"	"Q61009"	"Q61009 [485-508]"	"Q61009 1xBiotin [K500]"	"Scavenger receptor class B member 1 [OS=Mus musculus]"	"1"	"2748.35828"	"0.65"	"0.50"	"-0.81"	"-9.97"	"0.77"	"0.12"	"0.27"	"95.8"	"150.3"	"135.8"	"54.7"	""	"163.5"	"42932.43359375"	"67352.421875"	"60869.1640625"	"24496.70703125"	""	"73288.3671875"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"916.78958"	"0.0001108"	"8.823E-09"	"4.67"	"52.33"
"4397"	"[K].EAIQAYSESLMSPAAKGTVLQEAK.[L]"	"1xBiotin [K16]; 1xOxidation [M11]"	"1.1343E-05"	"0.000586377"	"1"	"1"	"15"	"Q61009"	"Q61009 [485-508]"	"Q61009 1xBiotin [K500]"	"Scavenger receptor class B member 1 [OS=Mus musculus]"	"1"	"2764.35319"	"0.07"	"-0.07"	"-0.53"	"-2.60"	"0.14"	"0.08"	"0.21"	"120.9"	"126.5"	"115.4"	"83.7"	"20.0"	"133.6"	"199806.890625"	"209173.828125"	"190734.609375"	"138372.46875"	"32990.19921875"	"220794.875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"922.12271"	"0.0001108"	"3.129E-08"	"5.62"	"47.12"
"19565"	"[R].NKALGVAVGGGADGSR.[D]"	"1xBiotin [K2]"	"2.49249E-05"	"0.000586377"	"1"	"3"	"8"	"Q8VDS8-1"	"Q8VDS8-1 [20-35]"	"Q8VDS8-1 1xBiotin [K21]"	"Syntaxin-18 [OS=Mus musculus]"	"1"	"1654.83296"	"0.58"	"0.17"	"0.56"	"0.69"	"0.81"	"0.23"	"0.63"	"71.0"	"105.8"	"80.1"	"104.5"	"114.4"	"124.2"	"34435.26171875"	"51340.3037109375"	"38844.2900390625"	"50694.798828125"	"55474.7275390625"	"60242.037109375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"827.91967"	"0.0001108"	"9.942E-08"	"2.91"	"36.16"
"4407"	"[R].EALTKQGYQLIGSHSGVK.[L]"	"1xBiotin [K5]"	"8.57358E-06"	"0.000586377"	"1"	"1"	"15"	"Q8BJM7-1"	"Q8BJM7-1 [351-368]"	"Q8BJM7-1 1xBiotin [K355]"	"S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase [OS=Mus musculus]"	"1"	"2142.10120"	"0.48"	"0.50"	"0.34"	"-0.63"	"0.42"	"-0.06"	"-0.07"	"85.0"	"118.9"	"119.9"	"107.3"	"55.0"	"114.0"	"525134.4375"	"734556.244140625"	"740759.4375"	"663305.0625"	"339939.42578125"	"704384.052734375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"714.70485"	"0.0001108"	"2.092E-08"	"5.07"	"40.40"
"19543"	"[K].NHFKGGQSGLSQSK.[N]"	"1xBiotin [K4]"	"3.1473E-05"	"0.000586377"	"1"	"2"	"24"	"Q60848-1"	"Q60848-1 [733-746]"	"Q60848-1 1xBiotin [K736]"	"Lymphocyte-specific helicase [OS=Mus musculus]"	"1"	"1700.81731"	"0.81"	"0.29"	"0.95"	"0.61"	"0.71"	"-0.09"	"0.42"	"66.2"	"115.7"	"80.7"	"127.8"	"101.2"	"108.4"	"320590.65234375"	"560539.296875"	"390986.46875"	"618845.869628906"	"490083.17578125"	"524909.0859375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"850.91248"	"0.0001108"	"1.39E-07"	"4.07"	"25.45"
"4453"	"[R].EASAQEDAKGVGR.[M]"	"1xBiotin [K9]"	"1.8298E-05"	"0.000586377"	"1"	"2"	"23"	"Q3UVK0"	"Q3UVK0 [32-44]"	"Q3UVK0 1xBiotin [K40]"	"Endoplasmic reticulum metallopeptidase 1 [OS=Mus musculus]"	"1"	"1543.71693"	"0.20"	"0.40"	"0.27"	"0.35"	"0.44"	"0.24"	"0.04"	"82.1"	"94.4"	"108.1"	"99.1"	"104.8"	"111.5"	"1029473.38574219"	"1183003.29003906"	"1355756.67822266"	"1241858.31787109"	"1314278.66308594"	"1397250.07958984"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"772.36208"	"0.0001108"	"6.329E-08"	"3.60"	"26.59"
"4465"	"[R].EATKGFYDK.[D]"	"1xBiotin [K4]"	"0.0131519"	"0.000586377"	"1"	"1"	"6"	"Q62167"	"Q62167 [47-55]"	"Q62167 1xBiotin [K50]"	"ATP-dependent RNA helicase DDX3X [OS=Mus musculus]"	"1"	"1284.59290"	"0.55"	"-9.97"	"0.34"	"1.02"	"0.60"	"0.04"	"9.97"	"82.5"	"120.9"	""	"104.4"	"167.4"	"124.7"	"19354.166015625"	"28365.009765625"	""	"24497.119140625"	"39263.6875"	"29241.54296875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"642.80014"	"0.0001108"	"0.0009415"	"2.09"	"33.27"
"19446"	"[R].NFSDNQLQEGKNVIGLQMGTNR.[G]"	"1xBiotin [K11]; 1xOxidation [M18]"	"4.78947E-05"	"0.000586377"	"1"	"1"	"9"	"Q9WVA4"	"Q9WVA4 [161-182]"	"Q9WVA4 1xBiotin [K171]"	"Transgelin-2 [OS=Mus musculus]"	"1"	"2705.27701"	"0.39"	"0.19"	"0.17"	"-1.98"	"0.33"	"-0.07"	"0.14"	"98.6"	"129.5"	"112.1"	"111.2"	"24.9"	"123.7"	"77365.875"	"101666.359375"	"88011.9296875"	"87321.1796875"	"19543.97265625"	"97061.421875"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"3"	"902.43116"	"0.0001108"	"2.573E-07"	"3.12"	"46.43"
"19445"	"[R].NFSDNQLQEGKNVIGLQMGTNR.[G]"	"1xBiotin [K11]"	"0.00014087"	"0.000586377"	"1"	"1"	"3"	"Q9WVA4"	"Q9WVA4 [161-182]"	"Q9WVA4 1xBiotin [K171]"	"Transgelin-2 [OS=Mus musculus]"	"1"	"2689.28209"	"9.97"	""	""	""	"9.97"	"-0.21"	"9.97"	""	"322.2"	""	""	""	"277.8"	""	"45004.703125"	""	""	""	"38812.3046875"	""	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"3"	"897.09921"	"0.0001108"	"1.236E-06"	"3.21"	"50.90"
"18955"	"[R].MTNQKIR.[I]"	"1xBiotin [K5]; 1xOxidation [M1]"	"0.027975"	"0.00104877"	"1"	"1"	"16"	"Q9CYN9"	"Q9CYN9 [342-348]"	"Q9CYN9 1xBiotin [K346]"	"Renin receptor [OS=Mus musculus]"	"1"	"1132.56016"	"-0.20"	"-0.06"	"-0.06"	"-1.37"	"-0.04"	"0.16"	"0.03"	"116.6"	"101.5"	"111.7"	"111.5"	"45.1"	"113.6"	"150905.28125"	"131470.40625"	"144572.046875"	"144399.828125"	"58365.9765625"	"147120.796875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"566.78377"	"0.0001873"	"0.002857"	"2.09"	"23.42"
"17733"	"[R].MGPGATAGGAEKSNVK.[I]"	"1xBiotin [K12]; 1xOxidation [M1]"	"6.14896E-06"	"0.000586377"	"1"	"1"	"16"	"P62821"	"P62821 [176-191]"	"P62821 1xBiotin [K187]"	"Ras-related protein Rab-1A [OS=Mus musculus]"	"1"	"1716.80437"	"0.01"	"-0.19"	"0.40"	"-0.92"	"-0.08"	"-0.09"	"0.11"	"105.5"	"106.6"	"92.8"	"139.2"	"55.9"	"99.9"	"84448.037109375"	"85330.541015625"	"74236.58984375"	"111422.29296875"	"44726.9970703125"	"79946.3359375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"858.90570"	"0.0001108"	"1.279E-08"	"3.83"	"25.48"
"18954"	"[R].MTNQKIR.[I]"	"1xBiotin [K5]"	"0.0332084"	"0.00104877"	"1"	"1"	"9"	"Q9CYN9"	"Q9CYN9 [342-348]"	"Q9CYN9 1xBiotin [K346]"	"Renin receptor [OS=Mus musculus]"	"1"	"1116.56524"	"1.11"	"1.24"	"0.42"	"1.47"	"0.77"	"-0.34"	"-0.47"	"53.0"	"114.4"	"125.1"	"70.9"	"146.5"	"90.1"	"49720.984375"	"107387.6015625"	"117460"	"66574.953125"	"137525.0625"	"84623.3828125"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"2"	"558.78628"	"0.0001873"	"0.00367"	"2.17"	"26.45"
"5005"	"[K].EFDGKSLVSVTK.[E]"	"1xBiotin [K5]"	"0.00175884"	"0.000586377"	"1"	"1"	"6"	"P11499"	"P11499 [527-538]"	"P11499 1xBiotin [K531]"	"Heat shock protein HSP 90-beta [OS=Mus musculus]"	"1"	"1535.77741"	"9.97"	""	"9.97"	"9.97"	""	"-9.97"	""	""	"212.7"	""	"229.9"	"157.4"	""	""	"12824.220703125"	""	"13865.33203125"	"9489.3681640625"	""	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"768.39194"	"0.0001108"	"4.939E-05"	"2.71"	"43.55"
"5300"	"[R].EKAPSLFSSR.[I]"	"1xBiotin [K2]"	"0.00614989"	"0.000586377"	"1"	"1"	"12"	"Q9R1C6"	"Q9R1C6 [388-397]"	"Q9R1C6 1xBiotin [K389]"	"Diacylglycerol kinase epsilon [OS=Mus musculus]"	"1"	"1347.67255"	"0.43"	"0.15"	"0.05"	"-0.39"	"0.27"	"-0.17"	"0.12"	"92.9"	"125.5"	"102.9"	"96.3"	"70.8"	"111.7"	"136960.421875"	"185071.734375"	"151663.953125"	"141919.46875"	"104374.1484375"	"164679.65625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"674.33993"	"0.0001108"	"0.0003074"	"2.37"	"39.87"
"5301"	"[K].EKATAASLTIPR.[N]"	"1xBiotin [K2]"	"0.000104022"	"0.000586377"	"1"	"2"	"17"	"Q9R233"	"Q9R233 [448-459]"	"Q9R233 1xBiotin [K449]"	"Tapasin [OS=Mus musculus]"	"1"	"1483.79372"	"-0.28"	"0.06"	"-0.12"	"-0.52"	"-0.46"	"-0.19"	"-0.52"	"115.2"	"95.2"	"119.9"	"105.8"	"80.5"	"83.5"	"364577.11328125"	"301265.015625"	"379399.09375"	"334928.3671875"	"254705.2421875"	"264172.9765625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"742.40086"	"0.0001108"	"8E-07"	"3.01"	"39.38"
"17925"	"[-].MKPKLMYQELK.[V]"	"1xBiotin [K4]; 2xOxidation [M1; M6]"	"0.00130658"	"0.000586377"	"1"	"1"	"5"	"O35405"	"O35405 [1-11]"	"O35405 1xBiotin [K4]"	"Phospholipase D3 [OS=Mus musculus]"	"1"	"1666.83652"	"-0.25"	"-0.21"	"0.06"	"-9.97"	"0.20"	"0.45"	"0.41"	"122.5"	"103.0"	"106.1"	"127.4"	""	"141.0"	"18718.185546875"	"15745.9365234375"	"16222.4638671875"	"19466.091796875"	""	"21550.453125"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"556.28352"	"0.0001108"	"3.206E-05"	"2.80"	"33.31"
"17911"	"[R].MKLSHPE.[-]"	"1xBiotin [K2]; 1xOxidation [M1]"	"0.0441201"	"0.00104877"	"1"	"1"	"4"	"Q9DC37"	"Q9DC37 [458-464]"	"Q9DC37 1xBiotin [K459]"	"major facilitator superfamily domain-containing protein 1 [OS=Mus musculus]"	"1"	"1083.49616"	"-0.18"	"-0.20"	"0.22"	"-0.76"	"0.12"	"0.30"	"0.33"	"107.3"	"94.6"	"93.1"	"125.0"	"63.2"	"116.8"	"13739.41015625"	"12108.103515625"	"11927.1748046875"	"16010.583984375"	"8092.79345703125"	"14953.55859375"	""	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"2"	"542.25146"	"0.0001873"	"0.005613"	"1.56"	"25.26"
"17900"	"[K].MKLGVQVVITDPEKLDQIR.[Q]"	"1xBiotin [K2]; 1xOxidation [M1]"	"1.41569E-05"	"0.000586377"	"1"	"2"	"2"	"P11983"	"P11983 [246-264]"	"P11983 1xBiotin [K247]"	"T-complex protein 1 subunit alpha [OS=Mus musculus]"	"2"	"2424.29891"	"-9.97"	"0.15"	"-9.97"	"-9.97"	"-9.97"	""	"-9.97"	"284.5"	""	"315.5"	""	""	""	"8056.24951171875"	""	"8933.9287109375"	""	""	""	""	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"3"	"808.77139"	"0.0001108"	"4.333E-08"	"3.52"	"49.56"
"17899"	"[K].MKLGVQVVITDPEK.[L]"	"1xBiotin [K2]; 1xOxidation [M1]"	"1.16786E-05"	"0.000586377"	"1"	"2"	"7"	"P11983"	"P11983 [246-259]"	"P11983 1xBiotin [K247]"	"T-complex protein 1 subunit alpha [OS=Mus musculus]"	"1"	"1798.94415"	"0.52"	"0.10"	"-0.24"	"-2.97"	"0.05"	"-0.48"	"-0.05"	"108.8"	"156.2"	"116.7"	"92.0"	"13.9"	"112.4"	"40570.30078125"	"58250.453125"	"43494.49609375"	"34294.85546875"	"5188.55908203125"	"41902.3984375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"899.97471"	"0.0001108"	"3.263E-08"	"3.99"	"44.57"
"17898"	"[K].MKLGVQVVITDPEK.[L]"	"1xBiotin [K2]"	"0.00216935"	"0.000586377"	"1"	"2"	"4"	"P11983"	"P11983 [246-259]"	"P11983 1xBiotin [K247]"	"T-complex protein 1 subunit alpha [OS=Mus musculus]"	"1"	"1782.94924"	"0.70"	"0.88"	"-0.26"	"-9.97"	"1.06"	"0.36"	"0.18"	"81.3"	"132.1"	"149.5"	"68.0"	""	"169.1"	"8679.6650390625"	"14103.044921875"	"15957.3759765625"	"7257.81494140625"	""	"18055.5"	""	"High"	"High"	"High"	"Peak Found"	"Not Found"	"High"	"High"	"2"	"891.97810"	"0.0001108"	"6.739E-05"	"2.71"	"48.14"
"17889"	"[-].MKHYEVEIR.[D]"	"1xAcetyl [N-Term]; 1xBiotin [K2]"	"0.00111631"	"0.000586377"	"1"	"1"	"6"	"Q9CY27"	"Q9CY27 [1-9]"	"Q9CY27 1xAcetyl [N-Term]; 1xBiotin [K2]"	"Very-long-chain enoyl-CoA reductase [OS=Mus musculus]"	"1"	"1472.70247"	"1.28"	"0.90"	"0.31"	"0.90"	"0.95"	"-0.33"	"0.05"	"58.1"	"141.1"	"108.2"	"71.9"	"108.4"	"112.3"	"37060.23046875"	"89946.796875"	"68939.328125"	"45854.4453125"	"69066.3125"	"71549.296875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"736.85534"	"0.0001108"	"2.54E-05"	"3.62"	"42.61"
"5291"	"[R].EKADAVYTGLNTR.[S]"	"1xBiotin [K2]"	"0.000199881"	"0.000586377"	"1"	"1"	"20"	"P20491"	"P20491 [59-71]"	"P20491 1xBiotin [K60]"	"High affinity immunoglobulin epsilon receptor subunit gamma [OS=Mus musculus]"	"1"	"1663.81083"	"0.42"	"0.51"	"0.50"	"0.65"	"0.58"	"0.16"	"0.07"	"72.9"	"97.4"	"103.8"	"103.0"	"114.2"	"108.7"	"652472.84375"	"871940.46875"	"929432.40625"	"922551.1875"	"1023064.3125"	"973498.875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"832.40946"	"0.0001108"	"2.069E-06"	"3.26"	"38.00"
"17888"	"[-].MKHYEVEIR.[D]"	"1xBiotin [K2]; 1xOxidation [M1]"	"0.0393919"	"0.00104877"	"1"	"1"	"5"	"Q9CY27"	"Q9CY27 [1-9]"	"Q9CY27 1xBiotin [K2]"	"Very-long-chain enoyl-CoA reductase [OS=Mus musculus]"	"1"	"1446.68682"	"-0.07"	"0.08"	"-0.07"	"-0.36"	"0.18"	"0.25"	"0.10"	"102.2"	"97.4"	"107.9"	"97.3"	"79.8"	"115.5"	"41513.23046875"	"39580.24609375"	"43845.97265625"	"39538.484375"	"32414.015625"	"46942.171875"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"3"	"482.90011"	"0.0001873"	"0.004752"	"1.85"	"33.28"
"5351"	"[R].EKHFNLCLEER.[D]"	"1xBiotin [K2]; 1xCarbamidomethyl [C7]"	"7.95472E-05"	"0.000586377"	"1"	"1"	"13"	"P58681"	"P58681 [922-932]"	"P58681 1xBiotin [K923]"	"Toll-like receptor 7 [OS=Mus musculus]"	"1"	"1700.78832"	"0.49"	"-0.20"	"-0.44"	"-1.28"	"0.22"	"-0.27"	"0.42"	"107.4"	"150.7"	"93.6"	"79.0"	"44.1"	"125.3"	"194879.45703125"	"273456.00390625"	"169974.453125"	"143311.232421875"	"80031.125"	"227416.78125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"567.60093"	"0.0001108"	"5.367E-07"	"3.96"	"41.52"
"17861"	"[-].MKDDFAEEEEVQSFGYKR.[F]"	"1xBiotin [K17]; 1xOxidation [M1]"	"1.67654E-05"	"0.000586377"	"1"	"1"	"6"	"Q8K4Q8"	"Q8K4Q8 [1-18]"	"Q8K4Q8 1xBiotin [K17]"	"Collectin-12 [OS=Mus musculus]"	"2"	"2450.06389"	"0.49"	"0.49"	"0.20"	"-9.97"	"0.89"	"0.39"	"0.40"	"88.2"	"124.0"	"123.5"	"101.5"	""	"162.8"	"48814.36328125"	"68685.9140625"	"68361.5234375"	"56205.05859375"	""	"90168.9921875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"817.35951"	"0.0001108"	"5.565E-08"	"4.44"	"42.38"
"5362"	"[R].EKLCFLDK.[V]"	"1xBiotin [K2]; 1xCarbamidomethyl [C4]"	"0.00467894"	"0.000586377"	"1"	"1"	"54"	"Q9CY27"	"Q9CY27 [15-22]"	"Q9CY27 1xBiotin [K16]"	"Very-long-chain enoyl-CoA reductase [OS=Mus musculus]"	"1"	"1278.62209"	"0.21"	"-0.19"	"-0.17"	"-0.29"	"0.24"	"0.03"	"0.43"	"101.2"	"117.4"	"88.8"	"90.1"	"82.8"	"119.7"	"3136778.17236328"	"3638217.94873047"	"2752049.23046875"	"2791240.00292969"	"2566699.94921875"	"3708164.25292969"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"639.81467"	"0.0001108"	"0.0002063"	"2.61"	"44.14"
"17851"	"[R].MKALDAIR.[A]"	"1xBiotin [K2]; 1xOxidation [M1]"	"0.0351565"	"0.00104877"	"1"	"3"	"5"	"Q8R092"	"Q8R092 [104-111]"	"Q8R092 1xBiotin [K105]"	"Uncharacterized protein C1orf43 homolog [OS=Mus musculus]"	"1"	"1159.59621"	"-0.11"	"-0.37"	"0.16"	"-0.84"	"-0.25"	"-0.14"	"0.13"	"114.9"	"106.6"	"88.8"	"128.8"	"64.1"	"96.9"	"21458.626953125"	"19909.40234375"	"16582.6875"	"24052.384765625"	"11968.7080078125"	"18101.2578125"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"2"	"580.30153"	"0.0001873"	"0.004012"	"1.67"	"36.13"
"17850"	"[R].MKALDAIR.[A]"	"1xBiotin [K2]"	"0.0109903"	"0.000586377"	"1"	"3"	"4"	"Q8R092"	"Q8R092 [104-111]"	"Q8R092 1xBiotin [K105]"	"Uncharacterized protein C1orf43 homolog [OS=Mus musculus]"	"1"	"1143.60130"	"0.53"	"-9.97"	"-0.16"	"0.87"	"0.30"	"-0.23"	"9.97"	"93.9"	"135.4"	""	"84.0"	"171.2"	"115.5"	"11697.318359375"	"16863.88671875"	""	"10466.8017578125"	"21319.85546875"	"14388.0556640625"	""	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"2"	"572.30428"	"0.0001108"	"0.0007211"	"2.32"	"40.15"
"17848"	"[K].MKAFYAPVHADDLR.[E]"	"1xBiotin [K2]; 1xOxidation [M1]"	"0.000285269"	"0.000586377"	"1"	"1"	"1"	"P55012"	"P55012 [844-857]"	"P55012 1xBiotin [K845]"	"Solute carrier family 12 member 2 [OS=Mus musculus]"	"1"	"1875.88804"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"3"	"625.96753"	"0.0001108"	"3.489E-06"	"2.92"	""
"5363"	"[R].EKLCFLDKVEPQATISEIK.[T]"	"1xBiotin [K2]; 1xCarbamidomethyl [C4]"	"1.01533E-05"	"0.000586377"	"1"	"1"	"6"	"Q9CY27"	"Q9CY27 [15-33]"	"Q9CY27 1xBiotin [K16]"	"Very-long-chain enoyl-CoA reductase [OS=Mus musculus]"	"2"	"2474.26694"	"0.00"	"0.34"	"-1.68"	"-9.97"	"0.13"	"0.13"	"-0.21"	"128.4"	"128.4"	"162.7"	"40.1"	""	"140.4"	"92814.6875"	"92829.5546875"	"117581.171875"	"28971.9296875"	""	"101509"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"825.42773"	"0.0001108"	"2.675E-08"	"4.59"	"50.73"
"5364"	"[R].EKLCFLDKVEPQATISEIK.[T]"	"2xBiotin [K2; K8]; 1xCarbamidomethyl [C4]"	"0.000126833"	"0.000586377"	"1"	"1"	"4"	"Q9CY27"	"Q9CY27 [15-33]"	"Q9CY27 2xBiotin [K16; K22]"	"Very-long-chain enoyl-CoA reductase [OS=Mus musculus]"	"2"	"2700.34454"	"0.20"	"0.85"	"-9.97"	"-9.97"	"0.61"	"0.41"	"-0.24"	"109.5"	"125.8"	"197.5"	""	""	"167.2"	"20946.478515625"	"24052.69140625"	"37758.61328125"	""	""	"31980.087890625"	""	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"900.78651"	"0.0001108"	"1.06E-06"	"3.71"	"58.08"
"17873"	"[K].MKEIAEAYLGK.[T]"	"1xBiotin [K2]; 1xOxidation [M1]"	"0.000557798"	"0.000586377"	"1"	"1"	"5"	"P63017"	"P63017 [127-137]"	"P63017 1xBiotin [K128]"	"Heat shock cognate 71 kDa protein [OS=Mus musculus]"	"1"	"1494.73310"	"-9.97"	"-0.19"	"-0.12"	"-1.44"	"-0.76"	"9.97"	"-0.57"	"159.7"	""	"140.3"	"146.5"	"58.8"	"94.6"	"20912.123046875"	""	"18373.2890625"	"19182.697265625"	"7692.99658203125"	"12386.27734375"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"2"	"747.87035"	"0.0001108"	"9.273E-06"	"3.14"	"40.72"
"5290"	"[R].EKAASFLNADGPK.[D]"	"1xBiotin [K2]"	"0.000684074"	"0.000586377"	"1"	"1"	"7"	"A2AAY5"	"A2AAY5 [836-848]"	"A2AAY5 1xBiotin [K837]"	"SH3 and PX domain-containing protein 2B [OS=Mus musculus]"	"1"	"1573.76790"	"0.21"	"-0.02"	"-0.03"	"0.00"	"0.30"	"0.08"	"0.32"	"94.5"	"109.7"	"93.0"	"92.3"	"94.2"	"116.2"	"78373.2421875"	"90952.15625"	"77115.578125"	"76568.484375"	"78148.3046875"	"96385.7734375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"787.38754"	"0.0001108"	"1.242E-05"	"3.18"	"40.11"
"5285"	"[K].EHVKVTSEPQPGFLER.[L]"	"1xBiotin [K4]"	"0.014765"	"0.000586377"	"1"	"1"	"3"	"Q9DBS1"	"Q9DBS1 [13-28]"	"Q9DBS1 1xBiotin [K16]"	"Transmembrane protein 43 [OS=Mus musculus]"	"1"	"2079.03279"	"0.75"	"0.52"	"0.98"	"0.34"	"0.31"	"-0.44"	"-0.21"	"69.8"	"117.6"	"100.2"	"137.6"	"88.2"	"86.6"	"8253.52734375"	"13903.43359375"	"11845.685546875"	"16257.990234375"	"10422.337890625"	"10233.2998046875"	""	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"3"	"693.68265"	"0.0001108"	"0.001116"	"3.29"	"38.00"
"18149"	"[R].MISKQFHHQLR.[V]"	"1xBiotin [K4]; 1xOxidation [M1]"	"0.0138549"	"0.000586377"	"1"	"1"	"9"	"Q8R1B4"	"Q8R1B4 [707-717]"	"Q8R1B4 1xBiotin [K710]"	"Eukaryotic translation initiation factor 3 subunit C [OS=Mus musculus]"	"1"	"1666.83046"	"0.38"	"0.09"	"0.16"	"-0.69"	"0.47"	"0.09"	"0.37"	"92.5"	"120.1"	"98.6"	"103.4"	"57.5"	"127.9"	"56178.283203125"	"72886.73046875"	"59873.98828125"	"62802.619140625"	"34899.291015625"	"77624.310546875"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"3"	"556.28169"	"0.0001108"	"0.001018"	"2.68"	"28.44"
"5015"	"[K].EFEPPSAGAAVTAKPGQEIR.[Q]"	"1xBiotin [K14]"	"1.34331E-05"	"0.000586377"	"1"	"1"	"3"	"Q7TQ95"	"Q7TQ95 [148-167]"	"Q7TQ95 1xBiotin [K161]"	"Protein lunapark [OS=Mus musculus]"	"0"	"2281.12814"	"0.10"	"-9.97"	"-9.97"	"-0.42"	"-9.97"	"-9.97"	""	"213.0"	"227.6"	""	""	"159.3"	""	"10848.015625"	"11592.427734375"	""	""	"8113.27978515625"	""	""	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"High"	"3"	"761.04698"	"0.0001108"	"4.001E-08"	"4.65"	"41.71"
"5024"	"[R].EFKGLGDCLVK.[I]"	"1xBiotin [K3]; 1xCarbamidomethyl [C8]"	"0.00189726"	"0.000586377"	"1"	"1"	"6"	"P51881"	"P51881 [153-163]"	"P51881 1xBiotin [K155]"	"ADP/ATP translocase 2 [OS=Mus musculus]"	"1"	"1491.73343"	""	"9.97"	""	"9.97"	"9.97"	"9.97"	"0.27"	""	""	"185.3"	""	"190.5"	"224.2"	""	""	"13183.8701171875"	""	"13555.3212890625"	"15946.8564453125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"746.37062"	"0.0001108"	"5.505E-05"	"2.77"	"45.28"
"5029"	"[K].EFIESLQLKPGQVVYK.[C]"	"1xBiotin [K9]"	"2.43502E-05"	"0.000586377"	"1"	"1"	"11"	"Q8R173"	"Q8R173 [113-128]"	"Q8R173 1xBiotin [K121]"	"Palmitoyltransferase ZDHHC3 [OS=Mus musculus]"	"0"	"2104.11472"	"0.51"	"0.36"	"-1.78"	"-3.61"	"0.27"	"-0.24"	"-0.09"	"113.5"	"161.5"	"145.5"	"33.1"	"9.3"	"137.1"	"112268.16796875"	"159739.28125"	"143978.90625"	"32698.55859375"	"9201.91259765625"	"135665.0703125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"1052.56188"	"0.0001108"	"9.596E-08"	"3.98"	"51.74"
"5039"	"[K].EFLSKPTV.[-]"	"1xBiotin [K5]"	"0.0846808"	"0.00288886"	"1"	"1"	"6"	"P47713"	"P47713 [741-748]"	"P47713 1xBiotin [K745]"	"Cytosolic phospholipase A2 [OS=Mus musculus]"	"0"	"1146.58636"	"0.50"	"0.40"	"0.52"	"0.38"	"0.60"	"0.09"	"0.20"	"75.2"	"106.6"	"99.1"	"107.6"	"97.8"	"113.7"	"72546.96875"	"102925.0703125"	"95636.9453125"	"103897.6875"	"94427.421875"	"109780.1015625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"573.79681"	"0.0004957"	"0.01497"	"1.91"	"49.33"
"5057"	"[K].EGAAGFFKGIGK.[G]"	"1xBiotin [K8]"	"0.000577658"	"0.000586377"	"1"	"3"	"5"	"Q8BX70-1"	"Q8BX70-1 [3541-3552]"	"Q8BX70-1 1xBiotin [K3548]"	"Vacuolar protein sorting-associated protein 13C [OS=Mus musculus]"	"1"	"1407.70893"	"-9.97"	"0.35"	"-9.97"	"-0.29"	"0.46"	"9.97"	"0.11"	"134.5"	""	"171.0"	""	"110.0"	"184.5"	"10191.451171875"	""	"12954.775390625"	""	"8333.1923828125"	"13976.623046875"	""	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"2"	"704.35808"	"0.0001108"	"9.754E-06"	"2.78"	"47.14"
"5069"	"[R].EGASKATSQSSIR.[Q]"	"1xBiotin [K5]"	"0.000106477"	"0.000586377"	"1"	"1"	"29"	"Q8VBT0"	"Q8VBT0 [253-265]"	"Q8VBT0 1xBiotin [K257]"	"Thioredoxin-related transmembrane protein 1 [OS=Mus musculus]"	"1"	"1547.74823"	"0.51"	"0.53"	"0.37"	"0.60"	"0.64"	"0.13"	"0.11"	"73.0"	"103.7"	"105.3"	"94.0"	"110.3"	"113.7"	"553400.872558594"	"786561.484375"	"798988.71875"	"712990.120117188"	"836322.293945313"	"862684.5625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"774.37795"	"0.0001108"	"8.224E-07"	"3.70"	"25.75"
"18577"	"[-G].MQIFVKTLTGK.[T]"	"1xBiotin [K6]; 1xOxidation [M1]"	"0.000834051"	"0.000586377"	"1"	"4"	"9"	"P62983"	"P62983 [1-11]"	"P62983 1xBiotin [K6]"	"Ubiquitin-40S ribosomal protein S27a [OS=Mus musculus]"	"1"	"1507.80112"	"0.38"	"-0.19"	"0.39"	"-1.25"	"0.40"	"0.02"	"0.59"	"96.4"	"125.2"	"84.7"	"126.1"	"40.4"	"127.2"	"21962.900390625"	"28533.74609375"	"19312.109375"	"28729.765625"	"9208.9443359375"	"28989.359375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"754.40471"	"0.0001108"	"1.662E-05"	"3.26"	"45.32"
"18576"	"[-G].MQIFVKTLTGK.[T]"	"1xBiotin [K6]"	"0.000341791"	"0.000586377"	"1"	"4"	"5"	"P62983"	"P62983 [1-11]"	"P62983 1xBiotin [K6]"	"Ubiquitin-40S ribosomal protein S27a [OS=Mus musculus]"	"1"	"1491.80620"	"0.71"	"0.62"	"0.21"	"-1.14"	"0.40"	"-0.31"	"-0.22"	"84.4"	"137.8"	"130.0"	"97.8"	"38.4"	"111.5"	"23304.732421875"	"38035.1484375"	"35888.76171875"	"26993.80078125"	"10590.2802734375"	"30769.46484375"	""	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"2"	"746.40679"	"0.0001108"	"4.509E-06"	"3.38"	"50.40"
"18570"	"[R].MQKEITALAPSTMK.[I]"	"1xBiotin [K3]; 2xOxidation [M1; M13]"	"5.90829E-05"	"0.000586377"	"1"	"6"	"6"	"P60710"	"P60710 [313-326]"	"P60710 1xBiotin [K315]"	"Actin, cytoplasmic 1 [OS=Mus musculus]"	"1"	"1806.87984"	"-0.15"	"-0.32"	"-0.22"	"-9.97"	"-0.01"	"0.14"	"0.31"	"131.5"	"118.8"	"105.5"	"113.3"	""	"130.9"	"25940.142578125"	"23430.37890625"	"20809.0546875"	"22339.63671875"	""	"25821.0078125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"903.94364"	"0.0001108"	"3.492E-07"	"3.78"	"38.33"
"18569"	"[R].MQKEITALAPSTMK.[I]"	"1xBiotin [K3]; 1xOxidation [M]"	"8.00124E-05"	"0.000586377"	"1"	"6"	"11"	"P60710"	"P60710 [313-326]"	"P60710 1xBiotin [K315]"	"Actin, cytoplasmic 1 [OS=Mus musculus]"	"1"	"1790.88492"	"-0.01"	"0.27"	"-0.23"	"-0.11"	"-0.04"	"-0.03"	"-0.31"	"100.7"	"100.0"	"121.8"	"86.1"	"93.4"	"97.9"	"32944.83984375"	"32717.08203125"	"39841.1323242188"	"28182.880859375"	"30571.3193359375"	"32042.0458984375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"895.94636"	"0.0001108"	"5.43E-07"	"3.79"	"40.83"
"5130"	"[K].EGKLYR.[NL]"	"1xBiotin [K3]"	"0.0683137"	"0.0019826"	"1"	"3"	"16"	"Q8VCH8"	"Q8VCH8 [479-484]"	"Q8VCH8 1xBiotin [K481]"	"UBX domain-containing protein 4 [OS=Mus musculus]"	"1"	"991.50296"	"0.54"	"0.58"	"0.35"	"0.38"	"0.61"	"0.07"	"0.03"	"74.5"	"108.4"	"111.2"	"95.0"	"97.1"	"113.7"	"692361.5"	"1006511.5"	"1032522.6875"	"882659.1875"	"902162.5625"	"1056311"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"496.25497"	"0.0003442"	"0.01077"	"1.68"	"28.55"
"5165"	"[R].EGMKGQLTEASSATSK.[A]"	"1xBiotin [K4]"	"0.000171761"	"0.000586377"	"1"	"3"	"6"	"Q9Z329-1"	"Q9Z329-1 [1861-1876]"	"Q9Z329-1 1xBiotin [K1864]"	"Inositol 1,4,5-trisphosphate receptor type 2 [OS=Mus musculus]"	"1"	"1850.86227"	"9.97"	""	""	"9.97"	""	"-9.97"	""	""	"261.4"	""	""	"338.6"	""	""	"28151.58984375"	""	""	"36469.1171875"	""	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"925.93507"	"0.0001108"	"1.654E-06"	"3.41"	"35.37"
"5166"	"[R].EGMKGQLTEASSATSK.[A]"	"1xBiotin [K4]; 1xOxidation [M3]"	"0.000216884"	"0.000586377"	"1"	"3"	"13"	"Q9Z329-1"	"Q9Z329-1 [1861-1876]"	"Q9Z329-1 1xBiotin [K1864]"	"Inositol 1,4,5-trisphosphate receptor type 2 [OS=Mus musculus]"	"1"	"1866.85719"	"0.12"	"-0.02"	"-0.03"	"-0.89"	"0.09"	"-0.03"	"0.11"	"106.0"	"115.4"	"104.8"	"103.7"	"57.4"	"112.8"	"29538.314453125"	"32182.9018554688"	"29206.5649414063"	"28914.2587890625"	"15990.7631835938"	"31435.3735351563"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"933.93219"	"0.0001108"	"2.327E-06"	"3.60"	"29.35"
"5174"	"[K].EGPASGKVGSCVSTK.[V]"	"1xBiotin [K7]; 1xCarbamidomethyl [C11]"	"0.0746337"	"0.00241047"	"1"	"1"	"6"	"P35295"	"P35295 [129-143]"	"P35295 1xBiotin [K135]"	"Ras-related protein Rab-20 [OS=Mus musculus]"	"1"	"1689.79347"	"0.50"	"0.13"	"0.22"	"0.52"	"0.54"	"0.05"	"0.41"	"79.3"	"111.9"	"86.9"	"92.6"	"113.9"	"115.5"	"5251.31494140625"	"7406.39892578125"	"5749.9443359375"	"6131.4423828125"	"7537.1962890625"	"7645.330078125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"845.39975"	"0.000415"	"0.01236"	"1.87"	"29.47"
"18444"	"[K].MPKIVDPLAR.[G]"	"1xBiotin [K3]; 1xOxidation [M1]"	"0.00193072"	"0.000586377"	"1"	"1"	"9"	"Q80WQ6"	"Q80WQ6 [153-162]"	"Q80WQ6 1xBiotin [K155]"	"Inactive rhomboid protein 2 [OS=Mus musculus]"	"1"	"1381.73304"	"0.01"	"-0.15"	"0.01"	"-0.81"	"0.27"	"0.26"	"0.42"	"105.5"	"106.2"	"94.9"	"106.0"	"60.1"	"127.3"	"44050.125"	"44344.31640625"	"39612.32421875"	"44232.453125"	"25108.494140625"	"53141.1953125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"691.37020"	"0.0001108"	"5.67E-05"	"2.70"	"42.85"
"18443"	"[K].MPKIVDPLAR.[G]"	"1xBiotin [K3]"	"0.000834051"	"0.000586377"	"1"	"1"	"6"	"Q80WQ6"	"Q80WQ6 [153-162]"	"Q80WQ6 1xBiotin [K155]"	"Inactive rhomboid protein 2 [OS=Mus musculus]"	"1"	"1365.73812"	"0.76"	"0.12"	"0.26"	"0.20"	"0.54"	"-0.22"	"0.43"	"79.1"	"134.3"	"85.7"	"94.9"	"90.8"	"115.1"	"41565.9453125"	"70597.6640625"	"45064.2265625"	"49901.01953125"	"47724.69140625"	"60508.82421875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"683.37251"	"0.0001108"	"1.668E-05"	"3.03"	"47.64"
"18385"	"[-].MNSTKSPASHHTER.[G]"	"1xAcetyl [N-Term]; 1xBiotin [K5]"	"2.6268E-05"	"0.000586377"	"1"	"1"	"8"	"Q9R0Q8"	"Q9R0Q8 [1-14]"	"Q9R0Q8 1xAcetyl [N-Term]; 1xBiotin [K5]"	"C-type lectin domain family 4 member E [OS=Mus musculus]"	"1"	"1850.82723"	"1.46"	"1.03"	"0.84"	"2.06"	"1.29"	"-0.18"	"0.26"	"42.3"	"116.6"	"86.2"	"75.9"	"175.9"	"103.1"	"12936.322265625"	"35642.99609375"	"26350.44140625"	"23216.7578125"	"53773.2109375"	"31537.73046875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"617.61380"	"0.0001108"	"1.072E-07"	"3.80"	"25.23"
"18322"	"[K].MNAKWDTGENPIYK.[S]"	"1xBiotin [K4]; 1xOxidation [M1]"	"0.000130586"	"0.000586377"	"1"	"1"	"7"	"P09055"	"P09055 [771-784]"	"P09055 1xBiotin [K774]"	"Integrin beta-1 [OS=Mus musculus]"	"1"	"1908.86188"	"0.02"	"0.06"	"-0.16"	"-1.14"	"0.17"	"0.15"	"0.10"	"108.6"	"109.8"	"113.6"	"97.0"	"49.2"	"121.9"	"39709.1396484375"	"40150.234375"	"41536.38671875"	"35463.658203125"	"17990.775390625"	"44569.78125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"954.93450"	"0.0001108"	"1.114E-06"	"3.77"	"41.70"
"18321"	"[K].MNAKWDTGENPIYK.[S]"	"1xBiotin [K4]"	"0.00178986"	"0.000586377"	"1"	"1"	"7"	"P09055"	"P09055 [771-784]"	"P09055 1xBiotin [K774]"	"Integrin beta-1 [OS=Mus musculus]"	"1"	"1892.86697"	""	"9.97"	""	"9.97"	"9.97"	"9.97"	"0.30"	""	""	"188.0"	""	"180.0"	"232.0"	""	""	"15033.1064453125"	""	"14388.552734375"	"18553.080078125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"946.93637"	"0.0001108"	"5.067E-05"	"2.45"	"43.89"
"5003"	"[R].EFCNSPECSAWKTISR.[I]"	"1xBiotin [K12]; 2xCarbamidomethyl [C3; C8]"	"0.000256844"	"0.000586377"	"1"	"1"	"12"	"Q6ZQE4"	"Q6ZQE4 [362-377]"	"Q6ZQE4 1xBiotin [K373]"	"Nuclear envelope integral membrane protein 1 [OS=Mus musculus]"	"1"	"2197.94636"	"0.62"	"-1.06"	"-1.03"	"-1.19"	"0.16"	"-0.47"	"1.22"	"118.4"	"182.5"	"56.8"	"58.2"	"52.0"	"132.1"	"47513.509765625"	"73246.923828125"	"22787.220703125"	"23338.166015625"	"20869.20703125"	"52993.703125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"733.32024"	"0.0001108"	"2.975E-06"	"3.54"	"44.79"
"15956"	"[R].ISKFYPIPTLHSTGS.[-]"	"1xBiotin [K3]"	"0.00285258"	"0.000586377"	"1"	"2"	"5"	"O54988-1"	"O54988-1 [1219-1233]"	"O54988-1 1xBiotin [K1221]"	"STE20-like serine/threonine-protein kinase [OS=Mus musculus]"	"1"	"1873.95168"	"0.26"	"-0.01"	"-0.96"	"-9.97"	"0.39"	"0.13"	"0.40"	"119.7"	"142.9"	"119.1"	"61.3"	""	"156.9"	"41831.12109375"	"49939.40625"	"41596.796875"	"21432.935546875"	""	"54826.52734375"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"2"	"937.47935"	"0.0001108"	"0.0001005"	"2.91"	"51.25"
"15955"	"[R].LSKFQDGSNNVMR.[T]"	"1xBiotin [K3]; 1xOxidation [M12]"	"0.000231252"	"0.000586377"	"1"	"2"	"6"	"Q9Z329-1"	"Q9Z329-1 [907-919]"	"Q9Z329-1 1xBiotin [K909]"	"Inositol 1,4,5-trisphosphate receptor type 2 [OS=Mus musculus]"	"1"	"1737.80470"	"0.18"	"-0.15"	"0.01"	"-0.55"	"0.10"	"-0.07"	"0.25"	"103.6"	"117.0"	"93.6"	"104.0"	"70.8"	"111.1"	"40265.41796875"	"45466.0625"	"36376.01953125"	"40444.90234375"	"27507.5390625"	"43185.01953125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"869.40657"	"0.0001108"	"2.547E-06"	"2.37"	"34.33"
"6424"	"[R].EQTKVDHFWGLDDDGDLK.[G]"	"1xBiotin [K4]"	"3.19998E-06"	"0.000586377"	"1"	"5"	"38"	"Q9D666-1"	"Q9D666-1 [143-160]"	"Q9D666-1 1xBiotin [K146]"	"SUN domain-containing protein 1 [OS=Mus musculus]"	"1"	"2344.05504"	"0.45"	"0.25"	"-1.22"	"-3.39"	"0.49"	"0.04"	"0.24"	"109.4"	"149.5"	"130.3"	"46.9"	"10.4"	"153.5"	"829924.43359375"	"1134050.54296875"	"988373.68359375"	"355626.173828125"	"78949.4775390625"	"1164493.33984375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"1172.53195"	"0.0001108"	"4.93E-09"	"5.41"	"48.87"
"13980"	"[R].LKSLALDIDRDTEDQNR.[Y]"	"1xBiotin [K2]"	"0.00370715"	"0.000586377"	"1"	"1"	"19"	"O35153"	"O35153 [35-51]"	"O35153 1xBiotin [K36]"	"BET1-like protein [OS=Mus musculus]"	"2"	"2228.09757"	"0.33"	"0.11"	"-0.10"	"-1.66"	"0.21"	"-0.12"	"0.11"	"104.5"	"131.5"	"112.4"	"97.5"	"33.0"	"121.1"	"689562.3671875"	"868123.4296875"	"741653.52734375"	"643508.1875"	"217897.89453125"	"799602.34375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"1114.55367"	"0.0001108"	"0.0001472"	"3.64"	"43.06"
"13979"	"[R].LKSLALDIDR.[D]"	"1xBiotin [K2]"	"0.000454828"	"0.000586377"	"1"	"1"	"6"	"O35153"	"O35153 [35-44]"	"O35153 1xBiotin [K36]"	"BET1-like protein [OS=Mus musculus]"	"1"	"1369.75080"	"0.51"	"0.17"	"0.12"	"-0.48"	"0.01"	"-0.49"	"-0.16"	"94.3"	"134.0"	"106.5"	"102.5"	"67.6"	"95.1"	"106966.71875"	"151995.046875"	"120726.5703125"	"116267.1015625"	"76612.9296875"	"107900.71875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"685.37907"	"0.0001108"	"6.842E-06"	"3.70"	"46.32"
"13975"	"[K].LKSELVANNVTLPAGEQR.[K]"	"1xBiotin [K2]"	"0.000716737"	"0.000586377"	"1"	"6"	"8"	"Q61029"	"Q61029 [16-33]"	"Q61029 1xBiotin [K17]"	"Lamina-associated polypeptide 2, isoforms beta/delta/epsilon/gamma [OS=Mus musculus]"	"1"	"2165.13831"	"9.97"	"9.97"	"9.97"	""	""	"-9.97"	"-9.97"	""	"221.1"	"179.5"	"199.4"	""	""	""	"18947.53125"	"15382.0859375"	"17086.849609375"	""	""	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"722.38426"	"0.0001108"	"1.337E-05"	"3.67"	"42.77"
"7089"	"[K].FFVGGNWK.[M]"	""	"0.038507"	"0.00104877"	"1"	"1"	"7"	"P17751"	"P17751 [57-64]"	""	"Triosephosphate isomerase [OS=Mus musculus]"	"0"	"954.48321"	"0.17"	"-0.21"	"0.06"	"0.25"	"0.14"	"-0.04"	"0.34"	"95.0"	"106.9"	"82.3"	"98.7"	"112.8"	"104.3"	"218846.453125"	"246280.28125"	"189721.703125"	"227569.90625"	"260046.546875"	"240345.9375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"477.74511"	"0.0001873"	"0.004571"	"1.98"	"39.95"
"13962"	"[R].IKQQIALDR.[A]"	"1xBiotin [K2]"	"0.00392936"	"0.000586377"	"1"	"1"	"4"	"Q8VCH8"	"Q8VCH8 [267-275]"	"Q8VCH8 1xBiotin [K268]"	"UBX domain-containing protein 4 [OS=Mus musculus]"	"1"	"1310.72492"	"0.27"	"0.00"	"0.27"	"0.38"	"0.35"	"0.08"	"0.35"	"85.8"	"103.6"	"85.9"	"103.7"	"111.5"	"109.5"	"30666.255859375"	"36996.84375"	"30682.251953125"	"37026.42578125"	"39830.890625"	"39124.2578125"	""	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"2"	"655.86620"	"0.0001108"	"0.0001602"	"2.64"	"35.16"
"7105"	"[R].FGGGALKNFHCD.[-]"	"1xBiotin [K7]; 1xCarbamidomethyl [C11]"	"2.6268E-05"	"0.000586377"	"1"	"1"	"28"	"Q9D4V7-1"	"Q9D4V7-1 [225-236]"	"Q9D4V7-1 1xBiotin [K231]"	"Rab-like protein 3 [OS=Mus musculus]"	"1"	"1548.67223"	"0.44"	"0.28"	"0.24"	"-0.25"	"0.36"	"-0.08"	"0.09"	"87.4"	"118.4"	"105.7"	"102.9"	"73.4"	"112.2"	"1088756.3203125"	"1476245.11328125"	"1317757.8046875"	"1282276.99609375"	"914569.083984375"	"1398440.0625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"774.83981"	"0.0001108"	"1.073E-07"	"3.96"	"41.39"
"7107"	"[K].FGHVDQEKTPSFAFQGGSNTEFK.[S]"	"1xBiotin [K8]"	"0.000130586"	"0.000586377"	"1"	"1"	"4"	"Q9ERU9"	"Q9ERU9 [1696-1718]"	"Q9ERU9 1xBiotin [K1703]"	"E3 SUMO-protein ligase RanBP2 [OS=Mus musculus]"	"1"	"2784.27224"	"-9.97"	"-9.97"	"-9.97"	"-9.97"	"0.18"	"9.97"	"9.97"	"281.1"	""	""	""	""	"318.9"	"31182.69140625"	""	""	""	""	"35365.671875"	""	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"928.76187"	"0.0001108"	"1.113E-06"	"4.47"	"44.41"
"13950"	"[R].LKQDYLR.[I]"	"1xBiotin [K2]"	"0.031187"	"0.00104877"	"1"	"1"	"4"	"Q6P073"	"Q6P073 [17-23]"	"Q6P073 1xBiotin [K18]"	"Ubiquitin-conjugating enzyme E2 J2 [OS=Mus musculus]"	"1"	"1161.60849"	"0.36"	"0.33"	"0.26"	"-0.04"	"0.05"	"-0.31"	"-0.27"	"88.9"	"114.4"	"111.4"	"106.7"	"86.5"	"92.2"	"24998.62109375"	"32165.65625"	"31335.013671875"	"30019.8828125"	"24329.19921875"	"25924.3671875"	""	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"2"	"581.30791"	"0.0001873"	"0.00335"	"2.22"	"35.46"
"13993"	"[K].LKSQWNNDNPLFK.[S]"	"1xBiotin [K2]"	"2.31052E-05"	"0.000586377"	"1"	"1"	"14"	"P11835"	"P11835 [745-757]"	"P11835 1xBiotin [K746]"	"Integrin beta-2 [OS=Mus musculus]"	"1"	"1829.90031"	"0.40"	"0.08"	"-0.16"	"-1.64"	"0.54"	"0.14"	"0.46"	"99.1"	"130.8"	"105.0"	"88.7"	"31.9"	"144.6"	"208650.484375"	"275248.515625"	"220912.58203125"	"186718.28125"	"67120.1875"	"304307.703125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"915.45396"	"0.0001108"	"8.855E-08"	"4.63"	"46.69"
"13928"	"[R].IKNVLITPGK.[S]"	"1xBiotin [K2]"	"0.000462854"	"0.000586377"	"1"	"1"	"6"	"Q8BHE0"	"Q8BHE0 [289-298]"	"Q8BHE0 1xBiotin [K290]"	"Proline-rich protein 11 [OS=Mus musculus]"	"1"	"1308.77080"	"0.28"	"0.37"	"0.28"	"0.10"	"0.09"	"-0.19"	"-0.28"	"87.6"	"106.4"	"112.8"	"106.3"	"93.6"	"93.3"	"23197.7109375"	"28187.068359375"	"29901.138671875"	"28178.75390625"	"24804.66796875"	"24709.064453125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"654.88871"	"0.0001108"	"7.038E-06"	"3.60"	"40.33"
"13923"	"[R].IKNFQINNQIVK.[L]"	"1xBiotin [K2]"	"0.000446941"	"0.000586377"	"1"	"1"	"5"	"P59268"	"P59268 [126-137]"	"P59268 1xBiotin [K127]"	"Palmitoyltransferase ZDHHC9 [OS=Mus musculus]"	"1"	"1684.92032"	"9.97"	""	"9.97"	""	""	"-9.97"	""	""	"366.6"	""	"233.4"	""	""	""	"14115.619140625"	""	"8986.7822265625"	""	""	""	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"2"	"842.96447"	"0.0001108"	"6.684E-06"	"3.35"	"43.20"
"13914"	"[R].IKLVEEPPTTKPR.[S]"	"1xBiotin [K2]"	"5.04755E-05"	"0.000586377"	"1"	"1"	"9"	"Q9CZE3"	"Q9CZE3 [207-219]"	"Q9CZE3 1xBiotin [K208]"	"Ras-related protein Rab-32 [OS=Mus musculus]"	"1"	"1733.96185"	"0.56"	"0.31"	"0.52"	"0.34"	"0.41"	"-0.14"	"0.10"	"77.4"	"113.9"	"96.1"	"111.4"	"98.0"	"103.1"	"41542.29296875"	"61129.89453125"	"51547.90234375"	"59771.65234375"	"52596.73828125"	"55312.921875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"578.65864"	"0.0001108"	"2.782E-07"	"3.52"	"34.25"
"13907"	"[K].IKIQLANEEYKR.[I]"	"1xBiotin [K2]"	"3.02141E-05"	"0.000586377"	"1"	"1"	"10"	"Q5SYH2"	"Q5SYH2 [106-117]"	"Q5SYH2 1xBiotin [K107]"	"Transmembrane protein 199 [OS=Mus musculus]"	"2"	"1730.92580"	"0.15"	"0.10"	"0.15"	"-0.34"	"0.23"	"0.08"	"0.14"	"96.0"	"106.7"	"102.6"	"106.2"	"75.6"	"112.9"	"67872.671875"	"75423.1953125"	"72539.0859375"	"75110.5625"	"53464.9716796875"	"79858.3896484375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"577.64655"	"0.0001108"	"1.308E-07"	"4.50"	"36.57"
"13906"	"[K].IKIQLANEEYK.[R]"	"1xBiotin [K2]"	"0.000118261"	"0.000586377"	"1"	"1"	"6"	"Q5SYH2"	"Q5SYH2 [106-116]"	"Q5SYH2 1xBiotin [K107]"	"Transmembrane protein 199 [OS=Mus musculus]"	"1"	"1574.82469"	"0.21"	"-0.21"	"-9.97"	"-0.77"	"-0.30"	"-0.51"	"-0.09"	"135.5"	"157.2"	"117.5"	""	"79.7"	"110.1"	"35954.2578125"	"41700.234375"	"31179.61328125"	""	"21147.94140625"	"29213.35546875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"787.91605"	"0.0001108"	"9.645E-07"	"3.64"	"40.53"
"13896"	"[R].LKLLNPDDLR.[K]"	"1xBiotin [K2]"	"0.00377246"	"0.000586377"	"1"	"4"	"5"	"Q6P1H6-1"	"Q6P1H6-1 [74-83]"	"Q6P1H6-1 1xBiotin [K75]"	"ankyrin repeat and LEM domain-containing protein 2 [OS=Mus musculus]"	"1"	"1422.77735"	"-0.04"	"0.10"	"-0.38"	"-1.29"	"0.01"	"0.05"	"-0.09"	"114.7"	"111.7"	"123.1"	"88.3"	"46.9"	"115.4"	"11663.7265625"	"11356.0556640625"	"12516.4130859375"	"8978.92578125"	"4771.11865234375"	"11731.244140625"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"2"	"711.89176"	"0.0001108"	"0.0001508"	"2.82"	"48.57"
"13895"	"[K].IKIIAPPER.[K]"	"1xBiotin [K2]"	"0.0022205"	"0.000586377"	"1"	"7"	"9"	"P60710"	"P60710 [327-335]"	"P60710 1xBiotin [K328]"	"Actin, cytoplasmic 1 [OS=Mus musculus]"	"1"	"1262.72894"	"0.24"	"0.38"	"0.21"	"-0.15"	"-0.13"	"-0.37"	"-0.51"	"92.9"	"109.9"	"120.9"	"107.6"	"83.9"	"84.8"	"180703.28125"	"213859.25"	"235191.390625"	"209405.765625"	"163332.546875"	"165090.9375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"631.86802"	"0.0001108"	"6.949E-05"	"2.72"	"39.39"
"7108"	"[K].FGKASWAAAAER.[M]"	"1xBiotin [K3]"	"0.000150202"	"0.000586377"	"1"	"2"	"6"	"Q9QXM1"	"Q9QXM1 [456-467]"	"Q9QXM1 1xBiotin [K458]"	"Junction-mediating and -regulatory protein [OS=Mus musculus]"	"1"	"1490.72089"	"-1.13"	"-0.20"	"0.58"	"0.10"	"0.03"	"1.16"	"0.24"	"101.3"	"46.4"	"88.0"	"151.8"	"108.7"	"103.8"	"25446.9252929688"	"11647.505859375"	"22108.337890625"	"38121.2685546875"	"27293.798828125"	"26062.49609375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"745.86413"	"0.0001108"	"1.359E-06"	"3.17"	"42.74"
"7118"	"[K].FGQGFGKTNIYTQK.[Q]"	"1xBiotin [K7]"	"7.86248E-05"	"0.000586377"	"1"	"2"	"6"	"Q8VDP2"	"Q8VDP2 [122-135]"	"Q8VDP2 1xBiotin [K128]"	"UPF0428 protein CXorf56 homolog [OS=Mus musculus]"	"1"	"1814.88942"	"-0.05"	"-0.07"	"-9.97"	"-9.97"	"-0.04"	"0.01"	"0.03"	"153.9"	"149.1"	"147.0"	""	""	"149.9"	"32213.9140625"	"31210.509765625"	"30764.978515625"	""	""	"31374.349609375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"907.94882"	"0.0001108"	"5.317E-07"	"3.93"	"42.29"
"13926"	"[R].LKNITLDDASAPR.[L]"	"1xBiotin [K2]"	"0.000873873"	"0.000586377"	"1"	"1"	"6"	"Q91W50"	"Q91W50 [757-769]"	"Q91W50 1xBiotin [K758]"	"cold shock domain-containing protein E1 [OS=Mus musculus]"	"1"	"1639.84722"	""	"9.97"	""	"9.97"	""	""	"-9.97"	""	""	"351.4"	""	"248.6"	""	""	""	"16185.08984375"	""	"11448.1416015625"	""	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"820.42750"	"0.0001108"	"1.786E-05"	"2.31"	"40.59"
"13995"	"[R].LKSSTSFANIQENAT.[-]"	"1xBiotin [K2]"	"0.0469494"	"0.00154748"	"1"	"1"	"2"	"Q8BGT0"	"Q8BGT0 [324-338]"	"Q8BGT0 1xBiotin [K325]"	"Osteopetrosis-associated transmembrane protein 1 [OS=Mus musculus]"	"1"	"1836.87964"	"0.04"	"-0.06"	"0.14"	"-0.21"	"0.23"	"0.19"	"0.28"	"98.0"	"100.4"	"94.3"	"107.8"	"84.7"	"114.7"	"44555.11328125"	"45658.5078125"	"42880.77734375"	"49009.47265625"	"38503.20703125"	"52158.859375"	""	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"2"	"918.94313"	"0.0002716"	"0.006145"	"3.19"	"42.02"
"7073"	"[K].FFLNAKGQK.[E]"	"1xBiotin [K]"	"0.00283601"	"0.000586377"	"1"	"1"	"13"	"Q9DB25"	"Q9DB25 [45-53]"	"Q9DB25 1xBiotin [K]"	"dolichyl-phosphate beta-glucosyltransferase [OS=Mus musculus]"	"1"	"1278.66634"	"0.30"	"0.02"	"-0.20"	"-0.19"	"0.34"	"0.04"	"0.32"	"95.9"	"117.9"	"97.1"	"83.5"	"84.2"	"121.3"	"273883.34375"	"336630.0625"	"277224.3125"	"238499.03125"	"240438.8125"	"346281.65625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"639.83679"	"0.0001108"	"9.95E-05"	"2.71"	"41.61"
"14016"	"[R].LKVGLQVVAVK.[A]"	"1xBiotin [K2]"	"0.00758093"	"0.000586377"	"1"	"1"	"5"	"P63038-1"	"P63038-1 [291-301]"	"P63038-1 1xBiotin [K292]"	"60 kDa heat shock protein, mitochondrial [OS=Mus musculus]"	"1"	"1379.84430"	"9.97"	"9.97"	""	"9.97"	"9.97"	"-0.17"	"-0.35"	""	"173.6"	"196.9"	""	"75.0"	"154.5"	""	"9636.2900390625"	"10929.2900390625"	""	"4164.142578125"	"8574.810546875"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"2"	"690.42555"	"0.0001108"	"0.0004183"	"2.84"	"45.71"
"14464"	"[RK].LLLLGAGESGKSTIVK.[Q]"	"1xBiotin [K11]"	"0.0837597"	"0.00241047"	"1"	"13"	"1"	"P63094"	"P63094 [43-58]"	"P63094 1xBiotin [K53]"	"Guanine nucleotide-binding protein G(s) subunit alpha isoforms short [OS=Mus musculus]"	"1"	"1812.02993"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"906.52006"	"0.000415"	"0.0147"	"2.17"	""
"14454"	"[K].LILKNENVDR.[H]"	"1xBiotin [K4]"	"0.0019195"	"0.000586377"	"1"	"1"	"9"	"Q9D5T0"	"Q9D5T0 [271-280]"	"Q9D5T0 1xBiotin [K274]"	"ATPase family aaa domain-containing protein 1 [OS=Mus musculus]"	"1"	"1439.76751"	"0.22"	"0.27"	"0.17"	"0.39"	"0.27"	"0.05"	"0.00"	"85.6"	"99.7"	"103.2"	"96.5"	"112.1"	"103.0"	"145902.1875"	"169982.546875"	"176025.546875"	"164508.625"	"191183.609375"	"175587.6875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"720.38723"	"0.0001108"	"5.627E-05"	"2.39"	"37.81"
"14410"	"[R].ILLAVNGKVFDVTK.[G]"	"1xBiotin [K8]"	"0.000261377"	"0.000586377"	"1"	"1"	"5"	"Q80UU9"	"Q80UU9 [113-126]"	"Q80UU9 1xBiotin [K120]"	"Membrane-associated progesterone receptor component 2 [OS=Mus musculus]"	"1"	"1742.98734"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"2"	"871.99728"	"0.0001108"	"3.047E-06"	"3.74"	""
"14396"	"[K].ILKVIR.[K]"	"1xBiotin [K3]"	"0.11765"	"0.00731053"	"1"	"2"	"8"	"P11499"	"P11499 [400-405]"	"P11499 1xBiotin [K402]"	"Heat shock protein HSP 90-beta [OS=Mus musculus]"	"1"	"967.61212"	"0.30"	"0.39"	"0.59"	"-1.48"	"-0.52"	"-0.82"	"-0.90"	"98.2"	"121.3"	"128.6"	"148.0"	"35.2"	"68.7"	"34253.4052734375"	"42298.283203125"	"44854.787109375"	"51627.78515625"	"12292.1953125"	"23967.833984375"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"2"	"484.30947"	"0.001478"	"0.0248"	"1.81"	"38.69"
"14394"	"[R].ILKTPSILR.[T]"	"1xBiotin [K3]"	"0.0565215"	"0.0019826"	"1"	"2"	"3"	"Q8BNI4"	"Q8BNI4 [198-206]"	"Q8BNI4 1xBiotin [K200]"	"Derlin-2 [OS=Mus musculus]"	"1"	"1266.76024"	"0.57"	"0.29"	"-9.97"	"0.15"	"0.55"	"-0.02"	"0.26"	"95.6"	"141.9"	"116.6"	""	"106.1"	"139.9"	"11792.6015625"	"17501.23046875"	"14386.716796875"	""	"13083.22265625"	"17255.26171875"	""	"High"	"High"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"2"	"633.88344"	"0.0003442"	"0.008125"	"2.13"	"43.88"
"14382"	"[R].IIKPFPAPQTPGR.[L]"	"1xBiotin [K3]"	"0.000108356"	"0.000586377"	"1"	"1"	"55"	"Q9Z0F8"	"Q9Z0F8 [726-738]"	"Q9Z0F8 1xBiotin [K728]"	"Disintegrin and metalloproteinase domain-containing protein 17 [OS=Mus musculus]"	"0"	"1647.90394"	"0.28"	"0.10"	"-0.18"	"-0.50"	"0.26"	"-0.02"	"0.16"	"98.7"	"119.7"	"106.1"	"87.4"	"69.8"	"118.4"	"1839726.08691406"	"2230746.6875"	"1977823.22460938"	"1628735.59277344"	"1300883.40625"	"2207360.21875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"824.45576"	"0.0001108"	"8.49E-07"	"2.60"	"43.84"
"14365"	"[K].LLKGIDLGSLVDSDVDLK.[I]"	"1xBiotin [K3]"	"1.35116E-05"	"0.000586377"	"1"	"2"	"9"	"Q3U1N2-1"	"Q3U1N2-1 [392-409]"	"Q3U1N2-1 1xBiotin [K394]"	"Sterol regulatory element-binding protein 2 [OS=Mus musculus]"	"1"	"2126.14133"	"-0.34"	"-0.49"	"-4.59"	"-9.97"	"0.12"	"0.47"	"0.61"	"165.2"	"130.3"	"117.7"	"6.9"	""	"180.0"	"75650.859375"	"59678.7265625"	"53890.46875"	"3141.80883789063"	""	"82442.357421875"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"2"	"1063.57537"	"0.0001108"	"4.063E-08"	"4.55"	"59.26"
"6997"	"[R].FDDHKGPTITLTQIV.[-]"	"1xBiotin [K5]"	"0.0970105"	"0.00379267"	"1"	"1"	"3"	"Q9R1Q9"	"Q9R1Q9 [449-463]"	"Q9R1Q9 1xBiotin [K453]"	"V-type proton ATPase subunit S1 [OS=Mus musculus]"	"1"	"1910.96806"	"-0.03"	"0.06"	"-1.08"	"-4.72"	"0.24"	"0.27"	"0.18"	"127.4"	"124.9"	"132.5"	"60.1"	"4.8"	"150.2"	"558020.1875"	"547376"	"580633.8125"	"263433.53125"	"21235.56640625"	"658090.4375"	""	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"2"	"955.98776"	"0.0008081"	"0.01845"	"3.14"	"54.30"
"14332"	"[K].LLHESHLKDLTK.[N]"	"1xBiotin [K]"	"0.000196415"	"0.000586377"	"1"	"2"	"13"	"Q6P9J9"	"Q6P9J9 [878-889]"	"Q6P9J9 1xBiotin [K]"	"Anoctamin-6 [OS=Mus musculus]"	"1"	"1659.88869"	"0.42"	"0.45"	"-0.24"	"-0.64"	"0.12"	"-0.31"	"-0.33"	"95.5"	"128.0"	"130.3"	"81.1"	"61.5"	"103.6"	"79586.23046875"	"106616.48046875"	"108575.9609375"	"67544.734375"	"51242.44140625"	"86264.412109375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"830.44786"	"0.0001108"	"2.022E-06"	"2.99"	"33.66"
"14315"	"[R].ILGTKQGEHRPSLHR.[F]"	"1xBiotin [K5]"	"0.00204656"	"0.000586377"	"1"	"1"	"22"	"Q60664"	"Q60664 [391-405]"	"Q60664 1xBiotin [K395]"	"Lymphoid-restricted membrane protein [OS=Mus musculus]"	"1"	"1955.03921"	"0.67"	"0.42"	"0.29"	"0.12"	"0.33"	"-0.34"	"-0.09"	"80.1"	"127.1"	"107.3"	"98.0"	"87.0"	"100.6"	"1151447.9375"	"1827595.59375"	"1542397.75"	"1409855"	"1250636.90625"	"1446750.40625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"652.35109"	"0.0001108"	"6.191E-05"	"2.23"	"25.71"
"14295"	"[R].ILGPGLNKAGK.[F]"	"1xBiotin [K]"	"0.00531779"	"0.000586377"	"1"	"1"	"6"	"P53026"	"P53026 [123-133]"	"P53026 1xBiotin [K]"	"60S ribosomal protein L10A [OS=Mus musculus]"	"1"	"1293.73475"	"0.45"	"-0.12"	"0.16"	"-0.18"	"-0.04"	"-0.49"	"0.08"	"95.8"	"131.0"	"88.5"	"107.0"	"84.4"	"93.3"	"16719"	"22858.041015625"	"15435.689453125"	"18670.970703125"	"14730.5546875"	"16281.9560546875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"647.37108"	"0.0001108"	"0.0002494"	"2.50"	"37.34"
"14288"	"[K].LLGMSGKR.[S]"	"1xBiotin [K7]; 1xOxidation [M4]"	"0.12339"	"0.00909051"	"1"	"1"	"1"	"Q61937"	"Q61937 [135-142]"	"Q61937 1xBiotin [K141]"	"Nucleophosmin [OS=Mus musculus]"	"1"	"1103.57000"	"-0.15"	"-0.40"	"0.01"	"-1.25"	"0.07"	"0.22"	"0.47"	"116.9"	"105.1"	"88.3"	"117.7"	"49.3"	"122.6"	"21738.25390625"	"19551.47265625"	"16427.7265625"	"21892.8515625"	"9169.9912109375"	"22807.873046875"	""	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"2"	"552.28870"	"0.001706"	"0.02662"	"1.37"	"29.19"
"14254"	"[R].LIGDAAKNQVAMNPTNTVFDAK.[R]"	"1xBiotin [K7]; 1xOxidation [M12]"	"0.00259874"	"0.000586377"	"1"	"1"	"2"	"P63017"	"P63017 [50-71]"	"P63017 1xBiotin [K56]"	"Heat shock cognate 71 kDa protein [OS=Mus musculus]"	"1"	"2560.25342"	"-9.97"	"0.54"	"-9.97"	"-9.97"	"0.28"	"9.97"	"-0.26"	"163.8"	""	"238.0"	""	""	"198.3"	"9481.255859375"	""	"13777.359375"	""	""	"11480.41796875"	""	"High"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"3"	"854.08955"	"0.0001108"	"8.734E-05"	"3.16"	"44.56"
"14222"	"[R].LIFAGKQLEDGR.[T]"	"1xBiotin [K6]"	"0.000206998"	"0.000586377"	"1"	"4"	"8"	"P62983"	"P62983 [43-54]"	"P62983 1xBiotin [K48]"	"Ubiquitin-40S ribosomal protein S27a [OS=Mus musculus]"	"1"	"1572.82027"	"0.08"	"-0.08"	"0.05"	"-0.79"	"0.10"	"0.02"	"0.18"	"105.5"	"111.1"	"100.0"	"109.4"	"61.0"	"113.0"	"53686.7109375"	"56559.734375"	"50877.48828125"	"55652.27734375"	"31024.734375"	"57515.1015625"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"2"	"786.91397"	"0.0001108"	"2.178E-06"	"3.72"	"45.90"
"14161"	"[R].LLEEHAKLQASVR.[G]"	"1xBiotin [K7]"	"0.00163051"	"0.000586377"	"1"	"1"	"8"	"Q61335"	"Q61335 [225-237]"	"Q61335 1xBiotin [K231]"	"B-cell receptor-associated protein 31 [OS=Mus musculus]"	"1"	"1719.92105"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"-0.56"	"-0.60"	""	"131.7"	"135.6"	"146.5"	"96.8"	"89.4"	""	"20843.51953125"	"21461.880859375"	"23200.70703125"	"15322.2080078125"	"14160.41796875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"573.97861"	"0.0001108"	"4.436E-05"	"3.41"	"35.10"
"14120"	"[K].LLDKVSIVQK.[E]"	"1xBiotin [K4]"	"0.000873873"	"0.000586377"	"1"	"2"	"6"	"Q91ZV0"	"Q91ZV0 [682-691]"	"Q91ZV0 1xBiotin [K685]"	"Melanoma inhibitory activity protein 2 [OS=Mus musculus]"	"1"	"1368.79193"	"0.35"	"-0.06"	"-0.20"	"-0.27"	"0.07"	"-0.29"	"0.12"	"100.2"	"128.0"	"96.4"	"87.4"	"83.1"	"104.9"	"54398.2890625"	"69447.25"	"52286.23046875"	"47429.890625"	"45093.13671875"	"56933.859375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"684.89956"	"0.0001108"	"1.774E-05"	"3.72"	"43.75"
"14093"	"[R].IICEKTLSFPK.[Q]"	"1xBiotin [K5]; 1xCarbamidomethyl [C3]"	"0.000676144"	"0.000586377"	"1"	"3"	"6"	"Q08EC4-1"	"Q08EC4-1 [142-152]"	"Q08EC4-1 1xBiotin [K146]"	"Cas scaffolding protein family member 4 [OS=Mus musculus]"	"1"	"1561.81168"	"0.53"	"0.30"	"-0.14"	"-0.85"	"0.39"	"-0.14"	"0.09"	"93.0"	"134.5"	"114.5"	"84.5"	"51.8"	"121.8"	"13644.15625"	"19730.423828125"	"16791.7734375"	"12398.1162109375"	"7593.71142578125"	"17871.904296875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"781.40996"	"0.0001108"	"1.229E-05"	"2.96"	"45.55"
"14067"	"[R].LLANGHPILNNNHPKND.[-]"	"1xBiotin [K15]"	"0.0024949"	"0.000586377"	"1"	"1"	"6"	"Q924Z4"	"Q924Z4 [364-380]"	"Q924Z4 1xBiotin [K378]"	"Ceramide synthase 2 [OS=Mus musculus]"	"1"	"2107.05017"	"0.79"	"0.55"	"0.40"	"0.19"	"0.62"	"-0.17"	"0.07"	"73.3"	"127.1"	"107.1"	"96.4"	"83.4"	"112.8"	"30461.50390625"	"52824.91796875"	"44522.30859375"	"40093.73828125"	"34663.39453125"	"46876.390625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"703.02165"	"0.0001108"	"8.221E-05"	"2.85"	"32.76"
"7053"	"[K].FEKSSHHWGADVRPELK.[D]"	"1xBiotin [K3]"	"4.51411E-06"	"0.000586377"	"1"	"1"	"36"	"P13011"	"P13011 [34-50]"	"P13011 1xBiotin [K36]"	"Acyl-CoA desaturase 2 [OS=Mus musculus]"	"1"	"2249.09203"	"0.53"	"0.76"	"-1.61"	"-2.38"	"0.27"	"-0.26"	"-0.49"	"102.3"	"147.9"	"173.4"	"33.5"	"19.6"	"123.3"	"3805634.94726563"	"5498581.64746094"	"6448122.87060547"	"1245467.02392578"	"729882.125"	"4583301.8125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"750.36891"	"0.0001108"	"8.159E-09"	"4.76"	"34.30"
"13870"	"[K].IKGVSPQGAIMDR.[M]"	"1xBiotin [K2]; 1xOxidation [M11]"	"0.000729384"	"0.000586377"	"1"	"1"	"6"	"P97369"	"P97369 [157-169]"	"P97369 1xBiotin [K158]"	"Neutrophil cytosol factor 4 [OS=Mus musculus]"	"1"	"1613.81381"	"0.59"	"0.45"	"0.46"	"-0.77"	"0.35"	"-0.24"	"-0.10"	"84.4"	"127.2"	"115.2"	"116.1"	"49.6"	"107.5"	"11437.548828125"	"17238.087890625"	"15605.75390625"	"15725.8779296875"	"6727.33203125"	"14569.3876953125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"807.41099"	"0.0001108"	"1.369E-05"	"2.44"	"35.30"
"6960"	"[R].FAQDKSVVNK.[M]"	"1xBiotin [K5]"	"0.00573543"	"0.000586377"	"1"	"2"	"5"	"P97411-1"	"P97411-1 [15-24]"	"P97411-1 1xBiotin [K19]"	"Islet cell autoantigen 1 [OS=Mus musculus]"	"1"	"1361.68820"	"9.97"	""	"9.97"	"9.97"	"9.97"	"0.23"	"9.97"	""	"119.9"	""	"143.2"	"195.7"	"141.1"	""	"9954.345703125"	""	"11888.9375"	"16243.9091796875"	"11709.5849609375"	""	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"2"	"681.34740"	"0.0001108"	"0.0002775"	"2.49"	"30.76"
"13859"	"[R].LKGIVPLAK.[V]"	"1xBiotin [K2]"	"0.0143442"	"0.000586377"	"1"	"1"	"2"	"P27773"	"P27773 [74-82]"	"P27773 1xBiotin [K75]"	"Protein disulfide-isomerase A3 [OS=Mus musculus]"	"1"	"1164.71731"	"0.17"	"-9.97"	"0.35"	"-0.19"	"-0.12"	"-0.30"	"9.97"	"115.6"	"130.4"	""	"147.0"	"101.0"	"106.0"	"10208.595703125"	"11513.4228515625"	""	"12978.0712890625"	"8918.365234375"	"9362.1474609375"	""	"High"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"2"	"582.86206"	"0.0001108"	"0.001064"	"2.17"	"42.80"
"7127"	"[K].FGTSEMSKPFR.[I]"	"1xBiotin [K8]; 1xOxidation [M6]"	"0.00111631"	"0.000586377"	"1"	"1"	"6"	"Q9ERU9"	"Q9ERU9 [1538-1548]"	"Q9ERU9 1xBiotin [K1545]"	"E3 SUMO-protein ligase RanBP2 [OS=Mus musculus]"	"0"	"1528.69230"	"0.27"	"-0.13"	"-0.15"	"-0.81"	"0.07"	"-0.19"	"0.20"	"106.4"	"127.9"	"97.3"	"95.8"	"60.9"	"111.7"	"30106.35546875"	"36180.66015625"	"27527.533203125"	"27106.20703125"	"17227.77734375"	"31609.751953125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"764.85009"	"0.0001108"	"2.537E-05"	"3.01"	"37.18"
"13591"	"[R].LGPKVSVLIVQQTDTSDPEK.[V]"	"1xBiotin [K4]"	"6.55633E-06"	"0.000586377"	"1"	"1"	"10"	"P46061"	"P46061 [451-470]"	"P46061 1xBiotin [K454]"	"Ran GTPase-activating protein 1 [OS=Mus musculus]"	"1"	"2380.24284"	"0.33"	"0.04"	"-0.12"	"-1.54"	"0.41"	"0.08"	"0.37"	"102.1"	"128.0"	"105.3"	"93.7"	"35.2"	"135.7"	"35483.109375"	"44469.17578125"	"36595.25390625"	"32563.51171875"	"12228.0810546875"	"47145.734375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"794.08537"	"0.0001108"	"1.407E-08"	"4.70"	"49.00"
"13589"	"[R].LGPGQLTWKNSER.[G]"	"1xBiotin [K9]"	"0.000526204"	"0.000586377"	"1"	"2"	"6"	"Q8BP97-1"	"Q8BP97-1 [260-272]"	"Q8BP97-1 1xBiotin [K268]"	"rhomboid domain-containing protein 3 [OS=Mus musculus]"	"1"	"1711.85845"	"0.48"	"0.54"	"0.25"	"0.05"	"0.39"	"-0.09"	"-0.16"	"81.2"	"113.3"	"118.4"	"96.8"	"84.1"	"106.2"	"16759.177734375"	"23389.63671875"	"24434.201171875"	"19988.14453125"	"17357.916015625"	"21913.93359375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"856.43309"	"0.0001108"	"8.466E-06"	"3.41"	"42.88"
"13578"	"[K].LGNKSPNGISDYPK.[I]"	"1xBiotin [K4]"	"0.000197564"	"0.000586377"	"1"	"3"	"6"	"Q91ZX6"	"Q91ZX6 [120-133]"	"Q91ZX6 1xBiotin [K123]"	"Sentrin-specific protease 2 [OS=Mus musculus]"	"1"	"1715.84213"	"0.32"	"0.43"	"-0.27"	"0.35"	"0.50"	"0.18"	"0.07"	"84.5"	"105.1"	"113.5"	"69.8"	"108.0"	"119.2"	"19947.36328125"	"24826.30078125"	"26802.716796875"	"16489.607421875"	"25500.453125"	"28148.466796875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"858.42454"	"0.0001108"	"2.034E-06"	"3.28"	"35.21"
"13553"	"[K].LGLKSLVSK.[G]"	"1xBiotin [K4]"	"0.00171831"	"0.000586377"	"4"	"4"	"12"	"P43274; P43276; P15864; P43277"	"P43274 [82-90]; P43276 [82-90]; P15864 [82-90]; P43277 [83-91]"	"P43274 1xBiotin [K85]; P43276 1xBiotin [K85]; P15864 1xBiotin [K85]; P43277 1xBiotin [K86]"	"Histone H1.4 [OS=Mus musculus];Histone H1.5 [OS=Mus musculus];Histone H1.2 [OS=Mus musculus];Histone H1.3 [OS=Mus musculus]"	"1"	"1170.69149"	"0.73"	"0.19"	"0.59"	"-0.58"	"0.83"	"0.10"	"0.65"	"77.4"	"128.3"	"88.1"	"116.7"	"51.7"	"137.9"	"84063.2265625"	"139353.515625"	"95667.2265625"	"126746.0390625"	"56212.921875"	"149779.859375"	"NotUnique"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"585.84923"	"0.0001108"	"4.788E-05"	"3.72"	"45.43"
"7223"	"[R].FLGGLVKGK.[S]"	"1xBiotin [K]"	"0.00861397"	"0.000586377"	"1"	"2"	"6"	"Q3U7R1"	"Q3U7R1 [652-660]"	"Q3U7R1 1xBiotin [K]"	"Extended synaptotagmin-1 [OS=Mus musculus]"	"1"	"1144.65471"	"0.33"	"0.63"	"0.07"	"-0.72"	"0.30"	"-0.03"	"-0.33"	"89.7"	"112.8"	"138.5"	"94.4"	"54.4"	"110.3"	"19471.93359375"	"24484.900390625"	"30071.763671875"	"20500.65234375"	"11813.7490234375"	"23940.978515625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"572.83081"	"0.0001108"	"0.0005028"	"2.55"	"43.38"
"13544"	"[K].IGIEIIKR.[A]"	"1xBiotin [K7]"	"0.00780432"	"0.000586377"	"1"	"2"	"5"	"P63038-1"	"P63038-1 [463-470]"	"P63038-1 1xBiotin [K469]"	"60 kDa heat shock protein, mitochondrial [OS=Mus musculus]"	"1"	"1167.69183"	"-9.97"	"0.51"	"0.01"	"-0.49"	"0.58"	"9.97"	"0.08"	"106.5"	""	"151.1"	"107.3"	"75.9"	"159.3"	"12069.61328125"	""	"17132.93359375"	"12166.8212890625"	"8602.029296875"	"18055.80078125"	""	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"2"	"584.34975"	"0.0001108"	"0.000438"	"2.75"	"45.29"
"13532"	"[R].LGKVADWTGATYQDK.[R]"	"1xBiotin [K3]"	"0.000253866"	"0.000586377"	"1"	"1"	"6"	"O70194"	"O70194 [39-53]"	"O70194 1xBiotin [K41]"	"Eukaryotic translation initiation factor 3 subunit D [OS=Mus musculus]"	"1"	"1878.90546"	"0.61"	"0.49"	"0.23"	"-0.84"	"0.39"	"-0.21"	"-0.10"	"86.0"	"130.9"	"121.0"	"101.0"	"48.1"	"112.9"	"21022.439453125"	"32014.66015625"	"29584.888671875"	"24701.69921875"	"11756.8359375"	"27614.333984375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"939.95654"	"0.0001108"	"2.923E-06"	"2.84"	"43.25"
"7239"	"[R].FLIKEDVR.[D]"	"1xBiotin [K4]"	"0.0230169"	"0.00104877"	"1"	"1"	"6"	"Q921R4"	"Q921R4 [202-209]"	"Q921R4 1xBiotin [K205]"	"dnaJ homolog subfamily C member 14 [OS=Mus musculus]"	"1"	"1245.66600"	"0.99"	"0.76"	"0.43"	"0.67"	"0.56"	"-0.42"	"-0.20"	"66.0"	"130.7"	"112.0"	"88.9"	"104.9"	"97.6"	"24461.30859375"	"48444.53515625"	"41526.40625"	"32945.953125"	"38911.109375"	"36175.88671875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"623.33664"	"0.0001873"	"0.002143"	"2.39"	"42.80"
"7212"	"[K].FLEGNSVKPASWER.[E]"	"1xBiotin [K8]"	"9.64274E-05"	"0.000586377"	"1"	"2"	"6"	"Q9EQ32-1"	"Q9EQ32-1 [489-502]"	"Q9EQ32-1 1xBiotin [K496]"	"Phosphoinositide 3-kinase adapter protein 1 [OS=Mus musculus]"	"0"	"1845.89523"	"0.53"	"0.35"	"-0.28"	"-9.97"	"0.49"	"-0.04"	"0.14"	"100.9"	"145.4"	"128.8"	"83.3"	""	"141.6"	"16595.98046875"	"23910.80859375"	"21173.349609375"	"13697.302734375"	""	"23288.8515625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"923.45126"	"0.0001108"	"7.161E-07"	"3.48"	"43.84"
"13529"	"[K].LGKTAAFK.[A]"	"1xBiotin [K3]"	"0.0115118"	"0.000586377"	"1"	"1"	"6"	"O35857"	"O35857 [170-177]"	"O35857 1xBiotin [K172]"	"Mitochondrial import inner membrane translocase subunit TIM44 [OS=Mus musculus]"	"1"	"1061.58121"	"0.06"	"-0.34"	"0.11"	"0.11"	"-0.12"	"-0.18"	"0.22"	"101.3"	"106.0"	"80.3"	"109.5"	"109.6"	"93.3"	"100135.640625"	"104737.1953125"	"79355.7109375"	"108198.703125"	"108333.6328125"	"92149.8828125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"531.29413"	"0.0001108"	"0.0007743"	"3.00"	"34.63"
"13512"	"[R].IGGTVDNSVRPKLE.[-]"	"1xBiotin [K12]"	"0.022885"	"0.00104877"	"1"	"2"	"2"	"Q6P9J9"	"Q6P9J9 [898-911]"	"Q6P9J9 1xBiotin [K909]"	"Anoctamin-6 [OS=Mus musculus]"	"1"	"1710.88433"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"2"	"855.94605"	"0.0001873"	"0.002129"	"3.13"	""
"13507"	"[R].IGGSFKHPSSFEGK.[G]"	"1xBiotin [K6]"	"0.000493514"	"0.000586377"	"1"	"1"	"12"	"O88822"	"O88822 [250-263]"	"O88822 1xBiotin [K255]"	"lathosterol oxidase [OS=Mus musculus]"	"1"	"1703.82100"	"0.45"	"0.20"	"0.44"	"0.03"	"0.13"	"-0.31"	"-0.07"	"85.9"	"116.9"	"98.8"	"116.3"	"87.8"	"94.3"	"52424.8129882813"	"71403"	"60319.9140625"	"71038.5859375"	"53630.5844726563"	"57555.21484375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"568.61108"	"0.0001108"	"7.718E-06"	"3.69"	"35.42"
"7241"	"[R].FLLKSCPLLTK.[E]"	"1xBiotin [K4]; 1xCarbamidomethyl [C6]"	"0.000660557"	"0.000586377"	"1"	"1"	"5"	"Q9QXM0"	"Q9QXM0 [54-64]"	"Q9QXM0 1xBiotin [K57]"	"Monoacylglycerol lipase ABHD2 [OS=Mus musculus]"	"1"	"1545.85315"	"0.68"	"0.34"	"0.08"	"-2.85"	"0.52"	"-0.16"	"0.18"	"92.4"	"148.3"	"116.6"	"97.5"	"12.8"	"132.4"	"19448.28515625"	"31231.51171875"	"24547.546875"	"20531.068359375"	"2700.4013671875"	"27891.560546875"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"2"	"773.43042"	"0.0001108"	"1.183E-05"	"3.21"	"51.51"
"7260"	"[R].FLNKSSEDDGASER.[L]"	"1xBiotin [K4]"	"9.25705E-05"	"0.000586377"	"1"	"2"	"7"	"Q9R049"	"Q9R049 [597-610]"	"Q9R049 1xBiotin [K600]"	"E3 ubiquitin-protein ligase AMFR [OS=Mus musculus]"	"1"	"1780.78065"	"0.26"	"0.00"	"0.29"	"0.16"	"0.05"	"-0.21"	"0.04"	"91.4"	"109.2"	"91.6"	"111.3"	"102.2"	"94.4"	"42839.99609375"	"51194.64453125"	"42947.7890625"	"52200.69921875"	"47911.78125"	"44274.359375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"890.89387"	"0.0001108"	"6.724E-07"	"3.71"	"33.98"
"28881"	"[K].YYLAPK.[I]"	""	"0.0726021"	"0.00241047"	"1"	"1"	"3"	"P17918"	"P17918 [249-254]"	""	"proliferating cell nuclear antigen [OS=Mus musculus]"	"0"	"754.41340"	"0.56"	"0.41"	"0.39"	"0.11"	"0.17"	"-0.39"	"-0.25"	"82.0"	"120.7"	"109.2"	"107.6"	"88.4"	"92.1"	"6219.61376953125"	"9153.771484375"	"8287.634765625"	"8161.22119140625"	"6705.55615234375"	"6989.32763671875"	""	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"2"	"377.71049"	"0.000415"	"0.01188"	"0.90"	"23.22"
"7267"	"[K].FINYVKNCFR.[M]"	"1xBiotin [K6]; 1xCarbamidomethyl [C8]"	"0.00978691"	"0.000586377"	"1"	"1"	"3"	"Q61937"	"Q61937 [266-275]"	"Q61937 1xBiotin [K271]"	"Nucleophosmin [OS=Mus musculus]"	"1"	"1586.76065"	"-9.97"	"0.24"	"-9.97"	"-9.97"	"-9.97"	""	"-9.97"	"274.6"	""	"325.4"	""	""	""	"10723.4091796875"	""	"12705.5126953125"	""	""	""	""	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"2"	"793.88380"	"0.0001108"	"0.000611"	"1.99"	"46.58"
"7270"	"[R].FLPELHKTGTFK.[F]"	"1xBiotin [K7]"	"0.00157448"	"0.000586377"	"1"	"1"	"7"	"Q91VE0"	"Q91VE0 [584-595]"	"Q91VE0 1xBiotin [K590]"	"Long-chain fatty acid transport protein 4 [OS=Mus musculus]"	"1"	"1643.86141"	"0.65"	"0.49"	"-0.55"	"-9.97"	"0.02"	"-0.63"	"-0.47"	"105.8"	"166.1"	"148.3"	"72.5"	""	"107.3"	"36012.578125"	"56521.00390625"	"50462.30078125"	"24670.1015625"	""	"36519.85546875"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"548.62527"	"0.0001108"	"4.221E-05"	"3.33"	"42.83"
"13420"	"[R].LFSSKSSGK.[S]"	"1xBiotin [K5]"	"0.0132282"	"0.000586377"	"1"	"1"	"36"	"Q9EP72"	"Q9EP72 [216-224]"	"Q9EP72 1xBiotin [K220]"	"ER membrane protein complex subunit 7 [OS=Mus musculus]"	"1"	"1166.58742"	"0.13"	"-0.09"	"0.15"	"0.08"	"0.05"	"-0.08"	"0.14"	"96.1"	"105.2"	"90.3"	"106.9"	"101.7"	"99.8"	"2231771.89355469"	"2443090.54882813"	"2095035.49804688"	"2480535.56640625"	"2361264.66015625"	"2315987.77832031"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"583.79733"	"0.0001108"	"0.0009455"	"1.49"	"30.34"
"13521"	"[R].LGKDGQENGHITTK.[A]"	"1xBiotin [K3]"	"4.02077E-05"	"0.000586377"	"1"	"1"	"9"	"Q07113"	"Q07113 [2371-2384]"	"Q07113 1xBiotin [K2373]"	"Cation-independent mannose-6-phosphate receptor [OS=Mus musculus]"	"1"	"1723.84319"	"0.46"	"0.56"	"0.75"	"1.06"	"0.69"	"0.24"	"0.13"	"65.0"	"89.1"	"95.8"	"109.4"	"135.7"	"104.9"	"23622.642578125"	"32388.724609375"	"34812.109375"	"39780.40234375"	"49331.5087890625"	"38140.83984375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"575.28598"	"0.0001108"	"1.992E-07"	"3.89"	"25.79"
"13611"	"[K].LGQSVTTIPTVGFNVETVTYKNVK.[F]"	"1xBiotin [K21]"	"0.0814973"	"0.00241047"	"1"	"1"	"1"	"P62331"	"P62331 [35-58]"	"P62331 1xBiotin [K55]"	"ADP-ribosylation factor 6 [OS=Mus musculus]"	"1"	"2821.48044"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"3"	"941.16550"	"0.000415"	"0.01414"	"3.56"	""
"13646"	"[K].LGSTMKLVSHLTSQLNELK.[E]"	"1xBiotin [K6]; 1xOxidation [M5]"	"0.000904981"	"0.000586377"	"1"	"1"	"3"	"P70227"	"P70227 [2628-2646]"	"P70227 1xBiotin [K2633]"	"Inositol 1,4,5-trisphosphate receptor type 3 [OS=Mus musculus]"	"1"	"2341.22541"	""	""	""	""	"9.97"	"9.97"	"9.97"	""	""	""	""	""	"600.0"	""	""	""	""	""	"26208.1796875"	""	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"3"	"781.08008"	"0.0001108"	"1.87E-05"	"3.25"	"52.16"
"13689"	"[R].LHDGNHYVNKLTDLK.[C]"	"1xBiotin [K10]"	"0.00366424"	"0.000586377"	"1"	"1"	"3"	"Q9Z2B5"	"Q9Z2B5 [824-838]"	"Q9Z2B5 1xBiotin [K833]"	"Eukaryotic translation initiation factor 2-alpha kinase 3 [OS=Mus musculus]"	"1"	"1992.99601"	"0.46"	"0.16"	"-0.26"	"-9.97"	"-9.97"	"-9.97"	"-9.97"	"138.6"	"190.8"	"154.6"	"116.0"	""	""	"17868.681640625"	"24586.921875"	"19926.228515625"	"14947.1884765625"	""	""	""	"High"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"High"	"High"	"3"	"665.00387"	"0.0001108"	"0.0001451"	"3.74"	"38.93"
"7153"	"[R].FHSGNKSPEVLR.[A]"	"1xBiotin [K6]"	"2.14183E-05"	"0.000586377"	"1"	"1"	"26"	"Q99LI2"	"Q99LI2 [427-438]"	"Q99LI2 1xBiotin [K432]"	"chloride channel CLIC-like protein 1 [OS=Mus musculus]"	"1"	"1596.79512"	"0.21"	"0.35"	"0.01"	"-0.35"	"0.36"	"0.15"	"0.01"	"92.2"	"106.5"	"117.4"	"92.9"	"72.5"	"118.5"	"997161.390625"	"1152147.234375"	"1270063.109375"	"1005451.859375"	"784603.40625"	"1281747.421875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"798.90118"	"0.0001108"	"7.918E-08"	"3.58"	"31.95"
"7168"	"[R].FKEALGGPAWDYR.[N]"	"1xBiotin [K2]"	"0.000649104"	"0.000586377"	"1"	"3"	"3"	"Q9Z329-1"	"Q9Z329-1 [1588-1600]"	"Q9Z329-1 1xBiotin [K1589]"	"Inositol 1,4,5-trisphosphate receptor type 2 [OS=Mus musculus]"	"1"	"1735.82609"	"0.32"	"0.45"	"-0.29"	"-2.10"	"0.25"	"-0.07"	"-0.20"	"102.4"	"127.8"	"140.2"	"83.6"	"23.9"	"122.1"	"23720.20703125"	"29591.8671875"	"32454.974609375"	"19358.125"	"5543.18701171875"	"28265.7265625"	""	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"2"	"868.41640"	"0.0001108"	"1.156E-05"	"2.69"	"47.39"
"13820"	"[R].LKELGPLPSHDAGR.[L]"	"1xBiotin [K2]"	"5.83456E-06"	"0.000586377"	"1"	"1"	"17"	"Q921R8-1"	"Q921R8-1 [17-30]"	"Q921R8-1 1xBiotin [K18]"	"Solute carrier family 41 member 3 [OS=Mus musculus]"	"1"	"1715.88975"	"0.14"	"0.04"	"0.06"	"-0.12"	"-0.03"	"-0.16"	"-0.07"	"98.8"	"108.5"	"101.9"	"102.7"	"91.2"	"96.9"	"191317.466796875"	"210188.107421875"	"197316.41015625"	"198852.309570313"	"176621.345703125"	"187546.004882813"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"572.63468"	"0.0001108"	"1.194E-08"	"4.52"	"37.09"
"13819"	"[R].LKELEESAAIQK.[I]"	"1xBiotin [K2]"	"2.37888E-05"	"0.000586377"	"1"	"2"	"17"	"Q8R2Y0-1"	"Q8R2Y0-1 [188-199]"	"Q8R2Y0-1 1xBiotin [K189]"	"Monoacylglycerol lipase ABHD6 [OS=Mus musculus]"	"1"	"1584.83017"	"0.04"	"0.09"	"0.03"	"0.05"	"0.30"	"0.26"	"0.21"	"94.0"	"96.5"	"100.2"	"96.3"	"97.4"	"115.5"	"278912.9609375"	"286104.61328125"	"297208.09375"	"285572.8046875"	"288893.8828125"	"342676.78515625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"792.91872"	"0.0001108"	"9.267E-08"	"4.16"	"37.32"
"7172"	"[K].FKGPFTDVVTTNLK.[L]"	"1xBiotin [K2]"	"0.00104697"	"0.000586377"	"1"	"1"	"9"	"Q9WV55"	"Q9WV55 [25-38]"	"Q9WV55 1xBiotin [K26]"	"vesicle-associated membrane protein-associated protein A [OS=Mus musculus]"	"1"	"1792.93022"	"0.16"	"0.03"	"-0.12"	"-3.03"	"0.02"	"-0.14"	"-0.01"	"115.4"	"129.2"	"118.1"	"106.2"	"14.1"	"117.0"	"34560.75390625"	"38701.12890625"	"35371.6171875"	"31802.416015625"	"4235.34326171875"	"35039.01953125"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"2"	"896.96942"	"0.0001108"	"2.322E-05"	"3.01"	"50.71"
"13816"	"[K].LKEGAENLR.[RK]"	"1xBiotin [K2]"	"0.00462481"	"0.000586377"	"1"	"5"	"7"	"P70268"	"P70268 [52-60]"	"P70268 1xBiotin [K53]"	"serine/threonine-protein kinase N1 [OS=Mus musculus]"	"1"	"1255.64633"	"0.63"	"0.43"	"0.18"	"0.19"	"0.25"	"-0.38"	"-0.19"	"81.6"	"126.0"	"110.1"	"92.2"	"93.3"	"96.8"	"121827.390625"	"188228.515625"	"164411.890625"	"137734.40625"	"139389.578125"	"144544.453125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"628.32688"	"0.0001108"	"0.0002033"	"2.98"	"30.17"
"13814"	"[R].IKEEYEVAEMGAPHGSASVR.[T]"	"1xBiotin [K2]; 1xOxidation [M10]"	"1.09972E-07"	"0.000586377"	"1"	"1"	"6"	"Q9CQW9"	"Q9CQW9 [23-42]"	"Q9CQW9 1xBiotin [K24]"	"Interferon-induced transmembrane protein 3 [OS=Mus musculus]"	"1"	"2402.11151"	"0.24"	"0.08"	"0.22"	"-0.77"	"0.41"	"0.17"	"0.33"	"95.0"	"112.3"	"100.5"	"110.4"	"55.5"	"126.2"	"63817.765625"	"75420.7734375"	"67509.765625"	"74142.8984375"	"37305.87109375"	"84770.125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"801.37543"	"0.0001108"	"3.599E-11"	"5.41"	"33.80"
"13813"	"[R].IKEEYEVAEMGAPHGSASVR.[T]"	"1xBiotin [K2]"	"9.50535E-08"	"0.000586377"	"1"	"1"	"6"	"Q9CQW9"	"Q9CQW9 [23-42]"	"Q9CQW9 1xBiotin [K24]"	"Interferon-induced transmembrane protein 3 [OS=Mus musculus]"	"1"	"2386.11659"	""	"9.97"	"9.97"	"9.97"	""	""	"-9.97"	""	""	"194.1"	"174.2"	"231.8"	""	""	""	"28296.767578125"	"25395.66796875"	"33799.1328125"	""	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"796.04442"	"0.0001108"	"2.92E-11"	"4.80"	"37.94"
"13812"	"[R].LKEEQKEEEER.[K]"	"1xBiotin [K2]"	"0.00135308"	"0.000586377"	"1"	"1"	"8"	"Q80WW9"	"Q80WW9 [166-176]"	"Q80WW9 1xBiotin [K167]"	"DDRGK domain-containing protein 1 [OS=Mus musculus]"	"2"	"1672.78468"	"0.35"	"0.50"	"0.62"	"0.11"	"0.24"	"-0.11"	"-0.27"	"80.1"	"102.1"	"113.6"	"123.5"	"86.3"	"94.4"	"15005.146484375"	"19132.021484375"	"21271.61328125"	"23135.84765625"	"16173.76953125"	"17675.3125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"558.26616"	"0.0001108"	"3.378E-05"	"2.56"	"20.70"
"7180"	"[K].FKNESNSLHTYSESPAAPR.[E]"	"1xBiotin [K2]"	"0.000148461"	"0.000586377"	"1"	"1"	"6"	"Q9QZ15"	"Q9QZ15 [12-30]"	"Q9QZ15 1xBiotin [K13]"	"C-type lectin domain family 4 member A [OS=Mus musculus]"	"1"	"2361.09282"	"-9.97"	"0.40"	"0.42"	"0.19"	"0.34"	"9.97"	"-0.06"	"99.0"	""	"130.4"	"132.5"	"113.1"	"125.0"	"18194.47265625"	""	"23979.134765625"	"24356.716796875"	"20802.880859375"	"22978.896484375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"787.70223"	"0.0001108"	"1.339E-06"	"3.71"	"33.26"
"13807"	"[R].LKDSWAER.[L]"	"1xBiotin [K2]"	"0.0195914"	"0.000586377"	"1"	"1"	"5"	"Q8K0C4"	"Q8K0C4 [411-418]"	"Q8K0C4 1xBiotin [K412]"	"lanosterol 14-alpha demethylase [OS=Mus musculus]"	"1"	"1230.59357"	"0.46"	"0.37"	"-9.97"	"0.18"	"0.24"	"-0.21"	"-0.12"	"100.3"	"137.6"	"129.4"	""	"114.0"	"118.8"	"30641.482421875"	"42043.2109375"	"39524.08984375"	""	"34828.33203125"	"36286.49609375"	""	"High"	"High"	"High"	"Not Found"	"Peak Found"	"High"	"High"	"2"	"615.80044"	"0.0001108"	"0.001685"	"1.91"	"35.54"
"7193"	"[R].FKWAIELSGPGGGSR.[G]"	"1xBiotin [K2]"	"0.00707044"	"0.000586377"	"1"	"1"	"4"	"Q9CZX9"	"Q9CZX9 [15-29]"	"Q9CZX9 1xBiotin [K16]"	"ER membrane protein complex subunit 4 [OS=Mus musculus]"	"1"	"1787.88975"	"0.32"	"-0.09"	"-9.97"	"-9.97"	"0.25"	"-0.07"	"0.34"	"137.1"	"171.2"	"128.9"	""	""	"162.8"	"9578.8076171875"	"11966.0126953125"	"9011.5400390625"	""	""	"11375.4052734375"	""	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"2"	"894.44853"	"0.0001108"	"0.0003779"	"2.58"	"52.67"
"13803"	"[K].IKDPDAAKPEDWDER.[A]"	"1xBiotin [K2]"	"5.38195E-05"	"0.000586377"	"1"	"1"	"6"	"P14211"	"P14211 [208-222]"	"P14211 1xBiotin [K209]"	"Calreticulin [OS=Mus musculus]"	"1"	"2010.92257"	"0.66"	"0.12"	"0.62"	"0.13"	"0.64"	"-0.02"	"0.52"	"76.5"	"120.6"	"82.9"	"117.3"	"83.5"	"119.2"	"10844.5634765625"	"17101.544921875"	"11759.3330078125"	"16625.18359375"	"11837.3984375"	"16901.4453125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"670.97902"	"0.0001108"	"3.056E-07"	"3.71"	"34.94"
"13798"	"[K].LKDLLAEK.[E]"	"1xBiotin [K2]"	"0.00939743"	"0.000586377"	"1"	"1"	"5"	"B1AVY7"	"B1AVY7 [669-676]"	"B1AVY7 1xBiotin [K670]"	"Kinesin-like protein KIF16B [OS=Mus musculus]"	"1"	"1155.64421"	"0.45"	"0.29"	"0.37"	"0.12"	"0.40"	"-0.06"	"0.10"	"82.3"	"112.6"	"101.0"	"106.3"	"89.5"	"108.3"	"21536.474609375"	"29446.677734375"	"26418.5"	"27810.625"	"23402.759765625"	"28319.83984375"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"2"	"578.32579"	"0.0001108"	"0.0005724"	"3.15"	"41.42"
"13717"	"[R].LHKSPGLLAVPPEEMAASAAAAIVSPEEELDGCEPEAIGK.[R]"	"1xBiotin [K3]; 1xCarbamidomethyl [C33]; 1xOxidation [M15]"	"0.0166696"	"0.000586377"	"1"	"2"	"4"	"P97287"	"P97287 [78-117]"	"P97287 1xBiotin [K80]"	"Induced myeloid leukemia cell differentiation protein Mcl-1 homolog [OS=Mus musculus]"	"1"	"4326.09784"	"-9.97"	"-0.78"	"-9.97"	"-9.97"	"-9.97"	""	"-9.97"	"378.8"	""	"221.2"	""	""	""	"56670.791015625"	""	"33093.3046875"	""	""	""	""	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"4"	"1082.27774"	"0.0001108"	"0.001333"	"4.36"	"55.59"
"13715"	"[K].LHKPPVDVGVDSR.[E]"	"1xBiotin [K3]"	"0.000197564"	"0.000586377"	"1"	"1"	"10"	"P57787"	"P57787 [434-446]"	"P57787 1xBiotin [K436]"	"Monocarboxylate transporter 4 [OS=Mus musculus]"	"0"	"1644.85264"	"0.04"	"0.22"	"-0.48"	"0.09"	"0.03"	"-0.02"	"-0.20"	"100.0"	"103.0"	"116.8"	"71.8"	"106.6"	"101.9"	"30971.748046875"	"31920.341796875"	"36170.3359375"	"22228.34375"	"33008.44140625"	"31562.5234375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"548.95567"	"0.0001108"	"2.039E-06"	"3.81"	"35.70"
"13699"	"[R].LHFFMPGFAPLTSR.[G]"	"1xOxidation [M5]"	"0.000314997"	"0.000586377"	"1"	"5"	"6"	"P99024"	"P99024 [263-276]"	""	"tubulin beta-5 chain [OS=Mus musculus]"	"0"	"1636.83044"	"0.07"	"0.15"	"-1.04"	"-9.97"	"0.15"	"0.08"	"0.00"	"126.1"	"132.8"	"139.7"	"61.3"	""	"140.0"	"116919.765625"	"123110.375"	"129471.3828125"	"56855.35546875"	""	"129792.4765625"	""	"High"	"High"	"High"	"Peak Found"	"Not Found"	"High"	"High"	"3"	"546.28163"	"0.0001108"	"4.007E-06"	"4.61"	"47.53"
"13698"	"[R].LHFFMPGFAPLTSR.[G]"	""	"0.00075096"	"0.000586377"	"1"	"5"	"8"	"P99024"	"P99024 [263-276]"	""	"tubulin beta-5 chain [OS=Mus musculus]"	"0"	"1620.83553"	"0.54"	"0.64"	"-3.11"	"-9.97"	"0.43"	"-0.10"	"-0.20"	"109.5"	"159.1"	"170.6"	"12.7"	""	"148.1"	"57069.052734375"	"82895.1484375"	"88890.38671875"	"6598.015625"	""	"77148.3818359375"	""	"High"	"High"	"High"	"Peak Found"	"Not Found"	"High"	"High"	"3"	"540.94974"	"0.0001108"	"1.426E-05"	"3.65"	"53.64"
"13696"	"[R].LHEPEKNAR.[E]"	"1xBiotin [K6]"	"0.0226234"	"0.00104877"	"1"	"3"	"9"	"P97797"	"P97797 [412-420]"	"P97797 1xBiotin [K417]"	"tyrosine-protein phosphatase non-receptor type substrate 1 [OS=Mus musculus]"	"1"	"1319.65248"	"0.15"	"0.19"	"0.26"	"0.02"	"0.46"	"0.31"	"0.28"	"87.8"	"97.4"	"99.8"	"105.1"	"88.9"	"121.0"	"108178.890625"	"119994.0234375"	"123039.603515625"	"129506.443359375"	"109595.466796875"	"149172.142578125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"660.32942"	"0.0001873"	"0.002087"	"1.80"	"23.04"
"7123"	"[K].FGSYLGYSVGAGHFR.[S]"	""	"0.00633127"	"0.000586377"	"1"	"1"	"2"	"Q00651"	"Q00651 [254-268]"	""	"Integrin alpha-4 [OS=Mus musculus]"	"0"	"1617.78085"	""	"9.97"	"9.97"	""	""	""	"-9.97"	""	""	"340.6"	"259.4"	""	""	""	""	"10775.2900390625"	"8203.6494140625"	""	""	""	"High"	"Not Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"High"	"3"	"539.93168"	"0.0001108"	"0.0003219"	"2.56"	"39.95"
"14487"	"[R].LLLPGELAKHAVSEGTK.[A]"	"1xBiotin [K]"	"2.28373E-05"	"0.000586377"	"2"	"13"	"14"	"Q64525; P10854"	"Q64525 [101-117]; P10854 [101-117]"	"Q64525 1xBiotin [K]; P10854 1xBiotin [K]"	"Histone H2B type 2-B [OS=Mus musculus];Histone H2B type 1-M [OS=Mus musculus]"	"1"	"1989.08376"	"0.62"	"0.51"	"0.08"	"-2.60"	"0.62"	"0.00"	"0.11"	"89.2"	"137.0"	"127.3"	"94.5"	"14.7"	"137.3"	"245547.29296875"	"377298.3828125"	"350424.4609375"	"260259.71875"	"40564.89453125"	"377996.16796875"	"NotUnique"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"995.04594"	"0.0001108"	"8.715E-08"	"3.95"	"48.05"
"6954"	"[R].FAKQPVYTLVDR.[E]"	"1xBiotin [K3]"	"0.00243744"	"0.000586377"	"1"	"1"	"3"	"Q9QXX0"	"Q9QXX0 [1170-1181]"	"Q9QXX0 1xBiotin [K1172]"	"Protein jagged-1 [OS=Mus musculus]"	"1"	"1662.86722"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"0.23"	"0.21"	""	"143.9"	"145.3"	"103.8"	"38.5"	"168.5"	""	"11354.7099609375"	"11461.2724609375"	"8188.70947265625"	"3040.94116210938"	"13295.10546875"	""	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"2"	"831.93735"	"0.0001108"	"7.957E-05"	"2.48"	"46.67"
"14500"	"[R].ILLQSKNAGAVIGK.[G]"	"1xBiotin [K6]"	"0.000165856"	"0.000586377"	"1"	"3"	"4"	"P61979"	"P61979 [47-60]"	"P61979 1xBiotin [K52]"	"Heterogeneous nuclear ribonucleoprotein K [OS=Mus musculus]"	"1"	"1637.94072"	"9.97"	""	"9.97"	""	""	"-9.97"	""	""	"298.4"	""	"301.6"	""	""	""	"9831.9072265625"	""	"9937.59375"	""	""	""	"High"	"High"	"Not Found"	"High"	"Not Found"	"High"	"High"	"2"	"819.47462"	"0.0001108"	"1.568E-06"	"4.03"	"42.45"
"15532"	"[K].IQAENTNKAAK.[K]"	"1xBiotin [K8]"	"0.00261392"	"0.000586377"	"1"	"1"	"3"	"Q61334"	"Q61334 [139-149]"	"Q61334 1xBiotin [K146]"	"B-cell receptor-associated protein 29 [OS=Mus musculus]"	"1"	"1413.71547"	"0.10"	"0.11"	"-0.07"	"0.26"	"0.12"	"0.02"	"0.01"	"93.8"	"100.8"	"101.4"	"89.5"	"112.4"	"102.0"	"10375.494140625"	"11157.6279296875"	"11217.5634765625"	"9902.576171875"	"12440.48828125"	"11289.0419921875"	""	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"2"	"707.36149"	"0.0001108"	"8.794E-05"	"2.54"	"22.53"
"6594"	"[K].ESNSFAENGCKGK.[K]"	"1xBiotin [K11]; 1xCarbamidomethyl [C10]"	"0.00050516"	"0.000586377"	"1"	"1"	"7"	"O88822"	"O88822 [276-288]"	"O88822 1xBiotin [K286]"	"lathosterol oxidase [OS=Mus musculus]"	"1"	"1653.69957"	"0.44"	"0.32"	"0.46"	"0.55"	"0.18"	"-0.25"	"-0.13"	"79.1"	"107.2"	"98.6"	"109.0"	"116.1"	"89.9"	"32291.494140625"	"43779.3828125"	"40255.33203125"	"44512.82421875"	"47383.46484375"	"36706.31640625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"827.35333"	"0.0001108"	"7.994E-06"	"2.36"	"27.50"
"15523"	"[R].LPYDASKWEFAR.[E]"	"1xBiotin [K7]"	"1.98546E-05"	"0.000586377"	"1"	"1"	"5"	"P35969"	"P35969 [814-825]"	"P35969 1xBiotin [K820]"	"Vascular endothelial growth factor receptor 1 [OS=Mus musculus]"	"1"	"1708.81519"	"-0.12"	"-0.04"	"-1.07"	"-3.78"	"-0.12"	"0.00"	"-0.08"	"137.4"	"126.5"	"134.1"	"65.6"	"10.0"	"126.4"	"40556.25390625"	"37350.7109375"	"39571.421875"	"19362.65625"	"2949.77758789063"	"37321.5390625"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"2"	"854.91123"	"0.0001108"	"7.079E-08"	"3.64"	"50.49"
"15483"	"[R].IPTRPFEEGKK.[I]"	"1xBiotin [K10]"	"0.000688074"	"0.000586377"	"1"	"2"	"8"	"Q99JX3"	"Q99JX3 [202-212]"	"Q99JX3 1xBiotin [K211]"	"Golgi reassembly-stacking protein 2 [OS=Mus musculus]"	"1"	"1527.79881"	"0.38"	"0.10"	"0.24"	"0.78"	"0.53"	"0.15"	"0.43"	"77.8"	"101.0"	"83.4"	"92.0"	"133.5"	"112.3"	"209225.296875"	"271719.65625"	"224206.328125"	"247333.90625"	"358937.375"	"302051.15625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"764.40314"	"0.0001108"	"1.258E-05"	"2.84"	"31.80"
"15450"	"[K].IPSAVSTVSMQNIHPKAVTSDR.[I]"	"1xBiotin [K16]; 1xOxidation [M10]"	"7.90846E-05"	"0.000586377"	"1"	"1"	"6"	"Q61165"	"Q61165 [601-622]"	"Q61165 1xBiotin [K616]"	"Sodium/hydrogen exchanger 1 [OS=Mus musculus]"	"1"	"2580.29087"	"-0.23"	"-0.27"	"-0.50"	"-2.60"	"-0.48"	"-0.25"	"-0.21"	"140.6"	"119.6"	"116.6"	"99.5"	"23.1"	"100.6"	"34477.3828125"	"29326.2421875"	"28580.85546875"	"24409.994140625"	"5671.61474609375"	"24661.703125"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"3"	"860.76834"	"0.0001108"	"5.363E-07"	"3.30"	"37.28"
"15421"	"[K].LPPPKPLPGTLKR.[R]"	"1xBiotin [K12]"	"0.00026911"	"0.000586377"	"1"	"1"	"9"	"O35598"	"O35598 [711-723]"	"O35598 1xBiotin [K722]"	"Disintegrin and metalloproteinase domain-containing protein 10 [OS=Mus musculus]"	"1"	"1639.97163"	"0.30"	"0.25"	"-0.12"	"-1.06"	"0.20"	"-0.10"	"-0.06"	"100.6"	"123.6"	"119.8"	"92.5"	"48.4"	"115.2"	"22760.25"	"27957.017578125"	"27107.20703125"	"20926.572265625"	"10945.302734375"	"26060.642578125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"547.32914"	"0.0001108"	"3.19E-06"	"2.97"	"35.68"
"6597"	"[R].ESPIFKQFFK.[N]"	"1xBiotin [K6]"	"0.018282"	"0.000586377"	"1"	"1"	"4"	"P24452"	"P24452 [340-349]"	"P24452 1xBiotin [K345]"	"Macrophage-capping protein [OS=Mus musculus]"	"1"	"1496.76063"	""	"9.97"	""	""	""	""	"-9.97"	""	""	"600.0"	""	""	""	""	""	"5980.458984375"	""	""	""	""	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"2"	"748.88445"	"0.0001108"	"0.001528"	"2.32"	"56.15"
"15418"	"[R].LPPNTNDEVDEDPTGNKALWDR.[G]"	"1xBiotin [K17]"	"2.88369E-05"	"0.000586377"	"1"	"2"	"15"	"Q921M3-1"	"Q921M3-1 [1058-1079]"	"Q921M3-1 1xBiotin [K1074]"	"Splicing factor 3B subunit 3 [OS=Mus musculus]"	"1"	"2722.24133"	"1.50"	"0.97"	"1.03"	"-0.14"	"1.08"	"-0.42"	"0.11"	"55.2"	"156.6"	"108.2"	"113.0"	"50.2"	"116.7"	"15743.666015625"	"44667.265625"	"30842.54296875"	"32230.53125"	"14326.0556640625"	"33284.1953125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"908.08631"	"0.0001108"	"1.226E-07"	"5.09"	"44.47"
"15533"	"[K].IQAKLPGIAK.[K]"	"1xBiotin [K4]"	"0.000700215"	"0.000586377"	"1"	"5"	"6"	"Q9ES97-1"	"Q9ES97-1 [951-960]"	"Q9ES97-1 1xBiotin [K954]"	"Reticulon-3 [OS=Mus musculus]"	"1"	"1264.74459"	"-0.15"	"0.07"	"-0.32"	"-0.44"	"0.13"	"0.28"	"0.06"	"107.5"	"96.9"	"112.4"	"86.2"	"79.5"	"117.6"	"30134.810546875"	"27162.7734375"	"31524.701171875"	"24156.3515625"	"22281.34375"	"32973.1328125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"632.87585"	"0.0001108"	"1.292E-05"	"3.31"	"39.87"
"15401"	"[K].IPNPSKSLLFQDGGK.[G]"	"1xBiotin [K6]"	"1.81916E-05"	"0.000586377"	"1"	"2"	"6"	"P26954"	"P26954 [480-494]"	"P26954 1xBiotin [K485]"	"Interleukin-3 receptor class 2 subunit beta [OS=Mus musculus]"	"1"	"1826.94693"	"0.26"	"0.02"	"0.01"	"-0.11"	"0.54"	"0.28"	"0.52"	"91.0"	"108.8"	"92.1"	"91.3"	"84.5"	"132.2"	"14208.462890625"	"17000.248046875"	"14392.9150390625"	"14263.15625"	"13207.666015625"	"20655.021484375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"913.97685"	"0.0001108"	"6.268E-08"	"4.08"	"47.22"
"15382"	"[R].IPIITSAKTLELAK.[V]"	"1xBiotin [K8]"	"0.00151154"	"0.000586377"	"1"	"3"	"3"	"Q922T2"	"Q922T2 [199-212]"	"Q922T2 1xBiotin [K206]"	"Microfibril-associated glycoprotein 3 [OS=Mus musculus]"	"1"	"1724.00265"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"2"	"862.50484"	"0.0001108"	"3.951E-05"	"2.90"	""
"15373"	"[K].LPLKPNDLKTR.[S]"	"1xBiotin [K9]"	"0.00324251"	"0.000586377"	"1"	"1"	"11"	"Q6P9J9"	"Q6P9J9 [146-156]"	"Q6P9J9 1xBiotin [K154]"	"Anoctamin-6 [OS=Mus musculus]"	"1"	"1520.86174"	"0.20"	"0.51"	"-0.08"	"0.26"	"0.25"	"0.05"	"-0.25"	"86.9"	"100.0"	"123.6"	"82.0"	"103.8"	"103.6"	"42560.39453125"	"48961.4375"	"60491.880859375"	"40143.64453125"	"50823.8701171875"	"50708.44921875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"507.62525"	"0.0001108"	"0.0001208"	"3.31"	"35.64"
"15354"	"[R].IPKPQHKVR.[G]"	"1xBiotin [K7]"	"0.00355911"	"0.000586377"	"1"	"2"	"24"	"Q8VCW4"	"Q8VCW4 [529-537]"	"Q8VCW4 1xBiotin [K535]"	"Protein unc-93 homolog B1 [OS=Mus musculus]"	"1"	"1328.76197"	"0.75"	"0.51"	"0.36"	"0.60"	"0.52"	"-0.23"	"0.01"	"72.0"	"120.8"	"102.5"	"92.2"	"109.2"	"103.3"	"322019.529296875"	"540555.34765625"	"458577.82421875"	"412387.4453125"	"488618.0234375"	"462015.9140625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"443.59217"	"0.0001108"	"0.0001384"	"2.78"	"20.40"
"15352"	"[R].IPKIQQLVK.[E]"	"1xBiotin [K3]"	"0.0206337"	"0.000586377"	"1"	"1"	"5"	"P20029"	"P20029 [369-377]"	"P20029 1xBiotin [K371]"	"78 kDa glucose-regulated protein [OS=Mus musculus]"	"1"	"1292.77589"	"0.08"	"0.01"	"-0.16"	"-0.14"	"-0.26"	"-0.34"	"-0.27"	"105.3"	"111.0"	"106.2"	"94.0"	"95.6"	"87.9"	"12407.0849609375"	"13081.7119140625"	"12508.5986328125"	"11075.9033203125"	"11261.8779296875"	"10357.02734375"	""	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"2"	"646.89103"	"0.0001108"	"0.001817"	"1.88"	"44.45"
"15343"	"[R].LPKASEEGHLAVSESQLVDAK.[S]"	"1xBiotin [K3]"	"0.000976234"	"0.000586377"	"1"	"1"	"1"	"Q921R8-1"	"Q921R8-1 [31-51]"	"Q921R8-1 1xBiotin [K33]"	"Solute carrier family 41 member 3 [OS=Mus musculus]"	"1"	"2434.22825"	"-0.05"	"-9.97"	"0.20"	"-9.97"	"0.46"	"0.51"	"9.97"	"133.5"	"129.2"	""	"153.5"	""	"183.9"	"22886.845703125"	"22159.87109375"	""	"26314.916015625"	""	"31528.384765625"	""	"High"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"3"	"812.08095"	"0.0001108"	"2.089E-05"	"3.46"	"40.42"
"15337"	"[R].IPGTFKGER.[L]"	"1xBiotin [K6]"	"0.0591084"	"0.0019826"	"1"	"1"	"6"	"Q5SW45"	"Q5SW45 [467-475]"	"Q5SW45 1xBiotin [K472]"	"Meckel syndrome type 1 protein homolog [OS=Mus musculus]"	"1"	"1230.62995"	"0.08"	"0.06"	"0.41"	"-0.21"	"-0.13"	"-0.21"	"-0.19"	"96.8"	"102.1"	"100.9"	"128.3"	"83.5"	"88.4"	"30238.46484375"	"31919.5625"	"31539.83984375"	"40081.16015625"	"26106.033203125"	"27620.47265625"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"2"	"615.81835"	"0.0003442"	"0.008693"	"2.57"	"34.69"
"15314"	"[R].IPFAGKVEVCCFDK.[T]"	"1xBiotin [K6]; 2xCarbamidomethyl [C10; C11]"	"6.87558E-05"	"0.000586377"	"1"	"1"	"4"	"Q9EPE9"	"Q9EPE9 [518-531]"	"Q9EPE9 1xBiotin [K523]"	"manganese-transporting ATPase 13A1 [OS=Mus musculus]"	"1"	"1895.88526"	"9.97"	"9.97"	"9.97"	""	"9.97"	"0.18"	"0.29"	""	"157.4"	"145.8"	"118.7"	""	"178.1"	""	"15235.5078125"	"14105.87109375"	"11485.826171875"	""	"17237.224609375"	""	"High"	"High"	"High"	"Peak Found"	"Not Found"	"High"	"High"	"2"	"948.44664"	"0.0001108"	"4.349E-07"	"3.75"	"50.09"
"15300"	"[K].IPEHDLDPNVTIILKEPVR.[V]"	"1xBiotin [K15]"	"2.31052E-05"	"0.000586377"	"1"	"12"	"9"	"Q99PL5-1"	"Q99PL5-1 [83-101]"	"Q99PL5-1 1xBiotin [K97]"	"Ribosome-binding protein 1 [OS=Mus musculus]"	"1"	"2424.29554"	"0.80"	"0.19"	"0.01"	"-4.06"	"0.45"	"-0.35"	"0.26"	"95.2"	"165.2"	"108.3"	"95.7"	"5.7"	"130.0"	"66911.5703125"	"116098.78125"	"76113.6875"	"67253"	"4025.42797851563"	"91368.1796875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"808.77033"	"0.0001108"	"8.871E-08"	"5.09"	"50.87"
"15388"	"[R].LPLQDVYKIGGIGTVPVGR.[V]"	"1xBiotin [K8]"	"0.000676144"	"0.000586377"	"1"	"2"	"5"	"P10126"	"P10126 [248-266]"	"P10126 1xBiotin [K255]"	"Elongation factor 1-alpha 1 [OS=Mus musculus]"	"1"	"2208.22092"	"0.63"	"0.68"	"-0.58"	"-9.97"	"0.43"	"-0.20"	"-0.24"	"97.4"	"150.7"	"155.5"	"65.0"	""	"131.5"	"16714.146484375"	"25866.8046875"	"26701.220703125"	"11151.2529296875"	""	"22573.408203125"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"736.74537"	"0.0001108"	"1.229E-05"	"4.23"	"55.28"
"15534"	"[K].LQALKDTANR.[L]"	"1xBiotin [K5]"	"0.022885"	"0.00104877"	"1"	"1"	"4"	"P40142"	"P40142 [12-21]"	"P40142 1xBiotin [K16]"	"Transketolase [OS=Mus musculus]"	"1"	"1355.70999"	"0.18"	"0.01"	"-9.97"	"-9.97"	"-9.97"	"-9.97"	"-9.97"	"191.2"	"216.7"	"192.0"	""	""	""	"7908.35400390625"	"8963.216796875"	"7940.900390625"	""	""	""	""	"High"	"Peak Found"	"High"	"High"	"Not Found"	"High"	"High"	"2"	"678.35809"	"0.0001873"	"0.002114"	"2.21"	"32.45"
"15540"	"[K].LQCLKDFHK.[D]"	"1xBiotin [K5]; 1xCarbamidomethyl [C3]"	"0.00478912"	"0.000586377"	"1"	"1"	"13"	"O35316"	"O35316 [7-15]"	"O35316 1xBiotin [K11]"	"Sodium- and chloride-dependent taurine transporter [OS=Mus musculus]"	"1"	"1414.69699"	"0.32"	"0.26"	"0.35"	"0.56"	"0.56"	"0.24"	"0.30"	"78.3"	"97.7"	"93.7"	"99.7"	"115.4"	"115.3"	"556805.8359375"	"694215.546875"	"665784.546875"	"708655.375"	"820231.625"	"819583.140625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"707.85184"	"0.0001108"	"0.0002139"	"3.27"	"35.26"
"15564"	"[R].LQELALVLKK.[C]"	"1xBiotin [K]"	"0.0149367"	"0.000586377"	"1"	"1"	"4"	"Q8C1E7"	"Q8C1E7 [58-67]"	"Q8C1E7 1xBiotin [K]"	"Transmembrane protein 120A [OS=Mus musculus]"	"1"	"1380.82832"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"High"	"Not Found"	"High"	"Not Found"	"High"	"High"	"2"	"690.91728"	"0.0001108"	"0.001133"	"2.27"	""
"15952"	"[R].LSKEDIER.[M]"	"1xBiotin [K3]"	"0.00967402"	"0.000586377"	"1"	"1"	"7"	"P63017"	"P63017 [510-517]"	"P63017 1xBiotin [K512]"	"Heat shock cognate 71 kDa protein [OS=Mus musculus]"	"1"	"1215.60380"	"0.34"	"0.20"	"-0.13"	"0.59"	"0.21"	"-0.14"	"0.01"	"85.8"	"108.9"	"98.5"	"78.5"	"129.1"	"99.2"	"328258.53125"	"416445.03125"	"376867.75"	"300042.8125"	"493756.8125"	"379182.5"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"608.30555"	"0.0001108"	"0.000597"	"3.29"	"35.66"
"6425"	"[R].EQTKVDHFWGLDDDGDLKGGNK.[A]"	"1xBiotin [K4]"	"2.7958E-07"	"0.000586377"	"1"	"5"	"15"	"Q9D666-1"	"Q9D666-1 [143-164]"	"Q9D666-1 1xBiotin [K146]"	"SUN domain-containing protein 1 [OS=Mus musculus]"	"2"	"2700.23585"	"0.43"	"0.18"	"-1.84"	"-3.38"	"0.64"	"0.21"	"0.46"	"111.0"	"149.5"	"125.4"	"30.9"	"10.7"	"172.5"	"210983.42578125"	"284316.4375"	"238453.90234375"	"58835.12890625"	"20264.2822265625"	"327871.864257813"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"900.74971"	"0.0001108"	"1.414E-10"	"6.14"	"44.25"
"6481"	"[K].ERPQVGGTIKQPPTNPPPRPPAEVR.[K]"	"1xBiotin [K10]"	"6.95624E-05"	"0.000586377"	"1"	"2"	"29"	"Q61462"	"Q61462 [140-164]"	"Q61462 1xBiotin [K149]"	"Cytochrome b-245 light chain [OS=Mus musculus]"	"1"	"2944.55740"	"0.14"	"0.07"	"-0.07"	"-0.35"	"0.03"	"-0.11"	"-0.03"	"101.5"	"111.9"	"106.3"	"96.6"	"79.7"	"103.9"	"170365.58203125"	"187935.001953125"	"178533.89453125"	"162094.134765625"	"133847.017578125"	"174475.603515625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"4"	"736.89488"	"0.0001108"	"4.413E-07"	"3.65"	"33.42"
"15920"	"[R].ISFKGTPTEEQVR.[E]"	"1xBiotin [K4]"	"0.000164891"	"0.000586377"	"1"	"1"	"6"	"Q9Z268"	"Q9Z268 [395-407]"	"Q9Z268 1xBiotin [K398]"	"RasGAP-activating-like protein 1 [OS=Mus musculus]"	"1"	"1717.85778"	"0.41"	"0.07"	"0.41"	"0.26"	"0.31"	"-0.10"	"0.24"	"84.0"	"111.5"	"87.9"	"111.8"	"100.8"	"104.0"	"67767.75"	"90040.359375"	"70968.0546875"	"90252.6171875"	"81365.203125"	"83917.578125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"859.43243"	"0.0001108"	"1.567E-06"	"3.50"	"39.16"
"6490"	"[K].ERSYETMLSFGKR.[S]"	"1xBiotin [K12]; 1xOxidation [M7]"	"0.0510902"	"0.00154748"	"1"	"1"	"3"	"Q8K072"	"Q8K072 [112-124]"	"Q8K072 1xBiotin [K123]"	"Receptor expression-enhancing protein 4 [OS=Mus musculus]"	"2"	"1845.86221"	"0.56"	"0.24"	"0.23"	"-1.50"	"0.49"	"-0.07"	"0.25"	"91.1"	"134.5"	"107.2"	"107.0"	"32.3"	"127.9"	"21391.3359375"	"31598.498046875"	"25188.23828125"	"25129.87890625"	"7589.0634765625"	"30037.875"	""	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"3"	"615.95900"	"0.0002716"	"0.007015"	"2.31"	"38.08"
"6500"	"[K].ERVPATKTVHLQSR.[A]"	"1xBiotin [K7]"	"0.000203409"	"0.000586377"	"1"	"2"	"6"	"Q9CQ56"	"Q9CQ56 [112-125]"	"Q9CQ56 1xBiotin [K118]"	"Vesicle transport protein USE1 [OS=Mus musculus]"	"2"	"1847.99086"	"0.02"	"0.30"	"0.09"	"0.51"	"0.24"	"0.23"	"-0.05"	"86.9"	"87.8"	"106.7"	"92.5"	"123.5"	"102.7"	"17237.7265625"	"17420.427734375"	"21167.58984375"	"18349.25"	"24502.416015625"	"20376.470703125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"616.66816"	"0.0001108"	"2.128E-06"	"3.41"	"29.37"
"15690"	"[K].IQSNKGSSYK.[L]"	"1xBiotin [K5]"	"0.00283601"	"0.000586377"	"1"	"3"	"5"	"O88738"	"O88738 [2284-2293]"	"O88738 1xBiotin [K2288]"	"Baculoviral IAP repeat-containing protein 6 [OS=Mus musculus]"	"1"	"1337.65181"	"0.10"	"0.23"	"0.12"	"0.04"	"-0.20"	"-0.30"	"-0.43"	"96.3"	"103.3"	"113.0"	"104.9"	"98.7"	"83.8"	"17903.841796875"	"19217.251953125"	"21011.30859375"	"19506.04296875"	"18353.650390625"	"15589.9267578125"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"2"	"669.32973"	"0.0001108"	"9.943E-05"	"2.19"	"24.44"
"15668"	"[R].LQQGVSTTVAHLLDLVGSASGPGGWR.[G]"	""	"0.00758093"	"0.000586377"	"1"	"2"	"1"	"Q61140-1"	"Q61140-1 [470-495]"	""	"Breast cancer anti-estrogen resistance protein 1 [OS=Mus musculus]"	"0"	"2606.36852"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"3"	"869.45971"	"0.0001108"	"0.0004181"	"3.49"	""
"15646"	"[K].IQMSSKPSVQPKPLLLPAAPK.[T]"	"1xBiotin [K12]; 1xOxidation [M3]"	"0.000873873"	"0.000586377"	"1"	"1"	"5"	"F6VAN0"	"F6VAN0 [158-178]"	"F6VAN0 1xBiotin [K169]"	"Cyclic AMP-dependent transcription factor ATF-6 alpha [OS=Mus musculus]"	"0"	"2472.37168"	"0.28"	"-0.07"	"-0.15"	"-9.97"	"-0.04"	"-0.33"	"0.03"	"118.9"	"144.8"	"113.3"	"107.5"	""	"115.5"	"19391.83203125"	"23603.779296875"	"18476.79296875"	"17520.6953125"	""	"18841.267578125"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"3"	"824.79552"	"0.0001108"	"1.777E-05"	"2.40"	"43.36"
"15644"	"[R].IQMKSLTNK.[W]"	"1xBiotin [K4]; 1xOxidation [M3]"	"0.00283601"	"0.000586377"	"1"	"3"	"8"	"Q8R4D1"	"Q8R4D1 [548-556]"	"Q8R4D1 1xBiotin [K551]"	"Sodium/hydrogen exchanger 8 [OS=Mus musculus]"	"1"	"1304.67010"	"0.34"	"0.32"	"0.52"	"-0.76"	"0.34"	"0.00"	"0.02"	"88.2"	"111.4"	"110.0"	"126.5"	"52.2"	"111.7"	"41659.37890625"	"52601.69921875"	"51940.5"	"59696.78515625"	"24640.0234375"	"52714.2890625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"652.83877"	"0.0001108"	"9.943E-05"	"2.89"	"29.43"
"6516"	"[R].ESEASTKR.[A]"	"1xBiotin [K7]"	"0.00723668"	"0.000586377"	"1"	"1"	"16"	"Q8VD58"	"Q8VD58 [260-267]"	"Q8VD58 1xBiotin [K266]"	"Protein EVI2B [OS=Mus musculus]"	"1"	"1133.52555"	"0.97"	"0.84"	"0.99"	"1.12"	"0.82"	"-0.15"	"-0.02"	"56.2"	"110.0"	"100.4"	"111.6"	"122.6"	"99.2"	"112924.7578125"	"220852.4375"	"201580.984375"	"224096.671875"	"246191.40625"	"199214.265625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"567.26650"	"0.0001108"	"0.0003926"	"2.60"	"17.96"
"15624"	"[K].IQLGKIH.[-]"	"1xBiotin [K5]"	"0.0810517"	"0.00241047"	"1"	"1"	"6"	"Q9DC16"	"Q9DC16 [284-290]"	"Q9DC16 1xBiotin [K288]"	"Endoplasmic reticulum-Golgi intermediate compartment protein 1 [OS=Mus musculus]"	"1"	"1034.58155"	"0.38"	"0.07"	"0.32"	"0.15"	"0.57"	"0.19"	"0.50"	"83.5"	"108.3"	"87.5"	"104.1"	"92.7"	"123.9"	"90450.78125"	"117301.6015625"	"94736.8515625"	"112708.5078125"	"100354.53125"	"134136.890625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"517.79421"	"0.000415"	"0.01398"	"2.09"	"38.59"
"6557"	"[K].ESKPVENGMLVTDTVGKHLQR.[H]"	"1xBiotin [K17]; 1xOxidation [M9]"	"0.0023813"	"0.000586377"	"1"	"1"	"6"	"O35379"	"O35379 [889-909]"	"O35379 1xBiotin [K905]"	"Multidrug resistance-associated protein 1 [OS=Mus musculus]"	"1"	"2580.29087"	"0.07"	"0.00"	"-0.23"	"-2.99"	"-0.87"	"-0.93"	"-0.87"	"131.0"	"137.2"	"131.4"	"112.0"	"16.5"	"71.8"	"44995.873046875"	"47124.740234375"	"45107.509765625"	"38472.3486328125"	"5671.61474609375"	"24661.703125"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"4"	"645.82837"	"0.0001108"	"7.683E-05"	"3.96"	"37.28"
"15611"	"[R].LQKQTTYSEK.[N]"	"1xBiotin [K3]"	"0.00298864"	"0.000586377"	"1"	"1"	"5"	"Q8R070"	"Q8R070 [270-279]"	"Q8R070 1xBiotin [K272]"	"Glucose-6-phosphate exchanger SLC37A1 [OS=Mus musculus]"	"1"	"1451.71989"	"0.82"	"0.19"	"0.35"	"0.42"	"0.62"	"-0.20"	"0.43"	"74.5"	"131.8"	"84.8"	"94.9"	"99.5"	"114.5"	"24983.47265625"	"44181.46484375"	"28407.291015625"	"31811.498046875"	"33335.09375"	"38366.484375"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"2"	"726.36369"	"0.0001108"	"0.0001077"	"2.26"	"27.92"
"15605"	"[K].IQKLLQDFFNGK.[E]"	"1xBiotin [K3]"	"0.000981941"	"0.000586377"	"1"	"2"	"4"	"P63017"	"P63017 [346-357]"	"P63017 1xBiotin [K348]"	"Heat shock cognate 71 kDa protein [OS=Mus musculus]"	"1"	"1676.88287"	"-0.48"	"-0.27"	"-9.97"	"-9.97"	"0.17"	"0.66"	"0.45"	"163.5"	"116.8"	"135.2"	""	""	"184.5"	"12776.1220703125"	"9129.1103515625"	"10563.123046875"	""	""	"14411.7529296875"	""	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"2"	"838.94604"	"0.0001108"	"2.117E-05"	"3.30"	"56.63"
"15599"	"[R].LQKGEFILATR.[G]"	"1xBiotin [K3]"	"0.000499303"	"0.000586377"	"1"	"4"	"6"	"Q9CPV7"	"Q9CPV7 [351-361]"	"Q9CPV7 1xBiotin [K353]"	"palmitoyltransferase ZDHHC6 [OS=Mus musculus]"	"1"	"1501.81955"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"0.06"	"0.27"	""	"147.2"	"126.8"	"103.6"	"69.0"	"153.3"	""	"31943.943359375"	"27512.4296875"	"22478.732421875"	"14980.3271484375"	"33263.29296875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"751.41378"	"0.0001108"	"7.855E-06"	"3.33"	"47.54"
"15598"	"[K].IQKENPK.[V]"	"1xBiotin [K3]"	"0.0319077"	"0.00104877"	"1"	"1"	"7"	"Q9CQB5"	"Q9CQB5 [75-81]"	"Q9CQB5 1xBiotin [K77]"	"CDGSH iron-sulfur domain-containing protein 2 [OS=Mus musculus]"	"1"	"1082.56629"	"0.40"	"0.33"	"0.33"	"0.28"	"0.40"	"0.00"	"0.07"	"81.5"	"107.2"	"102.3"	"102.5"	"99.1"	"107.4"	"63206.12890625"	"83151.875"	"79411.578125"	"79541.7578125"	"76925.8359375"	"83341.5703125"	""	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"2"	"541.78688"	"0.0001873"	"0.003473"	"2.14"	"22.83"
"15596"	"[R].LQKDTACK.[E]"	"1xBiotin [K3]; 1xCarbamidomethyl [C7]"	"0.0166696"	"0.000586377"	"1"	"2"	"6"	"Q64281"	"Q64281 [308-315]"	"Q64281 1xBiotin [K310]"	"Leukocyte immunoglobulin-like receptor subfamily B member 4 [OS=Mus musculus]"	"1"	"1189.57039"	"0.27"	"0.10"	"-0.03"	"0.22"	"0.42"	"0.15"	"0.33"	"88.8"	"107.2"	"94.8"	"86.9"	"103.2"	"119.0"	"53039.59765625"	"64085.92578125"	"56671.40234375"	"51915.8046875"	"61686.71875"	"71131.453125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"595.28902"	"0.0001108"	"0.001335"	"2.93"	"23.62"
"6591"	"[K].ESNFSDTTTNWSSKYTR.[A]"	"1xBiotin [K14]"	"0.000293709"	"0.000586377"	"1"	"3"	"10"	"Q8C561-1"	"Q8C561-1 [622-638]"	"Q8C561-1 1xBiotin [K635]"	"LMBR1 domain-containing protein 2 [OS=Mus musculus]"	"1"	"2249.97679"	"-9.97"	"-9.97"	"-9.97"	"-9.97"	"0.51"	"9.97"	"9.97"	"247.3"	""	""	""	""	"352.7"	"12533.5380859375"	""	""	""	""	"17877.267578125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"1125.49139"	"0.0001108"	"3.636E-06"	"2.50"	"43.07"
"15297"	"[R].LPEFSFEKR.[Q]"	"1xBiotin [K8]"	"0.00219478"	"0.000586377"	"1"	"1"	"7"	"Q7TQ95"	"Q7TQ95 [312-320]"	"Q7TQ95 1xBiotin [K319]"	"Protein lunapark [OS=Mus musculus]"	"1"	"1378.68238"	"0.24"	"0.11"	"0.00"	"-0.72"	"0.29"	"0.05"	"0.18"	"98.6"	"116.4"	"106.2"	"98.5"	"59.8"	"120.6"	"107790.3203125"	"127249.078125"	"116077.96875"	"107709.90625"	"65387.63671875"	"131890.984375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"689.84467"	"0.0001108"	"6.817E-05"	"2.71"	"47.86"
"15294"	"[K].LPDSPALAKK.[T]"	"1xBiotin [K9]"	"0.00446612"	"0.000586377"	"1"	"1"	"4"	"P70302"	"P70302 [572-581]"	"P70302 1xBiotin [K580]"	"stromal interaction molecule 1 [OS=Mus musculus]"	"1"	"1265.69222"	"0.47"	"0.14"	"0.04"	"0.18"	"0.28"	"-0.19"	"0.14"	"87.4"	"121.3"	"96.1"	"90.1"	"98.9"	"106.2"	"27934.689453125"	"38781.41796875"	"30714.744140625"	"28792.107421875"	"31593.34375"	"33945.19921875"	""	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"2"	"633.34963"	"0.0001108"	"0.0001923"	"2.56"	"35.54"
"15249"	"[K].LNYKPPPQKSLK.[E]"	"1xBiotin [K]"	"0.000920948"	"0.000586377"	"1"	"1"	"10"	"Q61599"	"Q61599 [21-32]"	"Q61599 1xBiotin [K]"	"Rho GDP-dissociation inhibitor 2 [OS=Mus musculus]"	"1"	"1638.90361"	"-0.26"	"0.14"	"-0.09"	"-0.11"	"0.09"	"0.34"	"-0.05"	"102.4"	"85.7"	"112.5"	"96.2"	"94.6"	"108.7"	"53659.90234375"	"44894.10546875"	"58937.9609375"	"50421.47265625"	"49552.08203125"	"56972.27734375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"546.97271"	"0.0001108"	"1.916E-05"	"4.34"	"32.71"
"6619"	"[K].ESSPSGSKSQR.[Y]"	"1xBiotin [K8]"	"0.00600852"	"0.000586377"	"1"	"1"	"6"	"Q9CRB9"	"Q9CRB9 [38-48]"	"Q9CRB9 1xBiotin [K45]"	"MICOS complex subunit MIC19 [OS=Mus musculus]"	"1"	"1375.62705"	"0.50"	"0.32"	"0.05"	"0.41"	"0.22"	"-0.28"	"-0.10"	"83.4"	"117.9"	"104.3"	"86.1"	"111.2"	"97.1"	"7973.05078125"	"11267.3662109375"	"9971.3740234375"	"8233.6513671875"	"10625.8740234375"	"9281.8349609375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"688.31722"	"0.0001108"	"0.0002978"	"2.01"	"18.34"
"15050"	"[K].LMNTGKQHTFVETESVR.[Y]"	"1xBiotin [K6]; 1xOxidation [M2]"	"0.0136956"	"0.000586377"	"1"	"1"	"1"	"Q5XJY5"	"Q5XJY5 [39-55]"	"Q5XJY5 1xBiotin [K44]"	"Coatomer subunit delta [OS=Mus musculus]"	"1"	"2219.05835"	"-9.97"	"-9.97"	"-0.33"	"-9.97"	"-0.54"	"9.97"	"9.97"	"241.8"	""	""	"192.4"	""	"165.8"	"16911.701171875"	""	""	"13459.328125"	""	"11598.779296875"	""	"High"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"3"	"740.35786"	"0.0001108"	"0.0009992"	"2.07"	"33.95"
"6899"	"[K].EYFSKQK.[-]"	"1xBiotin [K5]"	"0.049116"	"0.00154748"	"1"	"1"	"5"	"P35700"	"P35700 [193-199]"	"P35700 1xBiotin [K197]"	"peroxiredoxin-1 [OS=Mus musculus]"	"1"	"1155.55031"	"0.13"	"-0.04"	"0.17"	"-0.08"	"0.34"	"0.21"	"0.38"	"93.7"	"102.3"	"91.3"	"105.4"	"88.7"	"118.6"	"38626.7421875"	"42178.38671875"	"37662.859375"	"43442.4296875"	"36589.73046875"	"48885.88671875"	""	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"2"	"578.27879"	"0.0002716"	"0.006592"	"1.85"	"32.73"
"15014"	"[R].IMKAQALR.[D]"	"1xBiotin [K3]; 1xOxidation [M2]"	"0.0160092"	"0.000586377"	"1"	"2"	"5"	"P11499"	"P11499 [605-612]"	"P11499 1xBiotin [K607]"	"Heat shock protein HSP 90-beta [OS=Mus musculus]"	"1"	"1172.62785"	"0.28"	"0.52"	"0.18"	"-0.65"	"0.23"	"-0.04"	"-0.29"	"90.9"	"110.2"	"130.7"	"103.2"	"58.1"	"106.9"	"36941.625"	"44810.91796875"	"53142.5546875"	"41939.37109375"	"23606.501953125"	"43475.640625"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"2"	"586.81788"	"0.0001108"	"0.001257"	"2.85"	"31.44"
"6932"	"[K].FAAKGEGQLSAAER.[A]"	"1xBiotin [K4]"	"2.88111E-06"	"0.000586377"	"1"	"1"	"18"	"P58252"	"P58252 [236-249]"	"P58252 1xBiotin [K239]"	"Elongation factor 2 [OS=Mus musculus]"	"1"	"1660.81117"	"0.17"	"0.06"	"0.17"	"0.28"	"0.06"	"-0.11"	"0.00"	"91.6"	"103.2"	"95.6"	"102.8"	"111.0"	"95.8"	"189582.328125"	"213555.572265625"	"197919.529296875"	"212765.82421875"	"229769.2265625"	"198262.54296875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"830.90962"	"0.0001108"	"4.23E-09"	"4.16"	"35.04"
"14842"	"[R].LLTGLKTAAK.[S]"	"1xBiotin [K6]"	"0.00278689"	"0.000586377"	"1"	"1"	"6"	"Q91WC9"	"Q91WC9 [181-190]"	"Q91WC9 1xBiotin [K186]"	"Sn1-specific diacylglycerol lipase beta [OS=Mus musculus]"	"1"	"1241.72861"	"1.09"	"0.56"	"0.77"	"0.08"	"1.23"	"0.14"	"0.67"	"61.8"	"131.6"	"91.1"	"105.4"	"65.2"	"144.9"	"69545.53125"	"148090.875"	"102525.1328125"	"118655.71875"	"73352.3203125"	"163039.734375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"621.36779"	"0.0001108"	"9.65E-05"	"3.10"	"39.19"
"6935"	"[K].FADYISKAR.[E]"	"1xBiotin [K7]"	"0.00449219"	"0.000586377"	"1"	"1"	"105"	"Q8R5J9"	"Q8R5J9 [179-187]"	"Q8R5J9 1xBiotin [K185]"	"PRA1 family protein 3 [OS=Mus musculus]"	"1"	"1296.64052"	"0.48"	"0.29"	"0.15"	"0.18"	"0.55"	"0.08"	"0.26"	"81.8"	"114.1"	"100.1"	"90.9"	"92.9"	"120.2"	"12387737.8652344"	"17272998.9345703"	"15159258.9736328"	"13768446.5146484"	"14072184.7138672"	"18199107.8017578"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"648.82389"	"0.0001108"	"0.000194"	"3.01"	"39.66"
"14812"	"[R].LISQIVSSITASLR.[F]"	""	"0.00939743"	"0.000586377"	"1"	"4"	"4"	"P05213"	"P05213 [230-243]"	""	"Tubulin alpha-1B chain [OS=Mus musculus]"	"0"	"1487.87917"	"-0.51"	"0.43"	"-9.97"	"-9.97"	"-0.99"	"-0.48"	"-1.41"	"169.0"	"118.7"	"227.0"	""	""	"85.3"	"6088.08935546875"	"4277.689453125"	"8179.9990234375"	""	""	"3072.81689453125"	""	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"2"	"744.44266"	"0.0001108"	"0.0005753"	"2.86"	"60.41"
"14793"	"[K].LLSKMAGR.[S]"	"1xBiotin [K4]"	"0.0276564"	"0.00104877"	"1"	"1"	"4"	"Q9D8Y7"	"Q9D8Y7 [17-24]"	"Q9D8Y7 1xBiotin [K20]"	"Tumor necrosis factor alpha-induced protein 8-like protein 2 [OS=Mus musculus]"	"1"	"1101.59073"	"1.59"	"1.33"	"-9.97"	"1.79"	"0.75"	"-0.84"	"-0.58"	"51.4"	"154.9"	"129.6"	""	"177.5"	"86.6"	"7723.3427734375"	"23292.9921875"	"19476.4453125"	""	"26691.982421875"	"13016.4462890625"	""	"High"	"High"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"2"	"551.29887"	"0.0001873"	"0.002808"	"2.31"	"35.41"
"14791"	"[K].IISKIENHEGVR.[R]"	"1xBiotin [K4]"	"0.00528695"	"0.000586377"	"1"	"2"	"6"	"P52480"	"P52480 [267-278]"	"P52480 1xBiotin [K270]"	"Pyruvate kinase PKM [OS=Mus musculus]"	"1"	"1620.85264"	"9.97"	"9.97"	"9.97"	"9.97"	"9.97"	"0.33"	"0.14"	""	"108.4"	"123.6"	"95.8"	"135.8"	"136.4"	""	"32995.5859375"	"37625.921875"	"29166.447265625"	"41324.9140625"	"41501.59765625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"540.95569"	"0.0001108"	"0.0002478"	"2.50"	"33.29"
"14712"	"[K].IIQTPGLWESENQNKGVK.[L]"	"1xBiotin [K]"	"0.000275461"	"0.000586377"	"1"	"1"	"10"	"P35293"	"P35293 [169-186]"	"P35293 1xBiotin [K]"	"Ras-related protein Rab-18 [OS=Mus musculus]"	"1"	"2267.14888"	"0.86"	"0.74"	"0.07"	"-0.15"	"1.20"	"0.34"	"0.46"	"68.6"	"124.9"	"114.7"	"72.2"	"61.9"	"157.6"	"41873.44140625"	"76224.857421875"	"69965.939453125"	"44077.41015625"	"37779.53125"	"96178.8828125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"756.38758"	"0.0001108"	"3.31E-06"	"4.40"	"43.86"
"14705"	"[K].LIQSPTTHKNHSESLILEAEK.[N]"	"1xBiotin [K9]"	"0.000182075"	"0.000586377"	"1"	"1"	"6"	"Q8C398"	"Q8C398 [412-432]"	"Q8C398 1xBiotin [K420]"	"Phosphatidylinositol-glycan biosynthesis class W protein [OS=Mus musculus]"	"1"	"2601.33411"	"0.33"	"0.12"	"0.45"	"-2.17"	"-0.24"	"-0.57"	"-0.37"	"103.8"	"130.5"	"113.2"	"141.7"	"23.1"	"87.7"	"49871.505859375"	"62720.759765625"	"54381.798828125"	"68057.732421875"	"11095.6376953125"	"42137.6611328125"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"3"	"867.78291"	"0.0001108"	"1.809E-06"	"3.56"	"37.15"
"14663"	"[R].LLQDSVDFSLADAINTEFK.[N]"	""	"0.000487792"	"0.000586377"	"1"	"1"	"5"	"P20152"	"P20152 [79-97]"	""	"Vimentin [OS=Mus musculus]"	"0"	"2126.06519"	"-2.21"	"-0.59"	"-9.97"	"-1.76"	"-0.97"	"1.25"	"-0.37"	"223.5"	"48.3"	"148.0"	""	"65.8"	"114.5"	"19147.2021484375"	"4137.0341796875"	"12683.6640625"	""	"5634.36877441406"	"9806.38696289063"	""	"High"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"High"	"High"	"2"	"1063.53717"	"0.0001108"	"7.603E-06"	"2.95"	"58.97"
"6936"	"[K].FAEEQLLKHGWTQGK.[G]"	"1xBiotin [K8]"	"1.75661E-05"	"0.000586377"	"1"	"2"	"9"	"Q3TFK5"	"Q3TFK5 [14-28]"	"Q3TFK5 1xBiotin [K21]"	"G patch domain-containing protein 4 [OS=Mus musculus]"	"1"	"1997.99019"	"0.25"	"0.28"	"-1.25"	"-3.25"	"0.19"	"-0.06"	"-0.08"	"118.3"	"140.8"	"143.4"	"49.9"	"12.4"	"135.2"	"85648.7578125"	"101889.5546875"	"103755.0390625"	"36131.20703125"	"8993.9765625"	"97848.3984375"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"2"	"999.49931"	"0.0001108"	"5.946E-08"	"4.08"	"44.33"
"14648"	"[K].IIPTSASKTEAPAAAK.[S]"	"1xBiotin [K]"	"2.88369E-05"	"0.000586377"	"1"	"1"	"18"	"Q9QY76"	"Q9QY76 [140-155]"	"Q9QY76 1xBiotin [K]"	"vesicle-associated membrane protein-associated protein B [OS=Mus musculus]"	"1"	"1781.94660"	"0.20"	"0.43"	"0.22"	"0.23"	"0.49"	"0.29"	"0.06"	"83.0"	"95.1"	"111.5"	"96.5"	"97.4"	"116.5"	"172496.48046875"	"197522.1796875"	"231664.0390625"	"200453.0546875"	"202353.296875"	"241905.6796875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"891.47762"	"0.0001108"	"1.224E-07"	"3.78"	"33.05"
"6941"	"[K].FAGAKAISSDMFFGR.[E]"	"1xBiotin [K5]"	"4.18829E-05"	"0.000586377"	"1"	"2"	"7"	"Q99K28"	"Q99K28 [424-438]"	"Q99K28 1xBiotin [K428]"	"ADP-ribosylation factor GTPase-activating protein 2 [OS=Mus musculus]"	"1"	"1830.86657"	"0.86"	"0.60"	"-1.24"	"-9.97"	"1.12"	"0.25"	"0.51"	"86.6"	"157.5"	"131.4"	"36.8"	""	"187.7"	"45925.44140625"	"83584.609375"	"69729.7265625"	"19511.060546875"	""	"99592.765625"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"2"	"915.93658"	"0.0001108"	"2.119E-07"	"2.87"	"54.03"
"14560"	"[R].ILNKAVYLFYGTK.[D]"	"1xBiotin [K4]"	"1.81916E-05"	"0.000586377"	"1"	"1"	"7"	"Q9R1C6"	"Q9R1C6 [398-410]"	"Q9R1C6 1xBiotin [K401]"	"Diacylglycerol kinase epsilon [OS=Mus musculus]"	"1"	"1755.95022"	"-0.72"	"-0.36"	"-2.98"	"-9.97"	"0.16"	"0.88"	"0.52"	"165.3"	"100.1"	"129.1"	"20.9"	""	"184.6"	"39331.3369140625"	"23827.71875"	"30718.615234375"	"4977.966796875"	""	"43941.2568359375"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"2"	"878.47874"	"0.0001108"	"6.265E-08"	"3.88"	"56.42"
"14537"	"[R].ILMAINGKVFDVTK.[G]"	"1xBiotin [K8]; 1xOxidation [M3]"	"0.000126096"	"0.000586377"	"1"	"1"	"4"	"O55022"	"O55022 [89-102]"	"O55022 1xBiotin [K96]"	"Membrane-associated progesterone receptor component 1 [OS=Mus musculus]"	"1"	"1790.95432"	"0.39"	"-0.01"	"0.20"	"-9.97"	"0.80"	"0.41"	"0.81"	"96.8"	"126.9"	"96.2"	"111.2"	""	"168.9"	"9774.412109375"	"12807.650390625"	"9714.224609375"	"11229.1259765625"	""	"17050.884765625"	""	"High"	"High"	"High"	"High"	"Not Found"	"Peak Found"	"High"	"2"	"895.98086"	"0.0001108"	"1.056E-06"	"4.12"	"48.99"
"6942"	"[K].FAGAKAISSDMFFGR.[E]"	"1xBiotin [K5]; 1xOxidation [M11]"	"6.9158E-05"	"0.000586377"	"1"	"2"	"18"	"Q99K28"	"Q99K28 [424-438]"	"Q99K28 1xBiotin [K428]"	"ADP-ribosylation factor GTPase-activating protein 2 [OS=Mus musculus]"	"1"	"1846.86149"	"0.03"	"0.08"	"-0.36"	"-3.38"	"0.35"	"0.32"	"0.27"	"114.8"	"117.5"	"121.1"	"89.2"	"11.0"	"146.4"	"173313.51953125"	"177483.119140625"	"182927.321289063"	"134677.64453125"	"16600.1850585938"	"221119.58203125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"923.93459"	"0.0001108"	"4.381E-07"	"3.23"	"48.38"
"14501"	"[K].LLLQVQHASKQISAEK.[Q]"	"1xBiotin [K]"	"0.0235521"	"0.00104877"	"1"	"1"	"4"	"P48962"	"P48962 [34-49]"	"P48962 1xBiotin [K]"	"ADP/ATP translocase 1 [OS=Mus musculus]"	"1"	"2019.10556"	""	"9.97"	"9.97"	""	""	""	"-9.97"	""	""	"297.1"	"302.9"	""	""	""	""	"14613.595703125"	"14902.111328125"	""	""	""	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"3"	"673.70699"	"0.0001873"	"0.002205"	"3.55"	"39.40"
"6861"	"[K].EVSTYIKK.[I]"	"1xBiotin [K]"	"0.0153746"	"0.000586377"	"1"	"1"	"6"	"P10126"	"P10126 [173-180]"	"P10126 1xBiotin [K]"	"Elongation factor 1-alpha 1 [OS=Mus musculus]"	"1"	"1193.62347"	"0.15"	"0.33"	"0.47"	"-0.03"	"0.38"	"0.24"	"0.05"	"85.2"	"94.3"	"107.4"	"118.3"	"83.7"	"111.2"	"41831.91015625"	"46268.7734375"	"52701.6875"	"58057.0625"	"41099.0859375"	"54574.08984375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"597.31540"	"0.0001108"	"0.001178"	"2.08"	"32.44"
"19647"	"[R].NKTEDLEATSEHFK.[T]"	"1xBiotin [K2]"	"0.000211883"	"0.000586377"	"1"	"1"	"14"	"O70404"	"O70404 [46-59]"	"O70404 1xBiotin [K47]"	"vesicle-associated membrane protein 8 [OS=Mus musculus]"	"1"	"1874.85890"	"-0.07"	"0.03"	"0.44"	"-0.12"	"0.26"	"0.33"	"0.23"	"93.1"	"88.5"	"94.9"	"126.7"	"85.4"	"111.3"	"314867.59375"	"299411.96875"	"320954.25"	"428453"	"288802.625"	"376512.46875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"937.93410"	"0.0001108"	"2.261E-06"	"3.27"	"38.42"
"15090"	"[R].LMWSKYPLDVQK.[E]"	"1xBiotin [K5]; 1xOxidation [M2]"	"0.00134522"	"0.000586377"	"1"	"1"	"5"	"Q7TPE5"	"Q7TPE5 [282-293]"	"Q7TPE5 1xBiotin [K286]"	"Probable RNA polymerase II nuclear localization protein SLC7A6OS [OS=Mus musculus]"	"1"	"1749.87026"	"0.35"	"0.13"	"-0.01"	"-9.97"	"-0.10"	"-0.44"	"-0.22"	"113.3"	"144.3"	"123.6"	"112.7"	""	"106.0"	"10547.8271484375"	"13434.1005859375"	"11503.5732421875"	"10492.3671875"	""	"9868.8798828125"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"2"	"875.43931"	"0.0001108"	"3.347E-05"	"3.23"	"49.18"
"6833"	"[K].EVPMVAVPPVGSKASSPATSSQGK.[K]"	"1xBiotin [K13]; 1xOxidation [M4]"	"0.00028361"	"0.000586377"	"1"	"9"	"10"	"Q99PL5-1"	"Q99PL5-1 [176-199]"	"Q99PL5-1 1xBiotin [K188]"	"Ribosome-binding protein 1 [OS=Mus musculus]"	"1"	"2553.26873"	"0.31"	"0.14"	"0.41"	"-0.06"	"0.35"	"0.03"	"0.21"	"86.9"	"107.9"	"95.7"	"115.8"	"83.1"	"110.5"	"31328.79296875"	"38890.4453125"	"34510.609375"	"41750.6328125"	"29968.125"	"39830.703125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"851.76184"	"0.0001108"	"3.442E-06"	"3.71"	"40.48"
"15214"	"[K].LNSLSIPSVSKR.[V]"	"1xBiotin [K11]"	"0.000384069"	"0.000586377"	"1"	"1"	"12"	"P49070"	"P49070 [71-82]"	"P49070 1xBiotin [K81]"	"calcium signal-modulating cyclophilin ligand [OS=Mus musculus]"	"1"	"1526.83592"	"0.37"	"0.11"	"0.22"	"-0.43"	"0.35"	"-0.02"	"0.24"	"91.6"	"118.4"	"98.9"	"106.4"	"68.2"	"116.6"	"213161.36328125"	"275470.26953125"	"230019.25390625"	"247503.0703125"	"158582.942382813"	"271281.806640625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"763.92147"	"0.0001108"	"5.386E-06"	"3.83"	"43.12"
"6640"	"[K].ESYSVYVYK.[V]"	""	"0.0078955"	"0.000586377"	"2"	"9"	"6"	"Q64525; P10854"	"Q64525 [36-44]; P10854 [36-44]"	""	"Histone H2B type 2-B [OS=Mus musculus];Histone H2B type 1-M [OS=Mus musculus]"	"0"	"1137.54627"	"0.99"	"0.13"	"-0.05"	"0.20"	"0.40"	"-0.59"	"0.28"	"79.8"	"158.5"	"87.1"	"77.3"	"91.8"	"105.5"	"17315.482421875"	"34393.140625"	"18892.052734375"	"16777.3828125"	"19916.6328125"	"22884.388671875"	"NotUnique"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"569.27708"	"0.0001108"	"0.0004439"	"2.15"	"32.70"
"15207"	"[R].INSDDKNLYLTASK.[K]"	"1xBiotin [K6]"	"4.18454E-06"	"0.000586377"	"1"	"1"	"11"	"Q64008"	"Q64008 [239-252]"	"Q64008 1xBiotin [K244]"	"Ras-related protein Rab-34 [OS=Mus musculus]"	"1"	"1807.88947"	"0.49"	"0.08"	"0.41"	"0.65"	"0.29"	"-0.19"	"0.21"	"79.1"	"110.8"	"83.8"	"105.1"	"124.2"	"97.0"	"92509.1708984375"	"129520.140625"	"97963.25390625"	"122885.38671875"	"145203.169921875"	"113339.75"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"904.44907"	"0.0001108"	"7.312E-09"	"4.87"	"40.18"
"15202"	"[K].LNQQMAKMMDPR.[V]"	"1xBiotin [K7]; 3xOxidation [M5; M8; M9]"	"0.0016984"	"0.000586377"	"1"	"1"	"16"	"P14576-1"	"P14576-1 [458-469]"	"P14576-1 1xBiotin [K464]"	"signal recognition particle 54 kDa protein [OS=Mus musculus]"	"1"	"1736.75868"	"-0.85"	"-0.52"	"-0.18"	"-9.97"	"-0.27"	"0.58"	"0.25"	"151.4"	"83.8"	"105.8"	"133.4"	""	"125.6"	"79787.0234375"	"44170.7158203125"	"55729.5434570313"	"70305.568359375"	""	"66170.5986328125"	""	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"2"	"868.88377"	"0.0001108"	"4.698E-05"	"2.89"	"24.21"
"15201"	"[K].LNQQMAKMMDPR.[V]"	"1xBiotin [K7]; 2xOxidation [M8; M]"	"0.00159294"	"0.000586377"	"1"	"1"	"11"	"P14576-1"	"P14576-1 [458-469]"	"P14576-1 1xBiotin [K464]"	"signal recognition particle 54 kDa protein [OS=Mus musculus]"	"1"	"1720.76376"	"-0.49"	"0.17"	"0.22"	"-1.42"	"0.16"	"0.66"	"0.00"	"109.3"	"77.7"	"122.6"	"127.1"	"41.0"	"122.4"	"41317.0556640625"	"29363.7700195313"	"46355.7880859375"	"48033.7177734375"	"15483.3366699219"	"46260.7185058594"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"860.88486"	"0.0001108"	"4.297E-05"	"2.36"	"27.96"
"15200"	"[K].LNQQMAKMMDPR.[V]"	"1xBiotin [K7]; 1xOxidation [M]"	"0.000708428"	"0.000586377"	"1"	"1"	"8"	"P14576-1"	"P14576-1 [458-469]"	"P14576-1 1xBiotin [K464]"	"signal recognition particle 54 kDa protein [OS=Mus musculus]"	"1"	"1704.76885"	"0.47"	"0.84"	"0.97"	"1.12"	"0.59"	"0.12"	"-0.26"	"61.2"	"84.6"	"109.7"	"119.7"	"132.9"	"91.9"	"21650.533203125"	"29950.26171875"	"38844.392578125"	"42383.369140625"	"47028.353515625"	"32520.3828125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"852.88870"	"0.0001108"	"1.311E-05"	"2.63"	"33.97"
"6641"	"[K].ESYSVYVYKVLK.[Q]"	"1xBiotin [K9]"	"0.00057096"	"0.000586377"	"2"	"9"	"4"	"Q64525; P10854"	"Q64525 [36-47]; P10854 [36-47]"	"Q64525 1xBiotin [K44]; P10854 1xBiotin [K44]"	"Histone H2B type 2-B [OS=Mus musculus];Histone H2B type 1-M [OS=Mus musculus]"	"1"	"1703.87131"	"0.44"	"-0.01"	"-9.97"	"-9.97"	"0.25"	"-0.19"	"0.27"	"132.1"	"179.5"	"130.9"	""	""	"157.5"	"15626.666015625"	"21242.205078125"	"15492.732421875"	""	""	"18641.15234375"	"NotUnique"	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"2"	"852.43931"	"0.0001108"	"9.541E-06"	"3.18"	"52.82"
"6643"	"[K].ETADAISKEVKK.[A]"	"2xBiotin [K8; K11]"	"0.000153747"	"0.000586377"	"1"	"1"	"6"	"Q60870"	"Q60870 [161-172]"	"Q60870 2xBiotin [K168; K171]"	"Receptor expression-enhancing protein 5 [OS=Mus musculus]"	"2"	"1770.87647"	"0.42"	"-9.97"	"-9.97"	"-1.65"	"-9.97"	"-9.97"	""	"225.7"	"302.3"	""	""	"72.0"	""	"21077.55078125"	"28226.296875"	""	""	"6726.8466796875"	""	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"885.94114"	"0.0001108"	"1.412E-06"	"3.98"	"39.08"
"6684"	"[R].ETLEDGLPVHDGKGDIR.[K]"	"1xBiotin [K13]"	"0.00010899"	"0.000586377"	"1"	"1"	"10"	"O70252"	"O70252 [246-262]"	"O70252 1xBiotin [K258]"	"Heme oxygenase 2 [OS=Mus musculus]"	"1"	"2077.00188"	"1.08"	"0.73"	"1.22"	"0.80"	"0.77"	"-0.31"	"0.04"	"56.9"	"120.3"	"94.5"	"132.2"	"99.3"	"96.9"	"49795.05859375"	"105309.833007813"	"82707.603515625"	"115751.063964844"	"86967.7348632813"	"84837.40625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"693.00533"	"0.0001108"	"8.51E-07"	"3.97"	"39.88"
"6703"	"[R].ETMVSKMLDR.[L]"	"1xBiotin [K6]; 2xOxidation [M3; M7]"	"0.0175585"	"0.000586377"	"1"	"1"	"3"	"Q9QZL0"	"Q9QZL0 [337-346]"	"Q9QZL0 1xBiotin [K342]"	"Receptor-interacting serine/threonine-protein kinase 3 [OS=Mus musculus]"	"1"	"1467.66403"	"-0.55"	"-0.36"	"0.06"	"-9.97"	"-0.29"	"0.26"	"0.07"	"139.0"	"94.8"	"108.1"	"144.5"	""	"113.6"	"19087.70703125"	"13018.6318359375"	"14834.193359375"	"19830.498046875"	""	"15594.4150390625"	""	"High"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"High"	"High"	"2"	"734.33589"	"0.0001108"	"0.001434"	"2.25"	"30.86"
"15153"	"[R].LNLKGQK.[L]"	"1xBiotin [K4]"	"0.0438712"	"0.00104877"	"1"	"2"	"6"	"A2A8U2-1"	"A2A8U2-1 [533-539]"	"A2A8U2-1 1xBiotin [K536]"	"Transmembrane protein 201 [OS=Mus musculus]"	"1"	"1026.57646"	"0.63"	"0.23"	"0.38"	"0.09"	"0.09"	"-0.54"	"-0.14"	"83.9"	"129.8"	"98.3"	"109.2"	"89.5"	"89.4"	"89459.484375"	"138465.359375"	"104890.4765625"	"116449.4140625"	"95480.0390625"	"95330.6171875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"513.79194"	"0.0001873"	"0.005563"	"2.30"	"32.23"
"15152"	"[K].LNIKFVPPEAR.[T]"	"1xBiotin [K4]"	"0.000454828"	"0.000586377"	"1"	"2"	"7"	"Q3UM18"	"Q3UM18 [78-88]"	"Q3UM18 1xBiotin [K81]"	"Large subunit GTPase 1 homolog [OS=Mus musculus]"	"1"	"1509.82463"	"0.06"	"0.10"	"0.05"	"-0.67"	"0.10"	"0.04"	"0.00"	"102.5"	"106.9"	"110.0"	"106.1"	"64.5"	"110.1"	"29448.427734375"	"30722.10546875"	"31619.142578125"	"30503.5703125"	"18527.521484375"	"31637.703125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"755.41573"	"0.0001108"	"6.862E-06"	"2.89"	"47.77"
"6752"	"[K].ETYKTAK.[L]"	"1xBiotin [K4]"	"0.0477509"	"0.00154748"	"1"	"1"	"20"	"Q7TQ95"	"Q7TQ95 [127-133]"	"Q7TQ95 1xBiotin [K130]"	"Protein lunapark [OS=Mus musculus]"	"1"	"1066.52376"	"0.49"	"0.46"	"0.16"	"-0.21"	"0.48"	"-0.01"	"0.02"	"83.8"	"118.0"	"115.3"	"93.6"	"72.3"	"117.0"	"702772.6875"	"990142.3125"	"967603.75"	"785192.8125"	"606494.8125"	"982109.875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"533.76554"	"0.0002716"	"0.006312"	"1.90"	"23.24"
"15135"	"[K].INHQKCCSEA.[-]"	"1xBiotin [K5]; 2xCarbamidomethyl [C6; C7]"	"0.0574787"	"0.0019826"	"1"	"4"	"5"	"O35375-1"	"O35375-1 [922-931]"	"O35375-1 1xBiotin [K926]"	"Neuropilin-2 [OS=Mus musculus]"	"1"	"1472.60791"	"0.62"	"0.34"	"0.25"	"0.35"	"0.37"	"-0.25"	"0.02"	"79.5"	"122.1"	"100.7"	"94.2"	"101.1"	"102.5"	"63446.67578125"	"97441.1484375"	"80387.109375"	"75195.171875"	"80671.65625"	"81789.171875"	""	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"2"	"736.80809"	"0.0003442"	"0.008369"	"2.85"	"21.67"
"15133"	"[R].INHANHTGSNHTYLKTAYGKPK.[L]"	"1xBiotin [K15]"	"4.41398E-05"	"0.000586377"	"1"	"2"	"6"	"Q9WU40-1"	"Q9WU40-1 [435-456]"	"Q9WU40-1 1xBiotin [K449]"	"inner nuclear membrane protein Man1 [OS=Mus musculus]"	"1"	"2678.32561"	"0.87"	"0.75"	"0.30"	"0.73"	"0.62"	"-0.25"	"-0.14"	"67.2"	"122.7"	"113.2"	"82.8"	"111.3"	"102.9"	"15061.455078125"	"27500.1796875"	"25366.501953125"	"18551.978515625"	"24949.609375"	"23074.9453125"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"4"	"670.33697"	"0.0001108"	"2.278E-07"	"4.58"	"23.96"
"15122"	"[R].LNFSHGTHEYHAETIKNVR.[E]"	"1xBiotin [K16]"	"0.000746594"	"0.000586377"	"1"	"2"	"2"	"P52480"	"P52480 [74-92]"	"P52480 1xBiotin [K89]"	"Pyruvate kinase PKM [OS=Mus musculus]"	"1"	"2479.19354"	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"4"	"620.55383"	"0.0001108"	"1.415E-05"	"3.06"	""
"6794"	"[K].EVGIHLNYKEDSCVR.[L]"	"1xBiotin [K9]; 1xCarbamidomethyl [C13]"	"8.58121E-05"	"0.000586377"	"1"	"2"	"12"	"Q64735-1"	"Q64735-1 [443-457]"	"Q64735-1 1xBiotin [K451]"	"Complement component receptor 1-like protein [OS=Mus musculus]"	"1"	"2044.95791"	"0.32"	"0.17"	"0.37"	"-0.37"	"0.18"	"-0.15"	"0.01"	"91.4"	"114.3"	"102.4"	"118.0"	"70.7"	"103.3"	"143898.671875"	"179983.25"	"161346.15625"	"185815.9921875"	"111338.94140625"	"162743.6796875"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"3"	"682.32430"	"0.0001108"	"6.02E-07"	"3.71"	"39.83"
"15115"	"[R].LNENLTVNGGGWSEKSVK.[L]"	"1xBiotin [K]"	"1.77562E-06"	"0.000586377"	"1"	"1"	"24"	"Q80WJ7"	"Q80WJ7 [274-291]"	"Q80WJ7 1xBiotin [K]"	"protein LYRIC [OS=Mus musculus]"	"1"	"2158.05973"	"0.41"	"0.04"	"0.16"	"-0.58"	"0.33"	"-0.09"	"0.28"	"93.8"	"124.8"	"96.7"	"104.4"	"62.6"	"117.6"	"477880.21875"	"635722.21875"	"492698.0625"	"532126.796875"	"319169.375"	"599204.65625"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"1079.53394"	"0.0001108"	"2.09E-09"	"5.01"	"42.35"
"15107"	"[K].LNDMEPSKAVPLNASK.[Q]"	"1xBiotin [K8]; 1xOxidation [M4]"	"0.000931749"	"0.000586377"	"1"	"1"	"6"	"Q9WV55"	"Q9WV55 [139-154]"	"Q9WV55 1xBiotin [K146]"	"vesicle-associated membrane protein-associated protein A [OS=Mus musculus]"	"1"	"1955.95651"	"1.44"	"0.66"	"0.78"	"0.51"	"1.23"	"-0.21"	"0.57"	"55.5"	"151.1"	"88.0"	"95.6"	"79.2"	"130.6"	"27628.271484375"	"75163.8671875"	"43760.80859375"	"47564.6171875"	"39389.546875"	"64996.234375"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"978.48131"	"0.0001108"	"1.963E-05"	"3.14"	"35.90"
"15098"	"[K].INAKLNYVPLEK.[Q]"	"1xBiotin [K4]"	"0.000110268"	"0.000586377"	"1"	"2"	"6"	"Q569Z5-1"	"Q569Z5-1 [905-916]"	"Q569Z5-1 1xBiotin [K908]"	"probable ATP-dependent RNA helicase DDX46 [OS=Mus musculus]"	"1"	"1627.88762"	"0.44"	"0.45"	"0.25"	"-0.67"	"-9.97"	"-9.97"	"-9.97"	"108.2"	"147.0"	"148.2"	"128.4"	"68.1"	""	"19947.216796875"	"27089.330078125"	"27320.076171875"	"23658.92578125"	"12556.5439453125"	""	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"2"	"814.44760"	"0.0001108"	"8.685E-07"	"3.10"	"44.98"
"28892"	"[R].YYNYVFGFYK.[R]"	""	"0.00272271"	"0.000586377"	"1"	"1"	"4"	"P20060"	"P20060 [80-89]"	""	"Beta-hexosaminidase subunit beta [OS=Mus musculus]"	"0"	"1363.63575"	"0.61"	"-9.97"	"-0.43"	"-9.97"	"-0.04"	"-0.65"	"9.97"	"141.7"	"215.7"	""	"105.2"	""	"137.4"	"19392.123046875"	"29525.044921875"	""	"14407.2373046875"	""	"18808.697265625"	""	"High"	"High"	"High"	"Peak Found"	"Not Found"	"High"	"High"	"2"	"682.32150"	"0.0001108"	"9.366E-05"	"2.52"	"50.01"