MTD mzTab-version 1.0 MTD mzTab-mode Complete MTD mzTab-type Identification MTD description JPST000123 -- main2 MTD ms_run[1]-location D:\JobRequest\ResultFiles\20200420\20200420121841733591^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\140611_AAS_1crizotinib100nM02.maxq.txt MTD ms_run[2]-location D:\JobRequest\ResultFiles\20200420\20200420121841733591^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\140611_AAS_1crizotinib100nM02.maxqFin.txt MTD software[1] [MS, MS:1001583, MaxQuant, 1.6.2.10] MTD software[1]-setting Taxon=userFasta.sprot_human_20200318 MTD software[1]-setting enzymes=Trypsin/P MTD software[1]-setting enzymeMode=0 MTD software[1]-setting fixedModifications=Carbamidomethyl (C) MTD software[1]-setting variableModifications=Biotin:Thermo-88310 (K),Label:13C(6)15N(2) (K),Label:13C(6)15N(4) (R),Oxidation (M) MTD software[1]-setting maxMissedCleavages=1 MTD software[1]-setting lcmsRunType=Standard MTD software[1]-setting firstSearchTol=20 MTD software[1]-setting mainSearchTol=4.5 MTD software[2] [MS, MS:1001476, X!Tandem, 2015.04.01.1] MTD software[2]-setting DB=userFasta.sprot_human_20200318 MTD software[2]-setting CLE=[RK]|{} MTD software[2]-setting MODS=Carbamidomethyl (C) MTD software[2]-setting IT_MODS=Oxidation (M),Label:13C(6)15N(2) (K),Label:13C(6)15N(4) (R),Biotin:Thermo-88310 (K) MTD software[2]-setting TOL(-)=10 MTD software[2]-setting TOL(+)=10 MTD software[2]-setting TOLU=ppm MTD software[2]-setting ITOL=20 MTD software[2]-setting ITOLU=ppm MTD software[2]-setting PEP_ISOTOPE_ERROR=yes MTD software[2]-setting PFA=1 MTD software[3] [MS, MS:1002251, Comet, 2015.02 rev. 0] MTD software[3]-setting Taxon=userFasta.sprot_human_20200318 MTD software[3]-setting search_enzyme_number=2 MTD software[3]-setting FixMod=Carbamidomethyl (C) MTD software[3]-setting VarMod=Biotin:Thermo-88310 (K),Label:13C(6)15N(2) (K),Label:13C(6)15N(4) (R),Oxidation (M) MTD software[3]-setting max_variable_mods_in_peptide=5 MTD software[3]-setting allowed_missed_cleavage=1 MTD software[3]-setting peptide_mass_tolerance=10 MTD software[3]-setting peptide_mass_units=2 MTD software[3]-setting fragment_bin_tol=0.02 MTD software[3]-setting fragment_bin_offset=0.0 MTD fixed_mod[1] [UNIMOD, UNIMOD:4, Carbamidomethyl,] MTD fixed_mod[1]-site C MTD fixed_mod[1]-position Anywhere MTD variable_mod[1] [UNIMOD, UNIMOD:1031, Biotin:Thermo-88310,] MTD variable_mod[1]-site K MTD variable_mod[1]-position Anywhere MTD variable_mod[2] [UNIMOD, UNIMOD:259, Label:13C(6)15N(2),] MTD variable_mod[2]-site K MTD variable_mod[2]-position Anywhere MTD variable_mod[3] [UNIMOD, UNIMOD:267, Label:13C(6)15N(4),] MTD variable_mod[3]-site R MTD variable_mod[3]-position Anywhere MTD variable_mod[4] [UNIMOD, UNIMOD:35, Oxidation,] MTD variable_mod[4]-site M MTD variable_mod[4]-position Anywhere MTD protein_search_engine_score[1] [http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore] MTD psm_search_engine_score[1] [http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore] PRH accession description taxid species database database_version search_engine best_search_engine_score[1] ambiguity_members modifications protein_coverage search_engine_score[1]_ms_run[1] num_psms_ms_run[1] num_peptides_distinct_ms_run[1] num_peptides_unique_ms_run[1] PRT sp|P04350|TBB4A_HUMAN Tubulin beta-4A chain OS=Homo sapiens OX=9606 GN=TUBB4A PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 78.0 null 122-UNIMOD:1031,127-UNIMOD:4,129-UNIMOD:4,122-UNIMOD:259,154-UNIMOD:259,147-UNIMOD:35,154-UNIMOD:1031 0.08 78.0 5 2 1 PRT sp|P04406|G3P_HUMAN Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 74.0 null 107-UNIMOD:1031,175-UNIMOD:35,186-UNIMOD:1031,139-UNIMOD:1031,130-UNIMOD:35,145-UNIMOD:1031,152-UNIMOD:4,156-UNIMOD:4,215-UNIMOD:1031,162-UNIMOD:259,133-UNIMOD:35,219-UNIMOD:1031,107-UNIMOD:259,66-UNIMOD:1031,105-UNIMOD:35,247-UNIMOD:4,248-UNIMOD:267,86-UNIMOD:1031,227-UNIMOD:1031,231-UNIMOD:35,323-UNIMOD:267,61-UNIMOD:1031,80-UNIMOD:267,263-UNIMOD:1031,334-UNIMOD:1031,117-UNIMOD:1031,194-UNIMOD:1031,328-UNIMOD:35,331-UNIMOD:35,5-UNIMOD:1031,271-UNIMOD:1031,215-UNIMOD:259,334-UNIMOD:259,194-UNIMOD:259,13-UNIMOD:267,271-UNIMOD:259 0.71 74.0 91 27 5 PRT sp|P20290|BTF3_HUMAN Transcription factor BTF3 OS=Homo sapiens OX=9606 GN=BTF3 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 72.0 null 94-UNIMOD:1031,108-UNIMOD:35,50-UNIMOD:35,54-UNIMOD:1031,57-UNIMOD:1031,171-UNIMOD:1031,67-UNIMOD:1031,87-UNIMOD:1031,93-UNIMOD:1031 0.46 72.0 10 8 6 PRT sp|P14618|KPYM_HUMAN Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 71.0 null 358-UNIMOD:4,367-UNIMOD:1031,2-UNIMOD:1,3-UNIMOD:1031,31-UNIMOD:4,30-UNIMOD:35,188-UNIMOD:1031,207-UNIMOD:1031,360-UNIMOD:35,224-UNIMOD:1031,89-UNIMOD:1031,206-UNIMOD:1031,422-UNIMOD:259,125-UNIMOD:1031,206-UNIMOD:259,187-UNIMOD:28,270-UNIMOD:1031,186-UNIMOD:1031,224-UNIMOD:259,152-UNIMOD:4,162-UNIMOD:1031,165-UNIMOD:4,115-UNIMOD:1031,89-UNIMOD:259,423-UNIMOD:4,424-UNIMOD:4,433-UNIMOD:1031,166-UNIMOD:1031,106-UNIMOD:267,494-UNIMOD:35,498-UNIMOD:1031,115-UNIMOD:259,423-UNIMOD:385,135-UNIMOD:1031,247-UNIMOD:1031,136-UNIMOD:1031,305-UNIMOD:1031,49-UNIMOD:4,62-UNIMOD:1031,22-UNIMOD:35,64-UNIMOD:35,66-UNIMOD:1031,69-UNIMOD:35,278-UNIMOD:267,433-UNIMOD:259,498-UNIMOD:259,266-UNIMOD:1031,376-UNIMOD:267,266-UNIMOD:259,270-UNIMOD:259 0.68 71.0 70 38 18 PRT sp|P61160|ARP2_HUMAN Actin-related protein 2 OS=Homo sapiens OX=9606 GN=ACTR2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 69.0 null 11-UNIMOD:4,19-UNIMOD:1031,20-UNIMOD:4,351-UNIMOD:1031,353-UNIMOD:35,365-UNIMOD:35,7-UNIMOD:1031,46-UNIMOD:1031,388-UNIMOD:1031 0.19 69.0 25 5 3 PRT sp|P61158|ARP3_HUMAN Actin-related protein 3 OS=Homo sapiens OX=9606 GN=ACTR3 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 68.0 null 8-UNIMOD:4,12-UNIMOD:4,18-UNIMOD:1031,34-UNIMOD:4,42-UNIMOD:1031,225-UNIMOD:1031 0.15 68.0 3 3 3 PRT sp|P07355|ANXA2_HUMAN Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 68.0 null 2-UNIMOD:1,9-UNIMOD:4,10-UNIMOD:1031,49-UNIMOD:1031,157-UNIMOD:1031,324-UNIMOD:1031,313-UNIMOD:1031,233-UNIMOD:1031,227-UNIMOD:1031,115-UNIMOD:259,63-UNIMOD:267,115-UNIMOD:1031,47-UNIMOD:1031,145-UNIMOD:267,240-UNIMOD:35,28-UNIMOD:259,169-UNIMOD:1031,324-UNIMOD:259,37-UNIMOD:267,204-UNIMOD:1031,28-UNIMOD:1031,245-UNIMOD:267,168-UNIMOD:267,206-UNIMOD:1031,279-UNIMOD:1031 0.55 68.0 40 22 10 PRT sp|P13797-2|PLST_HUMAN Isoform 2 of Plastin-3 OS=Homo sapiens OX=9606 GN=PLS3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 67.0 null 78-UNIMOD:1031,82-UNIMOD:4,569-UNIMOD:1031,569-UNIMOD:259,574-UNIMOD:259,24-UNIMOD:35,30-UNIMOD:1031,69-UNIMOD:1031,532-UNIMOD:1031,532-UNIMOD:259 0.12 67.0 11 6 2 PRT sp|Q13085|ACACA_HUMAN Acetyl-CoA carboxylase 1 OS=Homo sapiens OX=9606 GN=ACACA PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 65.0 null 386-UNIMOD:1031,407-UNIMOD:4,404-UNIMOD:35,311-UNIMOD:1031,309-UNIMOD:35,323-UNIMOD:1031 0.03 65.0 27 3 0 PRT sp|P55263-3|ADK_HUMAN Isoform 3 of Adenosine kinase OS=Homo sapiens OX=9606 GN=ADK null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 65.0 null 119-UNIMOD:1031,140-UNIMOD:4,143-UNIMOD:4 0.10 65.0 2 1 0 PRT sp|Q9Y490|TLN1_HUMAN Talin-1 OS=Homo sapiens OX=9606 GN=TLN1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 64.0 null 922-UNIMOD:1031,1927-UNIMOD:4,1933-UNIMOD:1031,1939-UNIMOD:4,1960-UNIMOD:1031,1917-UNIMOD:1031,2133-UNIMOD:1031,2099-UNIMOD:1031,1544-UNIMOD:1031,2361-UNIMOD:1031 0.06 64.0 8 8 8 PRT sp|P63261|ACTG_HUMAN Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 62.0 null 1-UNIMOD:1,17-UNIMOD:4,18-UNIMOD:1031,16-UNIMOD:35,2-UNIMOD:1,3-UNIMOD:1,28-UNIMOD:267,1-UNIMOD:35,18-UNIMOD:259 0.08 62.0 77 3 0 PRT sp|P31939|PUR9_HUMAN Bifunctional purine biosynthesis protein PURH OS=Homo sapiens OX=9606 GN=ATIC PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 62.0 null 266-UNIMOD:1031,406-UNIMOD:1031 0.07 62.0 2 2 1 PRT sp|P29692|EF1D_HUMAN Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D PE=1 SV=5 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 61.0 null 59-UNIMOD:1031,2-UNIMOD:1,10-UNIMOD:1031,117-UNIMOD:1031,107-UNIMOD:1031,280-UNIMOD:1031,17-UNIMOD:1031,135-UNIMOD:35,29-UNIMOD:35,143-UNIMOD:1031,15-UNIMOD:1031 0.57 61.0 17 13 9 PRT sp|Q8TBX8|PI42C_HUMAN Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma OS=Homo sapiens OX=9606 GN=PIP4K2C PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 61.0 null 152-UNIMOD:1031,241-UNIMOD:1031,243-UNIMOD:35,101-UNIMOD:1031,104-UNIMOD:4,248-UNIMOD:1031,99-UNIMOD:1031,235-UNIMOD:1031 0.15 61.0 9 5 3 PRT sp|Q06830|PRDX1_HUMAN Peroxiredoxin-1 OS=Homo sapiens OX=9606 GN=PRDX1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 60.0 null 68-UNIMOD:1031,71-UNIMOD:4,83-UNIMOD:4,27-UNIMOD:1031,93-UNIMOD:1031,120-UNIMOD:1031,2-UNIMOD:1,7-UNIMOD:1031,16-UNIMOD:1031,100-UNIMOD:35,68-UNIMOD:259,92-UNIMOD:259,109-UNIMOD:1031,21-UNIMOD:35,151-UNIMOD:267,136-UNIMOD:1031,16-UNIMOD:259,27-UNIMOD:259,168-UNIMOD:259,35-UNIMOD:1031,120-UNIMOD:259,192-UNIMOD:259,197-UNIMOD:259,192-UNIMOD:1031,128-UNIMOD:267 0.71 60.0 47 19 7 PRT sp|P60709|ACTB_HUMAN Actin, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=ACTB PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 60.0 null 2-UNIMOD:1,16-UNIMOD:35,17-UNIMOD:4,18-UNIMOD:1031,153-UNIMOD:35,177-UNIMOD:267,50-UNIMOD:1031,113-UNIMOD:1031,44-UNIMOD:35,113-UNIMOD:259,47-UNIMOD:35,305-UNIMOD:35,291-UNIMOD:1031,254-UNIMOD:267,315-UNIMOD:1031,325-UNIMOD:35,28-UNIMOD:267,313-UNIMOD:35,372-UNIMOD:267,50-UNIMOD:259,61-UNIMOD:1031,326-UNIMOD:1031,360-UNIMOD:28,257-UNIMOD:4,269-UNIMOD:35,272-UNIMOD:4,283-UNIMOD:35,284-UNIMOD:259,328-UNIMOD:1031,1-UNIMOD:35,61-UNIMOD:259,326-UNIMOD:259,206-UNIMOD:267,191-UNIMOD:259,217-UNIMOD:4,227-UNIMOD:35,37-UNIMOD:267 0.70 60.0 158 25 5 PRT sp|P35250|RFC2_HUMAN Replication factor C subunit 2 OS=Homo sapiens OX=9606 GN=RFC2 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 59.0 null 82-UNIMOD:1031,88-UNIMOD:4,121-UNIMOD:1031 0.10 59.0 3 2 1 PRT sp|P06744|G6PI_HUMAN Glucose-6-phosphate isomerase OS=Homo sapiens OX=9606 GN=GPI PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 59.0 null 524-UNIMOD:1031,241-UNIMOD:1031,252-UNIMOD:1031,211-UNIMOD:259,12-UNIMOD:1031,454-UNIMOD:1031,124-UNIMOD:1031,447-UNIMOD:1031,34-UNIMOD:1031,142-UNIMOD:1031,65-UNIMOD:35,252-UNIMOD:259 0.29 59.0 19 14 9 PRT sp|P04083|ANXA1_HUMAN Annexin A1 OS=Homo sapiens OX=9606 GN=ANXA1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 59.0 null 29-UNIMOD:1031,53-UNIMOD:1031,214-UNIMOD:1031,90-UNIMOD:1031,287-UNIMOD:1031,312-UNIMOD:1031,262-UNIMOD:1031,263-UNIMOD:4,124-UNIMOD:267,56-UNIMOD:35,58-UNIMOD:1031,185-UNIMOD:1031,286-UNIMOD:35,71-UNIMOD:259,245-UNIMOD:1031,248-UNIMOD:35,270-UNIMOD:4,274-UNIMOD:1031,166-UNIMOD:1031,185-UNIMOD:259 0.56 59.0 24 15 8 PRT sp|P07437|TBB5_HUMAN Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 59.0 null 216-UNIMOD:1031,233-UNIMOD:35,239-UNIMOD:4,330-UNIMOD:35,336-UNIMOD:1031,58-UNIMOD:1031,363-UNIMOD:35,379-UNIMOD:259,121-UNIMOD:267,252-UNIMOD:1031,336-UNIMOD:259,257-UNIMOD:35,58-UNIMOD:259,262-UNIMOD:267,388-UNIMOD:35,390-UNIMOD:267,354-UNIMOD:4,174-UNIMOD:259,299-UNIMOD:35,300-UNIMOD:35,303-UNIMOD:4,306-UNIMOD:267,318-UNIMOD:267,251-UNIMOD:267,156-UNIMOD:267,162-UNIMOD:267,359-UNIMOD:267 0.47 59.0 47 18 2 PRT sp|Q05397-7|FAK1_HUMAN Isoform 7 of Focal adhesion kinase 1 OS=Homo sapiens OX=9606 GN=PTK2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 58.0 null 427-UNIMOD:4,454-UNIMOD:1031,456-UNIMOD:4,442-UNIMOD:35,571-UNIMOD:35,578-UNIMOD:1031,467-UNIMOD:1031,475-UNIMOD:35,222-UNIMOD:1031 0.07 58.0 9 4 1 PRT sp|P16066|ANPRA_HUMAN Atrial natriuretic peptide receptor 1 OS=Homo sapiens OX=9606 GN=NPR1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 58.0 null 647-UNIMOD:35,656-UNIMOD:4,662-UNIMOD:1031,666-UNIMOD:4,698-UNIMOD:1031,567-UNIMOD:1031 0.05 58.0 6 3 1 PRT sp|Q12792-4|TWF1_HUMAN Isoform 4 of Twinfilin-1 OS=Homo sapiens OX=9606 GN=TWF1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 58.0 null 73-UNIMOD:1031,38-UNIMOD:1031 0.19 58.0 2 2 2 PRT sp|P49368|TCPG_HUMAN T-complex protein 1 subunit gamma OS=Homo sapiens OX=9606 GN=CCT3 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 58.0 null 163-UNIMOD:1031,151-UNIMOD:35,31-UNIMOD:1031,353-UNIMOD:1031,78-UNIMOD:1031,366-UNIMOD:4,367-UNIMOD:1031,152-UNIMOD:35,381-UNIMOD:1031,249-UNIMOD:1031,133-UNIMOD:35,138-UNIMOD:1031,222-UNIMOD:1031,203-UNIMOD:1031,213-UNIMOD:4,21-UNIMOD:1031,128-UNIMOD:1031,455-UNIMOD:4,461-UNIMOD:267,219-UNIMOD:35,15-UNIMOD:1031,427-UNIMOD:1031,449-UNIMOD:267,528-UNIMOD:1031,529-UNIMOD:1031 0.43 58.0 28 18 13 PRT sp|P0DMV9|HS71B_HUMAN Heat shock 70 kDa protein 1B OS=Homo sapiens OX=9606 GN=HSPA1B PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 58.0 null 597-UNIMOD:1031,603-UNIMOD:4,56-UNIMOD:1031,328-UNIMOD:1031,236-UNIMOD:267,71-UNIMOD:1031,159-UNIMOD:1031,539-UNIMOD:1031,71-UNIMOD:259,77-UNIMOD:1031,246-UNIMOD:1031,348-UNIMOD:1031,112-UNIMOD:1031,187-UNIMOD:267,87-UNIMOD:35,449-UNIMOD:35,451-UNIMOD:1031,88-UNIMOD:259,88-UNIMOD:1031,100-UNIMOD:259,102-UNIMOD:259,171-UNIMOD:267,319-UNIMOD:1031,512-UNIMOD:1031,246-UNIMOD:259,549-UNIMOD:35,550-UNIMOD:259,559-UNIMOD:259,306-UNIMOD:4,311-UNIMOD:267,251-UNIMOD:1031,497-UNIMOD:1031,319-UNIMOD:259 0.45 58.0 52 29 7 PRT sp|P41567|EIF1_HUMAN Eukaryotic translation initiation factor 1 OS=Homo sapiens OX=9606 GN=EIF1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 58.0 null 66-UNIMOD:1031,69-UNIMOD:4,42-UNIMOD:1031 0.37 58.0 3 3 3 PRT sp|P10809|CH60_HUMAN 60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 58.0 null 96-UNIMOD:1031,551-UNIMOD:259,160-UNIMOD:1031,205-UNIMOD:1031,236-UNIMOD:1031,237-UNIMOD:4,72-UNIMOD:1031,352-UNIMOD:1031,387-UNIMOD:1031,250-UNIMOD:1031,417-UNIMOD:1031,301-UNIMOD:1031,396-UNIMOD:1031,218-UNIMOD:259,418-UNIMOD:1031,133-UNIMOD:1031,473-UNIMOD:1031,477-UNIMOD:35,217-UNIMOD:35,218-UNIMOD:1031,75-UNIMOD:1031,356-UNIMOD:35,82-UNIMOD:1031,58-UNIMOD:1031,191-UNIMOD:1031,72-UNIMOD:259,359-UNIMOD:1031,523-UNIMOD:1031,125-UNIMOD:1031,233-UNIMOD:1031,233-UNIMOD:259,493-UNIMOD:259,417-UNIMOD:259,31-UNIMOD:1031,405-UNIMOD:1031,130-UNIMOD:1031,469-UNIMOD:1031,75-UNIMOD:259,82-UNIMOD:259,481-UNIMOD:1031,429-UNIMOD:267,87-UNIMOD:259,352-UNIMOD:259,158-UNIMOD:28,91-UNIMOD:1031,447-UNIMOD:385,447-UNIMOD:4,469-UNIMOD:259,202-UNIMOD:1031,481-UNIMOD:259,87-UNIMOD:1031,196-UNIMOD:259,202-UNIMOD:259 0.70 58.0 90 45 17 PRT sp|P13639|EF2_HUMAN Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 58.0 null 32-UNIMOD:1031,41-UNIMOD:4,22-UNIMOD:35,591-UNIMOD:4,594-UNIMOD:1031,688-UNIMOD:1031,693-UNIMOD:4,239-UNIMOD:1031,567-UNIMOD:4,571-UNIMOD:1031,845-UNIMOD:1031,369-UNIMOD:4,386-UNIMOD:1031,388-UNIMOD:4,512-UNIMOD:1031,697-UNIMOD:35,231-UNIMOD:35,235-UNIMOD:1031,391-UNIMOD:1031,275-UNIMOD:1031,728-UNIMOD:4,426-UNIMOD:1031,497-UNIMOD:35,498-UNIMOD:1031,290-UNIMOD:4,299-UNIMOD:259,272-UNIMOD:1031,283-UNIMOD:1031,308-UNIMOD:1031,227-UNIMOD:28,305-UNIMOD:35,445-UNIMOD:1031,318-UNIMOD:1031,337-UNIMOD:1031,340-UNIMOD:35,314-UNIMOD:1031,426-UNIMOD:259,494-UNIMOD:35,495-UNIMOD:267,32-UNIMOD:259,318-UNIMOD:259,322-UNIMOD:259,42-UNIMOD:259,42-UNIMOD:1031,726-UNIMOD:267,572-UNIMOD:1031,252-UNIMOD:1031,257-UNIMOD:35,256-UNIMOD:35,580-UNIMOD:267,598-UNIMOD:1031,333-UNIMOD:1031,328-UNIMOD:1031,308-UNIMOD:259,249-UNIMOD:267,152-UNIMOD:1031,10-UNIMOD:267,430-UNIMOD:35 0.46 58.0 83 45 20 PRT sp|P05388-2|RLA0_HUMAN Isoform 2 of 60S acidic ribosomal protein P0 OS=Homo sapiens OX=9606 GN=RPLP0 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 57.0 null 235-UNIMOD:1031,77-UNIMOD:259,10-UNIMOD:1031,50-UNIMOD:1031,146-UNIMOD:259 0.36 57.0 7 6 5 PRT sp|Q14573|ITPR3_HUMAN Inositol 1,4,5-trisphosphate receptor type 3 OS=Homo sapiens OX=9606 GN=ITPR3 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 57.0 null 2101-UNIMOD:1031 0.01 57.0 1 1 1 PRT sp|P31327|CPSM_HUMAN Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Homo sapiens OX=9606 GN=CPS1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 57.0 null 1283-UNIMOD:35,1291-UNIMOD:1031,1471-UNIMOD:1031,1222-UNIMOD:1031,792-UNIMOD:35,793-UNIMOD:1031,799-UNIMOD:35,1168-UNIMOD:1031,757-UNIMOD:1031,761-UNIMOD:4,1222-UNIMOD:259,831-UNIMOD:1031,728-UNIMOD:1031,225-UNIMOD:4,228-UNIMOD:1031,458-UNIMOD:1031,219-UNIMOD:1031,1074-UNIMOD:1031,919-UNIMOD:1031,920-UNIMOD:4,829-UNIMOD:35,55-UNIMOD:1031,56-UNIMOD:35,553-UNIMOD:1031,905-UNIMOD:1031,600-UNIMOD:4,892-UNIMOD:1031,772-UNIMOD:1031,772-UNIMOD:259,811-UNIMOD:1031,769-UNIMOD:35,402-UNIMOD:1031,1168-UNIMOD:259,207-UNIMOD:1031,1281-UNIMOD:259,412-UNIMOD:1031,915-UNIMOD:1031,1183-UNIMOD:1031,1479-UNIMOD:1031,1120-UNIMOD:259,575-UNIMOD:259,908-UNIMOD:1031,841-UNIMOD:1031,1076-UNIMOD:35,214-UNIMOD:1031,1209-UNIMOD:35,453-UNIMOD:1031,1350-UNIMOD:35,1356-UNIMOD:1031,889-UNIMOD:1031,527-UNIMOD:1031,1150-UNIMOD:1031,935-UNIMOD:1031,1486-UNIMOD:1031,803-UNIMOD:267,1085-UNIMOD:267,452-UNIMOD:35,856-UNIMOD:1031,210-UNIMOD:1031,280-UNIMOD:1031,811-UNIMOD:259,167-UNIMOD:267,1157-UNIMOD:267,1309-UNIMOD:259,787-UNIMOD:267 0.40 57.0 141 57 33 PRT sp|P58546|MTPN_HUMAN Myotrophin OS=Homo sapiens OX=9606 GN=MTPN PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 56.0 null 66-UNIMOD:1031,83-UNIMOD:4,19-UNIMOD:1031,94-UNIMOD:1031 0.43 56.0 4 3 2 PRT sp|P05387|RLA2_HUMAN 60S acidic ribosomal protein P2 OS=Homo sapiens OX=9606 GN=RPLP2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 56.0 null 94-UNIMOD:1031,21-UNIMOD:1031,49-UNIMOD:1031,25-UNIMOD:1031,41-UNIMOD:1031,61-UNIMOD:259,49-UNIMOD:259 0.82 56.0 12 9 6 PRT sp|P11940|PABP1_HUMAN Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 56.0 null 132-UNIMOD:4,138-UNIMOD:1031,620-UNIMOD:1031,299-UNIMOD:1031,312-UNIMOD:1031,361-UNIMOD:1031,104-UNIMOD:1031,213-UNIMOD:1031,231-UNIMOD:1031,259-UNIMOD:1031,95-UNIMOD:1031,512-UNIMOD:1031,208-UNIMOD:1031,157-UNIMOD:1031 0.28 56.0 21 16 13 PRT sp|P68363|TBA1B_HUMAN Tubulin alpha-1B chain OS=Homo sapiens OX=9606 GN=TUBA1B PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 55.0 null 295-UNIMOD:4,302-UNIMOD:35,304-UNIMOD:1031,305-UNIMOD:4,60-UNIMOD:259,60-UNIMOD:1031,85-UNIMOD:28,96-UNIMOD:1031,370-UNIMOD:1031,326-UNIMOD:1031,79-UNIMOD:267,394-UNIMOD:1031,398-UNIMOD:35,336-UNIMOD:1031,347-UNIMOD:4,352-UNIMOD:259,280-UNIMOD:259,338-UNIMOD:1031,401-UNIMOD:1031,315-UNIMOD:4,316-UNIMOD:4,320-UNIMOD:267,112-UNIMOD:259,163-UNIMOD:1031,352-UNIMOD:1031,313-UNIMOD:35 0.49 55.0 50 22 7 PRT sp|Q6Y288|B3GLT_HUMAN Beta-1,3-glucosyltransferase OS=Homo sapiens OX=9606 GN=B3GLCT PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 55.0 null 464-UNIMOD:1031 0.04 55.0 2 1 0 PRT sp|P11142|HSP7C_HUMAN Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 55.0 null 56-UNIMOD:1031,137-UNIMOD:1031,61-UNIMOD:35,384-UNIMOD:259,71-UNIMOD:1031,328-UNIMOD:1031,187-UNIMOD:1031,550-UNIMOD:1031,159-UNIMOD:1031,156-UNIMOD:28,71-UNIMOD:259,155-UNIMOD:267,597-UNIMOD:1031,112-UNIMOD:1031,357-UNIMOD:1031,236-UNIMOD:267,348-UNIMOD:1031,188-UNIMOD:1031,451-UNIMOD:1031,187-UNIMOD:259,128-UNIMOD:1031,237-UNIMOD:35,246-UNIMOD:1031,589-UNIMOD:1031,589-UNIMOD:259,597-UNIMOD:259,122-UNIMOD:35,126-UNIMOD:259,342-UNIMOD:267,319-UNIMOD:1031,49-UNIMOD:267,87-UNIMOD:35,88-UNIMOD:259,88-UNIMOD:1031,108-UNIMOD:1031,500-UNIMOD:1031,17-UNIMOD:4,524-UNIMOD:1031,311-UNIMOD:267,512-UNIMOD:1031,357-UNIMOD:259,251-UNIMOD:1031,549-UNIMOD:35,550-UNIMOD:259,603-UNIMOD:4,609-UNIMOD:259,526-UNIMOD:1031,531-UNIMOD:1031,246-UNIMOD:259 0.59 55.0 144 43 14 PRT sp|P61247|RS3A_HUMAN 40S ribosomal protein S3a OS=Homo sapiens OX=9606 GN=RPS3A PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 55.0 null 240-UNIMOD:1031,227-UNIMOD:1031,94-UNIMOD:1031,96-UNIMOD:4,103-UNIMOD:35,249-UNIMOD:1031,199-UNIMOD:1031,201-UNIMOD:4,182-UNIMOD:1031,85-UNIMOD:1031,152-UNIMOD:1031,56-UNIMOD:1031,187-UNIMOD:1031,162-UNIMOD:267,195-UNIMOD:1031,46-UNIMOD:1031,63-UNIMOD:1031,20-UNIMOD:1031,82-UNIMOD:267,109-UNIMOD:1031,110-UNIMOD:35,111-UNIMOD:4,28-UNIMOD:1031,113-UNIMOD:35,115-UNIMOD:1031,139-UNIMOD:4,145-UNIMOD:1031 0.73 55.0 26 21 18 PRT sp|O43852|CALU_HUMAN Calumenin OS=Homo sapiens OX=9606 GN=CALU PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 55.0 null 37-UNIMOD:1031,59-UNIMOD:1031,281-UNIMOD:259,70-UNIMOD:259,281-UNIMOD:1031,75-UNIMOD:1031,79-UNIMOD:1031,249-UNIMOD:35,251-UNIMOD:1031 0.25 55.0 10 8 6 PRT sp|Q13310-2|PABP4_HUMAN Isoform 2 of Polyadenylate-binding protein 4 OS=Homo sapiens OX=9606 GN=PABPC4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 55.0 null 132-UNIMOD:4,138-UNIMOD:1031,333-UNIMOD:1031,339-UNIMOD:4,312-UNIMOD:1031,602-UNIMOD:1031,361-UNIMOD:1031,188-UNIMOD:1031,95-UNIMOD:1031,375-UNIMOD:1031,108-UNIMOD:1031,617-UNIMOD:1031,622-UNIMOD:1031 0.23 55.0 13 11 8 PRT sp|Q8NC51-3|PAIRB_HUMAN Isoform 3 of Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 54.0 null 52-UNIMOD:1031,331-UNIMOD:1031,68-UNIMOD:1031,314-UNIMOD:1031,325-UNIMOD:35,39-UNIMOD:1031,68-UNIMOD:259,102-UNIMOD:1031,211-UNIMOD:259,288-UNIMOD:1031,306-UNIMOD:1031,211-UNIMOD:1031 0.31 54.0 19 11 6 PRT sp|P67809|YBOX1_HUMAN Y-box-binding protein 1 OS=Homo sapiens OX=9606 GN=YBX1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 54.0 null 137-UNIMOD:1031,118-UNIMOD:1031,81-UNIMOD:1031,264-UNIMOD:1031,58-UNIMOD:1031,92-UNIMOD:1031,64-UNIMOD:1031 0.38 54.0 12 10 8 PRT sp|O15355|PPM1G_HUMAN Protein phosphatase 1G OS=Homo sapiens OX=9606 GN=PPM1G PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 54.0 null 172-UNIMOD:1031,241-UNIMOD:4,247-UNIMOD:1031,383-UNIMOD:1031,164-UNIMOD:4,166-UNIMOD:1031,386-UNIMOD:35,519-UNIMOD:1031 0.17 54.0 7 5 3 PRT sp|P62937|PPIA_HUMAN Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 54.0 null 100-UNIMOD:35,115-UNIMOD:4,118-UNIMOD:259,76-UNIMOD:1031,82-UNIMOD:1031,125-UNIMOD:1031,133-UNIMOD:1031,136-UNIMOD:35,44-UNIMOD:1031,142-UNIMOD:35,28-UNIMOD:1031,49-UNIMOD:1031,52-UNIMOD:4,61-UNIMOD:35,62-UNIMOD:4,69-UNIMOD:267,131-UNIMOD:1031,161-UNIMOD:4,31-UNIMOD:1031,155-UNIMOD:259,91-UNIMOD:1031,91-UNIMOD:259,144-UNIMOD:267,28-UNIMOD:259,125-UNIMOD:259 0.84 54.0 45 16 3 PRT sp|Q9UMS4|PRP19_HUMAN Pre-mRNA-processing factor 19 OS=Homo sapiens OX=9606 GN=PRPF19 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 54.0 null 266-UNIMOD:1031,244-UNIMOD:1031,179-UNIMOD:1031,200-UNIMOD:1031 0.14 54.0 4 4 4 PRT sp|P00390-2|GSHR_HUMAN Isoform Cytoplasmic of Glutathione reductase, mitochondrial OS=Homo sapiens OX=9606 GN=GSR null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 54.0 null 311-UNIMOD:1031,253-UNIMOD:1031 0.07 54.0 2 2 2 PRT sp|P17066|HSP76_HUMAN Heat shock 70 kDa protein 6 OS=Homo sapiens OX=9606 GN=HSPA6 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 54.0 null 58-UNIMOD:1031,189-UNIMOD:267,190-UNIMOD:267 0.08 54.0 5 3 2 PRT sp|P12268|IMDH2_HUMAN Inosine-5'-monophosphate dehydrogenase 2 OS=Homo sapiens OX=9606 GN=IMPDH2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 54.0 null 511-UNIMOD:1031,208-UNIMOD:1031,422-UNIMOD:1031,450-UNIMOD:1031,414-UNIMOD:35,109-UNIMOD:1031,438-UNIMOD:1031,420-UNIMOD:35,140-UNIMOD:4,238-UNIMOD:1031,293-UNIMOD:1031,436-UNIMOD:1031,134-UNIMOD:1031,325-UNIMOD:35,331-UNIMOD:4,339-UNIMOD:4,349-UNIMOD:1031 0.35 54.0 36 15 7 PRT sp|P04075|ALDOA_HUMAN Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 54.0 null 178-UNIMOD:4,200-UNIMOD:1031,28-UNIMOD:1031,111-UNIMOD:1031,339-UNIMOD:4,342-UNIMOD:1031,42-UNIMOD:1031,312-UNIMOD:1031,202-UNIMOD:4,208-UNIMOD:1031,13-UNIMOD:1031,42-UNIMOD:259,14-UNIMOD:1031,56-UNIMOD:267,330-UNIMOD:1031,342-UNIMOD:259,240-UNIMOD:4,322-UNIMOD:1031,108-UNIMOD:1031,258-UNIMOD:267,73-UNIMOD:4,312-UNIMOD:259,69-UNIMOD:267 0.69 54.0 37 24 14 PRT sp|Q9BWJ5|SF3B5_HUMAN Splicing factor 3B subunit 5 OS=Homo sapiens OX=9606 GN=SF3B5 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 54.0 null 17-UNIMOD:1031 0.29 54.0 1 1 1 PRT sp|O43175|SERA_HUMAN D-3-phosphoglycerate dehydrogenase OS=Homo sapiens OX=9606 GN=PHGDH PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 53.0 null 281-UNIMOD:4,289-UNIMOD:1031,33-UNIMOD:1031,21-UNIMOD:1031,8-UNIMOD:1031,18-UNIMOD:4,19-UNIMOD:4,90-UNIMOD:267,394-UNIMOD:1031,69-UNIMOD:1031,58-UNIMOD:1031,364-UNIMOD:259,129-UNIMOD:1031,364-UNIMOD:1031,394-UNIMOD:259,137-UNIMOD:1031 0.29 53.0 18 13 8 PRT sp|Q15185-3|TEBP_HUMAN Isoform 3 of Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 53.0 null 58-UNIMOD:4,65-UNIMOD:1031,40-UNIMOD:4,48-UNIMOD:1031,35-UNIMOD:1031,79-UNIMOD:1031,33-UNIMOD:1031 0.42 53.0 8 7 6 PRT sp|Q9Y265|RUVB1_HUMAN RuvB-like 1 OS=Homo sapiens OX=9606 GN=RUVBL1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 53.0 null 22-UNIMOD:1031,171-UNIMOD:1031,445-UNIMOD:1031,400-UNIMOD:1031,441-UNIMOD:1031,162-UNIMOD:259,281-UNIMOD:1031,108-UNIMOD:1031 0.27 53.0 9 9 9 PRT sp|P61978|HNRPK_HUMAN Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 53.0 null 456-UNIMOD:1031,52-UNIMOD:1031,422-UNIMOD:1031,86-UNIMOD:267,163-UNIMOD:1031,405-UNIMOD:1031,456-UNIMOD:259,60-UNIMOD:1031,219-UNIMOD:1031,422-UNIMOD:259,198-UNIMOD:1031,42-UNIMOD:35,145-UNIMOD:4,60-UNIMOD:259 0.41 53.0 28 18 10 PRT sp|O15372|EIF3H_HUMAN Eukaryotic translation initiation factor 3 subunit H OS=Homo sapiens OX=9606 GN=EIF3H PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 53.0 null 5-UNIMOD:1031,227-UNIMOD:1031,274-UNIMOD:1031,269-UNIMOD:1031,221-UNIMOD:1031 0.17 53.0 7 5 3 PRT sp|P04792|HSPB1_HUMAN Heat shock protein beta-1 OS=Homo sapiens OX=9606 GN=HSPB1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 53.0 null 141-UNIMOD:1031,112-UNIMOD:1031,198-UNIMOD:1031,169-UNIMOD:35,188-UNIMOD:267,123-UNIMOD:1031,114-UNIMOD:1031,114-UNIMOD:259,123-UNIMOD:259,89-UNIMOD:267,136-UNIMOD:267,128-UNIMOD:28 0.63 53.0 28 10 3 PRT sp|P08238|HS90B_HUMAN Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 53.0 null 491-UNIMOD:1031,538-UNIMOD:1031,204-UNIMOD:1031,624-UNIMOD:1031,306-UNIMOD:259,639-UNIMOD:267,466-UNIMOD:35,438-UNIMOD:1031,306-UNIMOD:1031,481-UNIMOD:1031,521-UNIMOD:4,219-UNIMOD:1031,531-UNIMOD:1031,347-UNIMOD:1031,348-UNIMOD:1031,72-UNIMOD:1031,107-UNIMOD:1031,617-UNIMOD:35,623-UNIMOD:1031,620-UNIMOD:35,621-UNIMOD:35,435-UNIMOD:1031,513-UNIMOD:35,526-UNIMOD:1031,564-UNIMOD:4,559-UNIMOD:1031,502-UNIMOD:267,428-UNIMOD:1031,567-UNIMOD:35,568-UNIMOD:1031,69-UNIMOD:1031,177-UNIMOD:267,491-UNIMOD:259,448-UNIMOD:267,606-UNIMOD:35,607-UNIMOD:1031 0.38 53.0 113 30 7 PRT sp|P68366-2|TBA4A_HUMAN Isoform 2 of Tubulin alpha-4A chain OS=Homo sapiens OX=9606 GN=TUBA4A null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 53.0 null 39-UNIMOD:4,45-UNIMOD:1031,97-UNIMOD:1031,311-UNIMOD:1031,321-UNIMOD:1031 0.14 53.0 5 5 5 PRT sp|O43399-6|TPD54_HUMAN Isoform 6 of Tumor protein D54 OS=Homo sapiens OX=9606 GN=TPD52L2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 53.0 null 96-UNIMOD:1031,27-UNIMOD:267,47-UNIMOD:1031 0.32 53.0 4 4 4 PRT sp|P36639-4|8ODP_HUMAN Isoform p18 of 7,8-dihydro-8-oxoguanine triphosphatase OS=Homo sapiens OX=9606 GN=NUDT1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 53.0 null 38-UNIMOD:1031,24-UNIMOD:1031 0.18 53.0 2 2 1 PRT sp|P31948|STIP1_HUMAN Stress-induced-phosphoprotein 1 OS=Homo sapiens OX=9606 GN=STIP1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 52.0 null 26-UNIMOD:4,32-UNIMOD:1031,100-UNIMOD:1031,252-UNIMOD:1031,325-UNIMOD:1031,453-UNIMOD:1031,461-UNIMOD:4,417-UNIMOD:4,420-UNIMOD:4,429-UNIMOD:1031,364-UNIMOD:1031,100-UNIMOD:259,109-UNIMOD:259,523-UNIMOD:1031,381-UNIMOD:1031,446-UNIMOD:1031,282-UNIMOD:4,284-UNIMOD:1031,530-UNIMOD:1031,312-UNIMOD:1031,78-UNIMOD:1031,317-UNIMOD:1031,523-UNIMOD:259,1-UNIMOD:1,8-UNIMOD:1031,1-UNIMOD:35,486-UNIMOD:1031,366-UNIMOD:1031,370-UNIMOD:4,68-UNIMOD:259,73-UNIMOD:259,429-UNIMOD:259,246-UNIMOD:1031,229-UNIMOD:1031,388-UNIMOD:1031,533-UNIMOD:1031,162-UNIMOD:1031,339-UNIMOD:385,339-UNIMOD:4,344-UNIMOD:1031,395-UNIMOD:1031,162-UNIMOD:259,169-UNIMOD:259,301-UNIMOD:1031,462-UNIMOD:259,237-UNIMOD:1031,338-UNIMOD:1031,337-UNIMOD:1031,305-UNIMOD:267,338-UNIMOD:259,344-UNIMOD:259,325-UNIMOD:259,277-UNIMOD:1031,278-UNIMOD:4,347-UNIMOD:1031,51-UNIMOD:1031,250-UNIMOD:1031 0.66 52.0 72 42 23 PRT sp|P80723|BASP1_HUMAN Brain acid soluble protein 1 OS=Homo sapiens OX=9606 GN=BASP1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 52.0 null 210-UNIMOD:1031,173-UNIMOD:1031,143-UNIMOD:1031,173-UNIMOD:259,184-UNIMOD:259,25-UNIMOD:1031,150-UNIMOD:259,163-UNIMOD:259,150-UNIMOD:1031,52-UNIMOD:1031,79-UNIMOD:1031,38-UNIMOD:259,89-UNIMOD:1031,198-UNIMOD:259,10-UNIMOD:1031,18-UNIMOD:1031,69-UNIMOD:1031,52-UNIMOD:259,57-UNIMOD:1031,84-UNIMOD:1031 0.84 52.0 24 15 8 PRT sp|P30086|PEBP1_HUMAN Phosphatidylethanolamine-binding protein 1 OS=Homo sapiens OX=9606 GN=PEBP1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 52.0 null 113-UNIMOD:1031,150-UNIMOD:1031 0.24 52.0 3 3 3 PRT sp|P49588|SYAC_HUMAN Alanine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=AARS1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 52.0 null 172-UNIMOD:1031,184-UNIMOD:4,187-UNIMOD:4,671-UNIMOD:4,677-UNIMOD:1031,625-UNIMOD:1031,255-UNIMOD:35,747-UNIMOD:1031,651-UNIMOD:1031,81-UNIMOD:1031,558-UNIMOD:1031,90-UNIMOD:1031,65-UNIMOD:1031,762-UNIMOD:1031,338-UNIMOD:1031,236-UNIMOD:1031,242-UNIMOD:35,876-UNIMOD:1031,90-UNIMOD:259,772-UNIMOD:1031,773-UNIMOD:4,178-UNIMOD:35,74-UNIMOD:1031,75-UNIMOD:4,782-UNIMOD:1031,396-UNIMOD:1031,451-UNIMOD:1031,789-UNIMOD:1031,762-UNIMOD:259,834-UNIMOD:1031,81-UNIMOD:259,231-UNIMOD:1031,533-UNIMOD:4,550-UNIMOD:259,19-UNIMOD:1031 0.34 52.0 58 27 18 PRT sp|P07195|LDHB_HUMAN L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 52.0 null 60-UNIMOD:1031,7-UNIMOD:1031,82-UNIMOD:1031,244-UNIMOD:1031,329-UNIMOD:1031,310-UNIMOD:1031,58-UNIMOD:1031,308-UNIMOD:1031,82-UNIMOD:259,91-UNIMOD:259,58-UNIMOD:259,233-UNIMOD:259,244-UNIMOD:259,127-UNIMOD:259,156-UNIMOD:1031,234-UNIMOD:35,308-UNIMOD:259 0.41 52.0 21 15 10 PRT sp|O94806|KPCD3_HUMAN Serine/threonine-protein kinase D3 OS=Homo sapiens OX=9606 GN=PRKD3 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 52.0 null 698-UNIMOD:4,701-UNIMOD:1031,605-UNIMOD:1031 0.04 52.0 2 2 2 PRT sp|Q7LGA3-3|HS2ST_HUMAN Isoform 3 of Heparan sulfate 2-O-sulfotransferase 1 OS=Homo sapiens OX=9606 GN=HS2ST1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 52.0 null 83-UNIMOD:1031,97-UNIMOD:4 0.09 52.0 2 1 0 PRT sp|Q8IZ83-3|A16A1_HUMAN Isoform 3 of Aldehyde dehydrogenase family 16 member A1 OS=Homo sapiens OX=9606 GN=ALDH16A1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 51.0 null 513-UNIMOD:1031 0.03 51.0 6 1 0 PRT sp|P38646|GRP75_HUMAN Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 51.0 null 187-UNIMOD:1031,206-UNIMOD:1031,485-UNIMOD:259,394-UNIMOD:1031,175-UNIMOD:1031,121-UNIMOD:1031,366-UNIMOD:4,368-UNIMOD:1031,76-UNIMOD:1031,135-UNIMOD:1031,300-UNIMOD:1031,303-UNIMOD:35,99-UNIMOD:267,625-UNIMOD:1031,646-UNIMOD:259,234-UNIMOD:259,567-UNIMOD:1031,608-UNIMOD:4,610-UNIMOD:1031,238-UNIMOD:1031,389-UNIMOD:35,392-UNIMOD:35,288-UNIMOD:1031,653-UNIMOD:1031,174-UNIMOD:35,345-UNIMOD:1031,513-UNIMOD:267,103-UNIMOD:35,106-UNIMOD:1031,612-UNIMOD:1031,143-UNIMOD:1031 0.48 51.0 38 28 18 PRT sp|P54760|EPHB4_HUMAN Ephrin type-B receptor 4 OS=Homo sapiens OX=9606 GN=EPHB4 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 51.0 null 781-UNIMOD:1031 0.02 51.0 2 1 0 PRT sp|P40937|RFC5_HUMAN Replication factor C subunit 5 OS=Homo sapiens OX=9606 GN=RFC5 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 51.0 null 66-UNIMOD:1031,73-UNIMOD:4 0.07 51.0 1 1 1 PRT sp|P18621|RL17_HUMAN 60S ribosomal protein L17 OS=Homo sapiens OX=9606 GN=RPL17 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 51.0 null 105-UNIMOD:1031,124-UNIMOD:1031,37-UNIMOD:1031,86-UNIMOD:1031,39-UNIMOD:35,49-UNIMOD:1031,159-UNIMOD:1031,27-UNIMOD:1031,144-UNIMOD:4,153-UNIMOD:1031 0.56 51.0 13 9 7 PRT sp|P22102|PUR2_HUMAN Trifunctional purine biosynthetic protein adenosine-3 OS=Homo sapiens OX=9606 GN=GART PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 51.0 null 93-UNIMOD:4,107-UNIMOD:1031,28-UNIMOD:1031,41-UNIMOD:4,438-UNIMOD:1031,156-UNIMOD:259,162-UNIMOD:259,156-UNIMOD:1031,212-UNIMOD:35,219-UNIMOD:1031,852-UNIMOD:1031,404-UNIMOD:1031,459-UNIMOD:1031,501-UNIMOD:1031,506-UNIMOD:4,251-UNIMOD:1031,866-UNIMOD:1031,449-UNIMOD:35,452-UNIMOD:1031,453-UNIMOD:1031,285-UNIMOD:1031,291-UNIMOD:4,164-UNIMOD:1031,168-UNIMOD:4,977-UNIMOD:1031,162-UNIMOD:1031 0.19 51.0 87 17 10 PRT sp|Q14677-2|EPN4_HUMAN Isoform 2 of Clathrin interactor 1 OS=Homo sapiens OX=9606 GN=CLINT1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 51.0 null 104-UNIMOD:1031,189-UNIMOD:1031,182-UNIMOD:1031 0.08 51.0 4 3 2 PRT sp|P40925|MDHC_HUMAN Malate dehydrogenase, cytoplasmic OS=Homo sapiens OX=9606 GN=MDH1 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 51.0 null 137-UNIMOD:4,142-UNIMOD:1031,248-UNIMOD:1031,251-UNIMOD:4,110-UNIMOD:1031,73-UNIMOD:1031,239-UNIMOD:1031,214-UNIMOD:1031,205-UNIMOD:1031,118-UNIMOD:1031,103-UNIMOD:1031,310-UNIMOD:267,107-UNIMOD:1031,236-UNIMOD:1031 0.36 51.0 14 13 12 PRT sp|Q14204|DYHC1_HUMAN Cytoplasmic dynein 1 heavy chain 1 OS=Homo sapiens OX=9606 GN=DYNC1H1 PE=1 SV=5 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 51.0 null 2928-UNIMOD:28,2943-UNIMOD:1031,1912-UNIMOD:1031,2094-UNIMOD:1031,624-UNIMOD:1031,633-UNIMOD:4,235-UNIMOD:1031,67-UNIMOD:1031,3940-UNIMOD:4,3945-UNIMOD:1031,1584-UNIMOD:1031,3239-UNIMOD:1031,2639-UNIMOD:4,2642-UNIMOD:267,1099-UNIMOD:1031,2033-UNIMOD:1031,3620-UNIMOD:267,2239-UNIMOD:1031 0.05 51.0 26 16 13 PRT sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 50.0 null 2202-UNIMOD:4,2206-UNIMOD:1031,1992-UNIMOD:4,1993-UNIMOD:1031,1911-UNIMOD:1031,1151-UNIMOD:1031,1704-UNIMOD:1031,1158-UNIMOD:1031,1927-UNIMOD:1031,236-UNIMOD:1031,2436-UNIMOD:1031,2186-UNIMOD:1031,1847-UNIMOD:1031,41-UNIMOD:1031,673-UNIMOD:1031,1403-UNIMOD:4 0.10 50.0 21 18 15 PRT sp|P63167|DYL1_HUMAN Dynein light chain 1, cytoplasmic OS=Homo sapiens OX=9606 GN=DYNLL1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 50.0 null 9-UNIMOD:1031,24-UNIMOD:4,31-UNIMOD:1031,13-UNIMOD:35,17-UNIMOD:35,36-UNIMOD:1031,43-UNIMOD:1031 0.45 50.0 5 4 3 PRT sp|Q01105-2|SET_HUMAN Isoform 2 of Protein SET OS=Homo sapiens OX=9606 GN=SET null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ] 50.0 null 154-UNIMOD:1031,11-UNIMOD:1031,141-UNIMOD:1031,55-UNIMOD:1031,154-UNIMOD:259,44-UNIMOD:267,55-UNIMOD:259,176-UNIMOD:1031,2-UNIMOD:1,7-UNIMOD:1031,164-UNIMOD:1031,59-UNIMOD:1031,65-UNIMOD:28,70-UNIMOD:1031 0.40 50.0 24 13 5 PRT sp|Q9H477-2|RBSK_HUMAN Isoform 2 of Ribokinase OS=Homo sapiens OX=9606 GN=RBKS null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 50.0 null 54-UNIMOD:1031,59-UNIMOD:4 0.07 50.0 1 1 1 PRT sp|P06733|ENOA_HUMAN Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 50.0 null 162-UNIMOD:259,202-UNIMOD:1031,221-UNIMOD:259,71-UNIMOD:1031,357-UNIMOD:4,358-UNIMOD:1031,193-UNIMOD:1031,326-UNIMOD:1031,165-UNIMOD:35,169-UNIMOD:35,92-UNIMOD:1031,94-UNIMOD:35,97-UNIMOD:35,244-UNIMOD:35,80-UNIMOD:1031,89-UNIMOD:1031,228-UNIMOD:1031,64-UNIMOD:1031,233-UNIMOD:1031,193-UNIMOD:259,281-UNIMOD:259,103-UNIMOD:259,28-UNIMOD:259,81-UNIMOD:259,89-UNIMOD:259,239-UNIMOD:1031,420-UNIMOD:1031,81-UNIMOD:1031,406-UNIMOD:1031,256-UNIMOD:1031,335-UNIMOD:1031,337-UNIMOD:4,339-UNIMOD:4,2-UNIMOD:1,5-UNIMOD:1031,330-UNIMOD:1031,179-UNIMOD:267,60-UNIMOD:1031,58-UNIMOD:35,422-UNIMOD:1031,343-UNIMOD:259,330-UNIMOD:259,335-UNIMOD:259,80-UNIMOD:259 0.69 50.0 75 33 11 PRT sp|P62701|RS4X_HUMAN 40S ribosomal protein S4, X isoform OS=Homo sapiens OX=9606 GN=RPS4X PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 50.0 null 211-UNIMOD:1031,134-UNIMOD:1031,211-UNIMOD:259,94-UNIMOD:259,16-UNIMOD:1031,19-UNIMOD:35,37-UNIMOD:1031,233-UNIMOD:1031,230-UNIMOD:259,221-UNIMOD:267,62-UNIMOD:1031,63-UNIMOD:1031,128-UNIMOD:259,134-UNIMOD:259,71-UNIMOD:1031,128-UNIMOD:1031,106-UNIMOD:1031,75-UNIMOD:1031,65-UNIMOD:4 0.50 50.0 28 14 2 PRT sp|O43681|ASNA_HUMAN ATPase ASNA1 OS=Homo sapiens OX=9606 GN=ASNA1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 50.0 null 301-UNIMOD:1031,306-UNIMOD:35,50-UNIMOD:1031,53-UNIMOD:4,55-UNIMOD:4,89-UNIMOD:1031 0.19 50.0 6 3 2 PRT sp|P11021|BIP_HUMAN Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 50.0 null 81-UNIMOD:1031,447-UNIMOD:1031,617-UNIMOD:1031,96-UNIMOD:1031,185-UNIMOD:1031,196-UNIMOD:35,164-UNIMOD:1031,353-UNIMOD:1031,464-UNIMOD:259,621-UNIMOD:1031,573-UNIMOD:1031,213-UNIMOD:1031,96-UNIMOD:259,326-UNIMOD:1031,332-UNIMOD:35,376-UNIMOD:1031,154-UNIMOD:1031,125-UNIMOD:1031,148-UNIMOD:35,152-UNIMOD:259,523-UNIMOD:1031,516-UNIMOD:1031,153-UNIMOD:35,125-UNIMOD:259,138-UNIMOD:259,263-UNIMOD:35,268-UNIMOD:1031,541-UNIMOD:35,547-UNIMOD:1031,382-UNIMOD:1031,370-UNIMOD:1031,113-UNIMOD:259,271-UNIMOD:1031,601-UNIMOD:1031,118-UNIMOD:1031,591-UNIMOD:1031,74-UNIMOD:267,573-UNIMOD:259,339-UNIMOD:35,340-UNIMOD:1031,340-UNIMOD:259,344-UNIMOD:259,352-UNIMOD:1031,370-UNIMOD:259,376-UNIMOD:259,532-UNIMOD:267,197-UNIMOD:267,163-UNIMOD:259,521-UNIMOD:1031 0.56 50.0 86 39 20 PRT sp|P63244|RACK1_HUMAN Receptor of activated protein C kinase 1 OS=Homo sapiens OX=9606 GN=RACK1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 50.0 null 185-UNIMOD:1031,207-UNIMOD:4,271-UNIMOD:1031,240-UNIMOD:4,245-UNIMOD:267,212-UNIMOD:1031,168-UNIMOD:4,172-UNIMOD:1031,182-UNIMOD:4,183-UNIMOD:1031,175-UNIMOD:1031 0.30 50.0 11 8 5 PRT sp|Q9BZL6-2|KPCD2_HUMAN Isoform 2 of Serine/threonine-protein kinase D2 OS=Homo sapiens OX=9606 GN=PRKD2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 50.0 null 516-UNIMOD:4,519-UNIMOD:1031,423-UNIMOD:1031 0.05 50.0 2 2 2 PRT sp|Q9NPF4|OSGEP_HUMAN Probable tRNA N6-adenosine threonylcarbamoyltransferase OS=Homo sapiens OX=9606 GN=OSGEP PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ] 50.0 null 13-UNIMOD:1031 0.10 50.0 5 2 1 PRT sp|P31943|HNRH1_HUMAN Heterogeneous nuclear ribonucleoprotein H OS=Homo sapiens OX=9606 GN=HNRNPH1 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 50.0 null 98-UNIMOD:1031,34-UNIMOD:4,35-UNIMOD:1031 0.14 50.0 6 4 2 PRT sp|Q92769|HDAC2_HUMAN Histone deacetylase 2 OS=Homo sapiens OX=9606 GN=HDAC2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 50.0 null 13-UNIMOD:4,32-UNIMOD:1031,31-UNIMOD:35,468-UNIMOD:1031 0.07 50.0 6 2 1 PRT sp|P41240|CSK_HUMAN Tyrosine-protein kinase CSK OS=Homo sapiens OX=9606 GN=CSK PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 50.0 null 337-UNIMOD:1031,347-UNIMOD:1031,351-UNIMOD:1031,222-UNIMOD:1031,223-UNIMOD:4 0.07 50.0 10 3 1 PRT sp|Q14240|IF4A2_HUMAN Eukaryotic initiation factor 4A-II OS=Homo sapiens OX=9606 GN=EIF4A2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 50.0 null 67-UNIMOD:4,69-UNIMOD:1031,239-UNIMOD:1031,382-UNIMOD:1031 0.12 50.0 4 3 2 PRT sp|P23219|PGH1_HUMAN Prostaglandin G/H synthase 1 OS=Homo sapiens OX=9606 GN=PTGS1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 50.0 null 221-UNIMOD:1031 0.04 50.0 1 1 0 PRT sp|Q9BQE3|TBA1C_HUMAN Tubulin alpha-1C chain OS=Homo sapiens OX=9606 GN=TUBA1C PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 49.0 null 295-UNIMOD:4,304-UNIMOD:1031,305-UNIMOD:4 0.06 49.0 1 1 1 PRT sp|P38919|IF4A3_HUMAN Eukaryotic initiation factor 4A-III OS=Homo sapiens OX=9606 GN=EIF4A3 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 49.0 null 314-UNIMOD:1031,307-UNIMOD:35,311-UNIMOD:35,152-UNIMOD:1031,19-UNIMOD:1031,23-UNIMOD:35,374-UNIMOD:1031,198-UNIMOD:1031,70-UNIMOD:1031,320-UNIMOD:35,321-UNIMOD:1031,88-UNIMOD:1031 0.23 49.0 16 8 4 PRT sp|P62906|RL10A_HUMAN 60S ribosomal protein L10a OS=Homo sapiens OX=9606 GN=RPL10A PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 49.0 null 147-UNIMOD:1031,62-UNIMOD:1031,66-UNIMOD:4,74-UNIMOD:4,144-UNIMOD:35,78-UNIMOD:1031,106-UNIMOD:1031,91-UNIMOD:1031,85-UNIMOD:35,92-UNIMOD:1031,133-UNIMOD:1031,130-UNIMOD:1031,152-UNIMOD:1031,23-UNIMOD:267 0.42 49.0 14 9 6 PRT sp|P12429|ANXA3_HUMAN Annexin A3 OS=Homo sapiens OX=9606 GN=ANXA3 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 49.0 null 97-UNIMOD:1031,84-UNIMOD:35,100-UNIMOD:1031,104-UNIMOD:1031,69-UNIMOD:1031 0.17 49.0 7 3 2 PRT sp|P60174-1|TPIS_HUMAN Isoform 2 of Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 49.0 null 67-UNIMOD:4,69-UNIMOD:1031,83-UNIMOD:35,175-UNIMOD:1031,113-UNIMOD:259,149-UNIMOD:1031,188-UNIMOD:259,142-UNIMOD:1031,33-UNIMOD:259,156-UNIMOD:1031,218-UNIMOD:4,188-UNIMOD:1031,206-UNIMOD:267,69-UNIMOD:259 0.55 49.0 23 12 4 PRT sp|Q13535-2|ATR_HUMAN Isoform 2 of Serine/threonine-protein kinase ATR OS=Homo sapiens OX=9606 GN=ATR null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 49.0 null 1869-UNIMOD:1031,2260-UNIMOD:35,2261-UNIMOD:35,2262-UNIMOD:4,2263-UNIMOD:1031,1897-UNIMOD:1031 0.01 49.0 9 3 1 PRT sp|P42684-4|ABL2_HUMAN Isoform 4 of Tyrosine-protein kinase ABL2 OS=Homo sapiens OX=9606 GN=ABL2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 49.0 null 410-UNIMOD:1031,398-UNIMOD:35,284-UNIMOD:1031,281-UNIMOD:1031 0.04 49.0 5 3 2 PRT sp|Q5VTE0|EF1A3_HUMAN Putative elongation factor 1-alpha-like 3 OS=Homo sapiens OX=9606 GN=EEF1A1P5 PE=5 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 49.0 null 255-UNIMOD:1031,404-UNIMOD:35,408-UNIMOD:1031,410-UNIMOD:35,411-UNIMOD:4,273-UNIMOD:1031,5-UNIMOD:1031,20-UNIMOD:259,276-UNIMOD:35,439-UNIMOD:1031,273-UNIMOD:259,290-UNIMOD:259,172-UNIMOD:1031,30-UNIMOD:1031,31-UNIMOD:4,44-UNIMOD:1031,49-UNIMOD:35,266-UNIMOD:267,450-UNIMOD:1031,165-UNIMOD:1031,453-UNIMOD:1031,395-UNIMOD:1031,392-UNIMOD:1031,443-UNIMOD:1031,146-UNIMOD:259,30-UNIMOD:259,51-UNIMOD:1031,96-UNIMOD:267,155-UNIMOD:35,179-UNIMOD:1031,444-UNIMOD:1031,386-UNIMOD:259,392-UNIMOD:259,386-UNIMOD:1031,255-UNIMOD:259,439-UNIMOD:259,457-UNIMOD:1031,460-UNIMOD:1031,41-UNIMOD:1031,408-UNIMOD:259,423-UNIMOD:267 0.47 49.0 62 26 4 PRT sp|P23219-4|PGH1_HUMAN Isoform 4 of Prostaglandin G/H synthase 1 OS=Homo sapiens OX=9606 GN=PTGS1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 49.0 null 106-UNIMOD:35,112-UNIMOD:1031 0.05 49.0 1 1 0 PRT sp|Q9H2U2-6|IPYR2_HUMAN Isoform 5 of Inorganic pyrophosphatase 2, mitochondrial OS=Homo sapiens OX=9606 GN=PPA2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 49.0 null 69-UNIMOD:1031 0.09 49.0 1 1 1 PRT sp|P23368-2|MAOM_HUMAN Isoform 2 of NAD-dependent malic enzyme, mitochondrial OS=Homo sapiens OX=9606 GN=ME2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 49.0 null 156-UNIMOD:1031 0.05 49.0 2 1 0 PRT sp|P30101|PDIA3_HUMAN Protein disulfide-isomerase A3 OS=Homo sapiens OX=9606 GN=PDIA3 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 49.0 null 329-UNIMOD:267,305-UNIMOD:1031,85-UNIMOD:4,92-UNIMOD:4,94-UNIMOD:1031,366-UNIMOD:1031,82-UNIMOD:1031,296-UNIMOD:1031,218-UNIMOD:1031,494-UNIMOD:1031,214-UNIMOD:1031,129-UNIMOD:1031,130-UNIMOD:1031,425-UNIMOD:1031,226-UNIMOD:1031,104-UNIMOD:1031,335-UNIMOD:1031,362-UNIMOD:1031,494-UNIMOD:259,496-UNIMOD:259,73-UNIMOD:267,75-UNIMOD:1031,461-UNIMOD:1031,289-UNIMOD:1031,379-UNIMOD:259,129-UNIMOD:259,274-UNIMOD:1031,119-UNIMOD:267,482-UNIMOD:267,460-UNIMOD:259,104-UNIMOD:259,347-UNIMOD:1031,422-UNIMOD:1031 0.53 49.0 43 32 25 PRT sp|P62847-2|RS24_HUMAN Isoform 2 of 40S ribosomal protein S24 OS=Homo sapiens OX=9606 GN=RPS24 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 49.0 null 68-UNIMOD:1031,83-UNIMOD:1031,32-UNIMOD:1031,21-UNIMOD:1031,74-UNIMOD:35,83-UNIMOD:259,23-UNIMOD:35,122-UNIMOD:1031,61-UNIMOD:267,129-UNIMOD:1031,68-UNIMOD:259,37-UNIMOD:1031 0.54 49.0 18 9 1 PRT sp|Q92598-2|HS105_HUMAN Isoform Beta of Heat shock protein 105 kDa OS=Homo sapiens OX=9606 GN=HSPH1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 49.0 null 53-UNIMOD:1031,95-UNIMOD:1031,684-UNIMOD:1031,728-UNIMOD:1031,270-UNIMOD:4,272-UNIMOD:1031,68-UNIMOD:1031,356-UNIMOD:1031,659-UNIMOD:1031 0.17 49.0 13 13 12 PRT sp|Q15056-2|IF4H_HUMAN Isoform Short of Eukaryotic translation initiation factor 4H OS=Homo sapiens OX=9606 GN=EIF4H null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 49.0 null 217-UNIMOD:267,82-UNIMOD:1031,85-UNIMOD:4,123-UNIMOD:1031 0.27 49.0 5 4 1 PRT sp|P62266|RS23_HUMAN 40S ribosomal protein S23 OS=Homo sapiens OX=9606 GN=RPS23 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 48.0 null 48-UNIMOD:1031,37-UNIMOD:1031,108-UNIMOD:1031,135-UNIMOD:1031,54-UNIMOD:1031,60-UNIMOD:1031,29-UNIMOD:1031,48-UNIMOD:259,76-UNIMOD:1031,25-UNIMOD:1031,37-UNIMOD:259 0.53 48.0 22 11 2 PRT sp|P49773|HINT1_HUMAN Histidine triad nucleotide-binding protein 1 OS=Homo sapiens OX=9606 GN=HINT1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 48.0 null 38-UNIMOD:4,57-UNIMOD:1031,38-UNIMOD:385,58-UNIMOD:1031,2-UNIMOD:1,7-UNIMOD:1031,30-UNIMOD:1031,84-UNIMOD:4,92-UNIMOD:1031,83-UNIMOD:1031,21-UNIMOD:1031 0.57 48.0 11 7 4 PRT sp|O60506|HNRPQ_HUMAN Heterogeneous nuclear ribonucleoprotein Q OS=Homo sapiens OX=9606 GN=SYNCRIP PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 48.0 null 289-UNIMOD:4,297-UNIMOD:1031,283-UNIMOD:1031,117-UNIMOD:1031,363-UNIMOD:1031,407-UNIMOD:1031,254-UNIMOD:1031,338-UNIMOD:1031 0.16 48.0 8 7 6 PRT sp|P25787|PSA2_HUMAN Proteasome subunit alpha type-2 OS=Homo sapiens OX=9606 GN=PSMA2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 48.0 null 92-UNIMOD:1031,53-UNIMOD:1031 0.14 48.0 3 2 1 PRT sp|P63241|IF5A1_HUMAN Eukaryotic translation initiation factor 5A-1 OS=Homo sapiens OX=9606 GN=EIF5A PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 48.0 null 68-UNIMOD:1031,73-UNIMOD:4,79-UNIMOD:35,121-UNIMOD:1031,38-UNIMOD:4,39-UNIMOD:1031,67-UNIMOD:259,27-UNIMOD:1031,34-UNIMOD:1031,43-UNIMOD:35,47-UNIMOD:259 0.43 48.0 15 7 2 PRT sp|Q9H773|DCTP1_HUMAN dCTP pyrophosphatase 1 OS=Homo sapiens OX=9606 GN=DCTPP1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 48.0 null 140-UNIMOD:1031,162-UNIMOD:4 0.19 48.0 1 1 1 PRT sp|P54619-2|AAKG1_HUMAN Isoform 2 of 5'-AMP-activated protein kinase subunit gamma-1 OS=Homo sapiens OX=9606 GN=PRKAG1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 48.0 null 138-UNIMOD:1031,202-UNIMOD:259 0.10 48.0 3 2 1 PRT sp|P40227|TCPZ_HUMAN T-complex protein 1 subunit zeta OS=Homo sapiens OX=9606 GN=CCT6A PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 48.0 null 58-UNIMOD:1031,127-UNIMOD:1031,199-UNIMOD:1031,55-UNIMOD:1031,381-UNIMOD:1031,129-UNIMOD:1031,45-UNIMOD:1031,388-UNIMOD:1031,377-UNIMOD:1031,10-UNIMOD:1031,365-UNIMOD:1031,366-UNIMOD:4,41-UNIMOD:1031,2-UNIMOD:1,5-UNIMOD:1031,280-UNIMOD:1031,282-UNIMOD:4,388-UNIMOD:259,44-UNIMOD:35,273-UNIMOD:1031,287-UNIMOD:1031 0.31 48.0 28 18 9 PRT sp|P61221|ABCE1_HUMAN ATP-binding cassette sub-family E member 1 OS=Homo sapiens OX=9606 GN=ABCE1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 48.0 null 116-UNIMOD:1031,419-UNIMOD:1031,431-UNIMOD:1031 0.07 48.0 3 3 3 PRT sp|P30085-3|KCY_HUMAN Isoform 3 of UMP-CMP kinase OS=Homo sapiens OX=9606 GN=CMPK1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 48.0 null 48-UNIMOD:1031,52-UNIMOD:4 0.09 48.0 3 1 0 PRT sp|P28482-2|MK01_HUMAN Isoform 2 of Mitogen-activated protein kinase 1 OS=Homo sapiens OX=9606 GN=MAPK1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 48.0 null 0.06 48.0 1 1 1 PRT sp|Q13547|HDAC1_HUMAN Histone deacetylase 1 OS=Homo sapiens OX=9606 GN=HDAC1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 48.0 null 12-UNIMOD:4,31-UNIMOD:1031,30-UNIMOD:35,408-UNIMOD:4,412-UNIMOD:1031 0.07 48.0 4 2 1 PRT sp|P46087-3|NOP2_HUMAN Isoform 3 of Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase OS=Homo sapiens OX=9606 GN=NOP2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 48.0 null 459-UNIMOD:4,467-UNIMOD:1031 0.03 48.0 2 1 0 PRT sp|P39687|AN32A_HUMAN Acidic leucine-rich nuclear phosphoprotein 32 family member A OS=Homo sapiens OX=9606 GN=ANP32A PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 48.0 null 86-UNIMOD:1031,87-UNIMOD:4,99-UNIMOD:1031,20-UNIMOD:1031,101-UNIMOD:1031,68-UNIMOD:1031,110-UNIMOD:1031,111-UNIMOD:1031 0.32 48.0 10 8 5 PRT sp|P28066-2|PSA5_HUMAN Isoform 2 of Proteasome subunit alpha type-5 OS=Homo sapiens OX=9606 GN=PSMA5 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 47.0 null 129-UNIMOD:1031,138-UNIMOD:1031 0.20 47.0 2 2 2 PRT sp|P61254|RL26_HUMAN 60S ribosomal protein L26 OS=Homo sapiens OX=9606 GN=RPL26 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 47.0 null 103-UNIMOD:1031,89-UNIMOD:1031,63-UNIMOD:1031,36-UNIMOD:1031,2-UNIMOD:1031,51-UNIMOD:1031,28-UNIMOD:1031,30-UNIMOD:35,26-UNIMOD:267,136-UNIMOD:1031,69-UNIMOD:1031 0.59 47.0 20 10 3 PRT sp|P54819-3|KAD2_HUMAN Isoform 3 of Adenylate kinase 2, mitochondrial OS=Homo sapiens OX=9606 GN=AK2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 47.0 null 28-UNIMOD:1031,147-UNIMOD:1031 0.13 47.0 29 3 2 PRT sp|Q15418-4|KS6A1_HUMAN Isoform 4 of Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens OX=9606 GN=RPS6KA1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 47.0 null 521-UNIMOD:1031,536-UNIMOD:4,194-UNIMOD:1031,201-UNIMOD:1031,59-UNIMOD:1031 0.07 47.0 9 3 0 PRT sp|P06748|NPM_HUMAN Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 47.0 null 32-UNIMOD:1031,251-UNIMOD:35,257-UNIMOD:1031,239-UNIMOD:1031,45-UNIMOD:267,81-UNIMOD:35,248-UNIMOD:1031,150-UNIMOD:1031,154-UNIMOD:1031,267-UNIMOD:1031,273-UNIMOD:1031,250-UNIMOD:1031,206-UNIMOD:1031,202-UNIMOD:1031,27-UNIMOD:1031,263-UNIMOD:1031,248-UNIMOD:259,212-UNIMOD:1031,223-UNIMOD:259,229-UNIMOD:259,141-UNIMOD:1031,275-UNIMOD:4,257-UNIMOD:259,54-UNIMOD:259 0.55 47.0 37 22 11 PRT sp|P00505|AATM_HUMAN Aspartate aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=GOT2 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 47.0 null 382-UNIMOD:4,387-UNIMOD:1031,185-UNIMOD:1031,187-UNIMOD:4,200-UNIMOD:259,73-UNIMOD:1031,82-UNIMOD:259,90-UNIMOD:259,82-UNIMOD:1031,90-UNIMOD:1031 0.20 47.0 9 7 5 PRT sp|Q13188|STK3_HUMAN Serine/threonine-protein kinase 3 OS=Homo sapiens OX=9606 GN=STK3 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 47.0 null 56-UNIMOD:1031,175-UNIMOD:35,177-UNIMOD:1031,148-UNIMOD:1031 0.12 47.0 9 3 0 PRT sp|Q13572-2|ITPK1_HUMAN Isoform 2 of Inositol-tetrakisphosphate 1-kinase OS=Homo sapiens OX=9606 GN=ITPK1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 47.0 null 237-UNIMOD:1031 0.08 47.0 2 1 0 PRT sp|O95816|BAG2_HUMAN BAG family molecular chaperone regulator 2 OS=Homo sapiens OX=9606 GN=BAG2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 47.0 null 132-UNIMOD:1031,142-UNIMOD:4,111-UNIMOD:1031,195-UNIMOD:1031,9-UNIMOD:1031,209-UNIMOD:267 0.36 47.0 7 5 3 PRT sp|P53597|SUCA_HUMAN Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=SUCLG1 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 47.0 null 60-UNIMOD:4,66-UNIMOD:1031,90-UNIMOD:1031,57-UNIMOD:1031 0.15 47.0 3 3 3 PRT sp|Q13492-3|PICAL_HUMAN Isoform 3 of Phosphatidylinositol-binding clathrin assembly protein OS=Homo sapiens OX=9606 GN=PICALM null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 47.0 null 24-UNIMOD:1031,27-UNIMOD:4,28-UNIMOD:1031,35-UNIMOD:35,38-UNIMOD:1031 0.05 47.0 4 3 2 PRT sp|P43155-3|CACP_HUMAN Isoform 3 of Carnitine O-acetyltransferase OS=Homo sapiens OX=9606 GN=CRAT null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 47.0 null 245-UNIMOD:1031 0.04 47.0 1 1 1 PRT sp|Q8N4P3-2|MESH1_HUMAN Isoform 2 of Guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase MESH1 OS=Homo sapiens OX=9606 GN=HDDC3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 47.0 null 25-UNIMOD:1031,93-UNIMOD:1031,97-UNIMOD:1031 0.23 47.0 12 2 0 PRT sp|P62807|H2B1C_HUMAN Histone H2B type 1-C/E/F/G/I OS=Homo sapiens OX=9606 GN=H2BC4 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 47.0 null 109-UNIMOD:1031,47-UNIMOD:1031,117-UNIMOD:1031,6-UNIMOD:1031,35-UNIMOD:1031,86-UNIMOD:1031 0.53 47.0 9 6 3 PRT sp|P16591-3|FER_HUMAN Isoform 3 of Tyrosine-protein kinase Fer OS=Homo sapiens OX=9606 GN=FER null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 47.0 null 351-UNIMOD:1031,356-UNIMOD:1031,222-UNIMOD:1031,224-UNIMOD:4 0.06 47.0 6 2 0 PRT sp|Q92900-2|RENT1_HUMAN Isoform 2 of Regulator of nonsense transcripts 1 OS=Homo sapiens OX=9606 GN=UPF1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 47.0 null 520-UNIMOD:4,533-UNIMOD:1031,540-UNIMOD:1031,918-UNIMOD:1031,779-UNIMOD:1031 0.04 47.0 4 3 1 PRT sp|P10599|THIO_HUMAN Thioredoxin OS=Homo sapiens OX=9606 GN=TXN PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 47.0 null 8-UNIMOD:1031,21-UNIMOD:259,4-UNIMOD:28,37-UNIMOD:35,39-UNIMOD:1031,94-UNIMOD:1031,85-UNIMOD:1031,96-UNIMOD:1031,3-UNIMOD:1031,94-UNIMOD:259 0.55 47.0 17 8 4 PRT sp|Q06210-2|GFPT1_HUMAN Isoform 2 of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Homo sapiens OX=9606 GN=GFPT1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 47.0 null 114-UNIMOD:1031,233-UNIMOD:1031,236-UNIMOD:4 0.04 47.0 2 2 2 PRT sp|P61604|CH10_HUMAN 10 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPE1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 47.0 null 40-UNIMOD:1031,28-UNIMOD:1031,32-UNIMOD:35,54-UNIMOD:1031,56-UNIMOD:1031,70-UNIMOD:1031,66-UNIMOD:1031,54-UNIMOD:259,86-UNIMOD:1031,36-UNIMOD:1031,8-UNIMOD:1031,66-UNIMOD:259,28-UNIMOD:259 0.87 47.0 23 13 5 PRT sp|Q9BUJ2-3|HNRL1_HUMAN Isoform 3 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 OS=Homo sapiens OX=9606 GN=HNRNPUL1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 47.0 null 437-UNIMOD:1031,447-UNIMOD:35,413-UNIMOD:1031,418-UNIMOD:4 0.04 47.0 6 2 1 PRT sp|P29317|EPHA2_HUMAN Ephrin type-A receptor 2 OS=Homo sapiens OX=9606 GN=EPHA2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 47.0 null 778-UNIMOD:1031,646-UNIMOD:1031 0.03 47.0 3 2 1 PRT sp|P14625|ENPL_HUMAN Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ] 47.0 null 364-UNIMOD:1031,370-UNIMOD:35,671-UNIMOD:1031,168-UNIMOD:1031,142-UNIMOD:1031,114-UNIMOD:1031,168-UNIMOD:259,177-UNIMOD:259,293-UNIMOD:35,348-UNIMOD:1031,662-UNIMOD:35,663-UNIMOD:1031,547-UNIMOD:1031,356-UNIMOD:1031,593-UNIMOD:1031,161-UNIMOD:1031,154-UNIMOD:35,455-UNIMOD:1031,404-UNIMOD:1031,597-UNIMOD:1031,300-UNIMOD:259,682-UNIMOD:1031,633-UNIMOD:1031,95-UNIMOD:1031,733-UNIMOD:1031,405-UNIMOD:1031,114-UNIMOD:259,467-UNIMOD:1031,471-UNIMOD:35,97-UNIMOD:1031,682-UNIMOD:259,603-UNIMOD:1031,754-UNIMOD:259,473-UNIMOD:1031 0.35 47.0 218 31 18 PRT sp|P68104|EF1A1_HUMAN Elongation factor 1-alpha 1 OS=Homo sapiens OX=9606 GN=EEF1A1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 47.0 null 255-UNIMOD:1031,404-UNIMOD:35,408-UNIMOD:1031,410-UNIMOD:35,411-UNIMOD:4,146-UNIMOD:259,431-UNIMOD:28,439-UNIMOD:1031,450-UNIMOD:1031,273-UNIMOD:1031,276-UNIMOD:35,20-UNIMOD:259,408-UNIMOD:259,423-UNIMOD:267,30-UNIMOD:1031,31-UNIMOD:4,36-UNIMOD:1031,273-UNIMOD:259,290-UNIMOD:259,444-UNIMOD:1031,439-UNIMOD:259,443-UNIMOD:259,41-UNIMOD:1031,44-UNIMOD:1031,49-UNIMOD:35,444-UNIMOD:259,450-UNIMOD:259,392-UNIMOD:1031 0.36 47.0 24 13 0 PRT sp|Q9Y2Z0|SGT1_HUMAN Protein SGT1 homolog OS=Homo sapiens OX=9606 GN=SUGT1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 47.0 null 236-UNIMOD:1031,2-UNIMOD:1 0.09 47.0 2 2 2 PRT sp|P60842|IF4A1_HUMAN Eukaryotic initiation factor 4A-I OS=Homo sapiens OX=9606 GN=EIF4A1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 46.0 null 146-UNIMOD:1031,149-UNIMOD:35,54-UNIMOD:1031,193-UNIMOD:1031,309-UNIMOD:1031,82-UNIMOD:259,381-UNIMOD:1031,82-UNIMOD:1031,284-UNIMOD:1031,174-UNIMOD:1031,118-UNIMOD:259 0.31 46.0 15 9 5 PRT sp|P24534|EF1B_HUMAN Elongation factor 1-beta OS=Homo sapiens OX=9606 GN=EEF1B2 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 46.0 null 78-UNIMOD:1031,22-UNIMOD:259,129-UNIMOD:1031,66-UNIMOD:1031,133-UNIMOD:1031,186-UNIMOD:1031,185-UNIMOD:1031,130-UNIMOD:1031,133-UNIMOD:259,139-UNIMOD:259,73-UNIMOD:1031 0.34 46.0 12 7 3 PRT sp|Q02809|PLOD1_HUMAN Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 OS=Homo sapiens OX=9606 GN=PLOD1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 46.0 null 348-UNIMOD:1031,77-UNIMOD:1031 0.05 46.0 2 2 2 PRT sp|P49411|EFTU_HUMAN Elongation factor Tu, mitochondrial OS=Homo sapiens OX=9606 GN=TUFM PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 46.0 null 55-UNIMOD:1031,447-UNIMOD:1031,127-UNIMOD:4,442-UNIMOD:35,447-UNIMOD:259,286-UNIMOD:1031,290-UNIMOD:4,256-UNIMOD:1031,308-UNIMOD:35,311-UNIMOD:1031,361-UNIMOD:1031,88-UNIMOD:1031,418-UNIMOD:1031,311-UNIMOD:259,120-UNIMOD:267 0.38 46.0 24 13 6 PRT sp|P62258|1433E_HUMAN 14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 46.0 null 153-UNIMOD:1031,142-UNIMOD:1031,50-UNIMOD:1031,118-UNIMOD:259,141-UNIMOD:267,33-UNIMOD:35,215-UNIMOD:259,78-UNIMOD:1031,73-UNIMOD:1031 0.45 46.0 16 10 5 PRT sp|P23528|COF1_HUMAN Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 46.0 null 73-UNIMOD:259,132-UNIMOD:1031,139-UNIMOD:4,2-UNIMOD:1,13-UNIMOD:1031,144-UNIMOD:1031,18-UNIMOD:35,144-UNIMOD:259,92-UNIMOD:1031,121-UNIMOD:1031,115-UNIMOD:35,39-UNIMOD:4,44-UNIMOD:1031,45-UNIMOD:1031,114-UNIMOD:1031,92-UNIMOD:259,146-UNIMOD:267,22-UNIMOD:1031,19-UNIMOD:1031,30-UNIMOD:259,31-UNIMOD:259,30-UNIMOD:1031,127-UNIMOD:1031 0.82 46.0 37 17 5 PRT sp|P35579|MYH9_HUMAN Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 46.0 null 82-UNIMOD:1031,91-UNIMOD:4,1249-UNIMOD:1031,1555-UNIMOD:259,1806-UNIMOD:1031,910-UNIMOD:1031,917-UNIMOD:4,1802-UNIMOD:1031,1024-UNIMOD:1031,1028-UNIMOD:35,1775-UNIMOD:1031,137-UNIMOD:35,139-UNIMOD:1031,651-UNIMOD:1031,613-UNIMOD:1031,1190-UNIMOD:35,1191-UNIMOD:267,63-UNIMOD:1031,1219-UNIMOD:1031,656-UNIMOD:1031,30-UNIMOD:1031,1669-UNIMOD:1031,1174-UNIMOD:1031,69-UNIMOD:1031,931-UNIMOD:385,931-UNIMOD:4,938-UNIMOD:1031,1437-UNIMOD:4,1441-UNIMOD:1031,1724-UNIMOD:1031,435-UNIMOD:1031,1330-UNIMOD:1031,1525-UNIMOD:1031,1212-UNIMOD:1031,1246-UNIMOD:1031,1525-UNIMOD:259,1918-UNIMOD:1031,1332-UNIMOD:1031 0.17 46.0 36 30 24 PRT sp|O75832-2|PSD10_HUMAN Isoform 2 of 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens OX=9606 GN=PSMD10 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 46.0 null 107-UNIMOD:4,116-UNIMOD:1031 0.16 46.0 1 1 1 PRT sp|P19338|NUCL_HUMAN Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 46.0 null 589-UNIMOD:1031,610-UNIMOD:1031,577-UNIMOD:1031,627-UNIMOD:1031,624-UNIMOD:1031,333-UNIMOD:1031,324-UNIMOD:1031,116-UNIMOD:1031,444-UNIMOD:1031,624-UNIMOD:259,477-UNIMOD:1031,102-UNIMOD:1031,513-UNIMOD:1031,429-UNIMOD:1031,521-UNIMOD:1031,398-UNIMOD:1031,71-UNIMOD:1031,55-UNIMOD:1031,646-UNIMOD:1031,80-UNIMOD:1031,125-UNIMOD:1031,377-UNIMOD:1031,9-UNIMOD:1031,543-UNIMOD:4,545-UNIMOD:1031,88-UNIMOD:1031,288-UNIMOD:1031,333-UNIMOD:259,63-UNIMOD:1031,342-UNIMOD:267,95-UNIMOD:1031,223-UNIMOD:259,228-UNIMOD:259,96-UNIMOD:1031,79-UNIMOD:1031,429-UNIMOD:259,437-UNIMOD:259,110-UNIMOD:1031,16-UNIMOD:1031,17-UNIMOD:35,572-UNIMOD:1031,15-UNIMOD:1031,597-UNIMOD:267,424-UNIMOD:1031 0.43 46.0 57 38 20 PRT sp|Q9NWW6-2|NRK1_HUMAN Isoform 2 of Nicotinamide riboside kinase 1 OS=Homo sapiens OX=9606 GN=NMRK1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 46.0 null 30-UNIMOD:4,40-UNIMOD:1031,16-UNIMOD:1031,21-UNIMOD:1031 0.26 46.0 5 2 1 PRT sp|P12956|XRCC6_HUMAN X-ray repair cross-complementing protein 6 OS=Homo sapiens OX=9606 GN=XRCC6 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 46.0 null 443-UNIMOD:1031,317-UNIMOD:1031,317-UNIMOD:259,544-UNIMOD:1031,570-UNIMOD:1031,539-UNIMOD:1031,596-UNIMOD:1031,297-UNIMOD:1031,591-UNIMOD:1031,565-UNIMOD:1031,94-UNIMOD:1031,357-UNIMOD:1031,100-UNIMOD:1031,282-UNIMOD:1031,338-UNIMOD:1031 0.27 46.0 18 15 12 PRT sp|P49321-2|NASP_HUMAN Isoform 2 of Nuclear autoantigenic sperm protein OS=Homo sapiens OX=9606 GN=NASP null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 46.0 null 359-UNIMOD:1031,369-UNIMOD:4,318-UNIMOD:1031 0.07 46.0 3 2 1 PRT sp|O14737|PDCD5_HUMAN Programmed cell death protein 5 OS=Homo sapiens OX=9606 GN=PDCD5 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 46.0 null 20-UNIMOD:1031,33-UNIMOD:1031,68-UNIMOD:1031,63-UNIMOD:1031,97-UNIMOD:1031,98-UNIMOD:1031 0.54 46.0 9 7 5 PRT sp|P45985|MP2K4_HUMAN Dual specificity mitogen-activated protein kinase kinase 4 OS=Homo sapiens OX=9606 GN=MAP2K4 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 46.0 null 246-UNIMOD:4,260-UNIMOD:1031,231-UNIMOD:1031,131-UNIMOD:1031,128-UNIMOD:35 0.11 46.0 5 3 1 PRT sp|P32322|P5CR1_HUMAN Pyrroline-5-carboxylate reductase 1, mitochondrial OS=Homo sapiens OX=9606 GN=PYCR1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 46.0 null 307-UNIMOD:1031 0.07 46.0 2 2 2 PRT sp|P15559-3|NQO1_HUMAN Isoform 3 of NAD(P)H dehydrogenase [quinone] 1 OS=Homo sapiens OX=9606 GN=NQO1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 46.0 null 61-UNIMOD:1031,224-UNIMOD:1031,233-UNIMOD:1031,31-UNIMOD:1031,203-UNIMOD:1031 0.26 46.0 6 5 4 PRT sp|P28288-2|ABCD3_HUMAN Isoform 2 of ATP-binding cassette sub-family D member 3 OS=Homo sapiens OX=9606 GN=ABCD3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 46.0 null 362-UNIMOD:4,367-UNIMOD:4,369-UNIMOD:1031 0.04 46.0 2 1 0 PRT sp|O95819-4|M4K4_HUMAN Isoform 4 of Mitogen-activated protein kinase kinase kinase kinase 4 OS=Homo sapiens OX=9606 GN=MAP4K4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 46.0 null 54-UNIMOD:1031,155-UNIMOD:1031 0.03 46.0 3 2 0 PRT sp|P55072|TERA_HUMAN Transitional endoplasmic reticulum ATPase OS=Homo sapiens OX=9606 GN=VCP PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 46.0 null 529-UNIMOD:1031,535-UNIMOD:4,251-UNIMOD:1031,522-UNIMOD:4,524-UNIMOD:1031,332-UNIMOD:35,336-UNIMOD:1031,668-UNIMOD:1031,105-UNIMOD:4,109-UNIMOD:1031,18-UNIMOD:1031,148-UNIMOD:1031,288-UNIMOD:1031,60-UNIMOD:1031,658-UNIMOD:1031,695-UNIMOD:4,696-UNIMOD:1031,502-UNIMOD:1031,236-UNIMOD:1031,524-UNIMOD:259,529-UNIMOD:259,231-UNIMOD:259 0.25 46.0 131 16 12 PRT sp|P07900|HS90A_HUMAN Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 46.0 null 546-UNIMOD:1031,191-UNIMOD:1031,499-UNIMOD:1031,513-UNIMOD:1031,529-UNIMOD:4,112-UNIMOD:1031,74-UNIMOD:1031,489-UNIMOD:1031,521-UNIMOD:35,534-UNIMOD:259,224-UNIMOD:259,314-UNIMOD:259,209-UNIMOD:1031,69-UNIMOD:1031,647-UNIMOD:267,632-UNIMOD:1031,446-UNIMOD:1031,224-UNIMOD:1031,116-UNIMOD:1031,58-UNIMOD:1031,283-UNIMOD:1031,292-UNIMOD:1031,499-UNIMOD:259,539-UNIMOD:1031,558-UNIMOD:259,558-UNIMOD:1031,628-UNIMOD:35,631-UNIMOD:1031,407-UNIMOD:1031,443-UNIMOD:1031,338-UNIMOD:267,402-UNIMOD:35,185-UNIMOD:1031,327-UNIMOD:259,201-UNIMOD:267,585-UNIMOD:1031,654-UNIMOD:1031,355-UNIMOD:267,510-UNIMOD:267,614-UNIMOD:35,615-UNIMOD:1031,436-UNIMOD:1031,567-UNIMOD:1031,572-UNIMOD:4,292-UNIMOD:259,362-UNIMOD:1031,567-UNIMOD:259,573-UNIMOD:259,657-UNIMOD:1031,58-UNIMOD:259,69-UNIMOD:259,356-UNIMOD:1031,575-UNIMOD:35,576-UNIMOD:1031,456-UNIMOD:267,458-UNIMOD:1031,84-UNIMOD:1031,625-UNIMOD:35,180-UNIMOD:35,182-UNIMOD:267,294-UNIMOD:1031 0.53 46.0 158 51 15 PRT sp|Q14643-4|ITPR1_HUMAN Isoform 4 of Inositol 1,4,5-trisphosphate receptor type 1 OS=Homo sapiens OX=9606 GN=ITPR1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 46.0 null 2150-UNIMOD:35,2161-UNIMOD:4,2166-UNIMOD:1031 0.01 46.0 1 1 1 PRT sp|Q99714-2|HCD2_HUMAN Isoform 2 of 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Homo sapiens OX=9606 GN=HSD17B10 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 46.0 null 91-UNIMOD:4,99-UNIMOD:1031,105-UNIMOD:1031 0.13 46.0 4 2 0 PRT sp|Q8N163-2|CCAR2_HUMAN Isoform 2 of Cell cycle and apoptosis regulator protein 2 OS=Homo sapiens OX=9606 GN=CCAR2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 46.0 null 97-UNIMOD:1031,344-UNIMOD:1031 0.03 46.0 3 2 1 PRT sp|Q9BSD7|NTPCR_HUMAN Cancer-related nucleoside-triphosphatase OS=Homo sapiens OX=9606 GN=NTPCR PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 46.0 null 15-UNIMOD:1031 0.10 46.0 1 1 1 PRT sp|P17987|TCPA_HUMAN T-complex protein 1 subunit alpha OS=Homo sapiens OX=9606 GN=TCP1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 45.0 null 541-UNIMOD:1031,199-UNIMOD:1031,499-UNIMOD:1031,357-UNIMOD:4,365-UNIMOD:1031,147-UNIMOD:4,153-UNIMOD:1031,397-UNIMOD:4,400-UNIMOD:1031,109-UNIMOD:1031,538-UNIMOD:1031,125-UNIMOD:4,126-UNIMOD:1031,532-UNIMOD:1031,510-UNIMOD:1031,111-UNIMOD:1031,400-UNIMOD:259 0.31 45.0 23 16 9 PRT sp|Q16584|M3K11_HUMAN Mitogen-activated protein kinase kinase kinase 11 OS=Homo sapiens OX=9606 GN=MAP3K11 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45.0 null 243-UNIMOD:1031,258-UNIMOD:35,144-UNIMOD:1031 0.04 45.0 3 2 1 PRT sp|P18858-3|DNLI1_HUMAN Isoform 3 of DNA ligase 1 OS=Homo sapiens OX=9606 GN=LIG1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45.0 null 851-UNIMOD:1031,864-UNIMOD:4,713-UNIMOD:1031 0.03 45.0 4 2 0 PRT sp|O00299|CLIC1_HUMAN Chloride intracellular channel protein 1 OS=Homo sapiens OX=9606 GN=CLIC1 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 45.0 null 119-UNIMOD:1031,138-UNIMOD:1031,131-UNIMOD:1031,57-UNIMOD:1031,59-UNIMOD:4,178-UNIMOD:4,191-UNIMOD:4,193-UNIMOD:1031,192-UNIMOD:1031,49-UNIMOD:1031,135-UNIMOD:1031,204-UNIMOD:267 0.56 45.0 11 9 7 PRT sp|O43390-4|HNRPR_HUMAN Isoform 4 of Heterogeneous nuclear ribonucleoprotein R OS=Homo sapiens OX=9606 GN=HNRNPR null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45.0 null 194-UNIMOD:4,202-UNIMOD:1031,476-UNIMOD:1031,486-UNIMOD:1031,13-UNIMOD:1031,343-UNIMOD:267 0.13 45.0 7 6 5 PRT sp|Q07065|CKAP4_HUMAN Cytoskeleton-associated protein 4 OS=Homo sapiens OX=9606 GN=CKAP4 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 45.0 null 21-UNIMOD:1031,223-UNIMOD:1031,10-UNIMOD:1031,388-UNIMOD:1031,381-UNIMOD:1031,594-UNIMOD:1031,597-UNIMOD:1031 0.12 45.0 10 7 4 PRT sp|P11498-2|PYC_HUMAN Isoform 2 of Pyruvate carboxylase, mitochondrial OS=Homo sapiens OX=9606 GN=PC null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45.0 null 273-UNIMOD:1031,149-UNIMOD:35,152-UNIMOD:1031 0.05 45.0 3 2 1 PRT sp|O43707-2|ACTN4_HUMAN Isoform ACTN4ISO of Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45.0 null 385-UNIMOD:1031,560-UNIMOD:1031,198-UNIMOD:1031,413-UNIMOD:1031 0.12 45.0 6 5 3 PRT sp|P27816-6|MAP4_HUMAN Isoform 6 of Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45.0 null 871-UNIMOD:1031,1015-UNIMOD:1031,802-UNIMOD:1031,824-UNIMOD:267,991-UNIMOD:1031,702-UNIMOD:1031,888-UNIMOD:267,1060-UNIMOD:1031,464-UNIMOD:1031,959-UNIMOD:1031,938-UNIMOD:1031,998-UNIMOD:1031,718-UNIMOD:1031,986-UNIMOD:259,968-UNIMOD:1031,1038-UNIMOD:1031,1039-UNIMOD:4 0.17 45.0 18 17 12 PRT sp|P05141|ADT2_HUMAN ADP/ATP translocase 2 OS=Homo sapiens OX=9606 GN=SLC25A5 PE=1 SV=7 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 45.0 null 43-UNIMOD:1031,2-UNIMOD:1,10-UNIMOD:1031,245-UNIMOD:1031,257-UNIMOD:4,63-UNIMOD:1031,147-UNIMOD:1031,92-UNIMOD:1031,160-UNIMOD:4,163-UNIMOD:1031,96-UNIMOD:1031,272-UNIMOD:1031,33-UNIMOD:1031,23-UNIMOD:259,268-UNIMOD:1031,92-UNIMOD:259,105-UNIMOD:1031,31-UNIMOD:267,94-UNIMOD:1031,163-UNIMOD:259 0.50 45.0 22 16 10 PRT sp|P50991|TCPD_HUMAN T-complex protein 1 subunit delta OS=Homo sapiens OX=9606 GN=CCT4 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 45.0 null 126-UNIMOD:1031,79-UNIMOD:1031,213-UNIMOD:1031,221-UNIMOD:4,42-UNIMOD:1031,489-UNIMOD:1031,375-UNIMOD:1031,379-UNIMOD:4,292-UNIMOD:1031,295-UNIMOD:4,288-UNIMOD:1031,531-UNIMOD:1031,55-UNIMOD:1031,57-UNIMOD:35,21-UNIMOD:1031,49-UNIMOD:267,450-UNIMOD:4,292-UNIMOD:259,302-UNIMOD:259,174-UNIMOD:1031,186-UNIMOD:35,192-UNIMOD:35 0.41 45.0 25 17 12 PRT sp|Q15366-7|PCBP2_HUMAN Isoform 7 of Poly(rC)-binding protein 2 OS=Homo sapiens OX=9606 GN=PCBP2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45.0 null 109-UNIMOD:4,115-UNIMOD:1031,118-UNIMOD:4,262-UNIMOD:1031 0.09 45.0 3 2 1 PRT sp|Q15020-4|SART3_HUMAN Isoform 4 of Squamous cell carcinoma antigen recognized by T-cells 3 OS=Homo sapiens OX=9606 GN=SART3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45.0 null 805-UNIMOD:1031 0.02 45.0 1 1 0 PRT sp|Q15459|SF3A1_HUMAN Splicing factor 3A subunit 1 OS=Homo sapiens OX=9606 GN=SF3A1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45.0 null 80-UNIMOD:1031,55-UNIMOD:1031,756-UNIMOD:1031,105-UNIMOD:1031 0.08 45.0 4 4 4 PRT sp|P22314-2|UBA1_HUMAN Isoform 2 of Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45.0 null 766-UNIMOD:1031,811-UNIMOD:1031,819-UNIMOD:35,804-UNIMOD:35,617-UNIMOD:1031,282-UNIMOD:259,553-UNIMOD:1031,631-UNIMOD:1031,798-UNIMOD:1031,488-UNIMOD:1031,28-UNIMOD:1031,194-UNIMOD:4,199-UNIMOD:267,917-UNIMOD:267,256-UNIMOD:1031,403-UNIMOD:1031,404-UNIMOD:4,27-UNIMOD:35,844-UNIMOD:1031,849-UNIMOD:1031,497-UNIMOD:267 0.25 45.0 26 19 13 PRT sp|P48637-2|GSHB_HUMAN Isoform 2 of Glutathione synthetase OS=Homo sapiens OX=9606 GN=GSS null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45.0 null 341-UNIMOD:1031,183-UNIMOD:4,194-UNIMOD:1031,195-UNIMOD:1031,253-UNIMOD:1031 0.15 45.0 8 4 1 PRT sp|O00410-2|IPO5_HUMAN Isoform 2 of Importin-5 OS=Homo sapiens OX=9606 GN=IPO5 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45.0 null 903-UNIMOD:1031,912-UNIMOD:4,48-UNIMOD:1031,50-UNIMOD:4 0.04 45.0 3 3 3 PRT sp|Q14683|SMC1A_HUMAN Structural maintenance of chromosomes protein 1A OS=Homo sapiens OX=9606 GN=SMC1A PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 45.0 null 648-UNIMOD:1031,373-UNIMOD:1031,1037-UNIMOD:1031,317-UNIMOD:1031,190-UNIMOD:1031 0.06 45.0 6 5 4 PRT sp|P33897|ABCD1_HUMAN ATP-binding cassette sub-family D member 1 OS=Homo sapiens OX=9606 GN=ABCD1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45.0 null 511-UNIMOD:4,513-UNIMOD:1031,501-UNIMOD:35,462-UNIMOD:1031 0.04 45.0 3 2 1 PRT sp|P46777|RL5_HUMAN 60S ribosomal protein L5 OS=Homo sapiens OX=9606 GN=RPL5 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 45.0 null 164-UNIMOD:1031,178-UNIMOD:1031,188-UNIMOD:1031,158-UNIMOD:1031,221-UNIMOD:1031,27-UNIMOD:1031,242-UNIMOD:1031,220-UNIMOD:1031,5-UNIMOD:1031,8-UNIMOD:1031,43-UNIMOD:1031,271-UNIMOD:35,276-UNIMOD:1031,284-UNIMOD:1031 0.38 45.0 18 14 10 PRT sp|P30837|AL1B1_HUMAN Aldehyde dehydrogenase X, mitochondrial OS=Homo sapiens OX=9606 GN=ALDH1B1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 45.0 null 364-UNIMOD:1031,414-UNIMOD:1031,399-UNIMOD:1031,410-UNIMOD:35,379-UNIMOD:1031,383-UNIMOD:1031,386-UNIMOD:4 0.15 45.0 9 5 2 PRT sp|P22392|NDKB_HUMAN Nucleoside diphosphate kinase B OS=Homo sapiens OX=9606 GN=NME2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45.0 null 90-UNIMOD:35,100-UNIMOD:1031,124-UNIMOD:1031,49-UNIMOD:1031,12-UNIMOD:1031,26-UNIMOD:1031,12-UNIMOD:259,109-UNIMOD:4,114-UNIMOD:267,31-UNIMOD:1031 0.56 45.0 20 8 3 PRT sp|P35268|RL22_HUMAN 60S ribosomal protein L22 OS=Homo sapiens OX=9606 GN=RPL22 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 45.0 null 52-UNIMOD:1031,69-UNIMOD:1031,80-UNIMOD:1031,107-UNIMOD:1031,65-UNIMOD:267,84-UNIMOD:1031 0.41 45.0 9 6 3 PRT sp|Q14166|TTL12_HUMAN Tubulin--tyrosine ligase-like protein 12 OS=Homo sapiens OX=9606 GN=TTLL12 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 45.0 null 418-UNIMOD:4,419-UNIMOD:1031 0.03 45.0 5 1 0 PRT sp|Q13838|DX39B_HUMAN Spliceosome RNA helicase DDX39B OS=Homo sapiens OX=9606 GN=DDX39B PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ] 45.0 null 2-UNIMOD:1,32-UNIMOD:1031,36-UNIMOD:1031,198-UNIMOD:4 0.14 45.0 4 3 2 PRT sp|P13797|PLST_HUMAN Plastin-3 OS=Homo sapiens OX=9606 GN=PLS3 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 45.0 null 100-UNIMOD:259,104-UNIMOD:4,126-UNIMOD:259,537-UNIMOD:1031,340-UNIMOD:35,346-UNIMOD:259 0.09 45.0 4 3 2 PRT sp|Q07020|RL18_HUMAN 60S ribosomal protein L18 OS=Homo sapiens OX=9606 GN=RPL18 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 44.0 null 119-UNIMOD:1031,78-UNIMOD:1031,164-UNIMOD:1031,49-UNIMOD:1031,91-UNIMOD:267,49-UNIMOD:259,30-UNIMOD:1031,99-UNIMOD:1031,101-UNIMOD:4 0.48 44.0 18 10 5 PRT sp|Q14691|PSF1_HUMAN DNA replication complex GINS protein PSF1 OS=Homo sapiens OX=9606 GN=GINS1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44.0 null 51-UNIMOD:1031 0.10 44.0 1 1 1 PRT sp|P02545-6|LMNA_HUMAN Isoform 6 of Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44.0 null 417-UNIMOD:1031,78-UNIMOD:1031,32-UNIMOD:1031,457-UNIMOD:1031,260-UNIMOD:1031,450-UNIMOD:1031,135-UNIMOD:1031,200-UNIMOD:35,201-UNIMOD:1031,311-UNIMOD:1031,123-UNIMOD:1031,155-UNIMOD:1031,180-UNIMOD:1031,450-UNIMOD:259,378-UNIMOD:1031,181-UNIMOD:1031,270-UNIMOD:1031,540-UNIMOD:35,166-UNIMOD:267,588-UNIMOD:4,591-UNIMOD:4,90-UNIMOD:1031,97-UNIMOD:1031,486-UNIMOD:1031,316-UNIMOD:1031,435-UNIMOD:267,60-UNIMOD:267 0.50 44.0 41 29 18 PRT sp|Q96C23|GALM_HUMAN Aldose 1-epimerase OS=Homo sapiens OX=9606 GN=GALM PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44.0 null 101-UNIMOD:1031,111-UNIMOD:267 0.06 44.0 3 1 0 PRT sp|P52907|CAZA1_HUMAN F-actin-capping protein subunit alpha-1 OS=Homo sapiens OX=9606 GN=CAPZA1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44.0 null 19-UNIMOD:1031,103-UNIMOD:1031,97-UNIMOD:1031,278-UNIMOD:1031 0.20 44.0 4 4 4 PRT sp|P63220|RS21_HUMAN 40S ribosomal protein S21 OS=Homo sapiens OX=9606 GN=RPS21 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 44.0 null 27-UNIMOD:1031,51-UNIMOD:1031,56-UNIMOD:4,74-UNIMOD:1031,74-UNIMOD:259,81-UNIMOD:259,60-UNIMOD:267,16-UNIMOD:1031,17-UNIMOD:4 0.65 44.0 9 5 2 PRT sp|P00367-2|DHE3_HUMAN Isoform 2 of Glutamate dehydrogenase 1, mitochondrial OS=Homo sapiens OX=9606 GN=GLUD1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44.0 null 336-UNIMOD:1031,347-UNIMOD:35,313-UNIMOD:1031,24-UNIMOD:1031,198-UNIMOD:1031,209-UNIMOD:4,20-UNIMOD:1031 0.21 44.0 6 5 4 PRT sp|Q9UH65|SWP70_HUMAN Switch-associated protein 70 OS=Homo sapiens OX=9606 GN=SWAP70 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44.0 null 251-UNIMOD:1031,260-UNIMOD:4,261-UNIMOD:4,537-UNIMOD:1031,219-UNIMOD:1031 0.07 44.0 3 3 3 PRT sp|Q86XP3-2|DDX42_HUMAN Isoform 2 of ATP-dependent RNA helicase DDX42 OS=Homo sapiens OX=9606 GN=DDX42 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44.0 null 151-UNIMOD:1031,162-UNIMOD:4,589-UNIMOD:1031,476-UNIMOD:1031 0.07 44.0 3 3 3 PRT sp|Q9UKY7-2|CDV3_HUMAN Isoform 2 of Protein CDV3 homolog OS=Homo sapiens OX=9606 GN=CDV3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44.0 null 181-UNIMOD:1031,15-UNIMOD:1031 0.16 44.0 2 2 2 PRT sp|P78527-2|PRKDC_HUMAN Isoform 2 of DNA-dependent protein kinase catalytic subunit OS=Homo sapiens OX=9606 GN=PRKDC null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44.0 null 4030-UNIMOD:4,4039-UNIMOD:1031,4019-UNIMOD:1031,3992-UNIMOD:1031,4005-UNIMOD:1031,1292-UNIMOD:259,3753-UNIMOD:1031,525-UNIMOD:1031,2694-UNIMOD:1031,1857-UNIMOD:1031,2715-UNIMOD:1031,1869-UNIMOD:1031,99-UNIMOD:1031,1057-UNIMOD:1031,681-UNIMOD:1031,689-UNIMOD:1031,2738-UNIMOD:1031,2363-UNIMOD:4,2366-UNIMOD:1031,2908-UNIMOD:1031,111-UNIMOD:4,117-UNIMOD:1031,3846-UNIMOD:1031,3638-UNIMOD:1031,828-UNIMOD:1031,574-UNIMOD:1031,2829-UNIMOD:1031,1612-UNIMOD:1031,4054-UNIMOD:1031,3642-UNIMOD:1031,3988-UNIMOD:1031,3989-UNIMOD:35,3991-UNIMOD:1031,2628-UNIMOD:267,810-UNIMOD:259,3550-UNIMOD:1031,2746-UNIMOD:1031,3853-UNIMOD:1031,3552-UNIMOD:1031,3260-UNIMOD:1031,2702-UNIMOD:1031 0.09 44.0 53 35 26 PRT sp|P46060|RAGP1_HUMAN Ran GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RANGAP1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 44.0 null 452-UNIMOD:1031,481-UNIMOD:1031,406-UNIMOD:1031,31-UNIMOD:1031 0.10 44.0 4 4 4 PRT sp|Q15126|PMVK_HUMAN Phosphomevalonate kinase OS=Homo sapiens OX=9606 GN=PMVK PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 44.0 null 48-UNIMOD:1031,22-UNIMOD:1031,69-UNIMOD:1031 0.24 44.0 11 3 1 PRT sp|P07237|PDIA1_HUMAN Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 44.0 null 425-UNIMOD:35,436-UNIMOD:1031,375-UNIMOD:1031,415-UNIMOD:1031,114-UNIMOD:1031,276-UNIMOD:1031,247-UNIMOD:259,436-UNIMOD:259,444-UNIMOD:1031,65-UNIMOD:1031,71-UNIMOD:1031,271-UNIMOD:1031,328-UNIMOD:1031,385-UNIMOD:1031,130-UNIMOD:1031,42-UNIMOD:259,263-UNIMOD:259,230-UNIMOD:259,222-UNIMOD:259,461-UNIMOD:267,103-UNIMOD:1031,308-UNIMOD:1031 0.45 44.0 35 22 12 PRT sp|P62241|RS8_HUMAN 40S ribosomal protein S8 OS=Homo sapiens OX=9606 GN=RPS8 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 44.0 null 157-UNIMOD:1031,128-UNIMOD:1031,37-UNIMOD:1031,139-UNIMOD:259,98-UNIMOD:1031,100-UNIMOD:4,139-UNIMOD:1031,193-UNIMOD:259 0.34 44.0 11 7 3 PRT sp|Q08211|DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 44.0 null 1024-UNIMOD:1031,1029-UNIMOD:4,1036-UNIMOD:35,236-UNIMOD:1031,242-UNIMOD:4,55-UNIMOD:1031,434-UNIMOD:267 0.05 44.0 5 4 3 PRT sp|Q9P258|RCC2_HUMAN Protein RCC2 OS=Homo sapiens OX=9606 GN=RCC2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 44.0 null 77-UNIMOD:1031,320-UNIMOD:1031,337-UNIMOD:4,349-UNIMOD:1031,377-UNIMOD:1031,124-UNIMOD:1031 0.15 44.0 6 5 4 PRT sp|P23526-2|SAHH_HUMAN Isoform 2 of Adenosylhomocysteinase OS=Homo sapiens OX=9606 GN=AHCY null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44.0 null 393-UNIMOD:4,398-UNIMOD:1031,138-UNIMOD:1031,391-UNIMOD:35,198-UNIMOD:1031,200-UNIMOD:4,158-UNIMOD:1031,361-UNIMOD:1031,377-UNIMOD:1031,294-UNIMOD:1031,380-UNIMOD:1031,167-UNIMOD:4 0.32 44.0 14 11 7 PRT sp|P39748-2|FEN1_HUMAN Isoform FENMIT of Flap endonuclease 1 OS=Homo sapiens OX=9606 GN=FEN1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44.0 null 61-UNIMOD:1031,71-UNIMOD:1031,77-UNIMOD:4,136-UNIMOD:259 0.13 44.0 3 3 3 PRT sp|Q12931-2|TRAP1_HUMAN Isoform 2 of Heat shock protein 75 kDa, mitochondrial OS=Homo sapiens OX=9606 GN=TRAP1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44.0 null 128-UNIMOD:1031,143-UNIMOD:1031,143-UNIMOD:259,322-UNIMOD:1031,329-UNIMOD:1031,279-UNIMOD:1031,73-UNIMOD:1031,646-UNIMOD:1031,571-UNIMOD:35,576-UNIMOD:1031,208-UNIMOD:4,209-UNIMOD:1031,42-UNIMOD:1031,520-UNIMOD:4,271-UNIMOD:1031,43-UNIMOD:1031,271-UNIMOD:259,273-UNIMOD:267,378-UNIMOD:1031,524-UNIMOD:1031,545-UNIMOD:1031,316-UNIMOD:1031,524-UNIMOD:259 0.25 44.0 38 16 5 PRT sp|P23588-2|IF4B_HUMAN Isoform 2 of Eukaryotic translation initiation factor 4B OS=Homo sapiens OX=9606 GN=EIF4B null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44.0 null 304-UNIMOD:1031,326-UNIMOD:1031,396-UNIMOD:267,138-UNIMOD:1031,539-UNIMOD:1031,498-UNIMOD:1031,184-UNIMOD:1031,356-UNIMOD:1031,405-UNIMOD:1031,441-UNIMOD:1031,155-UNIMOD:1031 0.34 44.0 15 13 11 PRT sp|P61981|1433G_HUMAN 14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 44.0 null 217-UNIMOD:259,69-UNIMOD:1031,152-UNIMOD:1031,162-UNIMOD:259,152-UNIMOD:259,142-UNIMOD:1031,10-UNIMOD:1031 0.37 44.0 15 8 4 PRT sp|P07737|PROF1_HUMAN Profilin-1 OS=Homo sapiens OX=9606 GN=PFN1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 44.0 null 91-UNIMOD:1031,70-UNIMOD:1031,71-UNIMOD:4,105-UNIMOD:1031,54-UNIMOD:1031,116-UNIMOD:1031,54-UNIMOD:259,114-UNIMOD:35,126-UNIMOD:1031,108-UNIMOD:1031,105-UNIMOD:259,70-UNIMOD:259,127-UNIMOD:1031,128-UNIMOD:4,91-UNIMOD:259,108-UNIMOD:259,116-UNIMOD:259,131-UNIMOD:35 0.70 44.0 37 14 2 PRT sp|P50395-2|GDIB_HUMAN Isoform 2 of Rab GDP dissociation inhibitor beta OS=Homo sapiens OX=9606 GN=GDI2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44.0 null 369-UNIMOD:4,373-UNIMOD:259,54-UNIMOD:1031,157-UNIMOD:4,163-UNIMOD:267,390-UNIMOD:1031,224-UNIMOD:1031,165-UNIMOD:1031,389-UNIMOD:35,357-UNIMOD:267,345-UNIMOD:259 0.28 44.0 13 8 5 PRT sp|Q16630-3|CPSF6_HUMAN Isoform 3 of Cleavage and polyadenylation specificity factor subunit 6 OS=Homo sapiens OX=9606 GN=CPSF6 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44.0 null 403-UNIMOD:4,410-UNIMOD:1031 0.05 44.0 1 1 1 PRT sp|P40926|MDHM_HUMAN Malate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=MDH2 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 44.0 null 203-UNIMOD:1031,212-UNIMOD:4,78-UNIMOD:1031,89-UNIMOD:4,285-UNIMOD:4,296-UNIMOD:1031,165-UNIMOD:1031,241-UNIMOD:1031,239-UNIMOD:1031,297-UNIMOD:1031,307-UNIMOD:1031,314-UNIMOD:1031,185-UNIMOD:1031,91-UNIMOD:259,165-UNIMOD:259,239-UNIMOD:259,251-UNIMOD:35,301-UNIMOD:1031,157-UNIMOD:1031,215-UNIMOD:259,329-UNIMOD:1031,105-UNIMOD:1031 0.56 44.0 25 19 13 PRT sp|Q99714|HCD2_HUMAN 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Homo sapiens OX=9606 GN=HSD17B10 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 44.0 null 58-UNIMOD:4,69-UNIMOD:1031,91-UNIMOD:4,99-UNIMOD:1031,214-UNIMOD:4 0.24 44.0 3 3 2 PRT sp|P26641|EF1G_HUMAN Elongation factor 1-gamma OS=Homo sapiens OX=9606 GN=EEF1G PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 43.0 null 266-UNIMOD:4,277-UNIMOD:1031,285-UNIMOD:1031,253-UNIMOD:1031,263-UNIMOD:35,401-UNIMOD:1031,414-UNIMOD:267,210-UNIMOD:4,212-UNIMOD:1031,208-UNIMOD:1031,213-UNIMOD:35,132-UNIMOD:1031,434-UNIMOD:1031,147-UNIMOD:259,294-UNIMOD:1031,428-UNIMOD:1031,220-UNIMOD:1031,253-UNIMOD:259,275-UNIMOD:259,227-UNIMOD:1031,219-UNIMOD:1031,275-UNIMOD:1031 0.34 43.0 33 17 9 PRT sp|P15735|PHKG2_HUMAN Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Homo sapiens OX=9606 GN=PHKG2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 43.0 null 53-UNIMOD:1031,55-UNIMOD:35,155-UNIMOD:1031,364-UNIMOD:1031 0.11 43.0 7 3 0 PRT sp|Q9Y6E0-2|STK24_HUMAN Isoform A of Serine/threonine-protein kinase 24 OS=Homo sapiens OX=9606 GN=STK24 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43.0 null 146-UNIMOD:1031,159-UNIMOD:1031 0.04 43.0 7 1 0 PRT sp|Q9Y4K4|M4K5_HUMAN Mitogen-activated protein kinase kinase kinase kinase 5 OS=Homo sapiens OX=9606 GN=MAP4K5 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 43.0 null 142-UNIMOD:1031,49-UNIMOD:1031,155-UNIMOD:1031,609-UNIMOD:1031,142-UNIMOD:259,155-UNIMOD:259 0.05 43.0 8 3 1 PRT sp|P27695|APEX1_HUMAN DNA-(apurinic or apyrimidinic site) lyase OS=Homo sapiens OX=9606 GN=APEX1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 43.0 null 93-UNIMOD:4,98-UNIMOD:1031,99-UNIMOD:4,7-UNIMOD:1031,228-UNIMOD:1031,58-UNIMOD:259,63-UNIMOD:259,58-UNIMOD:1031 0.17 43.0 6 4 3 PRT sp|Q9Y2U5|M3K2_HUMAN Mitogen-activated protein kinase kinase kinase 2 OS=Homo sapiens OX=9606 GN=MAP3K2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 43.0 null 385-UNIMOD:1031,506-UNIMOD:1031,485-UNIMOD:1031 0.06 43.0 5 3 1 PRT sp|Q12965|MYO1E_HUMAN Unconventional myosin-Ie OS=Homo sapiens OX=9606 GN=MYO1E PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43.0 null 107-UNIMOD:4,118-UNIMOD:1031 0.02 43.0 2 1 0 PRT sp|Q13435|SF3B2_HUMAN Splicing factor 3B subunit 2 OS=Homo sapiens OX=9606 GN=SF3B2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 43.0 null 857-UNIMOD:1031,570-UNIMOD:1031,870-UNIMOD:1031,394-UNIMOD:1031,165-UNIMOD:1031,543-UNIMOD:1031,280-UNIMOD:1031,877-UNIMOD:1031,401-UNIMOD:1031 0.10 43.0 9 9 9 PRT sp|P00441|SODC_HUMAN Superoxide dismutase [Cu-Zn] OS=Homo sapiens OX=9606 GN=SOD1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 43.0 null 24-UNIMOD:1031,7-UNIMOD:4,10-UNIMOD:1031,137-UNIMOD:1031,123-UNIMOD:1031,129-UNIMOD:1031,2-UNIMOD:1,4-UNIMOD:1031,31-UNIMOD:1031,123-UNIMOD:259,129-UNIMOD:259 0.49 43.0 13 9 6 PRT sp|P46459-2|NSF_HUMAN Isoform 2 of Vesicle-fusing ATPase OS=Homo sapiens OX=9606 GN=NSF null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43.0 null 170-UNIMOD:4,172-UNIMOD:1031,614-UNIMOD:1031 0.04 43.0 4 2 1 PRT sp|Q9NP87|DPOLM_HUMAN DNA-directed DNA/RNA polymerase mu OS=Homo sapiens OX=9606 GN=POLM PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43.0 null 325-UNIMOD:1031 0.03 43.0 1 1 1 PRT sp|P17980|PRS6A_HUMAN 26S proteasome regulatory subunit 6A OS=Homo sapiens OX=9606 GN=PSMC3 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 43.0 null 225-UNIMOD:35,233-UNIMOD:1031,211-UNIMOD:1031,70-UNIMOD:1031,121-UNIMOD:4,125-UNIMOD:1031,74-UNIMOD:1031,120-UNIMOD:1031 0.14 43.0 38 6 4 PRT sp|O00233-2|PSMD9_HUMAN Isoform p27-S of 26S proteasome non-ATPase regulatory subunit 9 OS=Homo sapiens OX=9606 GN=PSMD9 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43.0 null 81-UNIMOD:4,87-UNIMOD:1031,90-UNIMOD:35 0.08 43.0 5 1 0 PRT sp|P11766|ADHX_HUMAN Alcohol dehydrogenase class-3 OS=Homo sapiens OX=9606 GN=ADH5 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 43.0 null 341-UNIMOD:1031,362-UNIMOD:35,366-UNIMOD:1031,2-UNIMOD:1,7-UNIMOD:1031,8-UNIMOD:4 0.11 43.0 6 3 2 PRT sp|P36776-3|LONM_HUMAN Isoform 3 of Lon protease homolog, mitochondrial OS=Homo sapiens OX=9606 GN=LONP1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43.0 null 324-UNIMOD:4,333-UNIMOD:1031,165-UNIMOD:1031 0.04 43.0 3 2 1 PRT sp|O75879|GATB_HUMAN Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Homo sapiens OX=9606 GN=GATB PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 43.0 null 139-UNIMOD:1031,186-UNIMOD:1031,280-UNIMOD:1031 0.08 43.0 6 3 1 PRT sp|O43865|SAHH2_HUMAN S-adenosylhomocysteine hydrolase-like protein 1 OS=Homo sapiens OX=9606 GN=AHCYL1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 43.0 null 272-UNIMOD:4,276-UNIMOD:35,284-UNIMOD:1031,270-UNIMOD:1031,286-UNIMOD:1031,141-UNIMOD:1031,524-UNIMOD:1031,292-UNIMOD:4,293-UNIMOD:4,111-UNIMOD:1031,267-UNIMOD:1031,20-UNIMOD:1031,285-UNIMOD:28,302-UNIMOD:1031,48-UNIMOD:35,53-UNIMOD:1031,240-UNIMOD:1031,57-UNIMOD:1031 0.22 43.0 31 13 10 PRT sp|Q9H173|SIL1_HUMAN Nucleotide exchange factor SIL1 OS=Homo sapiens OX=9606 GN=SIL1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43.0 null 132-UNIMOD:1031,137-UNIMOD:1031,139-UNIMOD:1031,144-UNIMOD:35 0.07 43.0 5 2 0 PRT sp|O75575|RPC9_HUMAN DNA-directed RNA polymerase III subunit RPC9 OS=Homo sapiens OX=9606 GN=CRCP PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43.0 null 34-UNIMOD:1031 0.14 43.0 1 1 1 PRT sp|Q15293|RCN1_HUMAN Reticulocalbin-1 OS=Homo sapiens OX=9606 GN=RCN1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 43.0 null 165-UNIMOD:1031,176-UNIMOD:1031,286-UNIMOD:267,166-UNIMOD:1031,81-UNIMOD:1031,81-UNIMOD:259,294-UNIMOD:259,70-UNIMOD:1031,266-UNIMOD:1031,86-UNIMOD:1031 0.30 43.0 15 9 6 PRT sp|P84077|ARF1_HUMAN ADP-ribosylation factor 1 OS=Homo sapiens OX=9606 GN=ARF1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 43.0 null 142-UNIMOD:1031,36-UNIMOD:1031 0.23 43.0 4 3 2 PRT sp|Q04695|K1C17_HUMAN Keratin, type I cytoskeletal 17 OS=Homo sapiens OX=9606 GN=KRT17 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 43.0 null 15-UNIMOD:1031,399-UNIMOD:1031,400-UNIMOD:1031,101-UNIMOD:1031,419-UNIMOD:1031,374-UNIMOD:1031 0.16 43.0 8 6 4 PRT sp|Q8N684-2|CPSF7_HUMAN Isoform 2 of Cleavage and polyadenylation specificity factor subunit 7 OS=Homo sapiens OX=9606 GN=CPSF7 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43.0 null 388-UNIMOD:1031,390-UNIMOD:4 0.04 43.0 2 1 0 PRT sp|Q16881-4|TRXR1_HUMAN Isoform 4 of Thioredoxin reductase 1, cytoplasmic OS=Homo sapiens OX=9606 GN=TXNRD1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43.0 null 111-UNIMOD:4,116-UNIMOD:4,119-UNIMOD:1031,120-UNIMOD:1031,307-UNIMOD:1031,176-UNIMOD:1031,122-UNIMOD:35,351-UNIMOD:1031,141-UNIMOD:1031,473-UNIMOD:4,476-UNIMOD:1031,479-UNIMOD:4,482-UNIMOD:1031,31-UNIMOD:1031,52-UNIMOD:1031,472-UNIMOD:1031,88-UNIMOD:1031,193-UNIMOD:1031,202-UNIMOD:1031 0.29 43.0 18 15 10 PRT sp|Q6IA69-2|NADE_HUMAN Isoform 2 of Glutamine-dependent NAD(+) synthetase OS=Homo sapiens OX=9606 GN=NADSYN1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43.0 null 271-UNIMOD:4,284-UNIMOD:1031 0.05 43.0 2 1 0 PRT sp|P62829|RL23_HUMAN 60S ribosomal protein L23 OS=Homo sapiens OX=9606 GN=RPL23 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ] 43.0 null 66-UNIMOD:1031,62-UNIMOD:35,113-UNIMOD:1031,112-UNIMOD:35,28-UNIMOD:4,35-UNIMOD:259,60-UNIMOD:35,66-UNIMOD:259,75-UNIMOD:1031,43-UNIMOD:1031,123-UNIMOD:1031,125-UNIMOD:4,13-UNIMOD:1031,123-UNIMOD:259 0.65 43.0 15 9 4 PRT sp|Q709F0|ACD11_HUMAN Acyl-CoA dehydrogenase family member 11 OS=Homo sapiens OX=9606 GN=ACAD11 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 43.0 null 1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:1031,53-UNIMOD:1031 0.04 43.0 8 2 0 PRT sp|P15056|BRAF_HUMAN Serine/threonine-protein kinase B-raf OS=Homo sapiens OX=9606 GN=BRAF PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 43.0 null 578-UNIMOD:1031,591-UNIMOD:1031 0.02 43.0 3 1 0 PRT sp|P37837|TALDO_HUMAN Transaldolase OS=Homo sapiens OX=9606 GN=TALDO1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 42.0 null 286-UNIMOD:1031,277-UNIMOD:1031,215-UNIMOD:1031,321-UNIMOD:1031,219-UNIMOD:1031,250-UNIMOD:4,292-UNIMOD:1031,314-UNIMOD:1031,204-UNIMOD:1031 0.23 42.0 12 9 6 PRT sp|P49915-2|GUAA_HUMAN Isoform 2 of GMP synthase [glutamine-hydrolyzing] OS=Homo sapiens OX=9606 GN=GMPS null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42.0 null 290-UNIMOD:1031,46-UNIMOD:1031,84-UNIMOD:1031,350-UNIMOD:4,357-UNIMOD:4,358-UNIMOD:1031,388-UNIMOD:1031,390-UNIMOD:4,83-UNIMOD:1031,239-UNIMOD:1031,313-UNIMOD:1031,230-UNIMOD:35,379-UNIMOD:1031,190-UNIMOD:1031,358-UNIMOD:259 0.25 42.0 20 13 11 PRT sp|O14818|PSA7_HUMAN Proteasome subunit alpha type-7 OS=Homo sapiens OX=9606 GN=PSMA7 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42.0 null 27-UNIMOD:1031,52-UNIMOD:1031,115-UNIMOD:1031 0.17 42.0 3 3 3 PRT sp|Q9H2G2-2|SLK_HUMAN Isoform 2 of STE20-like serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=SLK null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42.0 null 157-UNIMOD:1031,775-UNIMOD:1031,63-UNIMOD:1031,839-UNIMOD:1031,1165-UNIMOD:1031 0.05 42.0 11 5 3 PRT sp|Q9Y3S1-2|WNK2_HUMAN Isoform 2 of Serine/threonine-protein kinase WNK2 OS=Homo sapiens OX=9606 GN=WNK2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42.0 null 325-UNIMOD:1031,326-UNIMOD:4,349-UNIMOD:1031,207-UNIMOD:1031 0.02 42.0 6 3 1 PRT sp|Q9UQ88-4|CD11A_HUMAN Isoform SV3 of Cyclin-dependent kinase 11A OS=Homo sapiens OX=9606 GN=CDK11A null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42.0 null 539-UNIMOD:1031,20-UNIMOD:1031 0.04 42.0 4 2 1 PRT sp|Q9BRQ8-2|FSP1_HUMAN Isoform 2 of Ferroptosis suppressor protein 1 OS=Homo sapiens OX=9606 GN=AIFM2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42.0 null 142-UNIMOD:1031 0.07 42.0 1 1 1 PRT sp|P61313|RL15_HUMAN 60S ribosomal protein L15 OS=Homo sapiens OX=9606 GN=RPL15 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 42.0 null 83-UNIMOD:1031,153-UNIMOD:1031,56-UNIMOD:1031,105-UNIMOD:267 0.25 42.0 8 4 2 PRT sp|Q14566|MCM6_HUMAN DNA replication licensing factor MCM6 OS=Homo sapiens OX=9606 GN=MCM6 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 42.0 null 393-UNIMOD:4,402-UNIMOD:1031,407-UNIMOD:1031,205-UNIMOD:1031,95-UNIMOD:1031,646-UNIMOD:1031 0.07 42.0 8 5 3 PRT sp|P63104|1433Z_HUMAN 14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 42.0 null 157-UNIMOD:259,68-UNIMOD:1031,157-UNIMOD:1031,41-UNIMOD:267,1-UNIMOD:1,1-UNIMOD:35,85-UNIMOD:1031,9-UNIMOD:1031 0.29 42.0 12 7 4 PRT sp|A0AVT1-2|UBA6_HUMAN Isoform 2 of Ubiquitin-like modifier-activating enzyme 6 OS=Homo sapiens OX=9606 GN=UBA6 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42.0 null 29-UNIMOD:1031,18-UNIMOD:35 0.03 42.0 4 1 0 PRT sp|P35998|PRS7_HUMAN 26S proteasome regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PSMC2 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 42.0 null 222-UNIMOD:1031,225-UNIMOD:4,34-UNIMOD:1031,340-UNIMOD:1031 0.12 42.0 9 4 3 PRT sp|P54278-4|PMS2_HUMAN Isoform 4 of Mismatch repair endonuclease PMS2 OS=Homo sapiens OX=9606 GN=PMS2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42.0 null 91-UNIMOD:1031 0.12 42.0 2 1 0 PRT sp|P18669|PGAM1_HUMAN Phosphoglycerate mutase 1 OS=Homo sapiens OX=9606 GN=PGAM1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 42.0 null 100-UNIMOD:1031,153-UNIMOD:4,157-UNIMOD:1031,157-UNIMOD:259,106-UNIMOD:1031,126-UNIMOD:35,241-UNIMOD:1031,243-UNIMOD:35,100-UNIMOD:259,138-UNIMOD:1031,251-UNIMOD:1031,251-UNIMOD:259,191-UNIMOD:267 0.38 42.0 21 11 2 PRT sp|Q9NUQ8-2|ABCF3_HUMAN Isoform 2 of ATP-binding cassette sub-family F member 3 OS=Homo sapiens OX=9606 GN=ABCF3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42.0 null 516-UNIMOD:4,525-UNIMOD:1031,528-UNIMOD:35,451-UNIMOD:1031 0.04 42.0 4 2 1 PRT sp|Q13557-8|KCC2D_HUMAN Isoform Delta 6 of Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Homo sapiens OX=9606 GN=CAMK2D null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42.0 null 43-UNIMOD:1031,48-UNIMOD:1031 0.03 42.0 4 1 0 PRT sp|P54577|SYYC_HUMAN Tyrosine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=YARS1 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 42.0 null 247-UNIMOD:1031,250-UNIMOD:4,356-UNIMOD:1031,412-UNIMOD:259,490-UNIMOD:1031,519-UNIMOD:4,520-UNIMOD:1031,147-UNIMOD:1031,470-UNIMOD:1031,297-UNIMOD:259,391-UNIMOD:259,334-UNIMOD:1031,247-UNIMOD:259,265-UNIMOD:259 0.26 42.0 13 10 7 PRT sp|P67936|TPM4_HUMAN Tropomyosin alpha-4 chain OS=Homo sapiens OX=9606 GN=TPM4 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 42.0 null 13-UNIMOD:1031,169-UNIMOD:1031,223-UNIMOD:1031,215-UNIMOD:1031,113-UNIMOD:1031,177-UNIMOD:1031,2-UNIMOD:1,11-UNIMOD:1031,132-UNIMOD:1031,99-UNIMOD:35,100-UNIMOD:1031,212-UNIMOD:1031,195-UNIMOD:1031 0.44 42.0 14 12 10 PRT sp|P06753-2|TPM3_HUMAN Isoform 2 of Tropomyosin alpha-3 chain OS=Homo sapiens OX=9606 GN=TPM3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 42.0 null 13-UNIMOD:1031,76-UNIMOD:1031,82-UNIMOD:1031,169-UNIMOD:1031,170-UNIMOD:4,226-UNIMOD:4,228-UNIMOD:1031,233-UNIMOD:4,116-UNIMOD:1031,226-UNIMOD:385,223-UNIMOD:1031,2-UNIMOD:1,11-UNIMOD:1031,177-UNIMOD:1031,91-UNIMOD:35,92-UNIMOD:1031,124-UNIMOD:267,65-UNIMOD:267,54-UNIMOD:267,100-UNIMOD:1031,184-UNIMOD:1031,125-UNIMOD:1031,197-UNIMOD:1031,212-UNIMOD:1031,223-UNIMOD:259 0.69 42.0 29 20 13 PRT sp|Q9UHD1|CHRD1_HUMAN Cysteine and histidine-rich domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CHORDC1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 42.0 null 198-UNIMOD:1031,211-UNIMOD:4,213-UNIMOD:1031,59-UNIMOD:4,61-UNIMOD:259,213-UNIMOD:259,143-UNIMOD:1031,86-UNIMOD:4,89-UNIMOD:1031 0.17 42.0 7 6 5 PRT sp|P84098|RL19_HUMAN 60S ribosomal protein L19 OS=Homo sapiens OX=9606 GN=RPL19 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 42.0 null 21-UNIMOD:1031,153-UNIMOD:1031,46-UNIMOD:1031,139-UNIMOD:35,144-UNIMOD:1031,119-UNIMOD:35,126-UNIMOD:259,76-UNIMOD:35,80-UNIMOD:1031,82-UNIMOD:1031,92-UNIMOD:1031,162-UNIMOD:267,53-UNIMOD:1031 0.47 42.0 12 10 8 PRT sp|O14745|NHRF1_HUMAN Na(+)/H(+) exchange regulatory cofactor NHE-RF1 OS=Homo sapiens OX=9606 GN=SLC9A3R1 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 42.0 null 15-UNIMOD:4,16-UNIMOD:4,19-UNIMOD:1031,159-UNIMOD:1031,101-UNIMOD:1031 0.16 42.0 6 3 1 PRT sp|Q00610-2|CLH1_HUMAN Isoform 2 of Clathrin heavy chain 1 OS=Homo sapiens OX=9606 GN=CLTC null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42.0 null 245-UNIMOD:1031,227-UNIMOD:1031,189-UNIMOD:1031,736-UNIMOD:4,737-UNIMOD:1031,637-UNIMOD:1031,151-UNIMOD:4,742-UNIMOD:1031,1347-UNIMOD:1031 0.08 42.0 10 10 9 PRT sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens OX=9606 GN=RPS6KA3 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42.0 null 216-UNIMOD:1031,541-UNIMOD:1031,195-UNIMOD:1031,208-UNIMOD:1031,223-UNIMOD:1031,81-UNIMOD:259,504-UNIMOD:1031 0.10 42.0 13 5 2 PRT sp|Q709F0-2|ACD11_HUMAN Isoform 2 of Acyl-CoA dehydrogenase family member 11 OS=Homo sapiens OX=9606 GN=ACAD11 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42.0 null 1-UNIMOD:35,2-UNIMOD:1031,53-UNIMOD:1031 0.05 42.0 5 2 0 PRT sp|P21291|CSRP1_HUMAN Cysteine and glycine-rich protein 1 OS=Homo sapiens OX=9606 GN=CSRP1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42.0 null 178-UNIMOD:1031,161-UNIMOD:1031,167-UNIMOD:4,122-UNIMOD:4,131-UNIMOD:1031,112-UNIMOD:1031 0.47 42.0 5 5 5 PRT sp|P39019|RS19_HUMAN 40S ribosomal protein S19 OS=Homo sapiens OX=9606 GN=RPS19 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 42.0 null 7-UNIMOD:1031,77-UNIMOD:1031,38-UNIMOD:1031,143-UNIMOD:1031,29-UNIMOD:1031,144-UNIMOD:1031,23-UNIMOD:1031,111-UNIMOD:1031,112-UNIMOD:35,143-UNIMOD:259,122-UNIMOD:1031,144-UNIMOD:259 0.62 42.0 14 10 8 PRT sp|P09651-3|ROA1_HUMAN Isoform 2 of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42.0 null 245-UNIMOD:1031,166-UNIMOD:1031,175-UNIMOD:4,15-UNIMOD:1031,8-UNIMOD:1031,178-UNIMOD:267,105-UNIMOD:1031,78-UNIMOD:1031,137-UNIMOD:35,140-UNIMOD:267 0.36 42.0 14 9 3 PRT sp|P27348|1433T_HUMAN 14-3-3 protein theta OS=Homo sapiens OX=9606 GN=YWHAQ PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 42.0 null 212-UNIMOD:259,139-UNIMOD:1031,68-UNIMOD:1031,41-UNIMOD:267,49-UNIMOD:1031,158-UNIMOD:1031,11-UNIMOD:1031,222-UNIMOD:267,218-UNIMOD:35,9-UNIMOD:1031,115-UNIMOD:1031,49-UNIMOD:259,18-UNIMOD:267 0.60 42.0 23 13 6 PRT sp|P31946-2|1433B_HUMAN Isoform Short of 14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42.0 null 212-UNIMOD:259,157-UNIMOD:1031,49-UNIMOD:1031,68-UNIMOD:1031,115-UNIMOD:1031 0.35 42.0 9 5 3 PRT sp|P39023|RL3_HUMAN 60S ribosomal protein L3 OS=Homo sapiens OX=9606 GN=RPL3 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 42.0 null 103-UNIMOD:1031,114-UNIMOD:4,177-UNIMOD:1031,181-UNIMOD:35,115-UNIMOD:1031,115-UNIMOD:259,373-UNIMOD:1031,286-UNIMOD:1031,39-UNIMOD:1031,294-UNIMOD:1031,250-UNIMOD:1031,253-UNIMOD:4,366-UNIMOD:1031,272-UNIMOD:1031,19-UNIMOD:267,148-UNIMOD:1031,312-UNIMOD:259,362-UNIMOD:1031,349-UNIMOD:1031,393-UNIMOD:1031,153-UNIMOD:35,356-UNIMOD:1031,300-UNIMOD:1031,385-UNIMOD:1031,143-UNIMOD:1031,53-UNIMOD:35,386-UNIMOD:1031 0.47 42.0 38 23 12 PRT sp|P20839-2|IMDH1_HUMAN Isoform 2 of Inosine-5'-monophosphate dehydrogenase 1 OS=Homo sapiens OX=9606 GN=IMPDH1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42.0 null 486-UNIMOD:1031,413-UNIMOD:1031,403-UNIMOD:1031 0.09 42.0 4 3 2 PRT sp|P50990-2|TCPQ_HUMAN Isoform 2 of T-complex protein 1 subunit theta OS=Homo sapiens OX=9606 GN=CCT8 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42.0 null 150-UNIMOD:35,152-UNIMOD:1031,440-UNIMOD:1031,35-UNIMOD:1031,36-UNIMOD:35,162-UNIMOD:1031,447-UNIMOD:1031,33-UNIMOD:35,129-UNIMOD:4,130-UNIMOD:4,133-UNIMOD:1031,381-UNIMOD:1031,17-UNIMOD:4,18-UNIMOD:1031,306-UNIMOD:4,307-UNIMOD:1031,421-UNIMOD:1031,411-UNIMOD:4,420-UNIMOD:1031,216-UNIMOD:1031,515-UNIMOD:1031,348-UNIMOD:1031,12-UNIMOD:267,119-UNIMOD:1031,206-UNIMOD:1031,402-UNIMOD:259,299-UNIMOD:1031,316-UNIMOD:267,35-UNIMOD:259 0.45 42.0 46 22 14 PRT sp|P29401|TKT_HUMAN Transketolase OS=Homo sapiens OX=9606 GN=TKT PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 42.0 null 232-UNIMOD:1031,456-UNIMOD:259,241-UNIMOD:1031,283-UNIMOD:1031,102-UNIMOD:1031,1-UNIMOD:1,6-UNIMOD:1031,456-UNIMOD:1031,474-UNIMOD:267,493-UNIMOD:259,1-UNIMOD:35,16-UNIMOD:1031,319-UNIMOD:1031,352-UNIMOD:1031,538-UNIMOD:1031,597-UNIMOD:1031,241-UNIMOD:259,314-UNIMOD:1031,302-UNIMOD:267,260-UNIMOD:1031,543-UNIMOD:1031,114-UNIMOD:259,352-UNIMOD:259,353-UNIMOD:1031,59-UNIMOD:1031,327-UNIMOD:1031 0.34 42.0 35 21 12 PRT sp|Q13347|EIF3I_HUMAN Eukaryotic translation initiation factor 3 subunit I OS=Homo sapiens OX=9606 GN=EIF3I PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 42.0 null 282-UNIMOD:1031,213-UNIMOD:1031,185-UNIMOD:1031,224-UNIMOD:1031,81-UNIMOD:4,85-UNIMOD:1031,76-UNIMOD:4,91-UNIMOD:1031,310-UNIMOD:267,264-UNIMOD:1031 0.33 42.0 13 9 5 PRT sp|P22234|PUR6_HUMAN Multifunctional protein ADE2 OS=Homo sapiens OX=9606 GN=PAICS PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 42.0 null 36-UNIMOD:1031,30-UNIMOD:1031,19-UNIMOD:1031,53-UNIMOD:1031,244-UNIMOD:35,246-UNIMOD:1031,2-UNIMOD:1,11-UNIMOD:1031,110-UNIMOD:1031,47-UNIMOD:1031,286-UNIMOD:1031,288-UNIMOD:4,295-UNIMOD:4 0.22 42.0 16 9 6 PRT sp|Q9Y3F4|STRAP_HUMAN Serine-threonine kinase receptor-associated protein OS=Homo sapiens OX=9606 GN=STRAP PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 42.0 null 262-UNIMOD:1031,270-UNIMOD:4,122-UNIMOD:1031,122-UNIMOD:259 0.13 42.0 5 3 1 PRT sp|P25815|S100P_HUMAN Protein S100-P OS=Homo sapiens OX=9606 GN=S100P PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42.0 null 30-UNIMOD:1031,39-UNIMOD:1031 0.35 42.0 3 3 3 PRT sp|P00338|LDHA_HUMAN L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ] 42.0 null 59-UNIMOD:1031,14-UNIMOD:1031,90-UNIMOD:1031,81-UNIMOD:1031,57-UNIMOD:1031,62-UNIMOD:35,63-UNIMOD:35,118-UNIMOD:1031,232-UNIMOD:1031,318-UNIMOD:1031,222-UNIMOD:1031,243-UNIMOD:1031,163-UNIMOD:4,169-UNIMOD:267,233-UNIMOD:28,222-UNIMOD:259,224-UNIMOD:259,126-UNIMOD:1031,131-UNIMOD:4,328-UNIMOD:259,76-UNIMOD:1031,232-UNIMOD:259,243-UNIMOD:259,73-UNIMOD:267,315-UNIMOD:267,126-UNIMOD:259,155-UNIMOD:1031,14-UNIMOD:259,99-UNIMOD:267 0.52 42.0 52 23 8 PRT sp|P06454|PTMA_HUMAN Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 42.0 null 2-UNIMOD:1,15-UNIMOD:1031,103-UNIMOD:1031,21-UNIMOD:1031,21-UNIMOD:259,31-UNIMOD:267 0.41 42.0 6 4 1 PRT sp|Q8N163|CCAR2_HUMAN Cell cycle and apoptosis regulator protein 2 OS=Homo sapiens OX=9606 GN=CCAR2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 42.0 null 112-UNIMOD:1031,54-UNIMOD:1031 0.04 42.0 2 2 2 PRT sp|Q96IX5|ATPMD_HUMAN ATP synthase membrane subunit DAPIT, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5MD PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 41.0 null 16-UNIMOD:1031,17-UNIMOD:1031 0.47 41.0 2 2 2 PRT sp|Q96G23|CERS2_HUMAN Ceramide synthase 2 OS=Homo sapiens OX=9606 GN=CERS2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41.0 null 93-UNIMOD:1031 0.05 41.0 1 1 1 PRT sp|P08865|RSSA_HUMAN 40S ribosomal protein SA OS=Homo sapiens OX=9606 GN=RPSA PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41.0 null 89-UNIMOD:1031,42-UNIMOD:1031,220-UNIMOD:1031,52-UNIMOD:259 0.15 41.0 5 4 3 PRT sp|P30050|RL12_HUMAN 60S ribosomal protein L12 OS=Homo sapiens OX=9606 GN=RPL12 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 41.0 null 17-UNIMOD:4,31-UNIMOD:1031,99-UNIMOD:1031,114-UNIMOD:267,54-UNIMOD:1031,41-UNIMOD:1031,86-UNIMOD:1031,40-UNIMOD:1031 0.42 41.0 9 8 7 PRT sp|O95340|PAPS2_HUMAN Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2 OS=Homo sapiens OX=9606 GN=PAPSS2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41.0 null 233-UNIMOD:1031,394-UNIMOD:1031 0.04 41.0 3 2 1 PRT sp|Q99683|M3K5_HUMAN Mitogen-activated protein kinase kinase kinase 5 OS=Homo sapiens OX=9606 GN=MAP3K5 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41.0 null 805-UNIMOD:1031 0.01 41.0 2 1 0 PRT sp|Q9NWZ3-2|IRAK4_HUMAN Isoform 2 of Interleukin-1 receptor-associated kinase 4 OS=Homo sapiens OX=9606 GN=IRAK4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41.0 null 189-UNIMOD:1031,202-UNIMOD:1031 0.05 41.0 3 1 0 PRT sp|Q8NFU5|IPMK_HUMAN Inositol polyphosphate multikinase OS=Homo sapiens OX=9606 GN=IPMK PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41.0 null 62-UNIMOD:1031,46-UNIMOD:4,57-UNIMOD:35,60-UNIMOD:1031 0.08 41.0 4 2 0 PRT sp|O96017-13|CHK2_HUMAN Isoform 13 of Serine/threonine-protein kinase Chk2 OS=Homo sapiens OX=9606 GN=CHEK2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41.0 null 128-UNIMOD:1031,141-UNIMOD:4,28-UNIMOD:1031,152-UNIMOD:1031 0.14 41.0 4 3 1 PRT sp|P47914|RL29_HUMAN 60S ribosomal protein L29 OS=Homo sapiens OX=9606 GN=RPL29 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41.0 null 134-UNIMOD:1031,149-UNIMOD:1031,5-UNIMOD:1031,103-UNIMOD:1031,63-UNIMOD:1031,33-UNIMOD:1031,149-UNIMOD:259,56-UNIMOD:1031,57-UNIMOD:35,38-UNIMOD:1031,156-UNIMOD:1031 0.52 41.0 15 10 5 PRT sp|Q9UL54-2|TAOK2_HUMAN Isoform 2 of Serine/threonine-protein kinase TAO2 OS=Homo sapiens OX=9606 GN=TAOK2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41.0 null 153-UNIMOD:1031,166-UNIMOD:1031 0.02 41.0 3 1 0 PRT sp|P08670|VIME_HUMAN Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 41.0 null 439-UNIMOD:1031,104-UNIMOD:1031,139-UNIMOD:1031,373-UNIMOD:1031,294-UNIMOD:1031,292-UNIMOD:1031,188-UNIMOD:1031,64-UNIMOD:267,445-UNIMOD:1031,402-UNIMOD:1031,313-UNIMOD:1031,168-UNIMOD:1031,139-UNIMOD:259,217-UNIMOD:267,372-UNIMOD:35,193-UNIMOD:35,328-UNIMOD:4 0.42 41.0 23 19 15 PRT sp|O14979|HNRDL_HUMAN Heterogeneous nuclear ribonucleoprotein D-like OS=Homo sapiens OX=9606 GN=HNRNPDL PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 41.0 null 177-UNIMOD:4,180-UNIMOD:1031,162-UNIMOD:1031 0.06 41.0 2 2 2 PRT sp|Q09666|AHNK_HUMAN Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 41.0 null 5725-UNIMOD:1031,3149-UNIMOD:1031,5323-UNIMOD:1031,5655-UNIMOD:1031,1049-UNIMOD:1031,3201-UNIMOD:1031,1305-UNIMOD:1031,2706-UNIMOD:1031,2609-UNIMOD:1031,3073-UNIMOD:1031,2973-UNIMOD:1031,2183-UNIMOD:1031,2589-UNIMOD:1031,2509-UNIMOD:1031,2132-UNIMOD:1031,1210-UNIMOD:1031,5831-UNIMOD:1031,1461-UNIMOD:1031,828-UNIMOD:1031,563-UNIMOD:1031,567-UNIMOD:4,1652-UNIMOD:1031,942-UNIMOD:1031,1205-UNIMOD:1031,707-UNIMOD:1031,1194-UNIMOD:1031,2616-UNIMOD:1031,4926-UNIMOD:1031,1319-UNIMOD:1031,1184-UNIMOD:1031,1616-UNIMOD:1031,4125-UNIMOD:1031,1322-UNIMOD:1031,1191-UNIMOD:1031,727-UNIMOD:1031,2962-UNIMOD:1031,4038-UNIMOD:1031,3256-UNIMOD:1031,2717-UNIMOD:1031,4139-UNIMOD:1031,956-UNIMOD:1031,313-UNIMOD:1031,5767-UNIMOD:1031,1777-UNIMOD:1031,1488-UNIMOD:1031,326-UNIMOD:1031,3404-UNIMOD:1031,1668-UNIMOD:1031,1671-UNIMOD:35,884-UNIMOD:1031,887-UNIMOD:35,4886-UNIMOD:1031,4988-UNIMOD:1031 0.28 41.0 57 51 45 PRT sp|P62191-2|PRS4_HUMAN Isoform 2 of 26S proteasome regulatory subunit 4 OS=Homo sapiens OX=9606 GN=PSMC1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41.0 null 159-UNIMOD:1031,144-UNIMOD:1031,164-UNIMOD:1031,350-UNIMOD:1031,347-UNIMOD:1031 0.16 41.0 5 4 2 PRT sp|P43686-2|PRS6B_HUMAN Isoform 2 of 26S proteasome regulatory subunit 6B OS=Homo sapiens OX=9606 GN=PSMC4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41.0 null 179-UNIMOD:4,181-UNIMOD:1031,183-UNIMOD:35,173-UNIMOD:35,207-UNIMOD:1031,94-UNIMOD:1031,186-UNIMOD:1031 0.13 41.0 10 3 1 PRT sp|Q00839-2|HNRPU_HUMAN Isoform 2 of Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ] 41.0 null 505-UNIMOD:1031,543-UNIMOD:4,546-UNIMOD:1031,333-UNIMOD:1031,215-UNIMOD:1031,616-UNIMOD:1031,31-UNIMOD:1031,17-UNIMOD:1031,607-UNIMOD:1031,246-UNIMOD:1031,417-UNIMOD:1031,525-UNIMOD:1031,527-UNIMOD:35,35-UNIMOD:35,583-UNIMOD:1031,588-UNIMOD:4,678-UNIMOD:1031,219-UNIMOD:1031,497-UNIMOD:1031,2-UNIMOD:1,9-UNIMOD:1031,601-UNIMOD:1031,573-UNIMOD:1031,575-UNIMOD:4,524-UNIMOD:1031,617-UNIMOD:35,618-UNIMOD:1031,28-UNIMOD:1031 0.29 41.0 27 22 18 PRT sp|P23634-5|AT2B4_HUMAN Isoform ZK of Plasma membrane calcium-transporting ATPase 4 OS=Homo sapiens OX=9606 GN=ATP2B4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41.0 null 247-UNIMOD:1031 0.01 41.0 2 1 0 PRT sp|E9PAV3|NACAM_HUMAN Nascent polypeptide-associated complex subunit alpha, muscle-specific form OS=Homo sapiens OX=9606 GN=NACA PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41.0 null 2005-UNIMOD:1031,1990-UNIMOD:259,1943-UNIMOD:35,1945-UNIMOD:1031 0.02 41.0 4 3 2 PRT sp|O00193|SMAP_HUMAN Small acidic protein OS=Homo sapiens OX=9606 GN=SMAP PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 41.0 null 91-UNIMOD:1031,88-UNIMOD:35,62-UNIMOD:1031,13-UNIMOD:1031,74-UNIMOD:1031,170-UNIMOD:1031,45-UNIMOD:35,49-UNIMOD:1031 0.37 41.0 10 6 3 PRT sp|P46783|RS10_HUMAN 40S ribosomal protein S10 OS=Homo sapiens OX=9606 GN=RPS10 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 41.0 null 139-UNIMOD:1031,59-UNIMOD:1031,47-UNIMOD:1031,80-UNIMOD:267,31-UNIMOD:1031,49-UNIMOD:35,53-UNIMOD:1031,38-UNIMOD:259,25-UNIMOD:1031,29-UNIMOD:35 0.50 41.0 14 10 6 PRT sp|Q13043-2|STK4_HUMAN Isoform 2 of Serine/threonine-protein kinase 4 OS=Homo sapiens OX=9606 GN=STK4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41.0 null 180-UNIMOD:1031,151-UNIMOD:1031,164-UNIMOD:1031 0.10 41.0 11 3 1 PRT sp|P35637-2|FUS_HUMAN Isoform Short of RNA-binding protein FUS OS=Homo sapiens OX=9606 GN=FUS null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41.0 null 333-UNIMOD:1031,356-UNIMOD:1031,364-UNIMOD:1031,311-UNIMOD:1031 0.10 41.0 5 4 3 PRT sp|P42677|RS27_HUMAN 40S ribosomal protein S27 OS=Homo sapiens OX=9606 GN=RPS27 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ] 41.0 null 5-UNIMOD:1031,16-UNIMOD:1031,2-UNIMOD:1 0.20 41.0 7 2 0 PRT sp|P41091|IF2G_HUMAN Eukaryotic translation initiation factor 2 subunit 3 OS=Homo sapiens OX=9606 GN=EIF2S3 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41.0 null 27-UNIMOD:1031,434-UNIMOD:4,440-UNIMOD:1031,105-UNIMOD:4,59-UNIMOD:1031,421-UNIMOD:1031,266-UNIMOD:1031,269-UNIMOD:4,70-UNIMOD:1031 0.23 41.0 8 7 6 PRT sp|Q92665|RT31_HUMAN 28S ribosomal protein S31, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS31 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ] 41.0 null 174-UNIMOD:1031,171-UNIMOD:28 0.05 41.0 2 1 0 PRT sp|Q96Q15-4|SMG1_HUMAN Isoform 4 of Serine/threonine-protein kinase SMG1 OS=Homo sapiens OX=9606 GN=SMG1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41.0 null 886-UNIMOD:1031 0.01 41.0 2 1 0 PRT sp|P26447|S10A4_HUMAN Protein S100-A4 OS=Homo sapiens OX=9606 GN=S100A4 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 41.0 null 57-UNIMOD:1031,2-UNIMOD:1,3-UNIMOD:4,7-UNIMOD:1031,59-UNIMOD:35,35-UNIMOD:1031,31-UNIMOD:1031,57-UNIMOD:259 0.49 41.0 10 5 2 PRT sp|P62979|RS27A_HUMAN Ubiquitin-40S ribosomal protein S27a OS=Homo sapiens OX=9606 GN=RPS27A PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ] 41.0 null 63-UNIMOD:1031,11-UNIMOD:1031,27-UNIMOD:259,48-UNIMOD:1031,144-UNIMOD:4,145-UNIMOD:4,149-UNIMOD:4,152-UNIMOD:1031,1-UNIMOD:35,6-UNIMOD:1031,1-UNIMOD:1,107-UNIMOD:1031,63-UNIMOD:259,99-UNIMOD:1031,83-UNIMOD:1031 0.63 41.0 17 10 6 PRT sp|P61513|RL37A_HUMAN 60S ribosomal protein L37a OS=Homo sapiens OX=9606 GN=RPL37A PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41.0 null 80-UNIMOD:259,36-UNIMOD:1031,39-UNIMOD:4,42-UNIMOD:4,13-UNIMOD:1031,28-UNIMOD:1031,44-UNIMOD:1031,7-UNIMOD:1031 0.55 41.0 8 6 4 PRT sp|P54136-2|SYRC_HUMAN Isoform Monomeric of Arginine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=RARS1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41.0 null 133-UNIMOD:1031,71-UNIMOD:1031,78-UNIMOD:4,135-UNIMOD:35,491-UNIMOD:1031 0.09 41.0 5 3 2 PRT sp|Q99497|PARK7_HUMAN Protein/nucleic acid deglycase DJ-1 OS=Homo sapiens OX=9606 GN=PARK7 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 41.0 null 41-UNIMOD:1031,46-UNIMOD:4,32-UNIMOD:1031,148-UNIMOD:1031,130-UNIMOD:1031,93-UNIMOD:1031,188-UNIMOD:1031,132-UNIMOD:1031,12-UNIMOD:259 0.37 41.0 10 8 6 PRT sp|O94875-9|SRBS2_HUMAN Isoform 9 of Sorbin and SH3 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SORBS2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41.0 null 154-UNIMOD:1031 0.04 41.0 1 1 1 PRT sp|Q96SB4-4|SRPK1_HUMAN Isoform 3 of SRSF protein kinase 1 OS=Homo sapiens OX=9606 GN=SRPK1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41.0 null 96-UNIMOD:1031,92-UNIMOD:35,93-UNIMOD:1031 0.04 41.0 5 3 1 PRT sp|P36578|RL4_HUMAN 60S ribosomal protein L4 OS=Homo sapiens OX=9606 GN=RPL4 PE=1 SV=5 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 41.0 null 125-UNIMOD:4,138-UNIMOD:35,140-UNIMOD:1031,14-UNIMOD:1031,353-UNIMOD:1031,239-UNIMOD:1031,274-UNIMOD:1031,281-UNIMOD:35,368-UNIMOD:1031,259-UNIMOD:1031,165-UNIMOD:1031,325-UNIMOD:35,327-UNIMOD:1031,95-UNIMOD:35,96-UNIMOD:4,97-UNIMOD:267,364-UNIMOD:259,294-UNIMOD:1031,172-UNIMOD:1031,208-UNIMOD:4,219-UNIMOD:259,333-UNIMOD:1031,173-UNIMOD:1031,248-UNIMOD:267,234-UNIMOD:259,374-UNIMOD:1031,390-UNIMOD:1031,182-UNIMOD:1031,120-UNIMOD:1031,375-UNIMOD:1031,394-UNIMOD:1031 0.50 41.0 34 23 15 PRT sp|P00966|ASSY_HUMAN Argininosuccinate synthase OS=Homo sapiens OX=9606 GN=ASS1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 41.0 null 121-UNIMOD:1031,228-UNIMOD:1031,112-UNIMOD:1031,165-UNIMOD:1031,209-UNIMOD:1031,337-UNIMOD:4,340-UNIMOD:1031,58-UNIMOD:1031,234-UNIMOD:1031,101-UNIMOD:1031,53-UNIMOD:1031,276-UNIMOD:35,277-UNIMOD:1031,229-UNIMOD:1031 0.30 41.0 20 13 8 PRT sp|P08237|PFKAM_HUMAN ATP-dependent 6-phosphofructokinase, muscle type OS=Homo sapiens OX=9606 GN=PFKM PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 41.0 null 2-UNIMOD:1,10-UNIMOD:1031 0.02 41.0 2 1 0 PRT sp|Q92900|RENT1_HUMAN Regulator of nonsense transcripts 1 OS=Homo sapiens OX=9606 GN=UPF1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 41.0 null 509-UNIMOD:1031,531-UNIMOD:4,544-UNIMOD:1031,790-UNIMOD:1031 0.06 41.0 3 3 1 PRT sp|P06730|IF4E_HUMAN Eukaryotic translation initiation factor 4E OS=Homo sapiens OX=9606 GN=EIF4E PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 41.0 null 206-UNIMOD:1031,212-UNIMOD:1031 0.11 41.0 2 2 2 PRT sp|P51572|BAP31_HUMAN B-cell receptor-associated protein 31 OS=Homo sapiens OX=9606 GN=BCAP31 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 41.0 null 167-UNIMOD:1031,159-UNIMOD:1031 0.08 41.0 2 2 2 PRT sp|P09651|ROA1_HUMAN Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=5 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 41.0 null 166-UNIMOD:1031,175-UNIMOD:4,2-UNIMOD:1,3-UNIMOD:1031,137-UNIMOD:35 0.10 41.0 3 3 1 PRT sp|Q7L7X3-3|TAOK1_HUMAN Isoform 3 of Serine/threonine-protein kinase TAO1 OS=Homo sapiens OX=9606 GN=TAOK1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40.0 null 153-UNIMOD:1031,166-UNIMOD:1031,57-UNIMOD:1031 0.03 40.0 5 2 1 PRT sp|P13667|PDIA4_HUMAN Protein disulfide-isomerase A4 OS=Homo sapiens OX=9606 GN=PDIA4 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 40.0 null 629-UNIMOD:1031,234-UNIMOD:1031,145-UNIMOD:1031,245-UNIMOD:1031,141-UNIMOD:1031,637-UNIMOD:1031,528-UNIMOD:1031,576-UNIMOD:1031,570-UNIMOD:1031,560-UNIMOD:28,218-UNIMOD:1031,111-UNIMOD:1031,437-UNIMOD:1031,543-UNIMOD:1031,366-UNIMOD:1031,163-UNIMOD:259,629-UNIMOD:259,401-UNIMOD:1031 0.26 40.0 21 17 13 PRT sp|Q13131|AAPK1_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Homo sapiens OX=9606 GN=PRKAA1 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 40.0 null 152-UNIMOD:1031,162-UNIMOD:35,165-UNIMOD:1031,152-UNIMOD:259,165-UNIMOD:259,56-UNIMOD:1031,45-UNIMOD:1031,40-UNIMOD:1031,71-UNIMOD:1031,398-UNIMOD:1031 0.13 40.0 31 6 4 PRT sp|P13010|XRCC5_HUMAN X-ray repair cross-complementing protein 5 OS=Homo sapiens OX=9606 GN=XRCC5 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 40.0 null 565-UNIMOD:1031,481-UNIMOD:1031,202-UNIMOD:1031,339-UNIMOD:4,346-UNIMOD:4,347-UNIMOD:1031,265-UNIMOD:1031,534-UNIMOD:1031,481-UNIMOD:259,443-UNIMOD:1031,461-UNIMOD:35,543-UNIMOD:1031,332-UNIMOD:1031,338-UNIMOD:1031 0.18 40.0 20 13 11 PRT sp|Q99729-3|ROAA_HUMAN Isoform 3 of Heterogeneous nuclear ribonucleoprotein A/B OS=Homo sapiens OX=9606 GN=HNRNPAB null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40.0 null 99-UNIMOD:4,102-UNIMOD:1031,232-UNIMOD:1031,155-UNIMOD:1031,223-UNIMOD:1031,224-UNIMOD:4,126-UNIMOD:1031,227-UNIMOD:1031,215-UNIMOD:1031,131-UNIMOD:1031 0.29 40.0 10 8 4 PRT sp|Q14103-4|HNRPD_HUMAN Isoform 4 of Heterogeneous nuclear ribonucleoprotein D0 OS=Homo sapiens OX=9606 GN=HNRNPD null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40.0 null 107-UNIMOD:4,110-UNIMOD:1031,164-UNIMOD:1031,273-UNIMOD:1031,233-UNIMOD:4,236-UNIMOD:1031,239-UNIMOD:35,232-UNIMOD:1031,146-UNIMOD:1031,95-UNIMOD:1031,139-UNIMOD:1031,224-UNIMOD:1031,134-UNIMOD:1031 0.35 40.0 12 11 8 PRT sp|P23396|RS3_HUMAN 40S ribosomal protein S3 OS=Homo sapiens OX=9606 GN=RPS3 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 40.0 null 132-UNIMOD:1031,134-UNIMOD:4,202-UNIMOD:1031,187-UNIMOD:1031,90-UNIMOD:1031,62-UNIMOD:1031,141-UNIMOD:1031,10-UNIMOD:1031,108-UNIMOD:1031,97-UNIMOD:4,185-UNIMOD:1031,106-UNIMOD:267,75-UNIMOD:1031,214-UNIMOD:1031,197-UNIMOD:1031,230-UNIMOD:1031,62-UNIMOD:259,179-UNIMOD:28,189-UNIMOD:35,2-UNIMOD:1,7-UNIMOD:1031,141-UNIMOD:259 0.69 40.0 22 17 13 PRT sp|O95373|IPO7_HUMAN Importin-7 OS=Homo sapiens OX=9606 GN=IPO7 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 40.0 null 489-UNIMOD:1031,724-UNIMOD:1031,736-UNIMOD:4,990-UNIMOD:1031,1010-UNIMOD:35,1013-UNIMOD:1031,774-UNIMOD:1031 0.06 40.0 7 5 3 PRT sp|P62333|PRS10_HUMAN 26S proteasome regulatory subunit 10B OS=Homo sapiens OX=9606 GN=PSMC6 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 40.0 null 170-UNIMOD:4,180-UNIMOD:1031,298-UNIMOD:1031,68-UNIMOD:1031 0.11 40.0 5 3 2 PRT sp|P22626-2|ROA2_HUMAN Isoform A2 of Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40.0 null 156-UNIMOD:1031,10-UNIMOD:1031,161-UNIMOD:1031,92-UNIMOD:259,100-UNIMOD:259,92-UNIMOD:1031,100-UNIMOD:1031,117-UNIMOD:267,181-UNIMOD:35,216-UNIMOD:267,135-UNIMOD:267 0.33 40.0 16 9 4 PRT sp|Q9Y2I7|FYV1_HUMAN 1-phosphatidylinositol 3-phosphate 5-kinase OS=Homo sapiens OX=9606 GN=PIKFYVE PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 40.0 null 1861-UNIMOD:1031,1962-UNIMOD:1031,2046-UNIMOD:1031 0.02 40.0 4 3 2 PRT sp|P53396-2|ACLY_HUMAN Isoform 2 of ATP-citrate synthase OS=Homo sapiens OX=9606 GN=ACLY null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40.0 null 68-UNIMOD:1031,826-UNIMOD:1031,835-UNIMOD:4,265-UNIMOD:1031,167-UNIMOD:1031,968-UNIMOD:1031,620-UNIMOD:1031,623-UNIMOD:4,975-UNIMOD:35 0.10 40.0 9 8 7 PRT sp|P62195-2|PRS8_HUMAN Isoform 2 of 26S proteasome regulatory subunit 8 OS=Homo sapiens OX=9606 GN=PSMC5 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40.0 null 188-UNIMOD:1031,214-UNIMOD:1031,30-UNIMOD:1031,154-UNIMOD:1031,80-UNIMOD:1031,389-UNIMOD:1031,86-UNIMOD:1031,322-UNIMOD:1031,47-UNIMOD:1031 0.28 40.0 12 9 6 PRT sp|P19525-2|E2AK2_HUMAN Isoform 2 of Interferon-induced, double-stranded RNA-activated protein kinase OS=Homo sapiens OX=9606 GN=EIF2AK2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40.0 null 399-UNIMOD:1031,403-UNIMOD:1031,375-UNIMOD:1031,385-UNIMOD:1031 0.06 40.0 10 2 0 PRT sp|P00568|KAD1_HUMAN Adenylate kinase isoenzyme 1 OS=Homo sapiens OX=9606 GN=AK1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40.0 null 21-UNIMOD:1031,25-UNIMOD:4,27-UNIMOD:1031,147-UNIMOD:1031 0.18 40.0 8 3 2 PRT sp|P34897-3|GLYM_HUMAN Isoform 3 of Serine hydroxymethyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=SHMT2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40.0 null 160-UNIMOD:1031,259-UNIMOD:1031,453-UNIMOD:1031,248-UNIMOD:1031,193-UNIMOD:267,448-UNIMOD:1031,443-UNIMOD:1031,82-UNIMOD:1031,259-UNIMOD:259 0.19 40.0 9 9 9 PRT sp|P68371|TBB4B_HUMAN Tubulin beta-4B chain OS=Homo sapiens OX=9606 GN=TUBB4B PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 40.0 null 58-UNIMOD:1031,73-UNIMOD:35,77-UNIMOD:267,363-UNIMOD:35 0.11 40.0 7 4 1 PRT sp|Q13418-3|ILK_HUMAN Isoform 3 of Integrin-linked protein kinase OS=Homo sapiens OX=9606 GN=ILK null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40.0 null 203-UNIMOD:35,207-UNIMOD:1031,212-UNIMOD:4,86-UNIMOD:1031,89-UNIMOD:1031 0.09 40.0 14 2 0 PRT sp|Q15046|SYK_HUMAN Lysine--tRNA ligase OS=Homo sapiens OX=9606 GN=KARS1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 40.0 null 493-UNIMOD:1031,496-UNIMOD:4,506-UNIMOD:35,175-UNIMOD:1031,141-UNIMOD:1031,190-UNIMOD:1031,127-UNIMOD:1031,573-UNIMOD:35,574-UNIMOD:1031,17-UNIMOD:1031,305-UNIMOD:1031,249-UNIMOD:1031,20-UNIMOD:1031,36-UNIMOD:1031,88-UNIMOD:259 0.27 40.0 21 13 7 PRT sp|P51858|HDGF_HUMAN Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 40.0 null 80-UNIMOD:1031,33-UNIMOD:35,39-UNIMOD:1031,108-UNIMOD:4,125-UNIMOD:1031,96-UNIMOD:1031,126-UNIMOD:1031,105-UNIMOD:1031,12-UNIMOD:4,19-UNIMOD:1031,148-UNIMOD:1031,11-UNIMOD:1031,151-UNIMOD:1031,12-UNIMOD:385,72-UNIMOD:1031 0.54 40.0 17 12 8 PRT sp|P30048-2|PRDX3_HUMAN Isoform 2 of Thioredoxin-dependent peroxide reductase, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40.0 null 131-UNIMOD:1031 0.13 40.0 2 2 2 PRT sp|Q16658|FSCN1_HUMAN Fascin OS=Homo sapiens OX=9606 GN=FSCN1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40.0 null 43-UNIMOD:1031,61-UNIMOD:4,74-UNIMOD:1031,80-UNIMOD:4,241-UNIMOD:1031,471-UNIMOD:1031,399-UNIMOD:1031,41-UNIMOD:1031,353-UNIMOD:1031,220-UNIMOD:1031 0.21 40.0 9 8 7 PRT sp|Q9P289|STK26_HUMAN Serine/threonine-protein kinase 26 OS=Homo sapiens OX=9606 GN=STK26 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40.0 null 175-UNIMOD:1031,146-UNIMOD:1031,159-UNIMOD:1031,392-UNIMOD:4,399-UNIMOD:35,401-UNIMOD:1031,32-UNIMOD:1031,280-UNIMOD:1031,276-UNIMOD:1031 0.20 40.0 14 6 3 PRT sp|P61088|UBE2N_HUMAN Ubiquitin-conjugating enzyme E2 N OS=Homo sapiens OX=9606 GN=UBE2N PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40.0 null 24-UNIMOD:1031,141-UNIMOD:267,82-UNIMOD:1031,10-UNIMOD:1031 0.34 40.0 5 4 3 PRT sp|Q6NXS1|IPP2B_HUMAN Protein phosphatase inhibitor 2 family member B OS=Homo sapiens OX=9606 GN=PPP1R2B PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 40.0 null 18-UNIMOD:1031,103-UNIMOD:1031,145-UNIMOD:1031,155-UNIMOD:1031 0.22 40.0 8 5 2 PRT sp|Q99613-2|EIF3C_HUMAN Isoform 2 of Eukaryotic translation initiation factor 3 subunit C OS=Homo sapiens OX=9606 GN=EIF3C null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40.0 null 617-UNIMOD:1031,310-UNIMOD:1031,633-UNIMOD:1031,190-UNIMOD:1031,321-UNIMOD:1031,322-UNIMOD:1031,126-UNIMOD:1031,742-UNIMOD:4,750-UNIMOD:259,884-UNIMOD:1031,889-UNIMOD:35 0.11 40.0 9 9 7 PRT sp|P62424|RL7A_HUMAN 60S ribosomal protein L7a OS=Homo sapiens OX=9606 GN=RPL7A PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 40.0 null 199-UNIMOD:4,212-UNIMOD:1031,197-UNIMOD:1031,75-UNIMOD:1031,97-UNIMOD:1031,212-UNIMOD:259,90-UNIMOD:28,176-UNIMOD:1031,182-UNIMOD:4,11-UNIMOD:1031,125-UNIMOD:1031,197-UNIMOD:259,217-UNIMOD:259,245-UNIMOD:1031,150-UNIMOD:1031,259-UNIMOD:1031,48-UNIMOD:1031 0.51 40.0 18 13 10 PRT sp|O60282|KIF5C_HUMAN Kinesin heavy chain isoform 5C OS=Homo sapiens OX=9606 GN=KIF5C PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40.0 null 253-UNIMOD:1031,241-UNIMOD:1031,238-UNIMOD:1031,198-UNIMOD:35 0.05 40.0 8 5 3 PRT sp|P48643|TCPE_HUMAN T-complex protein 1 subunit epsilon OS=Homo sapiens OX=9606 GN=CCT5 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 40.0 null 59-UNIMOD:1031,60-UNIMOD:35,493-UNIMOD:4,496-UNIMOD:1031,170-UNIMOD:1031,61-UNIMOD:35,265-UNIMOD:1031,176-UNIMOD:1031,181-UNIMOD:4,232-UNIMOD:1031,284-UNIMOD:1031,253-UNIMOD:4,259-UNIMOD:1031,226-UNIMOD:1031,501-UNIMOD:35,223-UNIMOD:1031,59-UNIMOD:259,265-UNIMOD:259,275-UNIMOD:259,526-UNIMOD:35,529-UNIMOD:1031,170-UNIMOD:259,176-UNIMOD:259,239-UNIMOD:35,279-UNIMOD:1031,42-UNIMOD:259,393-UNIMOD:35,399-UNIMOD:1031 0.31 40.0 30 16 9 PRT sp|P23284|PPIB_HUMAN Peptidyl-prolyl cis-trans isomerase B OS=Homo sapiens OX=9606 GN=PPIB PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 40.0 null 84-UNIMOD:1031,145-UNIMOD:259,98-UNIMOD:1031,71-UNIMOD:1031,67-UNIMOD:1031,131-UNIMOD:1031,140-UNIMOD:35,84-UNIMOD:259,129-UNIMOD:1031,41-UNIMOD:1031,202-UNIMOD:4 0.41 40.0 17 10 5 PRT sp|P48426-2|PI42A_HUMAN Isoform 2 of Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha OS=Homo sapiens OX=9606 GN=PIP4K2A null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40.0 null 319-UNIMOD:1031,175-UNIMOD:1031,86-UNIMOD:1031,32-UNIMOD:1031,35-UNIMOD:4,316-UNIMOD:1031,169-UNIMOD:1031 0.22 40.0 7 6 5 PRT sp|P78371|TCPB_HUMAN T-complex protein 1 subunit beta OS=Homo sapiens OX=9606 GN=CCT2 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 40.0 null 412-UNIMOD:4,170-UNIMOD:1031,431-UNIMOD:1031,191-UNIMOD:1031,154-UNIMOD:1031,263-UNIMOD:1031,248-UNIMOD:1031,223-UNIMOD:1031,395-UNIMOD:4,402-UNIMOD:1031,272-UNIMOD:1031,50-UNIMOD:1031,244-UNIMOD:35,522-UNIMOD:1031,48-UNIMOD:35,72-UNIMOD:1031,120-UNIMOD:1031,176-UNIMOD:1031,250-UNIMOD:1031,274-UNIMOD:1031 0.45 40.0 25 17 13 PRT sp|O75027-3|ABCB7_HUMAN Isoform 3 of ATP-binding cassette sub-family B member 7, mitochondrial OS=Homo sapiens OX=9606 GN=ABCB7 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40.0 null 471-UNIMOD:1031 0.02 40.0 1 1 1 PRT sp|P42338|PK3CB_HUMAN Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform OS=Homo sapiens OX=9606 GN=PIK3CB PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40.0 null 805-UNIMOD:1031 0.02 40.0 2 1 0 PRT sp|P21333-2|FLNA_HUMAN Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40.0 null 1071-UNIMOD:1031,1593-UNIMOD:1031,2397-UNIMOD:1031,771-UNIMOD:1031,574-UNIMOD:4,578-UNIMOD:1031,2555-UNIMOD:1031,1003-UNIMOD:1031,691-UNIMOD:1031,865-UNIMOD:1031,338-UNIMOD:1031,773-UNIMOD:1031,2133-UNIMOD:1031 0.06 40.0 12 11 8 PRT sp|P22314|UBA1_HUMAN Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 40.0 null 802-UNIMOD:1031,58-UNIMOD:28,68-UNIMOD:1031,528-UNIMOD:1031,296-UNIMOD:1031,368-UNIMOD:267,851-UNIMOD:1031,859-UNIMOD:35,884-UNIMOD:1031,830-UNIMOD:1031 0.12 40.0 8 8 3 PRT sp|P49458|SRP09_HUMAN Signal recognition particle 9 kDa protein OS=Homo sapiens OX=9606 GN=SRP9 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 40.0 null 39-UNIMOD:4,41-UNIMOD:1031,48-UNIMOD:4,52-UNIMOD:1031,60-UNIMOD:1031 0.35 40.0 4 3 2 PRT sp|P54136|SYRC_HUMAN Arginine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=RARS1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 40.0 null 205-UNIMOD:1031,207-UNIMOD:35 0.03 40.0 1 1 0 PRT sp|P40261|NNMT_HUMAN Nicotinamide N-methyltransferase OS=Homo sapiens OX=9606 GN=NNMT PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ] 40.0 null 1-UNIMOD:1,8-UNIMOD:1031,39-UNIMOD:1031,39-UNIMOD:259 0.13 40.0 3 3 3 PRT sp|Q9NRH2|SNRK_HUMAN SNF-related serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=SNRK PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 40.0 null 51-UNIMOD:1031 0.02 40.0 1 1 1 PRT sp|P62917|RL8_HUMAN 60S ribosomal protein L8 OS=Homo sapiens OX=9606 GN=RPL8 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 39.0 null 144-UNIMOD:1031,46-UNIMOD:1031,60-UNIMOD:1031,144-UNIMOD:259,42-UNIMOD:1031,234-UNIMOD:1031,250-UNIMOD:1031,10-UNIMOD:1031,149-UNIMOD:1031,177-UNIMOD:1031,155-UNIMOD:1031,204-UNIMOD:35,221-UNIMOD:1031 0.50 39.0 18 12 6 PRT sp|P50454|SERPH_HUMAN Serpin H1 OS=Homo sapiens OX=9606 GN=SERPINH1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 39.0 null 308-UNIMOD:1031,151-UNIMOD:1031,156-UNIMOD:4,252-UNIMOD:1031,39-UNIMOD:1031,300-UNIMOD:1031,250-UNIMOD:259,94-UNIMOD:1031,160-UNIMOD:1031,258-UNIMOD:35,217-UNIMOD:1031,218-UNIMOD:35,287-UNIMOD:1031,334-UNIMOD:1031 0.29 39.0 15 11 9 PRT sp|Q32P28-4|P3H1_HUMAN Isoform 4 of Prolyl 3-hydroxylase 1 OS=Homo sapiens OX=9606 GN=P3H1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39.0 null 662-UNIMOD:1031 0.03 39.0 1 1 1 PRT sp|P27144|KAD4_HUMAN Adenylate kinase 4, mitochondrial OS=Homo sapiens OX=9606 GN=AK4 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39.0 null 18-UNIMOD:1031,22-UNIMOD:4 0.08 39.0 2 1 0 PRT sp|Q13523|PRP4B_HUMAN Serine/threonine-protein kinase PRP4 homolog OS=Homo sapiens OX=9606 GN=PRPF4B PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ] 39.0 null 809-UNIMOD:4,817-UNIMOD:1031,809-UNIMOD:385,727-UNIMOD:1031,725-UNIMOD:35,656-UNIMOD:1031,659-UNIMOD:1031,593-UNIMOD:1031 0.06 39.0 7 5 3 PRT sp|P30040|ERP29_HUMAN Endoplasmic reticulum resident protein 29 OS=Homo sapiens OX=9606 GN=ERP29 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 39.0 null 137-UNIMOD:1031,192-UNIMOD:1031,254-UNIMOD:1031,107-UNIMOD:1031,54-UNIMOD:1031,238-UNIMOD:1031 0.28 39.0 6 6 6 PRT sp|Q9Y3A5|SBDS_HUMAN Ribosome maturation protein SBDS OS=Homo sapiens OX=9606 GN=SBDS PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 39.0 null 118-UNIMOD:1031,119-UNIMOD:4,151-UNIMOD:1031,138-UNIMOD:1031,137-UNIMOD:35,145-UNIMOD:1031,159-UNIMOD:1031,98-UNIMOD:1031,184-UNIMOD:1031,152-UNIMOD:28 0.27 39.0 9 7 5 PRT sp|Q8IVH8-3|M4K3_HUMAN Isoform 3 of Mitogen-activated protein kinase kinase kinase kinase 3 OS=Homo sapiens OX=9606 GN=MAP4K3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39.0 null 138-UNIMOD:1031,45-UNIMOD:1031 0.04 39.0 4 2 0 PRT sp|Q9UP95-5|S12A4_HUMAN Isoform 5 of Solute carrier family 12 member 4 OS=Homo sapiens OX=9606 GN=SLC12A4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39.0 null 957-UNIMOD:1031,959-UNIMOD:35,676-UNIMOD:1031,979-UNIMOD:1031,66-UNIMOD:1031 0.07 39.0 8 4 1 PRT sp|O00148|DX39A_HUMAN ATP-dependent RNA helicase DDX39A OS=Homo sapiens OX=9606 GN=DDX39A PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39.0 null 383-UNIMOD:1031,190-UNIMOD:1031,197-UNIMOD:4,333-UNIMOD:1031,199-UNIMOD:259,187-UNIMOD:1031 0.11 39.0 5 5 5 PRT sp|Q86WA8-2|LONP2_HUMAN Isoform 2 of Lon protease homolog 2, peroxisomal OS=Homo sapiens OX=9606 GN=LONP2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39.0 null 328-UNIMOD:4,337-UNIMOD:1031 0.02 39.0 2 1 0 PRT sp|P78362|SRPK2_HUMAN SRSF protein kinase 2 OS=Homo sapiens OX=9606 GN=SRPK2 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39.0 null 216-UNIMOD:1031,223-UNIMOD:4,222-UNIMOD:35 0.03 39.0 3 1 0 PRT sp|Q9BTT0|AN32E_HUMAN Acidic leucine-rich nuclear phosphoprotein 32 family member E OS=Homo sapiens OX=9606 GN=ANP32E PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39.0 null 101-UNIMOD:1031,113-UNIMOD:1031,87-UNIMOD:4,99-UNIMOD:1031,65-UNIMOD:1031,6-UNIMOD:1031 0.18 39.0 5 5 5 PRT sp|O15347|HMGB3_HUMAN High mobility group protein B3 OS=Homo sapiens OX=9606 GN=HMGB3 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 39.0 null 112-UNIMOD:1031,30-UNIMOD:1031,125-UNIMOD:1031,82-UNIMOD:1031,165-UNIMOD:1031,174-UNIMOD:1031 0.28 39.0 7 6 5 PRT sp|Q58A45-2|PAN3_HUMAN Isoform 2 of PAN2-PAN3 deadenylation complex subunit PAN3 OS=Homo sapiens OX=9606 GN=PAN3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39.0 null 184-UNIMOD:1031,194-UNIMOD:4,329-UNIMOD:35,333-UNIMOD:1031 0.05 39.0 5 2 0 PRT sp|Q9UBS4|DJB11_HUMAN DnaJ homolog subfamily B member 11 OS=Homo sapiens OX=9606 GN=DNAJB11 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 39.0 null 302-UNIMOD:1031,28-UNIMOD:1031,39-UNIMOD:1031,247-UNIMOD:1031 0.15 39.0 6 5 4 PRT sp|P30044|PRDX5_HUMAN Peroxiredoxin-5, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX5 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 39.0 null 86-UNIMOD:1031,100-UNIMOD:4,116-UNIMOD:259,83-UNIMOD:1031,142-UNIMOD:1031 0.32 39.0 10 7 5 PRT sp|P09429|HMGB1_HUMAN High mobility group protein B1 OS=Homo sapiens OX=9606 GN=HMGB1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 39.0 null 30-UNIMOD:1031,128-UNIMOD:1031,132-UNIMOD:35,114-UNIMOD:1031,43-UNIMOD:1031,127-UNIMOD:1031,157-UNIMOD:1031,63-UNIMOD:35,65-UNIMOD:1031,59-UNIMOD:1031,90-UNIMOD:1031,12-UNIMOD:1031,23-UNIMOD:4,177-UNIMOD:1031,167-UNIMOD:1031,52-UNIMOD:35,55-UNIMOD:1031 0.53 39.0 26 13 6 PRT sp|P26583|HMGB2_HUMAN High mobility group protein B2 OS=Homo sapiens OX=9606 GN=HMGB2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39.0 null 30-UNIMOD:1031,114-UNIMOD:1031,128-UNIMOD:1031,132-UNIMOD:35,127-UNIMOD:1031 0.21 39.0 5 4 3 PRT sp|P06493|CDK1_HUMAN Cyclin-dependent kinase 1 OS=Homo sapiens OX=9606 GN=CDK1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 39.0 null 201-UNIMOD:1031,9-UNIMOD:1031,20-UNIMOD:1031,130-UNIMOD:1031,24-UNIMOD:1031,33-UNIMOD:1031,130-UNIMOD:259,139-UNIMOD:259,143-UNIMOD:1031,279-UNIMOD:1031,32-UNIMOD:35,34-UNIMOD:1031 0.31 39.0 20 9 6 PRT sp|P54886-2|P5CS_HUMAN Isoform Short of Delta-1-pyrroline-5-carboxylate synthase OS=Homo sapiens OX=9606 GN=ALDH18A1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39.0 null 298-UNIMOD:1031,430-UNIMOD:1031,641-UNIMOD:1031,309-UNIMOD:1031,345-UNIMOD:1031,407-UNIMOD:1031,567-UNIMOD:1031,422-UNIMOD:1031,68-UNIMOD:1031 0.14 39.0 11 9 5 PRT sp|P11413|G6PD_HUMAN Glucose-6-phosphate 1-dehydrogenase OS=Homo sapiens OX=9606 GN=G6PD PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 39.0 null 385-UNIMOD:4,386-UNIMOD:1031,403-UNIMOD:1031,404-UNIMOD:35,497-UNIMOD:1031,408-UNIMOD:1031,89-UNIMOD:1031,496-UNIMOD:35,405-UNIMOD:35,432-UNIMOD:1031,171-UNIMOD:1031 0.19 39.0 16 7 4 PRT sp|Q92597-3|NDRG1_HUMAN Isoform 3 of Protein NDRG1 OS=Homo sapiens OX=9606 GN=NDRG1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39.0 null 208-UNIMOD:4,219-UNIMOD:1031,199-UNIMOD:1031 0.10 39.0 2 2 2 PRT sp|Q12797|ASPH_HUMAN Aspartyl/asparaginyl beta-hydroxylase OS=Homo sapiens OX=9606 GN=ASPH PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 39.0 null 8-UNIMOD:1031,42-UNIMOD:1031,37-UNIMOD:1031,356-UNIMOD:1031,110-UNIMOD:1031 0.08 39.0 5 5 5 PRT sp|Q8N1F7|NUP93_HUMAN Nuclear pore complex protein Nup93 OS=Homo sapiens OX=9606 GN=NUP93 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39.0 null 106-UNIMOD:1031 0.02 39.0 2 1 0 PRT sp|P05165-3|PCCA_HUMAN Isoform 3 of Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Homo sapiens OX=9606 GN=PCCA null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39.0 null 298-UNIMOD:1031,219-UNIMOD:1031 0.05 39.0 2 2 1 PRT sp|P09234|RU1C_HUMAN U1 small nuclear ribonucleoprotein C OS=Homo sapiens OX=9606 GN=SNRPC PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39.0 null 3-UNIMOD:1031,6-UNIMOD:4,9-UNIMOD:4 0.13 39.0 1 1 1 PRT sp|Q15691|MARE1_HUMAN Microtubule-associated protein RP/EB family member 1 OS=Homo sapiens OX=9606 GN=MAPRE1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39.0 null 148-UNIMOD:1031,174-UNIMOD:1031,150-UNIMOD:1031,83-UNIMOD:1031 0.16 39.0 4 3 2 PRT sp|P49591|SYSC_HUMAN Serine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=SARS1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 39.0 null 266-UNIMOD:1031,12-UNIMOD:1031,28-UNIMOD:1031,60-UNIMOD:4,62-UNIMOD:1031,486-UNIMOD:1031,492-UNIMOD:1031 0.14 39.0 6 6 6 PRT sp|Q9HB71|CYBP_HUMAN Calcyclin-binding protein OS=Homo sapiens OX=9606 GN=CACYBP PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 39.0 null 134-UNIMOD:1031,85-UNIMOD:1031,59-UNIMOD:1031,178-UNIMOD:1031,118-UNIMOD:1031,146-UNIMOD:1031,154-UNIMOD:4,171-UNIMOD:1031,173-UNIMOD:4,2-UNIMOD:1,8-UNIMOD:1031,14-UNIMOD:1031,155-UNIMOD:267,212-UNIMOD:1031,44-UNIMOD:35,47-UNIMOD:1031,41-UNIMOD:1031,118-UNIMOD:259 0.72 39.0 20 15 10 PRT sp|Q9Y606-2|TRUA_HUMAN Isoform 2 of tRNA pseudouridine synthase A OS=Homo sapiens OX=9606 GN=PUS1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39.0 null 119-UNIMOD:1031,299-UNIMOD:1031,165-UNIMOD:1031 0.11 39.0 4 3 2 PRT sp|P62888|RL30_HUMAN 60S ribosomal protein L30 OS=Homo sapiens OX=9606 GN=RPL30 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 39.0 null 85-UNIMOD:4,87-UNIMOD:259,32-UNIMOD:1031,57-UNIMOD:1031,65-UNIMOD:35,26-UNIMOD:1031 0.40 39.0 6 4 3 PRT sp|Q15181|IPYR_HUMAN Inorganic pyrophosphatase OS=Homo sapiens OX=9606 GN=PPA1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 39.0 null 238-UNIMOD:1031,242-UNIMOD:4,228-UNIMOD:1031,70-UNIMOD:1031,243-UNIMOD:35,58-UNIMOD:35,63-UNIMOD:1031,253-UNIMOD:259,113-UNIMOD:4,114-UNIMOD:4,123-UNIMOD:4,128-UNIMOD:259 0.28 39.0 10 7 5 PRT sp|P55884|EIF3B_HUMAN Eukaryotic translation initiation factor 3 subunit B OS=Homo sapiens OX=9606 GN=EIF3B PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 39.0 null 535-UNIMOD:1031,230-UNIMOD:1031,209-UNIMOD:1031,741-UNIMOD:1031,729-UNIMOD:1031,552-UNIMOD:1031,204-UNIMOD:1031,693-UNIMOD:1031,213-UNIMOD:1031 0.10 39.0 12 9 6 PRT sp|P00558|PGK1_HUMAN Phosphoglycerate kinase 1 OS=Homo sapiens OX=9606 GN=PGK1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 39.0 null 30-UNIMOD:1031,97-UNIMOD:1031,99-UNIMOD:4,216-UNIMOD:1031,48-UNIMOD:1031,50-UNIMOD:4,220-UNIMOD:1031,227-UNIMOD:35,91-UNIMOD:1031,29-UNIMOD:35,353-UNIMOD:1031,361-UNIMOD:1031,131-UNIMOD:1031,251-UNIMOD:35,264-UNIMOD:1031,41-UNIMOD:1031,2-UNIMOD:1,6-UNIMOD:1031,146-UNIMOD:1031,191-UNIMOD:1031,267-UNIMOD:1031,192-UNIMOD:1031,190-UNIMOD:35,131-UNIMOD:259,272-UNIMOD:1031,141-UNIMOD:1031,270-UNIMOD:35,275-UNIMOD:1031,39-UNIMOD:267,139-UNIMOD:259,141-UNIMOD:259,56-UNIMOD:259,133-UNIMOD:1031 0.46 39.0 36 25 16 PRT sp|P22059|OSBP1_HUMAN Oxysterol-binding protein 1 OS=Homo sapiens OX=9606 GN=OSBP PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39.0 null 224-UNIMOD:4,230-UNIMOD:1031 0.03 39.0 1 1 1 PRT sp|P55327-2|TPD52_HUMAN Isoform 2 of Tumor protein D52 OS=Homo sapiens OX=9606 GN=TPD52 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39.0 null 60-UNIMOD:1031,98-UNIMOD:1031,124-UNIMOD:1031,109-UNIMOD:259,135-UNIMOD:1031 0.32 39.0 7 5 3 PRT sp|Q15084-5|PDIA6_HUMAN Isoform 5 of Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39.0 null 133-UNIMOD:1031,264-UNIMOD:1031,256-UNIMOD:1031,121-UNIMOD:1031,115-UNIMOD:1031,415-UNIMOD:35,416-UNIMOD:1031 0.20 39.0 8 7 4 PRT sp|P62081|RS7_HUMAN 40S ribosomal protein S7 OS=Homo sapiens OX=9606 GN=RPS7 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 39.0 null 160-UNIMOD:1031,169-UNIMOD:1031,90-UNIMOD:1031,98-UNIMOD:267,155-UNIMOD:1031,74-UNIMOD:1031,178-UNIMOD:1031,70-UNIMOD:259,147-UNIMOD:1031 0.47 39.0 16 10 7 PRT sp|Q9BUT1-2|BDH2_HUMAN Isoform 2 of 3-hydroxybutyrate dehydrogenase type 2 OS=Homo sapiens OX=9606 GN=BDH2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39.0 null 42-UNIMOD:1031 0.10 39.0 1 1 1 PRT sp|P06576|ATPB_HUMAN ATP synthase subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1B PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 39.0 null 133-UNIMOD:1031,259-UNIMOD:1031,201-UNIMOD:1031,124-UNIMOD:1031,198-UNIMOD:1031,522-UNIMOD:1031,426-UNIMOD:1031,485-UNIMOD:1031,113-UNIMOD:35,121-UNIMOD:267 0.22 39.0 11 9 8 PRT sp|Q9UBF8-3|PI4KB_HUMAN Isoform 3 of Phosphatidylinositol 4-kinase beta OS=Homo sapiens OX=9606 GN=PI4KB null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39.0 null 60-UNIMOD:1031,62-UNIMOD:1031 0.03 39.0 7 1 0 PRT sp|O43491-2|E41L2_HUMAN Isoform 2 of Band 4.1-like protein 2 OS=Homo sapiens OX=9606 GN=EPB41L2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39.0 null 232-UNIMOD:4,236-UNIMOD:1031,507-UNIMOD:1031,374-UNIMOD:1031,277-UNIMOD:1031,216-UNIMOD:1031,220-UNIMOD:4,206-UNIMOD:1031,210-UNIMOD:1031 0.10 39.0 7 7 6 PRT sp|P0DMV8|HS71A_HUMAN Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 39.0 null 56-UNIMOD:1031,87-UNIMOD:35,88-UNIMOD:259,342-UNIMOD:267,71-UNIMOD:1031,319-UNIMOD:1031,518-UNIMOD:35,524-UNIMOD:1031,100-UNIMOD:259,102-UNIMOD:259,126-UNIMOD:259,56-UNIMOD:259,71-UNIMOD:259,497-UNIMOD:259,500-UNIMOD:259,559-UNIMOD:259,187-UNIMOD:267,328-UNIMOD:1031 0.22 39.0 27 12 2 PRT sp|P02545|LMNA_HUMAN Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 39.0 null 311-UNIMOD:1031,450-UNIMOD:1031,644-UNIMOD:267,417-UNIMOD:259,155-UNIMOD:259,341-UNIMOD:1031,386-UNIMOD:267 0.16 39.0 8 8 5 PRT sp|P27816|MAP4_HUMAN Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 39.0 null 986-UNIMOD:1031,1070-UNIMOD:1031,938-UNIMOD:1031,726-UNIMOD:1031,998-UNIMOD:1031,718-UNIMOD:1031,1038-UNIMOD:1031,1039-UNIMOD:4 0.08 39.0 8 7 2 PRT sp|Q15056|IF4H_HUMAN Eukaryotic translation initiation factor 4H OS=Homo sapiens OX=9606 GN=EIF4H PE=1 SV=5 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 39.0 null 82-UNIMOD:1031,85-UNIMOD:4,109-UNIMOD:267 0.12 39.0 2 2 0 PRT sp|P60660|MYL6_HUMAN Myosin light polypeptide 6 OS=Homo sapiens OX=9606 GN=MYL6 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 39.0 null 98-UNIMOD:1031,105-UNIMOD:35,119-UNIMOD:259,56-UNIMOD:1031,60-UNIMOD:35 0.26 39.0 3 3 3 PRT sp|Q13418|ILK_HUMAN Integrin-linked protein kinase OS=Homo sapiens OX=9606 GN=ILK PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 39.0 null 337-UNIMOD:35,341-UNIMOD:1031,346-UNIMOD:4 0.04 39.0 15 1 0 PRT sp|Q14157|UBP2L_HUMAN Ubiquitin-associated protein 2-like OS=Homo sapiens OX=9606 GN=UBAP2L PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 39.0 null 353-UNIMOD:1031,420-UNIMOD:1031 0.04 39.0 2 2 1 PRT sp|P16591|FER_HUMAN Tyrosine-protein kinase Fer OS=Homo sapiens OX=9606 GN=FER PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 39.0 null 708-UNIMOD:28,720-UNIMOD:1031,591-UNIMOD:1031,593-UNIMOD:4 0.04 39.0 3 2 0 PRT sp|Q86WA8|LONP2_HUMAN Lon protease homolog 2, peroxisomal OS=Homo sapiens OX=9606 GN=LONP2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 39.0 null 372-UNIMOD:4,381-UNIMOD:1031 0.02 39.0 1 1 0 PRT sp|Q12846|STX4_HUMAN Syntaxin-4 OS=Homo sapiens OX=9606 GN=STX4 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 39.0 null 124-UNIMOD:1031 0.06 39.0 1 1 1 PRT sp|P31689|DNJA1_HUMAN DnaJ homolog subfamily A member 1 OS=Homo sapiens OX=9606 GN=DNAJA1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 39.0 null 46-UNIMOD:1031,66-UNIMOD:1031,214-UNIMOD:1031 0.10 39.0 3 3 3 PRT sp|O14980|XPO1_HUMAN Exportin-1 OS=Homo sapiens OX=9606 GN=XPO1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 38.0 null 699-UNIMOD:4,700-UNIMOD:1031,192-UNIMOD:1031,119-UNIMOD:4,122-UNIMOD:1031,563-UNIMOD:1031,680-UNIMOD:1031,99-UNIMOD:4,103-UNIMOD:1031 0.08 38.0 6 6 6 PRT sp|P52565|GDIR1_HUMAN Rho GDP-dissociation inhibitor 1 OS=Homo sapiens OX=9606 GN=ARHGDIA PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 38.0 null 167-UNIMOD:1031,141-UNIMOD:1031,52-UNIMOD:1031 0.22 38.0 4 4 4 PRT sp|P08237-2|PFKAM_HUMAN Isoform 2 of ATP-dependent 6-phosphofructokinase, muscle type OS=Homo sapiens OX=9606 GN=PFKM null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38.0 null 696-UNIMOD:1031,144-UNIMOD:1031,586-UNIMOD:1031,526-UNIMOD:1031 0.08 38.0 4 4 4 PRT sp|O75369-7|FLNB_HUMAN Isoform 7 of Filamin-B OS=Homo sapiens OX=9606 GN=FLNB null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38.0 null 512-UNIMOD:1031,669-UNIMOD:1031,680-UNIMOD:1031,2334-UNIMOD:1031,1176-UNIMOD:1031,326-UNIMOD:1031 0.04 38.0 7 7 5 PRT sp|P41250|GARS_HUMAN Glycine--tRNA ligase OS=Homo sapiens OX=9606 GN=GARS1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 38.0 null 93-UNIMOD:1031,197-UNIMOD:1031,202-UNIMOD:35,501-UNIMOD:1031,108-UNIMOD:1031,733-UNIMOD:1031,219-UNIMOD:1031,615-UNIMOD:259,115-UNIMOD:1031,466-UNIMOD:4,471-UNIMOD:4,474-UNIMOD:267,99-UNIMOD:1031,204-UNIMOD:1031,506-UNIMOD:1031 0.17 38.0 53 13 9 PRT sp|Q9HA64|KT3K_HUMAN Ketosamine-3-kinase OS=Homo sapiens OX=9606 GN=FN3KRP PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 38.0 null 24-UNIMOD:4,29-UNIMOD:267,41-UNIMOD:1031,45-UNIMOD:1031 0.09 38.0 4 3 2 PRT sp|Q9BWU1-2|CDK19_HUMAN Isoform 2 of Cyclin-dependent kinase 19 OS=Homo sapiens OX=9606 GN=CDK19 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38.0 null 93-UNIMOD:1031,100-UNIMOD:35 0.04 38.0 5 1 0 PRT sp|O75460|ERN1_HUMAN Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Homo sapiens OX=9606 GN=ERN1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38.0 null 690-UNIMOD:1031,704-UNIMOD:1031 0.02 38.0 2 1 0 PRT sp|Q8NBJ5|GT251_HUMAN Procollagen galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=COLGALT1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38.0 null 605-UNIMOD:1031 0.04 38.0 2 2 2 PRT sp|P33992|MCM5_HUMAN DNA replication licensing factor MCM5 OS=Homo sapiens OX=9606 GN=MCM5 PE=1 SV=5 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 38.0 null 696-UNIMOD:1031,396-UNIMOD:1031,397-UNIMOD:4,581-UNIMOD:1031,392-UNIMOD:1031 0.07 38.0 4 4 4 PRT sp|P38159|RBMX_HUMAN RNA-binding motif protein, X chromosome OS=Homo sapiens OX=9606 GN=RBMX PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38.0 null 63-UNIMOD:1031,86-UNIMOD:1031,80-UNIMOD:1031 0.09 38.0 3 3 3 PRT sp|Q99832|TCPH_HUMAN T-complex protein 1 subunit eta OS=Homo sapiens OX=9606 GN=CCT7 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 38.0 null 55-UNIMOD:1031,157-UNIMOD:1031,158-UNIMOD:4,217-UNIMOD:1031,287-UNIMOD:1031,77-UNIMOD:1031,364-UNIMOD:4,366-UNIMOD:1031,280-UNIMOD:1031,430-UNIMOD:1031,135-UNIMOD:1031,227-UNIMOD:35,158-UNIMOD:385,166-UNIMOD:1031,45-UNIMOD:35,47-UNIMOD:1031,320-UNIMOD:1031,135-UNIMOD:259,67-UNIMOD:1031,148-UNIMOD:1031,382-UNIMOD:35 0.33 38.0 23 17 12 PRT sp|P26640|SYVC_HUMAN Valine--tRNA ligase OS=Homo sapiens OX=9606 GN=VARS1 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38.0 null 966-UNIMOD:1031,1242-UNIMOD:1031,433-UNIMOD:1031 0.05 38.0 3 3 3 PRT sp|Q96RQ3|MCCA_HUMAN Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=MCCC1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 38.0 null 284-UNIMOD:1031,203-UNIMOD:35,205-UNIMOD:1031,284-UNIMOD:259,295-UNIMOD:259 0.04 38.0 5 2 1 PRT sp|Q9UQ80|PA2G4_HUMAN Proliferation-associated protein 2G4 OS=Homo sapiens OX=9606 GN=PA2G4 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 38.0 null 72-UNIMOD:1031,85-UNIMOD:4,87-UNIMOD:4,49-UNIMOD:4,199-UNIMOD:1031,296-UNIMOD:4,298-UNIMOD:1031,210-UNIMOD:1031,22-UNIMOD:1031,253-UNIMOD:1031,347-UNIMOD:35,355-UNIMOD:259,210-UNIMOD:259,238-UNIMOD:1031,139-UNIMOD:1031 0.34 38.0 13 11 9 PRT sp|P50750|CDK9_HUMAN Cyclin-dependent kinase 9 OS=Homo sapiens OX=9606 GN=CDK9 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 38.0 null 345-UNIMOD:1031,150-UNIMOD:35,151-UNIMOD:1031 0.07 38.0 4 2 0 PRT sp|P18124|RL7_HUMAN 60S ribosomal protein L7 OS=Homo sapiens OX=9606 GN=RPL7 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 38.0 null 223-UNIMOD:1031,177-UNIMOD:267,236-UNIMOD:267,104-UNIMOD:1031,156-UNIMOD:1031,59-UNIMOD:1031,40-UNIMOD:1031,107-UNIMOD:1031,29-UNIMOD:1031,161-UNIMOD:1031 0.38 38.0 17 11 7 PRT sp|Q9Y266|NUDC_HUMAN Nuclear migration protein nudC OS=Homo sapiens OX=9606 GN=NUDC PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 38.0 null 68-UNIMOD:1031,105-UNIMOD:1031,212-UNIMOD:1031,160-UNIMOD:1031,123-UNIMOD:1031,39-UNIMOD:1031,50-UNIMOD:35,297-UNIMOD:1031,96-UNIMOD:1031,196-UNIMOD:1031,198-UNIMOD:35,267-UNIMOD:1031,299-UNIMOD:35,308-UNIMOD:1031,268-UNIMOD:1031,122-UNIMOD:1031 0.47 38.0 18 15 12 PRT sp|P00492|HPRT_HUMAN Hypoxanthine-guanine phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=HPRT1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38.0 null 103-UNIMOD:1031,106-UNIMOD:4,159-UNIMOD:1031,156-UNIMOD:1031,166-UNIMOD:1031 0.15 38.0 4 4 4 PRT sp|Q9NTJ3|SMC4_HUMAN Structural maintenance of chromosomes protein 4 OS=Homo sapiens OX=9606 GN=SMC4 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 38.0 null 83-UNIMOD:35,93-UNIMOD:1031,1009-UNIMOD:1031,1033-UNIMOD:1031,968-UNIMOD:1031 0.06 38.0 6 5 4 PRT sp|P15121|ALDR_HUMAN Aldo-keto reductase family 1 member B1 OS=Homo sapiens OX=9606 GN=AKR1B1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 38.0 null 22-UNIMOD:1031,263-UNIMOD:1031,235-UNIMOD:1031,251-UNIMOD:267 0.17 38.0 6 4 3 PRT sp|P48444-2|COPD_HUMAN Isoform 2 of Coatomer subunit delta OS=Homo sapiens OX=9606 GN=ARCN1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38.0 null 263-UNIMOD:1031 0.07 38.0 2 2 2 PRT sp|P14866-2|HNRPL_HUMAN Isoform 2 of Heterogeneous nuclear ribonucleoprotein L OS=Homo sapiens OX=9606 GN=HNRNPL null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38.0 null 285-UNIMOD:1031,360-UNIMOD:1031 0.07 38.0 2 2 1 PRT sp|P07814|SYEP_HUMAN Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 38.0 null 951-UNIMOD:1031,902-UNIMOD:1031,907-UNIMOD:1031,300-UNIMOD:1031,513-UNIMOD:1031,328-UNIMOD:1031,336-UNIMOD:4,337-UNIMOD:4,435-UNIMOD:1031,186-UNIMOD:1031,788-UNIMOD:1031,282-UNIMOD:1031,1143-UNIMOD:1031,1148-UNIMOD:4,666-UNIMOD:1031,1361-UNIMOD:1031,1009-UNIMOD:259,697-UNIMOD:4,708-UNIMOD:1031,359-UNIMOD:4,360-UNIMOD:1031,1503-UNIMOD:1031,1119-UNIMOD:267,1126-UNIMOD:35,1132-UNIMOD:259,647-UNIMOD:1031,716-UNIMOD:1031,498-UNIMOD:1031,173-UNIMOD:1031,181-UNIMOD:1031,720-UNIMOD:1031 0.21 38.0 29 25 21 PRT sp|Q92879-5|CELF1_HUMAN Isoform 5 of CUGBP Elav-like family member 1 OS=Homo sapiens OX=9606 GN=CELF1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38.0 null 42-UNIMOD:1031,44-UNIMOD:4,45-UNIMOD:4 0.04 38.0 1 1 1 PRT sp|Q8NG68|TTL_HUMAN Tubulin--tyrosine ligase OS=Homo sapiens OX=9606 GN=TTL PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 38.0 null 238-UNIMOD:4,244-UNIMOD:4,247-UNIMOD:1031,150-UNIMOD:1031 0.09 38.0 3 2 1 PRT sp|P49748-2|ACADV_HUMAN Isoform 2 of Very long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADVL null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38.0 null 254-UNIMOD:1031,460-UNIMOD:1031,254-UNIMOD:259,256-UNIMOD:1031 0.06 38.0 5 4 3 PRT sp|Q16186|ADRM1_HUMAN Proteasomal ubiquitin receptor ADRM1 OS=Homo sapiens OX=9606 GN=ADRM1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38.0 null 80-UNIMOD:4,83-UNIMOD:1031,21-UNIMOD:1031,97-UNIMOD:1031 0.14 38.0 5 4 3 PRT sp|Q14247|SRC8_HUMAN Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 38.0 null 57-UNIMOD:1031,161-UNIMOD:1031,144-UNIMOD:1031,272-UNIMOD:1031,295-UNIMOD:1031,79-UNIMOD:1031,110-UNIMOD:1031,112-UNIMOD:4,181-UNIMOD:1031,124-UNIMOD:1031,129-UNIMOD:35,346-UNIMOD:1031,304-UNIMOD:1031,87-UNIMOD:1031,263-UNIMOD:1031,309-UNIMOD:1031,57-UNIMOD:259,97-UNIMOD:1031,193-UNIMOD:1031,230-UNIMOD:1031,147-UNIMOD:1031,221-UNIMOD:1031,266-UNIMOD:1031,72-UNIMOD:1031,414-UNIMOD:267,184-UNIMOD:1031 0.46 38.0 38 27 19 PRT sp|P30740|ILEU_HUMAN Leukocyte elastase inhibitor OS=Homo sapiens OX=9606 GN=SERPINB1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38.0 null 129-UNIMOD:267,110-UNIMOD:259 0.13 38.0 3 3 3 PRT sp|P83731|RL24_HUMAN 60S ribosomal protein L24 OS=Homo sapiens OX=9606 GN=RPL24 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 38.0 null 6-UNIMOD:4,12-UNIMOD:1031,35-UNIMOD:1031,36-UNIMOD:4,93-UNIMOD:1031,27-UNIMOD:1031,1-UNIMOD:35,2-UNIMOD:1031,127-UNIMOD:35,131-UNIMOD:1031,94-UNIMOD:267,61-UNIMOD:1031,69-UNIMOD:1031,43-UNIMOD:1031,124-UNIMOD:1031,135-UNIMOD:1031,36-UNIMOD:385,91-UNIMOD:35,93-UNIMOD:259,97-UNIMOD:1031 0.59 38.0 24 13 5 PRT sp|Q03393|PTPS_HUMAN 6-pyruvoyl tetrahydrobiopterin synthase OS=Homo sapiens OX=9606 GN=PTS PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38.0 null 131-UNIMOD:1031 0.17 38.0 2 2 2 PRT sp|P62913-2|RL11_HUMAN Isoform 2 of 60S ribosomal protein L11 OS=Homo sapiens OX=9606 GN=RPL11 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38.0 null 51-UNIMOD:1031,66-UNIMOD:1031,71-UNIMOD:4,77-UNIMOD:1031,51-UNIMOD:259,84-UNIMOD:1031,143-UNIMOD:1031,149-UNIMOD:4,153-UNIMOD:1031,177-UNIMOD:1031 0.41 38.0 11 8 4 PRT sp|Q92499-3|DDX1_HUMAN Isoform 3 of ATP-dependent RNA helicase DDX1 OS=Homo sapiens OX=9606 GN=DDX1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38.0 null 559-UNIMOD:1031,574-UNIMOD:1031,333-UNIMOD:1031 0.08 38.0 3 3 3 PRT sp|P62736|ACTA_HUMAN Actin, aortic smooth muscle OS=Homo sapiens OX=9606 GN=ACTA2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 38.0 null 70-UNIMOD:1031,46-UNIMOD:35,49-UNIMOD:35,52-UNIMOD:1031,63-UNIMOD:1031,328-UNIMOD:1031,327-UNIMOD:35,328-UNIMOD:259,330-UNIMOD:259,314-UNIMOD:267,317-UNIMOD:1031,317-UNIMOD:259,52-UNIMOD:259,330-UNIMOD:1031,2-UNIMOD:4,12-UNIMOD:4,19-UNIMOD:4,315-UNIMOD:35,256-UNIMOD:267 0.40 38.0 20 13 2 PRT sp|P62847|RS24_HUMAN 40S ribosomal protein S24 OS=Homo sapiens OX=9606 GN=RPS24 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 38.0 null 68-UNIMOD:1031,74-UNIMOD:35,22-UNIMOD:28,32-UNIMOD:1031,21-UNIMOD:1031 0.31 38.0 3 3 0 PRT sp|P08729|K2C7_HUMAN Keratin, type II cytoskeletal 7 OS=Homo sapiens OX=9606 GN=KRT7 PE=1 SV=5 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 38.0 null 296-UNIMOD:1031,286-UNIMOD:1031,331-UNIMOD:1031,122-UNIMOD:1031,117-UNIMOD:1031,326-UNIMOD:1031,208-UNIMOD:1031,296-UNIMOD:259 0.19 38.0 9 8 7 PRT sp|P98082|DAB2_HUMAN Disabled homolog 2 OS=Homo sapiens OX=9606 GN=DAB2 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 38.0 null 120-UNIMOD:1031 0.02 38.0 1 1 1 PRT sp|Q14697|GANAB_HUMAN Neutral alpha-glucosidase AB OS=Homo sapiens OX=9606 GN=GANAB PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 38.0 null 899-UNIMOD:1031,39-UNIMOD:1031,41-UNIMOD:4,47-UNIMOD:4,48-UNIMOD:1031,269-UNIMOD:1031,48-UNIMOD:259,462-UNIMOD:1031 0.06 38.0 9 6 3 PRT sp|P54619|AAKG1_HUMAN 5'-AMP-activated protein kinase subunit gamma-1 OS=Homo sapiens OX=9606 GN=PRKAG1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 38.0 null 243-UNIMOD:1031 0.05 38.0 1 1 1 PRT sp|P63313|TYB10_HUMAN Thymosin beta-10 OS=Homo sapiens OX=9606 GN=TMSB10 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ] 38.0 null 2-UNIMOD:1,7-UNIMOD:35,4-UNIMOD:1031,32-UNIMOD:1031,26-UNIMOD:1031,20-UNIMOD:1031 0.82 38.0 5 4 3 PRT sp|Q9BUJ2|HNRL1_HUMAN Heterogeneous nuclear ribonucleoprotein U-like protein 1 OS=Homo sapiens OX=9606 GN=HNRNPUL1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 38.0 null 551-UNIMOD:1031,561-UNIMOD:35 0.02 38.0 3 1 0 PRT sp|P08243|ASNS_HUMAN Asparagine synthetase [glutamine-hydrolyzing] OS=Homo sapiens OX=9606 GN=ASNS PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 38.0 null 540-UNIMOD:1031,232-UNIMOD:259 0.06 38.0 2 2 1 PRT sp|P62913|RL11_HUMAN 60S ribosomal protein L11 OS=Homo sapiens OX=9606 GN=RPL11 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 38.0 null 38-UNIMOD:1031,150-UNIMOD:4,154-UNIMOD:1031 0.21 38.0 3 3 2 PRT sp|P06454-2|PTMA_HUMAN Isoform 2 of Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37.0 null 102-UNIMOD:1031,102-UNIMOD:259,21-UNIMOD:1031,103-UNIMOD:259,103-UNIMOD:1031,31-UNIMOD:267 0.25 37.0 12 4 0 PRT sp|P33991|MCM4_HUMAN DNA replication licensing factor MCM4 OS=Homo sapiens OX=9606 GN=MCM4 PE=1 SV=5 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 37.0 null 858-UNIMOD:1031,819-UNIMOD:1031,478-UNIMOD:1031,349-UNIMOD:1031,770-UNIMOD:1031,762-UNIMOD:1031,422-UNIMOD:267,220-UNIMOD:1031,814-UNIMOD:1031,455-UNIMOD:1031 0.13 37.0 12 10 8 PRT sp|Q71UI9-3|H2AV_HUMAN Isoform 3 of Histone H2A.V OS=Homo sapiens OX=9606 GN=H2AFV null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37.0 null 78-UNIMOD:1031,8-UNIMOD:1031 0.31 37.0 2 2 2 PRT sp|P13987|CD59_HUMAN CD59 glycoprotein OS=Homo sapiens OX=9606 GN=CD59 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ] 37.0 null 64-UNIMOD:4,66-UNIMOD:1031,70-UNIMOD:4,64-UNIMOD:385 0.13 37.0 2 1 0 PRT sp|Q9NYV4-2|CDK12_HUMAN Isoform 2 of Cyclin-dependent kinase 12 OS=Homo sapiens OX=9606 GN=CDK12 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37.0 null 861-UNIMOD:1031,862-UNIMOD:4 0.01 37.0 2 1 0 PRT sp|Q8TDX7|NEK7_HUMAN Serine/threonine-protein kinase Nek7 OS=Homo sapiens OX=9606 GN=NEK7 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37.0 null 163-UNIMOD:1031,53-UNIMOD:4,63-UNIMOD:1031,176-UNIMOD:1031,64-UNIMOD:1031 0.11 37.0 8 2 0 PRT sp|P23443-4|KS6B1_HUMAN Isoform 3 of Ribosomal protein S6 kinase beta-1 OS=Homo sapiens OX=9606 GN=RPS6KB1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37.0 null 220-UNIMOD:1031,233-UNIMOD:1031,104-UNIMOD:1031,225-UNIMOD:35,99-UNIMOD:1031 0.07 37.0 6 3 2 PRT sp|P50613|CDK7_HUMAN Cyclin-dependent kinase 7 OS=Homo sapiens OX=9606 GN=CDK7 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 37.0 null 139-UNIMOD:1031,41-UNIMOD:1031,342-UNIMOD:1031 0.12 37.0 7 3 2 PRT sp|Q01813|PFKAP_HUMAN ATP-dependent 6-phosphofructokinase, platelet type OS=Homo sapiens OX=9606 GN=PFKP PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 37.0 null 625-UNIMOD:1031,15-UNIMOD:1031,400-UNIMOD:1031,109-UNIMOD:1031,112-UNIMOD:4,747-UNIMOD:1031,736-UNIMOD:1031,395-UNIMOD:1031,710-UNIMOD:1031,718-UNIMOD:4,737-UNIMOD:1031,688-UNIMOD:1031 0.15 37.0 13 10 7 PRT sp|Q8NEV1|CSK23_HUMAN Casein kinase II subunit alpha 3 OS=Homo sapiens OX=9606 GN=CSNK2A3 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37.0 null 158-UNIMOD:1031,163-UNIMOD:35,49-UNIMOD:1031 0.08 37.0 5 2 1 PRT sp|P19784|CSK22_HUMAN Casein kinase II subunit alpha' OS=Homo sapiens OX=9606 GN=CSNK2A2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 37.0 null 159-UNIMOD:1031,164-UNIMOD:35,103-UNIMOD:1031 0.08 37.0 8 2 1 PRT sp|P08243-3|ASNS_HUMAN Isoform 3 of Asparagine synthetase [glutamine-hydrolyzing] OS=Homo sapiens OX=9606 GN=ASNS null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37.0 null 395-UNIMOD:1031,384-UNIMOD:1031,302-UNIMOD:1031,455-UNIMOD:35,457-UNIMOD:1031,473-UNIMOD:1031,120-UNIMOD:1031,124-UNIMOD:4,334-UNIMOD:267,161-UNIMOD:1031,93-UNIMOD:259 0.23 37.0 13 9 4 PRT sp|Q8TDD1|DDX54_HUMAN ATP-dependent RNA helicase DDX54 OS=Homo sapiens OX=9606 GN=DDX54 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37.0 null 388-UNIMOD:1031,389-UNIMOD:4 0.02 37.0 1 1 1 PRT sp|P09382|LEG1_HUMAN Galectin-1 OS=Homo sapiens OX=9606 GN=LGALS1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ] 37.0 null 29-UNIMOD:1031,2-UNIMOD:1,3-UNIMOD:4,13-UNIMOD:1031,17-UNIMOD:4 0.27 37.0 3 3 3 PRT sp|P62826|RAN_HUMAN GTP-binding nuclear protein Ran OS=Homo sapiens OX=9606 GN=RAN PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 37.0 null 60-UNIMOD:1031,38-UNIMOD:1031,112-UNIMOD:4,120-UNIMOD:4,123-UNIMOD:1031,23-UNIMOD:1031,142-UNIMOD:1031,37-UNIMOD:1031,99-UNIMOD:1031,123-UNIMOD:259,134-UNIMOD:1031,37-UNIMOD:259,152-UNIMOD:259,23-UNIMOD:259 0.58 37.0 20 13 7 PRT sp|P10412|H14_HUMAN Histone H1.4 OS=Homo sapiens OX=9606 GN=H1-4 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 37.0 null 97-UNIMOD:1031,75-UNIMOD:1031,90-UNIMOD:1031,34-UNIMOD:1031,63-UNIMOD:1031,160-UNIMOD:1031,117-UNIMOD:1031,52-UNIMOD:1031,26-UNIMOD:1031 0.44 37.0 10 9 6 PRT sp|P12004|PCNA_HUMAN Proliferating cell nuclear antigen OS=Homo sapiens OX=9606 GN=PCNA PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 37.0 null 80-UNIMOD:1031,81-UNIMOD:4,162-UNIMOD:4,164-UNIMOD:1031,181-UNIMOD:259,14-UNIMOD:1031 0.21 37.0 4 4 4 PRT sp|P42345|MTOR_HUMAN Serine/threonine-protein kinase mTOR OS=Homo sapiens OX=9606 GN=MTOR PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37.0 null 2166-UNIMOD:1031 0.01 37.0 2 1 0 PRT sp|O00267-2|SPT5H_HUMAN Isoform 2 of Transcription elongation factor SPT5 OS=Homo sapiens OX=9606 GN=SUPT5H null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37.0 null 714-UNIMOD:1031,1033-UNIMOD:1031 0.03 37.0 2 2 2 PRT sp|P05023-3|AT1A1_HUMAN Isoform 3 of Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37.0 null 456-UNIMOD:1031,354-UNIMOD:267 0.03 37.0 2 2 1 PRT sp|Q9UJ70|NAGK_HUMAN N-acetyl-D-glucosamine kinase OS=Homo sapiens OX=9606 GN=NAGK PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37.0 null 219-UNIMOD:1031 0.04 37.0 1 1 1 PRT sp|P16615-5|AT2A2_HUMAN Isoform 5 of Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Homo sapiens OX=9606 GN=ATP2A2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37.0 null 205-UNIMOD:1031,207-UNIMOD:35,169-UNIMOD:1031,494-UNIMOD:35,498-UNIMOD:4,502-UNIMOD:1031,683-UNIMOD:1031 0.05 37.0 6 4 2 PRT sp|P99999|CYC_HUMAN Cytochrome c OS=Homo sapiens OX=9606 GN=CYCS PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 37.0 null 40-UNIMOD:1031,39-UNIMOD:267,88-UNIMOD:1031,74-UNIMOD:1031,100-UNIMOD:259 0.50 37.0 9 6 5 PRT sp|Q8NB16|MLKL_HUMAN Mixed lineage kinase domain-like protein OS=Homo sapiens OX=9606 GN=MLKL PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 37.0 null 331-UNIMOD:1031,66-UNIMOD:1031,230-UNIMOD:1031,233-UNIMOD:1031,333-UNIMOD:267 0.08 37.0 13 3 1 PRT sp|O95453-4|PARN_HUMAN Isoform 4 of Poly(A)-specific ribonuclease PARN OS=Homo sapiens OX=9606 GN=PARN null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37.0 null 151-UNIMOD:1031,153-UNIMOD:35 0.03 37.0 4 1 0 PRT sp|P12236|ADT3_HUMAN ADP/ATP translocase 3 OS=Homo sapiens OX=9606 GN=SLC25A6 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 37.0 null 43-UNIMOD:1031,160-UNIMOD:4,163-UNIMOD:1031,147-UNIMOD:1031,105-UNIMOD:1031,23-UNIMOD:1031,166-UNIMOD:1031 0.29 37.0 6 6 6 PRT sp|P27824|CALX_HUMAN Calnexin OS=Homo sapiens OX=9606 GN=CANX PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 37.0 null 170-UNIMOD:1031,182-UNIMOD:259,90-UNIMOD:1031,87-UNIMOD:1031,516-UNIMOD:1031,61-UNIMOD:1031,210-UNIMOD:1031,194-UNIMOD:385,194-UNIMOD:4,199-UNIMOD:1031,127-UNIMOD:1031,531-UNIMOD:1031,531-UNIMOD:259,535-UNIMOD:259,217-UNIMOD:1031,134-UNIMOD:259,380-UNIMOD:1031,233-UNIMOD:259,234-UNIMOD:259,525-UNIMOD:259,110-UNIMOD:1031 0.27 37.0 28 19 12 PRT sp|Q6DD88|ATLA3_HUMAN Atlastin-3 OS=Homo sapiens OX=9606 GN=ATL3 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 37.0 null 239-UNIMOD:1031,388-UNIMOD:4,391-UNIMOD:1031 0.06 37.0 4 2 1 PRT sp|Q13263|TIF1B_HUMAN Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28 PE=1 SV=5 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37.0 null 779-UNIMOD:1031,266-UNIMOD:1031,209-UNIMOD:4,261-UNIMOD:1031,199-UNIMOD:1031 0.06 37.0 6 5 4 PRT sp|P38117|ETFB_HUMAN Electron transfer flavoprotein subunit beta OS=Homo sapiens OX=9606 GN=ETFB PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 37.0 null 59-UNIMOD:1031,66-UNIMOD:4,71-UNIMOD:4,238-UNIMOD:1031,210-UNIMOD:1031,176-UNIMOD:1031,116-UNIMOD:1031,248-UNIMOD:1031,19-UNIMOD:1031,110-UNIMOD:1031,202-UNIMOD:1031,11-UNIMOD:1031 0.50 37.0 15 13 11 PRT sp|Q01650|LAT1_HUMAN Large neutral amino acids transporter small subunit 1 OS=Homo sapiens OX=9606 GN=SLC7A5 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ] 37.0 null 19-UNIMOD:1031,2-UNIMOD:1,7-UNIMOD:1031 0.08 37.0 3 3 3 PRT sp|A4QPH2-4|PI4P2_HUMAN Isoform 3 of Putative phosphatidylinositol 4-kinase alpha-like protein P2 OS=Homo sapiens OX=9606 GN=PI4KAP2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37.0 null 267-UNIMOD:1031,262-UNIMOD:35 0.03 37.0 3 1 0 PRT sp|Q9GZP8|IMUP_HUMAN Immortalization up-regulated protein OS=Homo sapiens OX=9606 GN=IMUP PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 37.0 null 74-UNIMOD:1031 0.15 37.0 3 1 0 PRT sp|P15880|RS2_HUMAN 40S ribosomal protein S2 OS=Homo sapiens OX=9606 GN=RPS2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 37.0 null 275-UNIMOD:1031,211-UNIMOD:1031,108-UNIMOD:1031,58-UNIMOD:1031,110-UNIMOD:35,114-UNIMOD:1031,257-UNIMOD:259,229-UNIMOD:4,238-UNIMOD:259 0.28 37.0 14 9 4 PRT sp|P34932|HSP74_HUMAN Heat shock 70 kDa protein 4 OS=Homo sapiens OX=9606 GN=HSPA4 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 37.0 null 61-UNIMOD:1031,53-UNIMOD:1031,679-UNIMOD:1031,779-UNIMOD:4,785-UNIMOD:1031,376-UNIMOD:4,380-UNIMOD:4,388-UNIMOD:259,477-UNIMOD:1031,305-UNIMOD:1031,310-UNIMOD:4,430-UNIMOD:1031,270-UNIMOD:4,272-UNIMOD:1031,356-UNIMOD:1031,351-UNIMOD:1031,686-UNIMOD:1031,68-UNIMOD:1031,794-UNIMOD:1031,766-UNIMOD:1031 0.20 37.0 17 16 14 PRT sp|P04632|CPNS1_HUMAN Calpain small subunit 1 OS=Homo sapiens OX=9606 GN=CAPNS1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37.0 null 0.06 37.0 1 1 1 PRT sp|P37108|SRP14_HUMAN Signal recognition particle 14 kDa protein OS=Homo sapiens OX=9606 GN=SRP14 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37.0 null 107-UNIMOD:1031,55-UNIMOD:1031,56-UNIMOD:4,74-UNIMOD:1031,31-UNIMOD:1031,66-UNIMOD:1031 0.55 37.0 6 5 4 PRT sp|O00232-2|PSD12_HUMAN Isoform 2 of 26S proteasome non-ATPase regulatory subunit 12 OS=Homo sapiens OX=9606 GN=PSMD12 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37.0 null 428-UNIMOD:1031,78-UNIMOD:1031 0.06 37.0 2 2 2 PRT sp|P60228|EIF3E_HUMAN Eukaryotic translation initiation factor 3 subunit E OS=Homo sapiens OX=9606 GN=EIF3E PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 37.0 null 82-UNIMOD:1031,275-UNIMOD:1031,407-UNIMOD:1031 0.12 37.0 3 3 3 PRT sp|P52209-2|6PGD_HUMAN Isoform 2 of 6-phosphogluconate dehydrogenase, decarboxylating OS=Homo sapiens OX=9606 GN=PGD null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37.0 null 25-UNIMOD:1031,46-UNIMOD:1031,35-UNIMOD:1031,248-UNIMOD:1031,252-UNIMOD:1031,235-UNIMOD:1031,389-UNIMOD:4,150-UNIMOD:259 0.16 37.0 9 7 4 PRT sp|P08195-2|4F2_HUMAN Isoform 2 of 4F2 cell-surface antigen heavy chain OS=Homo sapiens OX=9606 GN=SLC3A2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37.0 null 59-UNIMOD:1031,197-UNIMOD:1031,514-UNIMOD:1031,65-UNIMOD:1031,59-UNIMOD:259,154-UNIMOD:1031,156-UNIMOD:1031,44-UNIMOD:1031 0.18 37.0 10 9 8 PRT sp|P13804|ETFA_HUMAN Electron transfer flavoprotein subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ETFA PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 37.0 null 75-UNIMOD:1031,68-UNIMOD:4,69-UNIMOD:1031,155-UNIMOD:4,226-UNIMOD:1031 0.14 37.0 4 4 4 PRT sp|Q06265|EXOS9_HUMAN Exosome complex component RRP45 OS=Homo sapiens OX=9606 GN=EXOSC9 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37.0 null 61-UNIMOD:4,67-UNIMOD:1031 0.04 37.0 1 1 1 PRT sp|Q13283|G3BP1_HUMAN Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens OX=9606 GN=G3BP1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 37.0 null 73-UNIMOD:4,76-UNIMOD:1031,66-UNIMOD:35,64-UNIMOD:1031,50-UNIMOD:1031 0.09 37.0 7 3 2 PRT sp|P53621|COPA_HUMAN Coatomer subunit alpha OS=Homo sapiens OX=9606 GN=COPA PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 37.0 null 1211-UNIMOD:1031,480-UNIMOD:1031,574-UNIMOD:1031,580-UNIMOD:4,271-UNIMOD:1031,1-UNIMOD:35,4-UNIMOD:1031,487-UNIMOD:1031,600-UNIMOD:1031,607-UNIMOD:1031,1143-UNIMOD:1031,1148-UNIMOD:4,447-UNIMOD:1031,453-UNIMOD:4,441-UNIMOD:1031,993-UNIMOD:1031 0.13 37.0 15 12 11 PRT sp|P50990|TCPQ_HUMAN T-complex protein 1 subunit theta OS=Homo sapiens OX=9606 GN=CCT8 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 37.0 null 2-UNIMOD:1,7-UNIMOD:1031,14-UNIMOD:35,169-UNIMOD:35,171-UNIMOD:1031,171-UNIMOD:259,181-UNIMOD:259,205-UNIMOD:4,206-UNIMOD:1031,266-UNIMOD:35,270-UNIMOD:259,430-UNIMOD:4,439-UNIMOD:259,440-UNIMOD:259,534-UNIMOD:1031 0.18 37.0 19 6 1 PRT sp|Q32P51|RA1L2_HUMAN Heterogeneous nuclear ribonucleoprotein A1-like 2 OS=Homo sapiens OX=9606 GN=HNRNPA1L2 PE=2 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 37.0 null 113-UNIMOD:1031,106-UNIMOD:1031 0.06 37.0 9 2 0 PRT sp|P62753|RS6_HUMAN 40S ribosomal protein S6 OS=Homo sapiens OX=9606 GN=RPS6 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 37.0 null 12-UNIMOD:4,14-UNIMOD:1031,2-UNIMOD:1031,58-UNIMOD:1031,1-UNIMOD:35,63-UNIMOD:35,149-UNIMOD:1031,64-UNIMOD:1031,203-UNIMOD:1031,203-UNIMOD:259,211-UNIMOD:259,119-UNIMOD:1031,143-UNIMOD:1031,72-UNIMOD:267,230-UNIMOD:1031 0.37 37.0 18 10 5 PRT sp|P53999|TCP4_HUMAN Activated RNA polymerase II transcriptional coactivator p15 OS=Homo sapiens OX=9606 GN=SUB1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 37.0 null 101-UNIMOD:1031,53-UNIMOD:1031,68-UNIMOD:1031,80-UNIMOD:1031,35-UNIMOD:1031,41-UNIMOD:1031 0.52 37.0 7 6 5 PRT sp|P36639|8ODP_HUMAN 7,8-dihydro-8-oxoguanine triphosphatase OS=Homo sapiens OX=9606 GN=NUDT1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 37.0 null 79-UNIMOD:1031 0.10 37.0 1 1 0 PRT sp|P49755|TMEDA_HUMAN Transmembrane emp24 domain-containing protein 10 OS=Homo sapiens OX=9606 GN=TMED10 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 37.0 null 75-UNIMOD:1031 0.12 37.0 2 2 2 PRT sp|P49840|GSK3A_HUMAN Glycogen synthase kinase-3 alpha OS=Homo sapiens OX=9606 GN=GSK3A PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 37.0 null 246-UNIMOD:1031,246-UNIMOD:259,260-UNIMOD:259 0.04 37.0 5 1 0 PRT sp|Q53EL6-2|PDCD4_HUMAN Isoform 2 of Programmed cell death protein 4 OS=Homo sapiens OX=9606 GN=PDCD4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36.0 null 286-UNIMOD:1031,234-UNIMOD:1031 0.07 36.0 2 2 2 PRT sp|Q15836|VAMP3_HUMAN Vesicle-associated membrane protein 3 OS=Homo sapiens OX=9606 GN=VAMP3 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36.0 null 66-UNIMOD:1031 0.20 36.0 1 1 1 PRT sp|Q13813-3|SPTN1_HUMAN Isoform 3 of Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36.0 null 637-UNIMOD:1031,825-UNIMOD:1031,2068-UNIMOD:1031,2058-UNIMOD:1031,1314-UNIMOD:1031,814-UNIMOD:1031 0.03 36.0 7 6 5 PRT sp|Q02790|FKBP4_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Homo sapiens OX=9606 GN=FKBP4 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 36.0 null 354-UNIMOD:1031,390-UNIMOD:1031,396-UNIMOD:4,441-UNIMOD:1031,222-UNIMOD:1031,28-UNIMOD:1031,426-UNIMOD:1031,387-UNIMOD:1031,250-UNIMOD:1031,424-UNIMOD:1031,399-UNIMOD:267,282-UNIMOD:1031,181-UNIMOD:1031,440-UNIMOD:35 0.31 36.0 14 12 10 PRT sp|P07919|QCR6_HUMAN Cytochrome b-c1 complex subunit 6, mitochondrial OS=Homo sapiens OX=9606 GN=UQCRH PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36.0 null 81-UNIMOD:4,85-UNIMOD:1031,37-UNIMOD:4,42-UNIMOD:1031,43-UNIMOD:4,45-UNIMOD:1031 0.29 36.0 3 2 1 PRT sp|O43148|MCES_HUMAN mRNA cap guanine-N7 methyltransferase OS=Homo sapiens OX=9606 GN=RNMT PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36.0 null 206-UNIMOD:4,208-UNIMOD:1031 0.04 36.0 1 1 1 PRT sp|P62633-7|CNBP_HUMAN Isoform 7 of Cellular nucleic acid-binding protein OS=Homo sapiens OX=9606 GN=CNBP null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36.0 null 80-UNIMOD:4,81-UNIMOD:4,84-UNIMOD:4,86-UNIMOD:1031 0.10 36.0 1 1 1 PRT sp|P62910|RL32_HUMAN 60S ribosomal protein L32 OS=Homo sapiens OX=9606 GN=RPL32 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36.0 null 50-UNIMOD:1031,96-UNIMOD:4,106-UNIMOD:259,76-UNIMOD:1031 0.30 36.0 5 3 1 PRT sp|Q96S44|PRPK_HUMAN EKC/KEOPS complex subunit TP53RK OS=Homo sapiens OX=9606 GN=TP53RK PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 36.0 null 40-UNIMOD:1031 0.06 36.0 9 1 0 PRT sp|P55010|IF5_HUMAN Eukaryotic translation initiation factor 5 OS=Homo sapiens OX=9606 GN=EIF5 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 36.0 null 99-UNIMOD:4,102-UNIMOD:4,115-UNIMOD:1031,95-UNIMOD:1031,122-UNIMOD:4,94-UNIMOD:1031,413-UNIMOD:1031 0.12 36.0 6 5 4 PRT sp|P08758|ANXA5_HUMAN Annexin A5 OS=Homo sapiens OX=9606 GN=ANXA5 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 36.0 null 108-UNIMOD:1031,101-UNIMOD:1031,290-UNIMOD:1031,97-UNIMOD:1031,310-UNIMOD:1031,316-UNIMOD:4,309-UNIMOD:1031,76-UNIMOD:1031,86-UNIMOD:1031,97-UNIMOD:259,79-UNIMOD:1031,85-UNIMOD:35 0.25 36.0 13 10 7 PRT sp|Q96AE4|FUBP1_HUMAN Far upstream element-binding protein 1 OS=Homo sapiens OX=9606 GN=FUBP1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 36.0 null 400-UNIMOD:1031,243-UNIMOD:1031,394-UNIMOD:1031,209-UNIMOD:1031,425-UNIMOD:1031,312-UNIMOD:1031,299-UNIMOD:1031 0.14 36.0 7 7 6 PRT sp|Q96TA2-3|YMEL1_HUMAN Isoform 3 of ATP-dependent zinc metalloprotease YME1L1 OS=Homo sapiens OX=9606 GN=YME1L1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36.0 null 295-UNIMOD:1031 0.03 36.0 2 1 0 PRT sp|P07741-2|APT_HUMAN Isoform 2 of Adenine phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=APRT null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36.0 null 91-UNIMOD:1031,34-UNIMOD:1031,51-UNIMOD:1031 0.32 36.0 3 3 3 PRT sp|Q9UNL2|SSRG_HUMAN Translocon-associated protein subunit gamma OS=Homo sapiens OX=9606 GN=SSR3 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36.0 null 8-UNIMOD:1031,103-UNIMOD:1031 0.15 36.0 2 2 2 PRT sp|P27797|CALR_HUMAN Calreticulin OS=Homo sapiens OX=9606 GN=CALR PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 36.0 null 105-UNIMOD:4,48-UNIMOD:1031,55-UNIMOD:1031,111-UNIMOD:259,64-UNIMOD:1031,377-UNIMOD:1031,143-UNIMOD:1031,62-UNIMOD:1031,159-UNIMOD:1031,360-UNIMOD:1031,151-UNIMOD:1031,43-UNIMOD:1031,355-UNIMOD:1031,357-UNIMOD:35,286-UNIMOD:259,153-UNIMOD:1031,41-UNIMOD:1031 0.32 36.0 23 18 13 PRT sp|Q9UNF0-2|PACN2_HUMAN Isoform 2 of Protein kinase C and casein kinase substrate in neurons protein 2 OS=Homo sapiens OX=9606 GN=PACSIN2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36.0 null 53-UNIMOD:1031,163-UNIMOD:4,164-UNIMOD:1031,167-UNIMOD:1031 0.07 36.0 3 3 2 PRT sp|P98082-2|DAB2_HUMAN Isoform 2 of Disabled homolog 2 OS=Homo sapiens OX=9606 GN=DAB2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36.0 null 108-UNIMOD:1031,53-UNIMOD:1031,90-UNIMOD:1031,44-UNIMOD:1031 0.09 36.0 6 5 4 PRT sp|P26639|SYTC_HUMAN Threonine--tRNA ligase 1, cytoplasmic OS=Homo sapiens OX=9606 GN=TARS1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 36.0 null 243-UNIMOD:1031,279-UNIMOD:1031,91-UNIMOD:1031,107-UNIMOD:4,121-UNIMOD:259,36-UNIMOD:1031,75-UNIMOD:259,309-UNIMOD:1031,549-UNIMOD:1031 0.16 36.0 10 8 6 PRT sp|Q9Y6N7-6|ROBO1_HUMAN Isoform 6 of Roundabout homolog 1 OS=Homo sapiens OX=9606 GN=ROBO1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36.0 null 42-UNIMOD:1031,50-UNIMOD:4 0.01 36.0 1 1 1 PRT sp|O75964|ATP5L_HUMAN ATP synthase subunit g, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5MG PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36.0 null 66-UNIMOD:1031,55-UNIMOD:1031 0.17 36.0 2 2 2 PRT sp|Q9NR30-2|DDX21_HUMAN Isoform 2 of Nucleolar RNA helicase 2 OS=Homo sapiens OX=9606 GN=DDX21 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36.0 null 381-UNIMOD:1031,252-UNIMOD:1031,413-UNIMOD:1031 0.05 36.0 4 3 2 PRT sp|Q9UG63|ABCF2_HUMAN ATP-binding cassette sub-family F member 2 OS=Homo sapiens OX=9606 GN=ABCF2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 36.0 null 25-UNIMOD:1031,436-UNIMOD:1031,618-UNIMOD:1031,608-UNIMOD:1031,461-UNIMOD:1031 0.09 36.0 8 5 3 PRT sp|O43670-2|ZN207_HUMAN Isoform 2 of BUB3-interacting and GLEBS motif-containing protein ZNF207 OS=Homo sapiens OX=9606 GN=ZNF207 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36.0 null 43-UNIMOD:1031,54-UNIMOD:4,31-UNIMOD:1031,55-UNIMOD:35,106-UNIMOD:1031 0.08 36.0 4 3 1 PRT sp|P23193-2|TCEA1_HUMAN Isoform 2 of Transcription elongation factor A protein 1 OS=Homo sapiens OX=9606 GN=TCEA1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36.0 null 34-UNIMOD:1031,46-UNIMOD:1031,231-UNIMOD:1031,242-UNIMOD:4,244-UNIMOD:259,96-UNIMOD:1031 0.16 36.0 6 5 4 PRT sp|P50502|F10A1_HUMAN Hsc70-interacting protein OS=Homo sapiens OX=9606 GN=ST13 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 36.0 null 118-UNIMOD:1031,142-UNIMOD:1031,186-UNIMOD:1031,360-UNIMOD:1031,163-UNIMOD:1031,230-UNIMOD:1031,48-UNIMOD:1031,64-UNIMOD:1031,153-UNIMOD:1031,14-UNIMOD:1031,16-UNIMOD:4,15-UNIMOD:35 0.30 36.0 19 10 4 PRT sp|P40429|RL13A_HUMAN 60S ribosomal protein L13a OS=Homo sapiens OX=9606 GN=RPL13A PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 36.0 null 148-UNIMOD:1031,25-UNIMOD:1031,197-UNIMOD:1031,159-UNIMOD:259,159-UNIMOD:1031,134-UNIMOD:1031,87-UNIMOD:35,91-UNIMOD:1031,118-UNIMOD:35,125-UNIMOD:1031 0.37 36.0 12 8 5 PRT sp|P23246-2|SFPQ_HUMAN Isoform Short of Splicing factor, proline- and glutamine-rich OS=Homo sapiens OX=9606 GN=SFPQ null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36.0 null 314-UNIMOD:1031,208-UNIMOD:1031,413-UNIMOD:1031,466-UNIMOD:1031,332-UNIMOD:1031,472-UNIMOD:1031,338-UNIMOD:1031 0.12 36.0 8 7 6 PRT sp|O75643|U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens OX=9606 GN=SNRNP200 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36.0 null 1421-UNIMOD:1031,368-UNIMOD:1031,1049-UNIMOD:1031,1146-UNIMOD:1031 0.03 36.0 4 4 4 PRT sp|Q5JWF2-2|GNAS1_HUMAN Isoform XLas-2 of Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas OS=Homo sapiens OX=9606 GN=GNAS null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36.0 null 696-UNIMOD:1031 0.02 36.0 1 1 1 PRT sp|Q6XQN6-3|PNCB_HUMAN Isoform 3 of Nicotinate phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=NAPRT null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36.0 null 414-UNIMOD:1031 0.03 36.0 1 1 1 PRT sp|Q9P2J5|SYLC_HUMAN Leucine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=LARS1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 36.0 null 717-UNIMOD:35,719-UNIMOD:1031,39-UNIMOD:1031,1002-UNIMOD:1031,1003-UNIMOD:35,832-UNIMOD:259,1155-UNIMOD:1031,464-UNIMOD:1031,100-UNIMOD:4,103-UNIMOD:1031,1108-UNIMOD:1031 0.08 36.0 10 8 6 PRT sp|P26373|RL13_HUMAN 60S ribosomal protein L13 OS=Homo sapiens OX=9606 GN=RPL13 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36.0 null 105-UNIMOD:1031,200-UNIMOD:1031,209-UNIMOD:1031,11-UNIMOD:1031,116-UNIMOD:267,123-UNIMOD:1031,88-UNIMOD:1031 0.27 36.0 11 8 5 PRT sp|O15212|PFD6_HUMAN Prefoldin subunit 6 OS=Homo sapiens OX=9606 GN=PFDN6 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36.0 null 32-UNIMOD:1031,122-UNIMOD:1031,66-UNIMOD:1031,15-UNIMOD:1031 0.44 36.0 4 4 4 PRT sp|P16949|STMN1_HUMAN Stathmin OS=Homo sapiens OX=9606 GN=STMN1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 36.0 null 70-UNIMOD:1031,95-UNIMOD:1031,29-UNIMOD:1031,85-UNIMOD:1031,2-UNIMOD:1,9-UNIMOD:1031,43-UNIMOD:1031,119-UNIMOD:1031,80-UNIMOD:1031,104-UNIMOD:1031,105-UNIMOD:35,52-UNIMOD:1031,42-UNIMOD:1031,62-UNIMOD:1031,96-UNIMOD:35,100-UNIMOD:1031,41-UNIMOD:1031,128-UNIMOD:1031,109-UNIMOD:1031,53-UNIMOD:1031 0.79 36.0 23 16 10 PRT sp|O60841|IF2P_HUMAN Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 36.0 null 284-UNIMOD:1031,766-UNIMOD:1031,1195-UNIMOD:1031,923-UNIMOD:1031,275-UNIMOD:1031,1016-UNIMOD:1031,573-UNIMOD:1031,1189-UNIMOD:28,921-UNIMOD:1031,352-UNIMOD:1031,226-UNIMOD:1031,577-UNIMOD:1031,628-UNIMOD:1031,73-UNIMOD:1031 0.12 36.0 14 13 12 PRT sp|Q9UEE9|CFDP1_HUMAN Craniofacial development protein 1 OS=Homo sapiens OX=9606 GN=CFDP1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 36.0 null 224-UNIMOD:35,230-UNIMOD:1031,167-UNIMOD:1031,135-UNIMOD:1031,180-UNIMOD:1031,268-UNIMOD:1031,187-UNIMOD:1031 0.21 36.0 9 6 5 PRT sp|A0FGR8-5|ESYT2_HUMAN Isoform 5 of Extended synaptotagmin-2 OS=Homo sapiens OX=9606 GN=ESYT2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36.0 null 282-UNIMOD:1031 0.05 36.0 1 1 1 PRT sp|P17931|LEG3_HUMAN Galectin-3 OS=Homo sapiens OX=9606 GN=LGALS3 PE=1 SV=5 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36.0 null 173-UNIMOD:4,176-UNIMOD:1031,196-UNIMOD:1031,227-UNIMOD:1031 0.15 36.0 3 3 3 PRT sp|O75676-2|KS6A4_HUMAN Isoform 2 of Ribosomal protein S6 kinase alpha-4 OS=Homo sapiens OX=9606 GN=RPS6KA4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36.0 null 46-UNIMOD:1031 0.02 36.0 1 1 1 PRT sp|Q13630|FCL_HUMAN GDP-L-fucose synthase OS=Homo sapiens OX=9606 GN=TSTA3 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 36.0 null 44-UNIMOD:1031,112-UNIMOD:4,116-UNIMOD:4,121-UNIMOD:1031 0.14 36.0 2 2 2 PRT sp|P60900-3|PSA6_HUMAN Isoform 3 of Proteasome subunit alpha type-6 OS=Homo sapiens OX=9606 GN=PSMA6 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36.0 null 25-UNIMOD:1031,36-UNIMOD:4,34-UNIMOD:35,102-UNIMOD:1031 0.16 36.0 3 2 1 PRT sp|P49915|GUAA_HUMAN GMP synthase [glutamine-hydrolyzing] OS=Homo sapiens OX=9606 GN=GMPS PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 36.0 null 2-UNIMOD:1,4-UNIMOD:4,9-UNIMOD:1031,145-UNIMOD:1031,389-UNIMOD:1031,416-UNIMOD:1031 0.09 36.0 7 4 2 PRT sp|Q92598|HS105_HUMAN Heat shock protein 105 kDa OS=Homo sapiens OX=9606 GN=HSPH1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 36.0 null 68-UNIMOD:1031,376-UNIMOD:4,380-UNIMOD:4 0.04 36.0 2 2 0 PRT sp|P31153|METK2_HUMAN S-adenosylmethionine synthase isoform type-2 OS=Homo sapiens OX=9606 GN=MAT2A PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 36.0 null 234-UNIMOD:1031,88-UNIMOD:1031,97-UNIMOD:259,228-UNIMOD:1031,163-UNIMOD:1031,264-UNIMOD:267 0.19 36.0 10 7 4 PRT sp|P27708|PYR1_HUMAN CAD protein OS=Homo sapiens OX=9606 GN=CAD PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 36.0 null 2082-UNIMOD:1031,754-UNIMOD:1031,758-UNIMOD:4,759-UNIMOD:35,760-UNIMOD:1031,747-UNIMOD:1031 0.02 36.0 6 4 2 PRT sp|Q9UMX0|UBQL1_HUMAN Ubiquilin-1 OS=Homo sapiens OX=9606 GN=UBQLN1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 36.0 null 47-UNIMOD:1031 0.03 36.0 1 1 1 PRT sp|Q58FF7|H90B3_HUMAN Putative heat shock protein HSP 90-beta-3 OS=Homo sapiens OX=9606 GN=HSP90AB3P PE=5 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 36.0 null 198-UNIMOD:259,289-UNIMOD:1031,494-UNIMOD:35,496-UNIMOD:1031,336-UNIMOD:35,341-UNIMOD:1031,423-UNIMOD:1031,272-UNIMOD:267,490-UNIMOD:35,493-UNIMOD:35,289-UNIMOD:259 0.13 36.0 37 7 0 PRT sp|O95747|OXSR1_HUMAN Serine/threonine-protein kinase OSR1 OS=Homo sapiens OX=9606 GN=OXSR1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 36.0 null 52-UNIMOD:1031,53-UNIMOD:4,110-UNIMOD:1031 0.05 36.0 2 2 2 PRT sp|O75533|SF3B1_HUMAN Splicing factor 3B subunit 1 OS=Homo sapiens OX=9606 GN=SF3B1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 35.0 null 240-UNIMOD:1031,195-UNIMOD:1031,6-UNIMOD:1031,741-UNIMOD:1031,499-UNIMOD:1031,175-UNIMOD:1031 0.05 35.0 8 7 6 PRT sp|O75521-2|ECI2_HUMAN Isoform 2 of Enoyl-CoA delta isomerase 2, mitochondrial OS=Homo sapiens OX=9606 GN=ECI2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35.0 null 57-UNIMOD:1031,324-UNIMOD:1031,333-UNIMOD:4,16-UNIMOD:1031,126-UNIMOD:1031,133-UNIMOD:35 0.17 35.0 5 4 3 PRT sp|P18206-2|VINC_HUMAN Isoform 1 of Vinculin OS=Homo sapiens OX=9606 GN=VCL null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35.0 null 581-UNIMOD:1031,352-UNIMOD:1031,950-UNIMOD:4,952-UNIMOD:1031,666-UNIMOD:1031,784-UNIMOD:1031,313-UNIMOD:4,316-UNIMOD:1031,731-UNIMOD:1031,985-UNIMOD:4,987-UNIMOD:267,219-UNIMOD:1031 0.12 35.0 9 9 9 PRT sp|Q99615-2|DNJC7_HUMAN Isoform 2 of DnaJ homolog subfamily C member 7 OS=Homo sapiens OX=9606 GN=DNAJC7 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35.0 null 72-UNIMOD:1031,312-UNIMOD:1031,308-UNIMOD:1031 0.07 35.0 3 3 3 PRT sp|P78347-2|GTF2I_HUMAN Isoform 2 of General transcription factor II-I OS=Homo sapiens OX=9606 GN=GTF2I null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35.0 null 130-UNIMOD:1031,453-UNIMOD:1031,850-UNIMOD:1031,838-UNIMOD:1031,447-UNIMOD:1031,94-UNIMOD:1031 0.08 35.0 6 6 5 PRT sp|Q13428-6|TCOF_HUMAN Isoform 6 of Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35.0 null 803-UNIMOD:1031,458-UNIMOD:1031,322-UNIMOD:1031,1225-UNIMOD:1031,470-UNIMOD:259,313-UNIMOD:1031,725-UNIMOD:1031,820-UNIMOD:1031,647-UNIMOD:1031,716-UNIMOD:1031,1297-UNIMOD:1031,904-UNIMOD:1031,642-UNIMOD:1031,644-UNIMOD:4,237-UNIMOD:1031,1235-UNIMOD:1031,637-UNIMOD:1031 0.11 35.0 17 16 13 PRT sp|Q9UHD8-7|SEPT9_HUMAN Isoform 7 of Septin-9 OS=Homo sapiens OX=9606 GN=SEPTIN9 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35.0 null 43-UNIMOD:1031,333-UNIMOD:1031,307-UNIMOD:1031 0.07 35.0 3 3 3 PRT sp|Q9NSD9-2|SYFB_HUMAN Isoform 2 of Phenylalanine--tRNA ligase beta subunit OS=Homo sapiens OX=9606 GN=FARSB null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35.0 null 344-UNIMOD:1031,8-UNIMOD:1031 0.09 35.0 4 3 2 PRT sp|P60953|CDC42_HUMAN Cell division control protein 42 homolog OS=Homo sapiens OX=9606 GN=CDC42 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35.0 null 153-UNIMOD:1031,157-UNIMOD:4,163-UNIMOD:1031,135-UNIMOD:1031,18-UNIMOD:4,27-UNIMOD:259,163-UNIMOD:259 0.21 35.0 5 5 5 PRT sp|P07858|CATB_HUMAN Cathepsin B OS=Homo sapiens OX=9606 GN=CTSB PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35.0 null 207-UNIMOD:4,209-UNIMOD:1031,211-UNIMOD:4,223-UNIMOD:1031 0.05 35.0 3 2 1 PRT sp|P54727|RD23B_HUMAN UV excision repair protein RAD23 homolog B OS=Homo sapiens OX=9606 GN=RAD23B PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 35.0 null 45-UNIMOD:1031,51-UNIMOD:1031,36-UNIMOD:1031 0.09 35.0 5 4 2 PRT sp|P41743|KPCI_HUMAN Protein kinase C iota type OS=Homo sapiens OX=9606 GN=PRKCI PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35.0 null 380-UNIMOD:1031,134-UNIMOD:1031,137-UNIMOD:4,282-UNIMOD:35,283-UNIMOD:1031 0.07 35.0 4 3 2 PRT sp|Q8IU85-2|KCC1D_HUMAN Isoform 2 of Calcium/calmodulin-dependent protein kinase type 1D OS=Homo sapiens OX=9606 GN=CAMK1D null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35.0 null 146-UNIMOD:1031,52-UNIMOD:1031,53-UNIMOD:4,56-UNIMOD:1031 0.08 35.0 3 2 1 PRT sp|P53778-2|MK12_HUMAN Isoform 2 of Mitogen-activated protein kinase 12 OS=Homo sapiens OX=9606 GN=MAPK12 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35.0 null 145-UNIMOD:1031,155-UNIMOD:4 0.05 35.0 1 1 1 PRT sp|O14976|GAK_HUMAN Cyclin-G-associated kinase OS=Homo sapiens OX=9606 GN=GAK PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35.0 null 175-UNIMOD:1031,78-UNIMOD:1031 0.02 35.0 3 2 1 PRT sp|Q16222-2|UAP1_HUMAN Isoform AGX1 of UDP-N-acetylhexosamine pyrophosphorylase OS=Homo sapiens OX=9606 GN=UAP1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35.0 null 357-UNIMOD:1031 0.04 35.0 1 1 1 PRT sp|O00116|ADAS_HUMAN Alkyldihydroxyacetonephosphate synthase, peroxisomal OS=Homo sapiens OX=9606 GN=AGPS PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 35.0 null 621-UNIMOD:1031,323-UNIMOD:1031,108-UNIMOD:1031,640-UNIMOD:1031,116-UNIMOD:1031 0.10 35.0 5 5 5 PRT sp|Q9H497-3|TOR3A_HUMAN Isoform 3 of Torsin-3A OS=Homo sapiens OX=9606 GN=TOR3A null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35.0 null 169-UNIMOD:4,170-UNIMOD:1031 0.09 35.0 1 1 1 PRT sp|P25705|ATPA_HUMAN ATP synthase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1A PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 35.0 null 194-UNIMOD:1031,149-UNIMOD:267,58-UNIMOD:267,531-UNIMOD:1031,316-UNIMOD:259,175-UNIMOD:1031,426-UNIMOD:35,427-UNIMOD:1031,433-UNIMOD:35,51-UNIMOD:35,230-UNIMOD:1031,239-UNIMOD:1031,261-UNIMOD:1031,126-UNIMOD:1031,189-UNIMOD:35 0.25 35.0 17 11 7 PRT sp|P25786|PSA1_HUMAN Proteasome subunit alpha type-1 OS=Homo sapiens OX=9606 GN=PSMA1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 35.0 null 208-UNIMOD:1031,115-UNIMOD:1031,243-UNIMOD:1031 0.24 35.0 8 4 1 PRT sp|Q99986|VRK1_HUMAN Serine/threonine-protein kinase VRK1 OS=Homo sapiens OX=9606 GN=VRK1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35.0 null 140-UNIMOD:1031,5-UNIMOD:1031 0.06 35.0 2 2 2 PRT sp|Q8TB61-5|S35B2_HUMAN Isoform 5 of Adenosine 3'-phospho 5'-phosphosulfate transporter 1 OS=Homo sapiens OX=9606 GN=SLC35B2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35.0 null 83-UNIMOD:1031 0.05 35.0 2 1 0 PRT sp|P09972|ALDOC_HUMAN Fructose-bisphosphate aldolase C OS=Homo sapiens OX=9606 GN=ALDOC PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 35.0 null 42-UNIMOD:1031,40-UNIMOD:35,173-UNIMOD:267 0.09 35.0 3 2 1 PRT sp|O75351|VPS4B_HUMAN Vacuolar protein sorting-associated protein 4B OS=Homo sapiens OX=9606 GN=VPS4B PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35.0 null 180-UNIMOD:1031,217-UNIMOD:1031 0.07 35.0 2 2 2 PRT sp|P68133|ACTS_HUMAN Actin, alpha skeletal muscle OS=Homo sapiens OX=9606 GN=ACTA1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35.0 null 70-UNIMOD:1031,84-UNIMOD:35,86-UNIMOD:259 0.06 35.0 3 2 0 PRT sp|Q6P1N9|TATD1_HUMAN Putative deoxyribonuclease TATDN1 OS=Homo sapiens OX=9606 GN=TATDN1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35.0 null 27-UNIMOD:1031 0.05 35.0 2 1 0 PRT sp|P07954-2|FUMH_HUMAN Isoform Cytoplasmic of Fumarate hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=FH null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35.0 null 18-UNIMOD:1031,37-UNIMOD:1031,434-UNIMOD:1031,45-UNIMOD:35,51-UNIMOD:1031,249-UNIMOD:1031,220-UNIMOD:1031,57-UNIMOD:1031,430-UNIMOD:1031 0.16 35.0 9 8 5 PRT sp|P53985|MOT1_HUMAN Monocarboxylate transporter 1 OS=Homo sapiens OX=9606 GN=SLC16A1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35.0 null 224-UNIMOD:1031 0.03 35.0 2 1 0 PRT sp|P62277|RS13_HUMAN 40S ribosomal protein S13 OS=Homo sapiens OX=9606 GN=RPS13 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 35.0 null 43-UNIMOD:1031,78-UNIMOD:1031,4-UNIMOD:35,9-UNIMOD:1031,27-UNIMOD:1031,34-UNIMOD:1031,93-UNIMOD:259,94-UNIMOD:1031,70-UNIMOD:1031,39-UNIMOD:1031,140-UNIMOD:1031 0.70 35.0 16 12 9 PRT sp|Q16513-4|PKN2_HUMAN Isoform 4 of Serine/threonine-protein kinase N2 OS=Homo sapiens OX=9606 GN=PKN2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35.0 null 14-UNIMOD:1031,341-UNIMOD:1031 0.03 35.0 3 2 1 PRT sp|Q96HW7-3|INT4_HUMAN Isoform 3 of Integrator complex subunit 4 OS=Homo sapiens OX=9606 GN=INTS4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35.0 null 445-UNIMOD:1031 0.06 35.0 1 1 1 PRT sp|P10620-2|MGST1_HUMAN Isoform 2 of Microsomal glutathione S-transferase 1 OS=Homo sapiens OX=9606 GN=MGST1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35.0 null 42-UNIMOD:1031,50-UNIMOD:4 0.17 35.0 1 1 1 PRT sp|Q6NUK1-2|SCMC1_HUMAN Isoform 2 of Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Homo sapiens OX=9606 GN=SLC25A24 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35.0 null 301-UNIMOD:1031,311-UNIMOD:4,317-UNIMOD:1031 0.07 35.0 2 2 2 PRT sp|Q09161|NCBP1_HUMAN Nuclear cap-binding protein subunit 1 OS=Homo sapiens OX=9606 GN=NCBP1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 35.0 null 698-UNIMOD:1031,330-UNIMOD:1031,332-UNIMOD:4,654-UNIMOD:1031,657-UNIMOD:1031 0.05 35.0 15 3 1 PRT sp|Q08J23|NSUN2_HUMAN RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 35.0 null 650-UNIMOD:1031,640-UNIMOD:1031,654-UNIMOD:1031,93-UNIMOD:4,95-UNIMOD:1031,369-UNIMOD:1031,511-UNIMOD:1031,577-UNIMOD:1031 0.09 35.0 9 7 5 PRT sp|P02786|TFR1_HUMAN Transferrin receptor protein 1 OS=Homo sapiens OX=9606 GN=TFRC PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 35.0 null 224-UNIMOD:1031,193-UNIMOD:1031,693-UNIMOD:1031,53-UNIMOD:259,382-UNIMOD:1031,665-UNIMOD:1031,261-UNIMOD:1031,240-UNIMOD:1031,371-UNIMOD:1031,231-UNIMOD:1031 0.19 35.0 13 11 9 PRT sp|P07910-3|HNRPC_HUMAN Isoform 3 of Heterogeneous nuclear ribonucleoproteins C1/C2 OS=Homo sapiens OX=9606 GN=HNRNPC null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35.0 null 152-UNIMOD:1031,29-UNIMOD:1031,109-UNIMOD:1031,204-UNIMOD:1031,139-UNIMOD:1031,164-UNIMOD:1031,96-UNIMOD:1031,143-UNIMOD:1031,148-UNIMOD:35 0.42 35.0 8 8 8 PRT sp|Q92688-2|AN32B_HUMAN Isoform 2 of Acidic leucine-rich nuclear phosphoprotein 32 family member B OS=Homo sapiens OX=9606 GN=ANP32B null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35.0 null 123-UNIMOD:4,27-UNIMOD:4,28-UNIMOD:1031,68-UNIMOD:1031 0.28 35.0 4 4 3 PRT sp|Q2M389-2|WASC4_HUMAN Isoform 2 of WASH complex subunit 4 OS=Homo sapiens OX=9606 GN=WASHC4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35.0 null 233-UNIMOD:1031 0.02 35.0 1 1 1 PRT sp|Q8TD19|NEK9_HUMAN Serine/threonine-protein kinase Nek9 OS=Homo sapiens OX=9606 GN=NEK9 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 35.0 null 81-UNIMOD:1031,178-UNIMOD:1031,199-UNIMOD:1031,200-UNIMOD:1031 0.04 35.0 7 3 0 PRT sp|Q14978|NOLC1_HUMAN Nucleolar and coiled-body phosphoprotein 1 OS=Homo sapiens OX=9606 GN=NOLC1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 35.0 null 505-UNIMOD:1031,561-UNIMOD:1031,33-UNIMOD:1031,558-UNIMOD:1031,401-UNIMOD:1031,390-UNIMOD:1031,255-UNIMOD:1031,579-UNIMOD:1031,601-UNIMOD:1031,193-UNIMOD:1031,208-UNIMOD:1031,302-UNIMOD:1031,415-UNIMOD:1031,647-UNIMOD:1031,572-UNIMOD:1031,613-UNIMOD:1031,310-UNIMOD:1031,104-UNIMOD:1031,77-UNIMOD:1031,158-UNIMOD:1031,351-UNIMOD:1031 0.31 35.0 25 21 18 PRT sp|P61956-2|SUMO2_HUMAN Isoform 2 of Small ubiquitin-related modifier 2 OS=Homo sapiens OX=9606 GN=SUMO2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35.0 null 33-UNIMOD:1031,11-UNIMOD:1031,21-UNIMOD:259,42-UNIMOD:1031,44-UNIMOD:35,45-UNIMOD:1031,48-UNIMOD:4 0.62 35.0 13 5 0 PRT sp|O95479|G6PE_HUMAN GDH/6PGL endoplasmic bifunctional protein OS=Homo sapiens OX=9606 GN=H6PD PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35.0 null 208-UNIMOD:1031 0.02 35.0 1 1 1 PRT sp|Q9H8W4|PKHF2_HUMAN Pleckstrin homology domain-containing family F member 2 OS=Homo sapiens OX=9606 GN=PLEKHF2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35.0 null 44-UNIMOD:1031,46-UNIMOD:4 0.06 35.0 2 1 0 PRT sp|Q0VDF9|HSP7E_HUMAN Heat shock 70 kDa protein 14 OS=Homo sapiens OX=9606 GN=HSPA14 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 35.0 null 53-UNIMOD:1031,65-UNIMOD:35,66-UNIMOD:1031,68-UNIMOD:1031,89-UNIMOD:385,89-UNIMOD:4,94-UNIMOD:1031,97-UNIMOD:1031 0.10 35.0 8 4 1 PRT sp|P05787|K2C8_HUMAN Keratin, type II cytoskeletal 8 OS=Homo sapiens OX=9606 GN=KRT8 PE=1 SV=7 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35.0 null 295-UNIMOD:1031,347-UNIMOD:1031,325-UNIMOD:1031 0.09 35.0 3 3 3 PRT sp|P51991-2|ROA3_HUMAN Isoform 2 of Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35.0 null 174-UNIMOD:4,177-UNIMOD:1031,165-UNIMOD:1031,96-UNIMOD:1031 0.09 35.0 4 3 2 PRT sp|Q58FG0|HS905_HUMAN Putative heat shock protein HSP 90-alpha A5 OS=Homo sapiens OX=9606 GN=HSP90AA5P PE=2 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 35.0 null 257-UNIMOD:4,258-UNIMOD:1031,260-UNIMOD:35 0.08 35.0 3 2 0 PRT sp|Q14103|HNRPD_HUMAN Heterogeneous nuclear ribonucleoprotein D0 OS=Homo sapiens OX=9606 GN=HNRNPD PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 35.0 null 126-UNIMOD:4,129-UNIMOD:1031,197-UNIMOD:1031,165-UNIMOD:1031 0.13 35.0 3 3 1 PRT sp|Q14651|PLSI_HUMAN Plastin-1 OS=Homo sapiens OX=9606 GN=PLS1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 35.0 null 457-UNIMOD:1031,461-UNIMOD:4 0.02 35.0 1 1 1 PRT sp|P62244|RS15A_HUMAN 40S ribosomal protein S15a OS=Homo sapiens OX=9606 GN=RPS15A PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 35.0 null 12-UNIMOD:1031,4-UNIMOD:35,88-UNIMOD:1031,57-UNIMOD:267,60-UNIMOD:1031,84-UNIMOD:1031,71-UNIMOD:1031,72-UNIMOD:4,19-UNIMOD:1031 0.56 35.0 10 7 5 PRT sp|Q15365|PCBP1_HUMAN Poly(rC)-binding protein 1 OS=Homo sapiens OX=9606 GN=PCBP1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ] 35.0 null 23-UNIMOD:1031,20-UNIMOD:35,31-UNIMOD:1031,54-UNIMOD:4,57-UNIMOD:267,325-UNIMOD:267,32-UNIMOD:1031 0.19 35.0 9 7 6 PRT sp|Q9Y6E0|STK24_HUMAN Serine/threonine-protein kinase 24 OS=Homo sapiens OX=9606 GN=STK24 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 35.0 null 158-UNIMOD:1031,52-UNIMOD:1031,292-UNIMOD:1031 0.10 35.0 9 3 1 PRT sp|Q14568|HS902_HUMAN Heat shock protein HSP 90-alpha A2 OS=Homo sapiens OX=9606 GN=HSP90AA2P PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 35.0 null 112-UNIMOD:259,116-UNIMOD:259,112-UNIMOD:1031 0.05 35.0 30 1 0 PRT sp|P23526|SAHH_HUMAN Adenosylhomocysteinase OS=Homo sapiens OX=9606 GN=AHCY PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 35.0 null 20-UNIMOD:1031,401-UNIMOD:1031,389-UNIMOD:1031,419-UNIMOD:35,421-UNIMOD:4,426-UNIMOD:1031 0.13 35.0 5 4 1 PRT sp|P30048|PRDX3_HUMAN Thioredoxin-dependent peroxide reductase, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX3 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 35.0 null 83-UNIMOD:1031 0.07 35.0 1 1 1 PRT sp|P62249|RS16_HUMAN 40S ribosomal protein S16 OS=Homo sapiens OX=9606 GN=RPS16 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ] 34.0 null 98-UNIMOD:1031,73-UNIMOD:1031,4-UNIMOD:1031,109-UNIMOD:1031,17-UNIMOD:1031,25-UNIMOD:4,60-UNIMOD:1031,26-UNIMOD:1031,90-UNIMOD:1031,2-UNIMOD:1,26-UNIMOD:259,125-UNIMOD:267,105-UNIMOD:1031 0.65 34.0 14 11 9 PRT sp|Q8N108-19|MIER1_HUMAN Isoform 9 of Mesoderm induction early response protein 1 OS=Homo sapiens OX=9606 GN=MIER1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 34.0 null 242-UNIMOD:1031 0.04 34.0 2 1 0 PRT sp|O14965|AURKA_HUMAN Aurora kinase A OS=Homo sapiens OX=9606 GN=AURKA PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 34.0 null 258-UNIMOD:1031,271-UNIMOD:1031,143-UNIMOD:1031 0.07 34.0 6 2 1 PRT sp|Q16706|MA2A1_HUMAN Alpha-mannosidase 2 OS=Homo sapiens OX=9606 GN=MAN2A1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 34.0 null 191-UNIMOD:1031,716-UNIMOD:1031 0.02 34.0 2 2 2 PRT sp|P25098|ARBK1_HUMAN Beta-adrenergic receptor kinase 1 OS=Homo sapiens OX=9606 GN=GRK2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 34.0 null 319-UNIMOD:1031,399-UNIMOD:1031 0.04 34.0 3 2 1 PRT sp|Q9UBS0|KS6B2_HUMAN Ribosomal protein S6 kinase beta-2 OS=Homo sapiens OX=9606 GN=RPS6KB2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 34.0 null 196-UNIMOD:1031,201-UNIMOD:35 0.04 34.0 2 1 0 PRT sp|O15111|IKKA_HUMAN Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Homo sapiens OX=9606 GN=CHUK PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 34.0 null 146-UNIMOD:1031,158-UNIMOD:1031 0.02 34.0 3 1 0 PRT sp|O75396|SC22B_HUMAN Vesicle-trafficking protein SEC22b OS=Homo sapiens OX=9606 GN=SEC22B PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 34.0 null 38-UNIMOD:1031,43-UNIMOD:1031,178-UNIMOD:1031 0.16 34.0 4 3 2 PRT sp|P60866|RS20_HUMAN 40S ribosomal protein S20 OS=Homo sapiens OX=9606 GN=RPS20 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 34.0 null 8-UNIMOD:1031,70-UNIMOD:4,75-UNIMOD:1031,19-UNIMOD:267,34-UNIMOD:1031,36-UNIMOD:4,2-UNIMOD:1,4-UNIMOD:1031,99-UNIMOD:1031,30-UNIMOD:1031 0.50 34.0 11 7 5 PRT sp|Q8WW12|PCNP_HUMAN PEST proteolytic signal-containing nuclear protein OS=Homo sapiens OX=9606 GN=PCNP PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 34.0 null 150-UNIMOD:1031,34-UNIMOD:1031,167-UNIMOD:1031,152-UNIMOD:1031,160-UNIMOD:259,82-UNIMOD:1031,70-UNIMOD:1031,81-UNIMOD:1031 0.44 34.0 11 9 7 PRT sp|P17844-2|DDX5_HUMAN Isoform 2 of Probable ATP-dependent RNA helicase DDX5 OS=Homo sapiens OX=9606 GN=DDX5 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 34.0 null 391-UNIMOD:1031,358-UNIMOD:1031,312-UNIMOD:1031,155-UNIMOD:4,157-UNIMOD:1031,121-UNIMOD:4,128-UNIMOD:1031 0.19 34.0 10 8 5 PRT sp|P04183|KITH_HUMAN Thymidine kinase, cytosolic OS=Homo sapiens OX=9606 GN=TK1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 34.0 null 206-UNIMOD:4,211-UNIMOD:1031,180-UNIMOD:1031,185-UNIMOD:4,220-UNIMOD:1031,230-UNIMOD:4,50-UNIMOD:4,54-UNIMOD:1031 0.25 34.0 6 4 2 PRT sp|Q00577|PURA_HUMAN Transcriptional activator protein Pur-alpha OS=Homo sapiens OX=9606 GN=PURA PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 34.0 null 87-UNIMOD:1031,97-UNIMOD:1031,78-UNIMOD:1031 0.08 34.0 3 3 3 PRT sp|Q9Y3I0|RTCB_HUMAN RNA-splicing ligase RtcB homolog OS=Homo sapiens OX=9606 GN=RTCB PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 34.0 null 279-UNIMOD:1031,285-UNIMOD:1031 0.08 34.0 3 3 3 PRT sp|P30876|RPB2_HUMAN DNA-directed RNA polymerase II subunit RPB2 OS=Homo sapiens OX=9606 GN=POLR2B PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 34.0 null 942-UNIMOD:1031,945-UNIMOD:4,151-UNIMOD:1031,155-UNIMOD:35 0.02 34.0 3 2 1 PRT sp|Q96M32|KAD7_HUMAN Adenylate kinase 7 OS=Homo sapiens OX=9606 GN=AK7 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 34.0 null 371-UNIMOD:4,380-UNIMOD:1031 0.02 34.0 1 1 1 PRT sp|Q16576|RBBP7_HUMAN Histone-binding protein RBBP7 OS=Homo sapiens OX=9606 GN=RBBP7 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 34.0 null 116-UNIMOD:4,119-UNIMOD:1031,113-UNIMOD:1031,159-UNIMOD:1031,166-UNIMOD:4,155-UNIMOD:259,97-UNIMOD:4,101-UNIMOD:1031 0.18 34.0 5 5 5 PRT sp|P55036-2|PSMD4_HUMAN Isoform Rpn10E of 26S proteasome non-ATPase regulatory subunit 4 OS=Homo sapiens OX=9606 GN=PSMD4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 34.0 null 122-UNIMOD:1031,37-UNIMOD:4,40-UNIMOD:1031,126-UNIMOD:1031 0.15 34.0 3 3 3 PRT sp|P26599|PTBP1_HUMAN Polypyrimidine tract-binding protein 1 OS=Homo sapiens OX=9606 GN=PTBP1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 34.0 null 410-UNIMOD:1031,428-UNIMOD:1031,259-UNIMOD:1031,266-UNIMOD:1031,482-UNIMOD:1031,137-UNIMOD:1031,134-UNIMOD:1031,368-UNIMOD:1031 0.19 34.0 13 11 10 PRT sp|Q7Z6Z7-2|HUWE1_HUMAN Isoform 2 of E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 34.0 null 2267-UNIMOD:1031,1693-UNIMOD:1031,10-UNIMOD:1031,19-UNIMOD:4,1931-UNIMOD:1031,3341-UNIMOD:1031,3345-UNIMOD:4 0.02 34.0 7 7 7 PRT sp|Q99623|PHB2_HUMAN Prohibitin-2 OS=Homo sapiens OX=9606 GN=PHB2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 34.0 null 236-UNIMOD:1031,262-UNIMOD:1031,244-UNIMOD:1031,250-UNIMOD:1031,270-UNIMOD:267 0.15 34.0 6 5 4 PRT sp|P63279|UBC9_HUMAN SUMO-conjugating enzyme UBC9 OS=Homo sapiens OX=9606 GN=UBE2I PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 34.0 null 18-UNIMOD:1031,59-UNIMOD:1031 0.17 34.0 3 2 1 PRT sp|Q13442|HAP28_HUMAN 28 kDa heat- and acid-stable phosphoprotein OS=Homo sapiens OX=9606 GN=PDAP1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 34.0 null 75-UNIMOD:1031,105-UNIMOD:1031,52-UNIMOD:1031,127-UNIMOD:35,132-UNIMOD:1031,95-UNIMOD:1031,137-UNIMOD:1031,164-UNIMOD:1031,172-UNIMOD:1031,94-UNIMOD:1031 0.43 34.0 14 9 6 PRT sp|Q96CP2|FWCH2_HUMAN FLYWCH family member 2 OS=Homo sapiens OX=9606 GN=FLYWCH2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 34.0 null 60-UNIMOD:1031,64-UNIMOD:4,41-UNIMOD:1031,49-UNIMOD:1031 0.26 34.0 3 3 3 PRT sp|P55769|NH2L1_HUMAN NHP2-like protein 1 OS=Homo sapiens OX=9606 GN=SNU13 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 34.0 null 21-UNIMOD:1031,30-UNIMOD:4,37-UNIMOD:1031 0.18 34.0 2 2 2 PRT sp|O75534-2|CSDE1_HUMAN Isoform 2 of Cold shock domain-containing protein E1 OS=Homo sapiens OX=9606 GN=CSDE1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 34.0 null 727-UNIMOD:1031,208-UNIMOD:1031,614-UNIMOD:4,617-UNIMOD:1031,81-UNIMOD:1031,542-UNIMOD:1031 0.07 34.0 5 5 5 PRT sp|Q96C19|EFHD2_HUMAN EF-hand domain-containing protein D2 OS=Homo sapiens OX=9606 GN=EFHD2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 34.0 null 188-UNIMOD:1031,2-UNIMOD:1,9-UNIMOD:1031,102-UNIMOD:1031,134-UNIMOD:1031 0.23 34.0 5 4 3 PRT sp|P63000|RAC1_HUMAN Ras-related C3 botulinum toxin substrate 1 OS=Homo sapiens OX=9606 GN=RAC1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 34.0 null 147-UNIMOD:1031,166-UNIMOD:1031,153-UNIMOD:1031,157-UNIMOD:4,123-UNIMOD:1031,178-UNIMOD:4,183-UNIMOD:1031 0.32 34.0 7 5 3 PRT sp|P60891|PRPS1_HUMAN Ribose-phosphate pyrophosphokinase 1 OS=Homo sapiens OX=9606 GN=PRPS1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 34.0 null 165-UNIMOD:4,176-UNIMOD:1031,18-UNIMOD:1031,29-UNIMOD:1031,194-UNIMOD:1031,198-UNIMOD:1031 0.26 34.0 10 6 4 PRT sp|Q9NVE7|PANK4_HUMAN 4'-phosphopantetheine phosphatase OS=Homo sapiens OX=9606 GN=PANK4 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 34.0 null 171-UNIMOD:1031 0.02 34.0 1 1 1 PRT sp|Q9NPJ3-2|ACO13_HUMAN Isoform 2 of Acyl-coenzyme A thioesterase 13 OS=Homo sapiens OX=9606 GN=ACOT13 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 34.0 null 88-UNIMOD:1031,14-UNIMOD:1031,17-UNIMOD:4,19-UNIMOD:35,104-UNIMOD:1031,100-UNIMOD:259 0.37 34.0 4 4 3 PRT sp|Q04837|SSBP_HUMAN Single-stranded DNA-binding protein, mitochondrial OS=Homo sapiens OX=9606 GN=SSBP1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 34.0 null 122-UNIMOD:1031,81-UNIMOD:1031 0.36 34.0 3 3 3 PRT sp|P09661|RU2A_HUMAN U2 small nuclear ribonucleoprotein A' OS=Homo sapiens OX=9606 GN=SNRPA1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 34.0 null 179-UNIMOD:1031,221-UNIMOD:1031,192-UNIMOD:1031,56-UNIMOD:1031,149-UNIMOD:1031 0.19 34.0 5 5 5 PRT sp|P49736|MCM2_HUMAN DNA replication licensing factor MCM2 OS=Homo sapiens OX=9606 GN=MCM2 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 34.0 null 216-UNIMOD:1031,384-UNIMOD:1031,216-UNIMOD:259,469-UNIMOD:1031,742-UNIMOD:1031,896-UNIMOD:1031 0.07 34.0 10 6 4 PRT sp|P46782|RS5_HUMAN 40S ribosomal protein S5 OS=Homo sapiens OX=9606 GN=RPS5 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 34.0 null 172-UNIMOD:4,63-UNIMOD:1031,66-UNIMOD:4,182-UNIMOD:259 0.13 34.0 5 2 0 PRT sp|O60664-4|PLIN3_HUMAN Isoform 4 of Perilipin-3 OS=Homo sapiens OX=9606 GN=PLIN3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 34.0 null 84-UNIMOD:259,123-UNIMOD:35,277-UNIMOD:1031,152-UNIMOD:1031,60-UNIMOD:4,65-UNIMOD:1031,65-UNIMOD:259 0.16 34.0 7 6 5 PRT sp|Q13555-10|KCC2G_HUMAN Isoform 10 of Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Homo sapiens OX=9606 GN=CAMK2G null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 34.0 null 43-UNIMOD:1031,48-UNIMOD:1031,57-UNIMOD:1031 0.05 34.0 5 2 0 PRT sp|Q05682-5|CALD1_HUMAN Isoform 5 of Caldesmon OS=Homo sapiens OX=9606 GN=CALD1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 34.0 null 398-UNIMOD:1031 0.06 34.0 2 2 2 PRT sp|Q12906-5|ILF3_HUMAN Isoform 5 of Interleukin enhancer-binding factor 3 OS=Homo sapiens OX=9606 GN=ILF3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 34.0 null 577-UNIMOD:1031,601-UNIMOD:1031,413-UNIMOD:1031,535-UNIMOD:1031,454-UNIMOD:1031,573-UNIMOD:1031 0.10 34.0 7 6 3 PRT sp|Q13200-3|PSMD2_HUMAN Isoform 3 of 26S proteasome non-ATPase regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PSMD2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 34.0 null 728-UNIMOD:1031,220-UNIMOD:1031 0.04 34.0 2 2 1 PRT sp|P13693-2|TCTP_HUMAN Isoform 2 of Translationally-controlled tumor protein OS=Homo sapiens OX=9606 GN=TPT1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 34.0 null 78-UNIMOD:1031,81-UNIMOD:35,96-UNIMOD:259,59-UNIMOD:1031,62-UNIMOD:35,63-UNIMOD:1031 0.23 34.0 7 4 1 PRT sp|Q9NZJ9-3|NUDT4_HUMAN Isoform 3 of Diphosphoinositol polyphosphate phosphohydrolase 2 OS=Homo sapiens OX=9606 GN=NUDT4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 34.0 null 80-UNIMOD:4,82-UNIMOD:1031 0.12 34.0 1 1 1 PRT sp|P31949|S10AB_HUMAN Protein S100-A11 OS=Homo sapiens OX=9606 GN=S100A11 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 34.0 null 27-UNIMOD:1031,43-UNIMOD:35,52-UNIMOD:259,55-UNIMOD:1031,13-UNIMOD:385,13-UNIMOD:4,23-UNIMOD:1031,36-UNIMOD:1031,2-UNIMOD:1,3-UNIMOD:1031 0.59 34.0 11 6 4 PRT sp|P05455|LA_HUMAN Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 34.0 null 116-UNIMOD:1031,328-UNIMOD:1031,287-UNIMOD:1031,344-UNIMOD:1031,391-UNIMOD:1031,208-UNIMOD:1031,352-UNIMOD:1031,280-UNIMOD:1031 0.21 34.0 9 8 7 PRT sp|Q15084|PDIA6_HUMAN Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 34.0 null 132-UNIMOD:267,85-UNIMOD:1031,231-UNIMOD:267,368-UNIMOD:1031 0.15 34.0 5 4 1 PRT sp|P09874|PARP1_HUMAN Poly [ADP-ribose] polymerase 1 OS=Homo sapiens OX=9606 GN=PARP1 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 34.0 null 119-UNIMOD:1031,87-UNIMOD:1031,621-UNIMOD:1031,512-UNIMOD:1031,418-UNIMOD:1031,425-UNIMOD:1031,429-UNIMOD:4,498-UNIMOD:1031,23-UNIMOD:1031,24-UNIMOD:4,940-UNIMOD:1031,664-UNIMOD:1031 0.11 34.0 10 10 10 PRT sp|P11586|C1TC_HUMAN C-1-tetrahydrofolate synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=MTHFD1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 34.0 null 553-UNIMOD:1031,251-UNIMOD:1031,543-UNIMOD:1031,878-UNIMOD:259,854-UNIMOD:1031,863-UNIMOD:4,66-UNIMOD:1031,82-UNIMOD:35,83-UNIMOD:259,333-UNIMOD:1031 0.13 34.0 13 10 8 PRT sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens OX=9606 GN=RPS6KA1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 34.0 null 189-UNIMOD:1031,75-UNIMOD:1031,210-UNIMOD:1031,217-UNIMOD:1031 0.07 34.0 8 4 1 PRT sp|Q14847|LASP1_HUMAN LIM and SH3 domain protein 1 OS=Homo sapiens OX=9606 GN=LASP1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 34.0 null 121-UNIMOD:1031,75-UNIMOD:1031,96-UNIMOD:1031,17-UNIMOD:1031,20-UNIMOD:4 0.23 34.0 4 4 4 PRT sp|Q9NTK5|OLA1_HUMAN Obg-like ATPase 1 OS=Homo sapiens OX=9606 GN=OLA1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 34.0 null 75-UNIMOD:4,79-UNIMOD:1031,333-UNIMOD:1031,190-UNIMOD:1031,394-UNIMOD:1031 0.12 34.0 5 4 3 PRT sp|Q96C01|F136A_HUMAN Protein FAM136A OS=Homo sapiens OX=9606 GN=FAM136A PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 34.0 null 18-UNIMOD:1031,82-UNIMOD:4,86-UNIMOD:4,89-UNIMOD:1031 0.19 34.0 2 2 2 PRT sp|Q86UR5|RIMS1_HUMAN Regulating synaptic membrane exocytosis protein 1 OS=Homo sapiens OX=9606 GN=RIMS1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 34.0 null 1587-UNIMOD:4,1590-UNIMOD:1031,1578-UNIMOD:1031 0.01 34.0 4 2 0 PRT sp|P35249|RFC4_HUMAN Replication factor C subunit 4 OS=Homo sapiens OX=9606 GN=RFC4 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 34.0 null 84-UNIMOD:1031,240-UNIMOD:1031 0.12 34.0 2 2 2 PRT sp|Q13885|TBB2A_HUMAN Tubulin beta-2A chain OS=Homo sapiens OX=9606 GN=TUBB2A PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 34.0 null 363-UNIMOD:35,379-UNIMOD:259,324-UNIMOD:1031,354-UNIMOD:4,121-UNIMOD:267 0.14 34.0 13 4 0 PRT sp|P34931|HS71L_HUMAN Heat shock 70 kDa protein 1-like OS=Homo sapiens OX=9606 GN=HSPA1L PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ] 34.0 null 58-UNIMOD:1031,58-UNIMOD:259,73-UNIMOD:259,63-UNIMOD:35,73-UNIMOD:1031,114-UNIMOD:259,128-UNIMOD:259 0.07 34.0 17 3 1 PRT sp|Q86VP6|CAND1_HUMAN Cullin-associated NEDD8-dissociated protein 1 OS=Homo sapiens OX=9606 GN=CAND1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 33.0 null 355-UNIMOD:1031,356-UNIMOD:4,801-UNIMOD:1031,802-UNIMOD:4,577-UNIMOD:1031,1163-UNIMOD:1031,237-UNIMOD:4,70-UNIMOD:1031,71-UNIMOD:4,1158-UNIMOD:1031,1153-UNIMOD:4,1156-UNIMOD:1031,40-UNIMOD:1031,940-UNIMOD:4,942-UNIMOD:4,948-UNIMOD:267,55-UNIMOD:1031 0.10 33.0 11 11 11 PRT sp|P42704|LPPRC_HUMAN Leucine-rich PPR motif-containing protein, mitochondrial OS=Homo sapiens OX=9606 GN=LRPPRC PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 33.0 null 1098-UNIMOD:1031,868-UNIMOD:1031,1347-UNIMOD:1031,1332-UNIMOD:1031,672-UNIMOD:259,613-UNIMOD:1031,287-UNIMOD:1031,606-UNIMOD:28,1350-UNIMOD:1031,966-UNIMOD:1031,763-UNIMOD:1031,1326-UNIMOD:1031,1139-UNIMOD:267,292-UNIMOD:1031,1037-UNIMOD:259,760-UNIMOD:1031,1357-UNIMOD:1031 0.13 33.0 25 16 11 PRT sp|Q9Y263|PLAP_HUMAN Phospholipase A-2-activating protein OS=Homo sapiens OX=9606 GN=PLAA PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 33.0 null 315-UNIMOD:1031 0.02 33.0 1 1 1 PRT sp|Q9H444|CHM4B_HUMAN Charged multivesicular body protein 4b OS=Homo sapiens OX=9606 GN=CHMP4B PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 33.0 null 17-UNIMOD:1031,14-UNIMOD:1031,70-UNIMOD:1031 0.14 33.0 3 3 3 PRT sp|O75947-2|ATP5H_HUMAN Isoform 2 of ATP synthase subunit d, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5PD null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 33.0 null 63-UNIMOD:1031,77-UNIMOD:4,85-UNIMOD:1031,72-UNIMOD:1031 0.21 33.0 3 3 3 PRT sp|P02795|MT2_HUMAN Metallothionein-2 OS=Homo sapiens OX=9606 GN=MT2A PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 33.0 null 44-UNIMOD:4,48-UNIMOD:4,50-UNIMOD:4,51-UNIMOD:1031,33-UNIMOD:4,34-UNIMOD:4,36-UNIMOD:4,37-UNIMOD:4,41-UNIMOD:4 0.43 33.0 2 2 2 PRT sp|P37802|TAGL2_HUMAN Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 33.0 null 153-UNIMOD:1031,171-UNIMOD:1031,178-UNIMOD:35,79-UNIMOD:1031,85-UNIMOD:35,139-UNIMOD:267,130-UNIMOD:35,17-UNIMOD:1031 0.40 33.0 12 7 4 PRT sp|P62269|RS18_HUMAN 40S ribosomal protein S18 OS=Homo sapiens OX=9606 GN=RPS18 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 33.0 null 94-UNIMOD:1031,78-UNIMOD:1031,137-UNIMOD:1031,47-UNIMOD:1031 0.39 33.0 8 6 5 PRT sp|Q9NZ45|CISD1_HUMAN CDGSH iron-sulfur domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CISD1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 33.0 null 55-UNIMOD:1031,62-UNIMOD:35,105-UNIMOD:1031 0.32 33.0 4 2 1 PRT sp|Q12851-2|M4K2_HUMAN Isoform 2 of Mitogen-activated protein kinase kinase kinase kinase 2 OS=Homo sapiens OX=9606 GN=MAP4K2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 33.0 null 45-UNIMOD:1031,48-UNIMOD:1031 0.02 33.0 5 1 0 PRT sp|P60903|S10AA_HUMAN Protein S100-A10 OS=Homo sapiens OX=9606 GN=S100A10 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 33.0 null 47-UNIMOD:1031,23-UNIMOD:1031,57-UNIMOD:1031,62-UNIMOD:4,28-UNIMOD:1031,37-UNIMOD:1031,56-UNIMOD:35,35-UNIMOD:35 0.47 33.0 9 5 1 PRT sp|Q6P1R4|DUS1L_HUMAN tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like OS=Homo sapiens OX=9606 GN=DUS1L PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 33.0 null 182-UNIMOD:1031 0.04 33.0 1 1 1 PRT sp|P16435|NCPR_HUMAN NADPH--cytochrome P450 reductase OS=Homo sapiens OX=9606 GN=POR PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 33.0 null 602-UNIMOD:1031,602-UNIMOD:259,610-UNIMOD:259,186-UNIMOD:259 0.04 33.0 5 2 1 PRT sp|O94804|STK10_HUMAN Serine/threonine-protein kinase 10 OS=Homo sapiens OX=9606 GN=STK10 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 33.0 null 65-UNIMOD:1031,65-UNIMOD:259,70-UNIMOD:259,159-UNIMOD:1031,574-UNIMOD:1031,165-UNIMOD:35,172-UNIMOD:267,248-UNIMOD:1031 0.05 33.0 8 4 1 PRT sp|P62851|RS25_HUMAN 40S ribosomal protein S25 OS=Homo sapiens OX=9606 GN=RPS25 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ] 33.0 null 66-UNIMOD:1031,94-UNIMOD:1031,52-UNIMOD:1031,43-UNIMOD:1031,59-UNIMOD:4,60-UNIMOD:1031,98-UNIMOD:1031,114-UNIMOD:1031,20-UNIMOD:1031 0.62 33.0 11 8 5 PRT sp|P27635|RL10_HUMAN 60S ribosomal protein L10 OS=Homo sapiens OX=9606 GN=RPL10 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 33.0 null 188-UNIMOD:1031,195-UNIMOD:4,198-UNIMOD:1031,145-UNIMOD:1031,101-UNIMOD:1031,102-UNIMOD:35,105-UNIMOD:4,80-UNIMOD:4,82-UNIMOD:1031,76-UNIMOD:35,78-UNIMOD:1031,164-UNIMOD:1031,153-UNIMOD:267,184-UNIMOD:35 0.36 33.0 16 7 2 PRT sp|Q9GZU8|PIP30_HUMAN PSME3-interacting protein OS=Homo sapiens OX=9606 GN=PSME3IP1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 33.0 null 151-UNIMOD:1031,65-UNIMOD:1031,160-UNIMOD:1031,62-UNIMOD:1031,146-UNIMOD:1031,130-UNIMOD:1031 0.21 33.0 6 6 6 PRT sp|Q9BQ61|TRIR_HUMAN Telomerase RNA component interacting RNase OS=Homo sapiens OX=9606 GN=TRIR PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 33.0 null 118-UNIMOD:1031,146-UNIMOD:1031,106-UNIMOD:1031,161-UNIMOD:1031,165-UNIMOD:4,124-UNIMOD:1031,72-UNIMOD:1031,73-UNIMOD:35,134-UNIMOD:1031 0.38 33.0 9 7 5 PRT sp|Q9C0J8|WDR33_HUMAN pre-mRNA 3' end processing protein WDR33 OS=Homo sapiens OX=9606 GN=WDR33 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 33.0 null 264-UNIMOD:1031 0.01 33.0 1 1 1 PRT sp|P08574|CY1_HUMAN Cytochrome c1, heme protein, mitochondrial OS=Homo sapiens OX=9606 GN=CYC1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 33.0 null 139-UNIMOD:4,146-UNIMOD:259 0.04 33.0 1 1 1 PRT sp|P18085|ARF4_HUMAN ADP-ribosylation factor 4 OS=Homo sapiens OX=9606 GN=ARF4 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 33.0 null 97-UNIMOD:267 0.17 33.0 2 2 2 PRT sp|Q04637-6|IF4G1_HUMAN Isoform E of Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 33.0 null 397-UNIMOD:1031,328-UNIMOD:1031,811-UNIMOD:1031,748-UNIMOD:1031,823-UNIMOD:1031,685-UNIMOD:1031,1256-UNIMOD:1031,1048-UNIMOD:1031,992-UNIMOD:1031,830-UNIMOD:1031 0.08 33.0 11 10 9 PRT sp|P00533|EGFR_HUMAN Epidermal growth factor receptor OS=Homo sapiens OX=9606 GN=EGFR PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 33.0 null 860-UNIMOD:1031,875-UNIMOD:1031,879-UNIMOD:1031,745-UNIMOD:1031 0.03 33.0 5 3 2 PRT sp|P51665|PSMD7_HUMAN 26S proteasome non-ATPase regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PSMD7 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 33.0 null 199-UNIMOD:1031,204-UNIMOD:1031,177-UNIMOD:267 0.14 33.0 4 3 2 PRT sp|Q15599-3|NHRF2_HUMAN Isoform 3 of Na(+)/H(+) exchange regulatory cofactor NHE-RF2 OS=Homo sapiens OX=9606 GN=SLC9A3R2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 33.0 null 45-UNIMOD:1031 0.07 33.0 1 1 1 PRT sp|P35241|RADI_HUMAN Radixin OS=Homo sapiens OX=9606 GN=RDX PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 33.0 null 526-UNIMOD:1031,400-UNIMOD:1031,360-UNIMOD:1031,556-UNIMOD:259,327-UNIMOD:1031,383-UNIMOD:1031,3-UNIMOD:1031 0.13 33.0 8 7 6 PRT sp|P62805|H4_HUMAN Histone H4 OS=Homo sapiens OX=9606 GN=H4C1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 33.0 null 80-UNIMOD:1031,78-UNIMOD:1031,32-UNIMOD:1031,9-UNIMOD:1031 0.45 33.0 6 4 3 PRT sp|Q16204|CCDC6_HUMAN Coiled-coil domain-containing protein 6 OS=Homo sapiens OX=9606 GN=CCDC6 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 33.0 null 71-UNIMOD:1031,266-UNIMOD:1031,119-UNIMOD:1031 0.06 33.0 3 3 3 PRT sp|Q9NZ01|TECR_HUMAN Very-long-chain enoyl-CoA reductase OS=Homo sapiens OX=9606 GN=TECR PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 33.0 null 18-UNIMOD:4,22-UNIMOD:1031,16-UNIMOD:1031,291-UNIMOD:1031 0.12 33.0 4 4 4 PRT sp|P55209-2|NP1L1_HUMAN Isoform 2 of Nucleosome assembly protein 1-like 1 OS=Homo sapiens OX=9606 GN=NAP1L1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 33.0 null 87-UNIMOD:1031,88-UNIMOD:4,82-UNIMOD:1031,116-UNIMOD:1031,271-UNIMOD:1031,151-UNIMOD:1031,266-UNIMOD:1031 0.18 33.0 7 7 6 PRT sp|Q9GZZ9-2|UBA5_HUMAN Isoform 2 of Ubiquitin-like modifier-activating enzyme 5 OS=Homo sapiens OX=9606 GN=UBA5 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 33.0 null 71-UNIMOD:1031 0.06 33.0 1 1 1 PRT sp|P24539|AT5F1_HUMAN ATP synthase F(0) complex subunit B1, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5PB PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 33.0 null 131-UNIMOD:1031,139-UNIMOD:1031,233-UNIMOD:259,162-UNIMOD:1031 0.20 33.0 5 4 3 PRT sp|O76094-2|SRP72_HUMAN Isoform 2 of Signal recognition particle subunit SRP72 OS=Homo sapiens OX=9606 GN=SRP72 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 33.0 null 322-UNIMOD:1031,443-UNIMOD:1031,587-UNIMOD:259,595-UNIMOD:259 0.07 33.0 3 3 3 PRT sp|P60660-2|MYL6_HUMAN Isoform Smooth muscle of Myosin light polypeptide 6 OS=Homo sapiens OX=9606 GN=MYL6 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 33.0 null 81-UNIMOD:1031 0.11 33.0 1 1 1 PRT sp|P46779|RL28_HUMAN 60S ribosomal protein L28 OS=Homo sapiens OX=9606 GN=RPL28 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 33.0 null 22-UNIMOD:1031,47-UNIMOD:1031,33-UNIMOD:1031,13-UNIMOD:4,19-UNIMOD:1031,58-UNIMOD:259,33-UNIMOD:259,84-UNIMOD:1031,58-UNIMOD:1031 0.46 33.0 12 9 6 PRT sp|P47712|PA24A_HUMAN Cytosolic phospholipase A2 OS=Homo sapiens OX=9606 GN=PLA2G4A PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 33.0 null 588-UNIMOD:1031,176-UNIMOD:1031,271-UNIMOD:1031,741-UNIMOD:1031,601-UNIMOD:1031 0.09 33.0 5 5 5 PRT sp|Q16539-5|MK14_HUMAN Isoform 5 of Mitogen-activated protein kinase 14 OS=Homo sapiens OX=9606 GN=MAPK14 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 33.0 null 15-UNIMOD:1031 0.05 33.0 3 1 0 PRT sp|P42766|RL35_HUMAN 60S ribosomal protein L35 OS=Homo sapiens OX=9606 GN=RPL35 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 33.0 null 25-UNIMOD:1031,66-UNIMOD:1031,35-UNIMOD:1031,43-UNIMOD:1031,20-UNIMOD:28,97-UNIMOD:1031,103-UNIMOD:1031,43-UNIMOD:259,46-UNIMOD:259,19-UNIMOD:1031 0.49 33.0 11 7 4 PRT sp|Q9H8X2|IPPK_HUMAN Inositol-pentakisphosphate 2-kinase OS=Homo sapiens OX=9606 GN=IPPK PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 33.0 null 209-UNIMOD:1031 0.03 33.0 3 1 0 PRT sp|P20962|PTMS_HUMAN Parathymosin OS=Homo sapiens OX=9606 GN=PTMS PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ] 33.0 null 15-UNIMOD:1031,2-UNIMOD:1,4-UNIMOD:1031,92-UNIMOD:1031,15-UNIMOD:259,27-UNIMOD:1031 0.38 33.0 5 5 5 PRT sp|Q15233|NONO_HUMAN Non-POU domain-containing octamer-binding protein OS=Homo sapiens OX=9606 GN=NONO PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 33.0 null 11-UNIMOD:1031,239-UNIMOD:1031,99-UNIMOD:1031,467-UNIMOD:1031,109-UNIMOD:1031,249-UNIMOD:1031 0.17 33.0 10 6 2 PRT sp|P61106|RAB14_HUMAN Ras-related protein Rab-14 OS=Homo sapiens OX=9606 GN=RAB14 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 33.0 null 170-UNIMOD:259 0.07 33.0 1 1 1 PRT sp|P53384-2|NUBP1_HUMAN Isoform 2 of Cytosolic Fe-S cluster assembly factor NUBP1 OS=Homo sapiens OX=9606 GN=NUBP1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 33.0 null 264-UNIMOD:1031,266-UNIMOD:4 0.05 33.0 1 1 1 PRT sp|P60520|GBRL2_HUMAN Gamma-aminobutyric acid receptor-associated protein-like 2 OS=Homo sapiens OX=9606 GN=GABARAPL2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 33.0 null 46-UNIMOD:1031,15-UNIMOD:4,20-UNIMOD:1031 0.19 33.0 2 2 2 PRT sp|Q6FI81|CPIN1_HUMAN Anamorsin OS=Homo sapiens OX=9606 GN=CIAPIN1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 33.0 null 48-UNIMOD:1031 0.05 33.0 1 1 1 PRT sp|P61224-2|RAP1B_HUMAN Isoform 2 of Ras-related protein Rap-1b OS=Homo sapiens OX=9606 GN=RAP1B null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 33.0 null 81-UNIMOD:1031 0.09 33.0 1 1 1 PRT sp|Q15645|PCH2_HUMAN Pachytene checkpoint protein 2 homolog OS=Homo sapiens OX=9606 GN=TRIP13 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 33.0 null 185-UNIMOD:1031,189-UNIMOD:4,316-UNIMOD:1031,288-UNIMOD:1031,190-UNIMOD:1031,35-UNIMOD:1031,195-UNIMOD:1031,379-UNIMOD:1031 0.18 33.0 9 7 5 PRT sp|Q9HAB8|PPCS_HUMAN Phosphopantothenate--cysteine ligase OS=Homo sapiens OX=9606 GN=PPCS PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 33.0 null 46-UNIMOD:1031,209-UNIMOD:35,212-UNIMOD:1031,219-UNIMOD:1031 0.09 33.0 12 2 1 PRT sp|Q99471-2|PFD5_HUMAN Isoform 2 of Prefoldin subunit 5 OS=Homo sapiens OX=9606 GN=PFDN5 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 33.0 null 47-UNIMOD:1031,49-UNIMOD:4,42-UNIMOD:1031 0.29 33.0 2 2 2 PRT sp|P25398|RS12_HUMAN 40S ribosomal protein S12 OS=Homo sapiens OX=9606 GN=RPS12 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 33.0 null 106-UNIMOD:4,108-UNIMOD:4,112-UNIMOD:1031,102-UNIMOD:1031,121-UNIMOD:1031,84-UNIMOD:1031,92-UNIMOD:4,93-UNIMOD:1031,33-UNIMOD:267,116-UNIMOD:1031,129-UNIMOD:1031,130-UNIMOD:4,40-UNIMOD:1031 0.49 33.0 11 9 7 PRT sp|P27361|MK03_HUMAN Mitogen-activated protein kinase 3 OS=Homo sapiens OX=9606 GN=MAPK3 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 33.0 null 168-UNIMOD:1031,178-UNIMOD:4,168-UNIMOD:259,181-UNIMOD:259 0.04 33.0 37 1 0 PRT sp|Q9NWW6|NRK1_HUMAN Nicotinamide riboside kinase 1 OS=Homo sapiens OX=9606 GN=NMRK1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 33.0 null 16-UNIMOD:1031 0.10 33.0 3 1 0 PRT sp|Q7RTV0|PHF5A_HUMAN PHD finger-like domain-containing protein 5A OS=Homo sapiens OX=9606 GN=PHF5A PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ] 33.0 null 95-UNIMOD:1031,2-UNIMOD:1,3-UNIMOD:1031,11-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:1031,26-UNIMOD:4 0.34 33.0 3 3 3 PRT sp|P23443|KS6B1_HUMAN Ribosomal protein S6 kinase beta-1 OS=Homo sapiens OX=9606 GN=RPS6KB1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 33.0 null 220-UNIMOD:1031 0.03 33.0 1 1 0 PRT sp|O95819|M4K4_HUMAN Mitogen-activated protein kinase kinase kinase kinase 4 OS=Homo sapiens OX=9606 GN=MAP4K4 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 33.0 null 155-UNIMOD:1031 0.01 33.0 1 1 0 PRT sp|Q00796|DHSO_HUMAN Sorbitol dehydrogenase OS=Homo sapiens OX=9606 GN=SORD PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ] 33.0 null 2-UNIMOD:1,6-UNIMOD:1031,140-UNIMOD:4 0.08 33.0 2 2 2 PRT sp|Q9NP79|VTA1_HUMAN Vacuolar protein sorting-associated protein VTA1 homolog OS=Homo sapiens OX=9606 GN=VTA1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 33.0 null 2-UNIMOD:1,15-UNIMOD:1031,29-UNIMOD:1031 0.10 33.0 2 2 2 PRT sp|P49841|GSK3B_HUMAN Glycogen synthase kinase-3 beta OS=Homo sapiens OX=9606 GN=GSK3B PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 33.0 null 183-UNIMOD:1031,183-UNIMOD:259,197-UNIMOD:259,76-UNIMOD:4,86-UNIMOD:1031 0.07 33.0 6 2 1 PRT sp|Q32MZ4|LRRF1_HUMAN Leucine-rich repeat flightless-interacting protein 1 OS=Homo sapiens OX=9606 GN=LRRFIP1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 33.0 null 185-UNIMOD:1031 0.03 33.0 1 1 1 PRT sp|Q00341|VIGLN_HUMAN Vigilin OS=Homo sapiens OX=9606 GN=HDLBP PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 33.0 null 494-UNIMOD:1031,308-UNIMOD:1031 0.02 33.0 2 2 2 PRT sp|P61956|SUMO2_HUMAN Small ubiquitin-related modifier 2 OS=Homo sapiens OX=9606 GN=SUMO2 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 33.0 null 33-UNIMOD:259,35-UNIMOD:259,45-UNIMOD:1031,48-UNIMOD:4 0.25 33.0 2 2 0 PRT sp|P09622|DLDH_HUMAN Dihydrolipoyl dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=DLD PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 32.0 null 430-UNIMOD:1031,438-UNIMOD:35,143-UNIMOD:1031,159-UNIMOD:1031,66-UNIMOD:1031,69-UNIMOD:4,277-UNIMOD:1031,122-UNIMOD:1031,440-UNIMOD:259 0.17 32.0 9 8 7 PRT sp|O75937|DNJC8_HUMAN DnaJ homolog subfamily C member 8 OS=Homo sapiens OX=9606 GN=DNAJC8 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 32.0 null 127-UNIMOD:1031,135-UNIMOD:1031,231-UNIMOD:1031 0.12 32.0 4 3 2 PRT sp|P16152|CBR1_HUMAN Carbonyl reductase [NADPH] 1 OS=Homo sapiens OX=9606 GN=CBR1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 32.0 null 148-UNIMOD:1031,150-UNIMOD:4,122-UNIMOD:4,130-UNIMOD:1031 0.10 32.0 2 2 2 PRT sp|P56381|ATP5E_HUMAN ATP synthase subunit epsilon, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1E PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 32.0 null 37-UNIMOD:1031,44-UNIMOD:1031,19-UNIMOD:4,21-UNIMOD:1031,28-UNIMOD:1031,32-UNIMOD:1031 0.67 32.0 5 5 5 PRT sp|P48449-2|ERG7_HUMAN Isoform 2 of Lanosterol synthase OS=Homo sapiens OX=9606 GN=LSS null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 32.0 null 390-UNIMOD:1031,391-UNIMOD:4 0.03 32.0 1 1 0 PRT sp|Q8N5S9|KKCC1_HUMAN Calcium/calmodulin-dependent protein kinase kinase 1 OS=Homo sapiens OX=9606 GN=CAMKK1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 32.0 null 277-UNIMOD:1031,157-UNIMOD:1031,156-UNIMOD:35 0.05 32.0 4 2 0 PRT sp|O00443|P3C2A_HUMAN Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha OS=Homo sapiens OX=9606 GN=PIK3C2A PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 32.0 null 1597-UNIMOD:1031 0.01 32.0 1 1 1 PRT sp|P08621-2|RU17_HUMAN Isoform 2 of U1 small nuclear ribonucleoprotein 70 kDa OS=Homo sapiens OX=9606 GN=SNRNP70 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 32.0 null 162-UNIMOD:1031,157-UNIMOD:35,27-UNIMOD:1031,130-UNIMOD:1031 0.10 32.0 4 3 2 PRT sp|P52564-2|MP2K6_HUMAN Isoform 2 of Dual specificity mitogen-activated protein kinase kinase 6 OS=Homo sapiens OX=9606 GN=MAP2K6 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 32.0 null 125-UNIMOD:1031,138-UNIMOD:1031,26-UNIMOD:1031,23-UNIMOD:35 0.11 32.0 24 2 0 PRT sp|P47813|IF1AX_HUMAN Eukaryotic translation initiation factor 1A, X-chromosomal OS=Homo sapiens OX=9606 GN=EIF1AX PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 32.0 null 88-UNIMOD:1031,16-UNIMOD:1031,104-UNIMOD:1031,40-UNIMOD:1031 0.38 32.0 4 4 4 PRT sp|Q9Y617|SERC_HUMAN Phosphoserine aminotransferase OS=Homo sapiens OX=9606 GN=PSAT1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 32.0 null 127-UNIMOD:1031,311-UNIMOD:1031,51-UNIMOD:1031,61-UNIMOD:267 0.13 32.0 5 4 3 PRT sp|P30084|ECHM_HUMAN Enoyl-CoA hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=ECHS1 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 32.0 null 118-UNIMOD:1031 0.04 32.0 1 1 1 PRT sp|P50213-2|IDH3A_HUMAN Isoform 2 of Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=IDH3A null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 32.0 null 22-UNIMOD:1031,253-UNIMOD:4,258-UNIMOD:1031 0.12 32.0 2 2 2 PRT sp|P40222|TXLNA_HUMAN Alpha-taxilin OS=Homo sapiens OX=9606 GN=TXLNA PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 32.0 null 330-UNIMOD:1031,325-UNIMOD:1031,256-UNIMOD:1031,12-UNIMOD:1031,224-UNIMOD:1031,359-UNIMOD:1031 0.12 32.0 8 6 5 PRT sp|P54709|AT1B3_HUMAN Sodium/potassium-transporting ATPase subunit beta-3 OS=Homo sapiens OX=9606 GN=ATP1B3 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 32.0 null 259-UNIMOD:1031,182-UNIMOD:1031 0.09 32.0 2 2 2 PRT sp|P61769|B2MG_HUMAN Beta-2-microglobulin OS=Homo sapiens OX=9606 GN=B2M PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 32.0 null 68-UNIMOD:1031,111-UNIMOD:1031,45-UNIMOD:4,26-UNIMOD:1031 0.51 32.0 5 4 3 PRT sp|P55145|MANF_HUMAN Mesencephalic astrocyte-derived neurotrophic factor OS=Homo sapiens OX=9606 GN=MANF PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 32.0 null 94-UNIMOD:1031,154-UNIMOD:4,157-UNIMOD:1031 0.16 32.0 3 2 1 PRT sp|Q6L8Q7-2|PDE12_HUMAN Isoform 2 of 2',5'-phosphodiesterase 12 OS=Homo sapiens OX=9606 GN=PDE12 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 32.0 null 377-UNIMOD:1031 0.02 32.0 2 1 0 PRT sp|P05783|K1C18_HUMAN Keratin, type I cytoskeletal 18 OS=Homo sapiens OX=9606 GN=KRT18 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 32.0 null 417-UNIMOD:1031,426-UNIMOD:1031,187-UNIMOD:1031,317-UNIMOD:1031,215-UNIMOD:1031 0.12 32.0 6 5 4 PRT sp|P51397|DAP1_HUMAN Death-associated protein 1 OS=Homo sapiens OX=9606 GN=DAP PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 32.0 null 29-UNIMOD:1031,12-UNIMOD:1031,101-UNIMOD:267,37-UNIMOD:1031 0.37 32.0 6 4 2 PRT sp|Q99543-2|DNJC2_HUMAN Isoform 2 of DnaJ homolog subfamily C member 2 OS=Homo sapiens OX=9606 GN=DNAJC2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 32.0 null 554-UNIMOD:1031 0.02 32.0 1 1 1 PRT sp|Q8IZQ5|SELH_HUMAN Selenoprotein H OS=Homo sapiens OX=9606 GN=SELENOH PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 32.0 null 9-UNIMOD:1031 0.11 32.0 1 1 1 PRT sp|P30622-2|CLIP1_HUMAN Isoform 3 of CAP-Gly domain-containing linker protein 1 OS=Homo sapiens OX=9606 GN=CLIP1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 32.0 null 346-UNIMOD:1031,660-UNIMOD:1031,949-UNIMOD:1031,991-UNIMOD:1031 0.03 32.0 4 4 4 PRT sp|O75822-3|EIF3J_HUMAN Isoform 3 of Eukaryotic translation initiation factor 3 subunit J OS=Homo sapiens OX=9606 GN=EIF3J null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 32.0 null 73-UNIMOD:1031,27-UNIMOD:1031,158-UNIMOD:4,161-UNIMOD:1031,68-UNIMOD:1031,112-UNIMOD:1031,175-UNIMOD:1031 0.37 32.0 7 6 5 PRT sp|P17812|PYRG1_HUMAN CTP synthase 1 OS=Homo sapiens OX=9606 GN=CTPS1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 32.0 null 466-UNIMOD:1031,299-UNIMOD:4,306-UNIMOD:1031,84-UNIMOD:1031,490-UNIMOD:1031,491-UNIMOD:4,557-UNIMOD:1031,559-UNIMOD:4 0.10 32.0 5 5 5 PRT sp|P20042|IF2B_HUMAN Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 32.0 null 216-UNIMOD:1031,226-UNIMOD:4,265-UNIMOD:1031,227-UNIMOD:259,324-UNIMOD:1031,276-UNIMOD:1031,281-UNIMOD:4,284-UNIMOD:4 0.15 32.0 7 6 5 PRT sp|P30041|PRDX6_HUMAN Peroxiredoxin-6 OS=Homo sapiens OX=9606 GN=PRDX6 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 32.0 null 144-UNIMOD:1031,199-UNIMOD:1031,209-UNIMOD:1031,56-UNIMOD:1031,47-UNIMOD:4,91-UNIMOD:4,53-UNIMOD:267,204-UNIMOD:1031,97-UNIMOD:1031,106-UNIMOD:267 0.42 32.0 10 9 8 PRT sp|Q14320|FA50A_HUMAN Protein FAM50A OS=Homo sapiens OX=9606 GN=FAM50A PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 32.0 null 298-UNIMOD:1031,305-UNIMOD:1031 0.06 32.0 4 2 0 PRT sp|Q05932-3|FOLC_HUMAN Isoform 3 of Folylpolyglutamate synthase, mitochondrial OS=Homo sapiens OX=9606 GN=FPGS null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 32.0 null 55-UNIMOD:1031,57-UNIMOD:1031,61-UNIMOD:4,66-UNIMOD:4 0.05 32.0 2 2 1 PRT sp|O75794|CD123_HUMAN Cell division cycle protein 123 homolog OS=Homo sapiens OX=9606 GN=CDC123 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 32.0 null 308-UNIMOD:1031,168-UNIMOD:1031,170-UNIMOD:4,24-UNIMOD:1031 0.14 32.0 4 3 2 PRT sp|Q00536|CDK16_HUMAN Cyclin-dependent kinase 16 OS=Homo sapiens OX=9606 GN=CDK16 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 32.0 null 194-UNIMOD:1031,288-UNIMOD:1031 0.05 32.0 3 2 1 PRT sp|P53618|COPB_HUMAN Coatomer subunit beta OS=Homo sapiens OX=9606 GN=COPB1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 32.0 null 771-UNIMOD:1031,107-UNIMOD:1031,703-UNIMOD:1031,651-UNIMOD:1031 0.07 32.0 6 5 4 PRT sp|P11908|PRPS2_HUMAN Ribose-phosphate pyrophosphokinase 2 OS=Homo sapiens OX=9606 GN=PRPS2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 32.0 null 165-UNIMOD:4,176-UNIMOD:1031 0.05 32.0 6 1 0 PRT sp|O43933|PEX1_HUMAN Peroxisome biogenesis factor 1 OS=Homo sapiens OX=9606 GN=PEX1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 32.0 null 601-UNIMOD:1031,629-UNIMOD:4,630-UNIMOD:1031 0.02 32.0 3 2 1 PRT sp|Q6PHR2-2|ULK3_HUMAN Isoform 2 of Serine/threonine-protein kinase ULK3 OS=Homo sapiens OX=9606 GN=ULK3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 32.0 null 139-UNIMOD:1031,44-UNIMOD:1031,45-UNIMOD:4,48-UNIMOD:1031 0.14 32.0 3 2 1 PRT sp|P08708|RS17_HUMAN 40S ribosomal protein S17 OS=Homo sapiens OX=9606 GN=RPS17 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 32.0 null 49-UNIMOD:1031,58-UNIMOD:35,126-UNIMOD:35,129-UNIMOD:1031,59-UNIMOD:1031,32-UNIMOD:1031,35-UNIMOD:4,44-UNIMOD:1031,19-UNIMOD:1031,45-UNIMOD:1031 0.53 32.0 15 7 2 PRT sp|Q16512|PKN1_HUMAN Serine/threonine-protein kinase N1 OS=Homo sapiens OX=9606 GN=PKN1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 32.0 null 644-UNIMOD:1031 0.01 32.0 1 1 1 PRT sp|Q4G0N4|NAKD2_HUMAN NAD kinase 2, mitochondrial OS=Homo sapiens OX=9606 GN=NADK2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 32.0 null 304-UNIMOD:1031,311-UNIMOD:4,303-UNIMOD:28,317-UNIMOD:1031,76-UNIMOD:1031 0.06 32.0 7 2 0 PRT sp|Q9BW71-3|HIRP3_HUMAN Isoform 3 of HIRA-interacting protein 3 OS=Homo sapiens OX=9606 GN=HIRIP3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 32.0 null 47-UNIMOD:1031 0.07 32.0 1 1 1 PRT sp|O14828-2|SCAM3_HUMAN Isoform 2 of Secretory carrier-associated membrane protein 3 OS=Homo sapiens OX=9606 GN=SCAMP3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 32.0 null 76-UNIMOD:1031,287-UNIMOD:259 0.10 32.0 4 3 2 PRT sp|Q02878|RL6_HUMAN 60S ribosomal protein L6 OS=Homo sapiens OX=9606 GN=RPL6 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 32.0 null 192-UNIMOD:1031,210-UNIMOD:1031,262-UNIMOD:1031,207-UNIMOD:1031,260-UNIMOD:1031,218-UNIMOD:1031,237-UNIMOD:259,237-UNIMOD:1031,239-UNIMOD:1031,218-UNIMOD:259,26-UNIMOD:1031,131-UNIMOD:1031,124-UNIMOD:1031,285-UNIMOD:259,8-UNIMOD:1031 0.45 32.0 19 16 13 PRT sp|O43684-2|BUB3_HUMAN Isoform 2 of Mitotic checkpoint protein BUB3 OS=Homo sapiens OX=9606 GN=BUB3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 32.0 null 129-UNIMOD:4,139-UNIMOD:259 0.04 32.0 2 1 0 PRT sp|P11166|GTR1_HUMAN Solute carrier family 2, facilitated glucose transporter member 1 OS=Homo sapiens OX=9606 GN=SLC2A1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 32.0 null 468-UNIMOD:267,245-UNIMOD:1031 0.09 32.0 6 3 1 PRT sp|Q15370|ELOB_HUMAN Elongin-B OS=Homo sapiens OX=9606 GN=ELOB PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 32.0 null 19-UNIMOD:1031,11-UNIMOD:1031,19-UNIMOD:259 0.17 32.0 5 3 2 PRT sp|O75792|RNH2A_HUMAN Ribonuclease H2 subunit A OS=Homo sapiens OX=9606 GN=RNASEH2A PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 32.0 null 69-UNIMOD:1031 0.04 32.0 1 1 1 PRT sp|Q08257-2|QOR_HUMAN Isoform 2 of Quinone oxidoreductase OS=Homo sapiens OX=9606 GN=CRYZ null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 32.0 null 187-UNIMOD:1031 0.09 32.0 2 1 0 PRT sp|Q96AG4|LRC59_HUMAN Leucine-rich repeat-containing protein 59 OS=Homo sapiens OX=9606 GN=LRRC59 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 32.0 null 131-UNIMOD:4,135-UNIMOD:1031,137-UNIMOD:4,40-UNIMOD:1031,48-UNIMOD:4,7-UNIMOD:1031,219-UNIMOD:1031,180-UNIMOD:1031,201-UNIMOD:1031,138-UNIMOD:1031,140-UNIMOD:4 0.23 32.0 9 7 5 PRT sp|Q9UNF1|MAGD2_HUMAN Melanoma-associated antigen D2 OS=Homo sapiens OX=9606 GN=MAGED2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 32.0 null 181-UNIMOD:1031,494-UNIMOD:1031,133-UNIMOD:1031,125-UNIMOD:1031,59-UNIMOD:1031 0.10 32.0 6 5 4 PRT sp|O60925|PFD1_HUMAN Prefoldin subunit 1 OS=Homo sapiens OX=9606 GN=PFDN1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ] 32.0 null 28-UNIMOD:1031,26-UNIMOD:1031,2-UNIMOD:1,10-UNIMOD:1031 0.26 32.0 3 3 3 PRT sp|Q9Y230-2|RUVB2_HUMAN Isoform 2 of RuvB-like 2 OS=Homo sapiens OX=9606 GN=RUVBL2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 32.0 null 152-UNIMOD:1031,182-UNIMOD:4,189-UNIMOD:1031,382-UNIMOD:1031,323-UNIMOD:1031,115-UNIMOD:1031,156-UNIMOD:1031 0.16 32.0 6 6 6 PRT sp|Q15942-2|ZYX_HUMAN Isoform 2 of Zyxin OS=Homo sapiens OX=9606 GN=ZYX null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 32.0 null 171-UNIMOD:1031 0.05 32.0 1 1 1 PRT sp|P26368-2|U2AF2_HUMAN Isoform 2 of Splicing factor U2AF 65 kDa subunit OS=Homo sapiens OX=9606 GN=U2AF2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 32.0 null 458-UNIMOD:1031,460-UNIMOD:4,70-UNIMOD:1031,15-UNIMOD:1031 0.08 32.0 3 3 2 PRT sp|O00418|EF2K_HUMAN Eukaryotic elongation factor 2 kinase OS=Homo sapiens OX=9606 GN=EEF2K PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 32.0 null 238-UNIMOD:1031,347-UNIMOD:1031,170-UNIMOD:1031 0.05 32.0 6 3 2 PRT sp|P78527|PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens OX=9606 GN=PRKDC PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 32.0 null 3747-UNIMOD:27,3753-UNIMOD:1031,2694-UNIMOD:1031,4023-UNIMOD:1031,2746-UNIMOD:1031,3877-UNIMOD:1031,3650-UNIMOD:1031,4019-UNIMOD:1031,4020-UNIMOD:35,3710-UNIMOD:1031 0.02 32.0 12 9 3 PRT sp|Q01105|SET_HUMAN Protein SET OS=Homo sapiens OX=9606 GN=SET PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 32.0 null 68-UNIMOD:1031 0.06 32.0 1 1 0 PRT sp|P52209|6PGD_HUMAN 6-phosphogluconate dehydrogenase, decarboxylating OS=Homo sapiens OX=9606 GN=PGD PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 32.0 null 38-UNIMOD:1031,261-UNIMOD:1031 0.05 32.0 2 2 0 PRT sp|O00506|STK25_HUMAN Serine/threonine-protein kinase 25 OS=Homo sapiens OX=9606 GN=STK25 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 32.0 null 142-UNIMOD:1031,142-UNIMOD:259,155-UNIMOD:259 0.04 32.0 8 1 0 PRT sp|P00367|DHE3_HUMAN Glutamate dehydrogenase 1, mitochondrial OS=Homo sapiens OX=9606 GN=GLUD1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 32.0 null 503-UNIMOD:1031,545-UNIMOD:1031 0.06 32.0 2 2 1 PRT sp|Q9NR30|DDX21_HUMAN Nucleolar RNA helicase 2 OS=Homo sapiens OX=9606 GN=DDX21 PE=1 SV=5 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 32.0 null 658-UNIMOD:1031 0.02 32.0 1 1 1 PRT sp|P07339|CATD_HUMAN Cathepsin D OS=Homo sapiens OX=9606 GN=CTSD PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 32.0 null 184-UNIMOD:1031,127-UNIMOD:1031,345-UNIMOD:1031 0.12 32.0 4 4 4 PRT sp|P24752|THIL_HUMAN Acetyl-CoA acetyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=ACAT1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 32.0 null 174-UNIMOD:1031,243-UNIMOD:1031,119-UNIMOD:4 0.14 32.0 5 3 1 PRT sp|Q9UBE0|SAE1_HUMAN SUMO-activating enzyme subunit 1 OS=Homo sapiens OX=9606 GN=SAE1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 32.0 null 183-UNIMOD:1031,210-UNIMOD:1031,214-UNIMOD:4 0.07 32.0 2 2 2 PRT sp|P05023|AT1A1_HUMAN Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 32.0 null 487-UNIMOD:1031 0.02 32.0 1 1 0 PRT sp|Q07021|C1QBP_HUMAN Complement component 1 Q subcomponent-binding protein, mitochondrial OS=Homo sapiens OX=9606 GN=C1QBP PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ] 32.0 null 91-UNIMOD:1031,174-UNIMOD:259,91-UNIMOD:259 0.13 32.0 6 3 1 PRT sp|Q13572|ITPK1_HUMAN Inositol-tetrakisphosphate 1-kinase OS=Homo sapiens OX=9606 GN=ITPK1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 32.0 null 237-UNIMOD:1031 0.06 32.0 2 1 0 PRT sp|O95070|YIF1A_HUMAN Protein YIF1A OS=Homo sapiens OX=9606 GN=YIF1A PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 32.0 null 2-UNIMOD:1,13-UNIMOD:1031 0.05 32.0 3 2 1 PRT sp|Q8WXI9|P66B_HUMAN Transcriptional repressor p66-beta OS=Homo sapiens OX=9606 GN=GATAD2B PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 32.0 null 52-UNIMOD:1031 0.03 32.0 1 1 1 PRT sp|P13929|ENOB_HUMAN Beta-enolase OS=Homo sapiens OX=9606 GN=ENO3 PE=1 SV=5 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 32.0 null 357-UNIMOD:4,358-UNIMOD:259 0.04 32.0 1 1 1 PRT sp|P78417|GSTO1_HUMAN Glutathione S-transferase omega-1 OS=Homo sapiens OX=9606 GN=GSTO1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 32.0 null 188-UNIMOD:1031,192-UNIMOD:4,11-UNIMOD:1031,136-UNIMOD:1031,143-UNIMOD:1031 0.21 32.0 5 5 5 PRT sp|P62136|PP1A_HUMAN Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Homo sapiens OX=9606 GN=PPP1CA PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 32.0 null 155-UNIMOD:4,158-UNIMOD:4,260-UNIMOD:1031,140-UNIMOD:4,141-UNIMOD:1031 0.14 32.0 4 3 1 PRT sp|Q12851|M4K2_HUMAN Mitogen-activated protein kinase kinase kinase kinase 2 OS=Homo sapiens OX=9606 GN=MAP4K2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 32.0 null 45-UNIMOD:259,48-UNIMOD:259,45-UNIMOD:1031 0.02 32.0 2 1 0 PRT sp|Q92733|PRCC_HUMAN Proline-rich protein PRCC OS=Homo sapiens OX=9606 GN=PRCC PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 31.0 null 250-UNIMOD:1031,443-UNIMOD:1031 0.05 31.0 3 2 1 PRT sp|O95218-2|ZRAB2_HUMAN Isoform 2 of Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 31.0 null 54-UNIMOD:1031,137-UNIMOD:1031,95-UNIMOD:1031 0.11 31.0 3 3 3 PRT sp|P12277|KCRB_HUMAN Creatine kinase B-type OS=Homo sapiens OX=9606 GN=CKB PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 31.0 null 298-UNIMOD:1031,307-UNIMOD:1031,304-UNIMOD:1031 0.09 31.0 4 4 4 PRT sp|Q9NX58|LYAR_HUMAN Cell growth-regulating nucleolar protein OS=Homo sapiens OX=9606 GN=LYAR PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 31.0 null 320-UNIMOD:1031,335-UNIMOD:1031,364-UNIMOD:1031 0.11 31.0 3 3 3 PRT sp|P51617-4|IRAK1_HUMAN Isoform 4 of Interleukin-1 receptor-associated kinase 1 OS=Homo sapiens OX=9606 GN=IRAK1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 31.0 null 342-UNIMOD:1031 0.04 31.0 1 1 0 PRT sp|Q13247-3|SRSF6_HUMAN Isoform SRP55-3 of Serine/arginine-rich splicing factor 6 OS=Homo sapiens OX=9606 GN=SRSF6 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 31.0 null 165-UNIMOD:1031,143-UNIMOD:1031,182-UNIMOD:1031 0.14 31.0 4 4 3 PRT sp|P49207|RL34_HUMAN 60S ribosomal protein L34 OS=Homo sapiens OX=9606 GN=RPL34 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 31.0 null 43-UNIMOD:1031,46-UNIMOD:4,49-UNIMOD:4,101-UNIMOD:1031,83-UNIMOD:4,85-UNIMOD:1031,86-UNIMOD:4,19-UNIMOD:1031,108-UNIMOD:1031,115-UNIMOD:1031,105-UNIMOD:1031 0.54 31.0 8 8 8 PRT sp|P46940|IQGA1_HUMAN Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens OX=9606 GN=IQGAP1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 31.0 null 1528-UNIMOD:1031,1571-UNIMOD:1031,924-UNIMOD:1031,1128-UNIMOD:1031,1445-UNIMOD:1031,88-UNIMOD:1031,1088-UNIMOD:1031,1168-UNIMOD:1031,806-UNIMOD:1031,567-UNIMOD:259,1270-UNIMOD:4,503-UNIMOD:1031,1534-UNIMOD:4,1433-UNIMOD:1031 0.11 31.0 18 14 11 PRT sp|Q8NE71-2|ABCF1_HUMAN Isoform 2 of ATP-binding cassette sub-family F member 1 OS=Homo sapiens OX=9606 GN=ABCF1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 31.0 null 174-UNIMOD:1031,551-UNIMOD:1031,304-UNIMOD:1031 0.05 31.0 4 3 2 PRT sp|O75385|ULK1_HUMAN Serine/threonine-protein kinase ULK1 OS=Homo sapiens OX=9606 GN=ULK1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 31.0 null 140-UNIMOD:1031 0.02 31.0 1 1 1 PRT sp|P24941-2|CDK2_HUMAN Isoform 2 of Cyclin-dependent kinase 2 OS=Homo sapiens OX=9606 GN=CDK2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 31.0 null 129-UNIMOD:1031,33-UNIMOD:1031,142-UNIMOD:1031,34-UNIMOD:1031 0.11 31.0 10 2 0 PRT sp|Q13164-4|MK07_HUMAN Isoform 4 of Mitogen-activated protein kinase 7 OS=Homo sapiens OX=9606 GN=MAPK7 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 31.0 null 102-UNIMOD:1031,112-UNIMOD:4 0.04 31.0 1 1 1 PRT sp|P11802|CDK4_HUMAN Cyclin-dependent kinase 4 OS=Homo sapiens OX=9606 GN=CDK4 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 31.0 null 35-UNIMOD:1031 0.05 31.0 2 1 0 PRT sp|Q9Y2H1-2|ST38L_HUMAN Isoform 2 of Serine/threonine-protein kinase 38-like OS=Homo sapiens OX=9606 GN=STK38L null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 31.0 null 26-UNIMOD:1031,122-UNIMOD:1031,25-UNIMOD:35 0.07 31.0 4 2 0 PRT sp|Q15208|STK38_HUMAN Serine/threonine-protein kinase 38 OS=Homo sapiens OX=9606 GN=STK38 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 31.0 null 117-UNIMOD:35,118-UNIMOD:1031,234-UNIMOD:4,238-UNIMOD:1031,128-UNIMOD:1031,214-UNIMOD:1031 0.11 31.0 12 4 1 PRT sp|P48730-2|KC1D_HUMAN Isoform 2 of Casein kinase I isoform delta OS=Homo sapiens OX=9606 GN=CSNK1D null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 31.0 null 130-UNIMOD:1031 0.03 31.0 1 1 1 PRT sp|Q96QR8|PURB_HUMAN Transcriptional activator protein Pur-beta OS=Homo sapiens OX=9606 GN=PURB PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 31.0 null 60-UNIMOD:1031,70-UNIMOD:1031 0.05 31.0 3 2 1 PRT sp|O43776|SYNC_HUMAN Asparagine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=NARS1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 31.0 null 445-UNIMOD:1031,449-UNIMOD:35,60-UNIMOD:1031,490-UNIMOD:1031 0.07 31.0 4 3 2 PRT sp|Q9UNZ2-6|NSF1C_HUMAN Isoform 4 of NSFL1 cofactor p47 OS=Homo sapiens OX=9606 GN=NSFL1C null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 31.0 null 16-UNIMOD:1031 0.05 31.0 1 1 0 PRT sp|P52272-2|HNRPM_HUMAN Isoform 2 of Heterogeneous nuclear ribonucleoprotein M OS=Homo sapiens OX=9606 GN=HNRNPM null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 31.0 null 655-UNIMOD:4,659-UNIMOD:1031,145-UNIMOD:1031,134-UNIMOD:1031,653-UNIMOD:1031,69-UNIMOD:1031 0.08 31.0 6 5 4 PRT sp|Q9P0L0|VAPA_HUMAN Vesicle-associated membrane protein-associated protein A OS=Homo sapiens OX=9606 GN=VAPA PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 31.0 null 38-UNIMOD:1031,211-UNIMOD:1031,52-UNIMOD:1031 0.16 31.0 3 3 3 PRT sp|A2RUC4-2|TYW5_HUMAN Isoform 2 of tRNA wybutosine-synthesizing protein 5 OS=Homo sapiens OX=9606 GN=TYW5 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 31.0 null 31-UNIMOD:1031 0.11 31.0 1 1 1 PRT sp|O75063|XYLK_HUMAN Glycosaminoglycan xylosylkinase OS=Homo sapiens OX=9606 GN=FAM20B PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 31.0 null 109-UNIMOD:1031,104-UNIMOD:1031 0.05 31.0 2 2 2 PRT sp|P46734-2|MP2K3_HUMAN Isoform 1 of Dual specificity mitogen-activated protein kinase kinase 3 OS=Homo sapiens OX=9606 GN=MAP2K3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 31.0 null 64-UNIMOD:1031,163-UNIMOD:1031,61-UNIMOD:35 0.08 31.0 4 2 1 PRT sp|P46776|RL27A_HUMAN 60S ribosomal protein L27a OS=Homo sapiens OX=9606 GN=RPL27A PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 31.0 null 47-UNIMOD:1031,94-UNIMOD:1031,55-UNIMOD:1031,110-UNIMOD:1031,59-UNIMOD:1031,119-UNIMOD:1031,58-UNIMOD:35,125-UNIMOD:1031,120-UNIMOD:28,55-UNIMOD:259 0.39 31.0 15 9 4 PRT sp|Q7Z7G8-2|VP13B_HUMAN Isoform 2 of Vacuolar protein sorting-associated protein 13B OS=Homo sapiens OX=9606 GN=VPS13B null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 31.0 null 1336-UNIMOD:1031 0.00 31.0 1 1 1 PRT sp|O95782-2|AP2A1_HUMAN Isoform B of AP-2 complex subunit alpha-1 OS=Homo sapiens OX=9606 GN=AP2A1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 31.0 null 620-UNIMOD:1031 0.01 31.0 1 1 0 PRT sp|Q9UII2|ATIF1_HUMAN ATPase inhibitor, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5IF1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 31.0 null 72-UNIMOD:259,82-UNIMOD:259,72-UNIMOD:1031,82-UNIMOD:1031,83-UNIMOD:1031,71-UNIMOD:1031 0.19 31.0 15 4 1 PRT sp|P46781|RS9_HUMAN 40S ribosomal protein S9 OS=Homo sapiens OX=9606 GN=RPS9 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 31.0 null 139-UNIMOD:1031,116-UNIMOD:1031,155-UNIMOD:1031,30-UNIMOD:1031,92-UNIMOD:35,93-UNIMOD:1031,66-UNIMOD:1031,91-UNIMOD:1031,180-UNIMOD:259,47-UNIMOD:1031,11-UNIMOD:1031,52-UNIMOD:1031 0.66 31.0 16 12 10 PRT sp|Q9P016-2|THYN1_HUMAN Isoform 2 of Thymocyte nuclear protein 1 OS=Homo sapiens OX=9606 GN=THYN1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 31.0 null 16-UNIMOD:1031 0.09 31.0 1 1 1 PRT sp|P62750|RL23A_HUMAN 60S ribosomal protein L23a OS=Homo sapiens OX=9606 GN=RPL23A PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 31.0 null 78-UNIMOD:1031,30-UNIMOD:1031,14-UNIMOD:1031,89-UNIMOD:1031,70-UNIMOD:1031,110-UNIMOD:1031,7-UNIMOD:1031,36-UNIMOD:1031,152-UNIMOD:259 0.45 31.0 14 9 5 PRT sp|P08133-2|ANXA6_HUMAN Isoform 2 of Annexin A6 OS=Homo sapiens OX=9606 GN=ANXA6 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 31.0 null 413-UNIMOD:1031,414-UNIMOD:1031,416-UNIMOD:35,588-UNIMOD:1031,402-UNIMOD:35,410-UNIMOD:1031 0.07 31.0 4 3 2 PRT sp|Q13619-2|CUL4A_HUMAN Isoform 2 of Cullin-4A OS=Homo sapiens OX=9606 GN=CUL4A null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 31.0 null 380-UNIMOD:1031,383-UNIMOD:4,365-UNIMOD:1031,533-UNIMOD:4,535-UNIMOD:1031,649-UNIMOD:1031 0.08 31.0 4 4 4 PRT sp|Q14C86-3|GAPD1_HUMAN Isoform 3 of GTPase-activating protein and VPS9 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=GAPVD1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 31.0 null 888-UNIMOD:1031,1153-UNIMOD:1031,1008-UNIMOD:1031 0.03 31.0 3 3 3 PRT sp|Q7KZF4|SND1_HUMAN Staphylococcal nuclease domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SND1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 31.0 null 152-UNIMOD:4,157-UNIMOD:1031,513-UNIMOD:1031,386-UNIMOD:1031,515-UNIMOD:1031,491-UNIMOD:1031 0.06 31.0 5 5 5 PRT sp|Q8NCF5|NF2IP_HUMAN NFATC2-interacting protein OS=Homo sapiens OX=9606 GN=NFATC2IP PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 31.0 null 131-UNIMOD:1031 0.05 31.0 1 1 1 PRT sp|P62328|TYB4_HUMAN Thymosin beta-4 OS=Homo sapiens OX=9606 GN=TMSB4X PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ] 31.0 null 32-UNIMOD:1031,2-UNIMOD:1,7-UNIMOD:35,26-UNIMOD:1031,4-UNIMOD:1031 0.73 31.0 4 3 2 PRT sp|Q01085|TIAR_HUMAN Nucleolysin TIAR OS=Homo sapiens OX=9606 GN=TIAL1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 31.0 null 138-UNIMOD:1031 0.03 31.0 1 1 1 PRT sp|P25205|MCM3_HUMAN DNA replication licensing factor MCM3 OS=Homo sapiens OX=9606 GN=MCM3 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 31.0 null 732-UNIMOD:1031,293-UNIMOD:1031,248-UNIMOD:1031,688-UNIMOD:1031 0.06 31.0 5 4 3 PRT sp|P40939|ECHA_HUMAN Trifunctional enzyme subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=HADHA PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 31.0 null 322-UNIMOD:4,326-UNIMOD:259,644-UNIMOD:1031,390-UNIMOD:1031,46-UNIMOD:259,353-UNIMOD:1031,415-UNIMOD:1031,262-UNIMOD:1031 0.10 31.0 9 7 5 PRT sp|Q14019|COTL1_HUMAN Coactosin-like protein OS=Homo sapiens OX=9606 GN=COTL1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 31.0 null 102-UNIMOD:1031,118-UNIMOD:1031,7-UNIMOD:1031,10-UNIMOD:4 0.22 31.0 4 3 2 PRT sp|O75648-5|MTU1_HUMAN Isoform 5 of Mitochondrial tRNA-specific 2-thiouridylase 1 OS=Homo sapiens OX=9606 GN=TRMU null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 31.0 null 101-UNIMOD:4,103-UNIMOD:1031 0.08 31.0 2 1 0 PRT sp|P20700|LMNB1_HUMAN Lamin-B1 OS=Homo sapiens OX=9606 GN=LMNB1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 31.0 null 271-UNIMOD:1031,124-UNIMOD:1031,79-UNIMOD:1031,134-UNIMOD:1031,261-UNIMOD:1031 0.14 31.0 6 6 6 PRT sp|P31040-2|SDHA_HUMAN Isoform 2 of Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Homo sapiens OX=9606 GN=SDHA null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 31.0 null 488-UNIMOD:4,490-UNIMOD:1031,576-UNIMOD:1031,287-UNIMOD:1031,134-UNIMOD:1031,499-UNIMOD:1031 0.10 31.0 5 5 5 PRT sp|Q712K3|UB2R2_HUMAN Ubiquitin-conjugating enzyme E2 R2 OS=Homo sapiens OX=9606 GN=UBE2R2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 31.0 null 191-UNIMOD:4,193-UNIMOD:1031 0.06 31.0 1 1 1 PRT sp|Q9UBE0-2|SAE1_HUMAN Isoform 2 of SUMO-activating enzyme subunit 1 OS=Homo sapiens OX=9606 GN=SAE1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 31.0 null 195-UNIMOD:1031 0.05 31.0 1 1 1 PRT sp|P42167|LAP2B_HUMAN Lamina-associated polypeptide 2, isoforms beta/gamma OS=Homo sapiens OX=9606 GN=TMPO PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 31.0 null 303-UNIMOD:1031,393-UNIMOD:1031,334-UNIMOD:1031,207-UNIMOD:1031,213-UNIMOD:1031 0.17 31.0 6 6 6 PRT sp|P48163|MAOX_HUMAN NADP-dependent malic enzyme OS=Homo sapiens OX=9606 GN=ME1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 31.0 null 60-UNIMOD:1031,519-UNIMOD:1031 0.06 31.0 5 3 2 PRT sp|O75436|VP26A_HUMAN Vacuolar protein sorting-associated protein 26A OS=Homo sapiens OX=9606 GN=VPS26A PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 31.0 null 242-UNIMOD:1031,35-UNIMOD:1031 0.08 31.0 2 2 2 PRT sp|P31689-2|DNJA1_HUMAN Isoform 2 of DnaJ homolog subfamily A member 1 OS=Homo sapiens OX=9606 GN=DNAJA1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 31.0 null 37-UNIMOD:1031,301-UNIMOD:1031,302-UNIMOD:4,134-UNIMOD:4,136-UNIMOD:1031,137-UNIMOD:4 0.12 31.0 4 3 2 PRT sp|Q12931|TRAP1_HUMAN Heat shock protein 75 kDa, mitochondrial OS=Homo sapiens OX=9606 GN=TRAP1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 31.0 null 402-UNIMOD:267,181-UNIMOD:1031,624-UNIMOD:35,629-UNIMOD:1031,375-UNIMOD:1031,598-UNIMOD:1031,109-UNIMOD:1031,573-UNIMOD:4,647-UNIMOD:267,652-UNIMOD:1031,653-UNIMOD:1031 0.17 31.0 13 11 5 PRT sp|P09493|TPM1_HUMAN Tropomyosin alpha-1 chain OS=Homo sapiens OX=9606 GN=TPM1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 31.0 null 141-UNIMOD:35,149-UNIMOD:1031 0.05 31.0 2 1 0 PRT sp|Q92841|DDX17_HUMAN Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens OX=9606 GN=DDX17 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 31.0 null 274-UNIMOD:1031,277-UNIMOD:4,313-UNIMOD:1031,480-UNIMOD:267,414-UNIMOD:35,420-UNIMOD:259 0.08 31.0 5 4 2 PRT sp|Q02543|RL18A_HUMAN 60S ribosomal protein L18a OS=Homo sapiens OX=9606 GN=RPL18A PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 31.0 null 16-UNIMOD:385,16-UNIMOD:4,21-UNIMOD:1031,22-UNIMOD:4,41-UNIMOD:1031,64-UNIMOD:4,70-UNIMOD:259,136-UNIMOD:1031,137-UNIMOD:4,151-UNIMOD:1031,149-UNIMOD:1031 0.44 31.0 12 8 5 PRT sp|Q8N4P3|MESH1_HUMAN Guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase MESH1 OS=Homo sapiens OX=9606 GN=HDDC3 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 31.0 null 93-UNIMOD:1031 0.17 31.0 3 2 1 PRT sp|Q9NPJ3|ACO13_HUMAN Acyl-coenzyme A thioesterase 13 OS=Homo sapiens OX=9606 GN=ACOT13 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 31.0 null 37-UNIMOD:1031,40-UNIMOD:4,136-UNIMOD:1031,13-UNIMOD:1031 0.24 31.0 3 3 2 PRT sp|O95782|AP2A1_HUMAN AP-2 complex subunit alpha-1 OS=Homo sapiens OX=9606 GN=AP2A1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 31.0 null 620-UNIMOD:1031 0.01 31.0 1 1 0 PRT sp|Q99829|CPNE1_HUMAN Copine-1 OS=Homo sapiens OX=9606 GN=CPNE1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 31.0 null 182-UNIMOD:1031 0.04 31.0 2 2 2 PRT sp|Q04446|GLGB_HUMAN 1,4-alpha-glucan-branching enzyme OS=Homo sapiens OX=9606 GN=GBE1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 31.0 null 68-UNIMOD:1031,554-UNIMOD:1031,143-UNIMOD:1031 0.05 31.0 4 3 2 PRT sp|P10606|COX5B_HUMAN Cytochrome c oxidase subunit 5B, mitochondrial OS=Homo sapiens OX=9606 GN=COX5B PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 31.0 null 57-UNIMOD:1031,86-UNIMOD:1031 0.21 31.0 2 2 2 PRT sp|P52594|AGFG1_HUMAN Arf-GAP domain and FG repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=AGFG1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 31.0 null 318-UNIMOD:1031 0.02 31.0 1 1 1 PRT sp|Q01081|U2AF1_HUMAN Splicing factor U2AF 35 kDa subunit OS=Homo sapiens OX=9606 GN=U2AF1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 31.0 null 2-UNIMOD:1,13-UNIMOD:1031 0.06 31.0 1 1 1 PRT sp|P26196|DDX6_HUMAN Probable ATP-dependent RNA helicase DDX6 OS=Homo sapiens OX=9606 GN=DDX6 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 31.0 null 162-UNIMOD:1031 0.03 31.0 1 1 1 PRT sp|Q92973|TNPO1_HUMAN Transportin-1 OS=Homo sapiens OX=9606 GN=TNPO1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 31.0 null 85-UNIMOD:1031,869-UNIMOD:1031 0.04 31.0 2 2 2 PRT sp|Q13310|PABP4_HUMAN Polyadenylate-binding protein 4 OS=Homo sapiens OX=9606 GN=PABPC4 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 31.0 null 104-UNIMOD:1031,375-UNIMOD:1031,240-UNIMOD:1031 0.07 31.0 3 3 2 PRT sp|O14744-3|ANM5_HUMAN Isoform 3 of Protein arginine N-methyltransferase 5 OS=Homo sapiens OX=9606 GN=PRMT5 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 30.0 null 179-UNIMOD:1031,180-UNIMOD:1031,319-UNIMOD:1031 0.04 30.0 3 2 1 PRT sp|O00141-4|SGK1_HUMAN Isoform 4 of Serine/threonine-protein kinase Sgk1 OS=Homo sapiens OX=9606 GN=SGK1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 30.0 null 117-UNIMOD:1031,121-UNIMOD:1031 0.03 30.0 1 1 1 PRT sp|Q92945|FUBP2_HUMAN Far upstream element-binding protein 2 OS=Homo sapiens OX=9606 GN=KHSRP PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 30.0 null 251-UNIMOD:1031,257-UNIMOD:1031,359-UNIMOD:1031,347-UNIMOD:1031,71-UNIMOD:1031,488-UNIMOD:1031 0.10 30.0 7 6 4 PRT sp|O43765|SGTA_HUMAN Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Homo sapiens OX=9606 GN=SGTA PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 30.0 null 153-UNIMOD:4,160-UNIMOD:1031,200-UNIMOD:1031,93-UNIMOD:267 0.12 30.0 3 3 3 PRT sp|P11279|LAMP1_HUMAN Lysosome-associated membrane glycoprotein 1 OS=Homo sapiens OX=9606 GN=LAMP1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 30.0 null 337-UNIMOD:1031,338-UNIMOD:4,146-UNIMOD:267 0.07 30.0 3 2 1 PRT sp|Q99873-5|ANM1_HUMAN Isoform 4 of Protein arginine N-methyltransferase 1 OS=Homo sapiens OX=9606 GN=PRMT1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 30.0 null 116-UNIMOD:1031 0.05 30.0 1 1 1 PRT sp|P32119|PRDX2_HUMAN Peroxiredoxin-2 OS=Homo sapiens OX=9606 GN=PRDX2 PE=1 SV=5 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 30.0 null 26-UNIMOD:1031,10-UNIMOD:1031,127-UNIMOD:267,34-UNIMOD:1031 0.20 30.0 6 4 3 PRT sp|O00592-2|PODXL_HUMAN Isoform 2 of Podocalyxin OS=Homo sapiens OX=9606 GN=PODXL null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 30.0 null 362-UNIMOD:1031,363-UNIMOD:4 0.03 30.0 1 1 1 PRT sp|P61927|RL37_HUMAN 60S ribosomal protein L37 OS=Homo sapiens OX=9606 GN=RPL37 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 30.0 null 31-UNIMOD:1031,34-UNIMOD:4,22-UNIMOD:4,25-UNIMOD:1031,36-UNIMOD:1031,37-UNIMOD:4,22-UNIMOD:385,14-UNIMOD:1031,19-UNIMOD:4,68-UNIMOD:1031,42-UNIMOD:1031,85-UNIMOD:1031 0.51 30.0 12 7 2 PRT sp|P62280|RS11_HUMAN 40S ribosomal protein S11 OS=Homo sapiens OX=9606 GN=RPS11 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 30.0 null 12-UNIMOD:1031,38-UNIMOD:1031,45-UNIMOD:1031,79-UNIMOD:1031,80-UNIMOD:35,59-UNIMOD:1031,60-UNIMOD:4,58-UNIMOD:1031,147-UNIMOD:1031,144-UNIMOD:1031,13-UNIMOD:28,20-UNIMOD:1031,32-UNIMOD:1031,30-UNIMOD:1031,136-UNIMOD:1031 0.58 30.0 19 11 5 PRT sp|Q14004-2|CDK13_HUMAN Isoform 2 of Cyclin-dependent kinase 13 OS=Homo sapiens OX=9606 GN=CDK13 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 30.0 null 839-UNIMOD:1031,840-UNIMOD:4,1045-UNIMOD:1031 0.02 30.0 2 2 2 PRT sp|P48729-3|KC1A_HUMAN Isoform 3 of Casein kinase I isoform alpha OS=Homo sapiens OX=9606 GN=CSNK1A1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 30.0 null 138-UNIMOD:1031,144-UNIMOD:35 0.04 30.0 7 1 0 PRT sp|P27448-6|MARK3_HUMAN Isoform 5 of MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens OX=9606 GN=MARK3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 30.0 null 180-UNIMOD:1031,190-UNIMOD:35,99-UNIMOD:1031,85-UNIMOD:1031 0.06 30.0 5 3 2 PRT sp|O60307|MAST3_HUMAN Microtubule-associated serine/threonine-protein kinase 3 OS=Homo sapiens OX=9606 GN=MAST3 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 30.0 null 492-UNIMOD:1031,505-UNIMOD:1031 0.01 30.0 3 1 0 PRT sp|P23458|JAK1_HUMAN Tyrosine-protein kinase JAK1 OS=Homo sapiens OX=9606 GN=JAK1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 30.0 null 716-UNIMOD:4,718-UNIMOD:1031 0.01 30.0 2 1 0 PRT sp|P52815|RM12_HUMAN 39S ribosomal protein L12, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL12 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 30.0 null 150-UNIMOD:1031,178-UNIMOD:1031,138-UNIMOD:1031,173-UNIMOD:1031 0.24 30.0 5 4 3 PRT sp|P06703|S10A6_HUMAN Protein S100-A6 OS=Homo sapiens OX=9606 GN=S100A6 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 30.0 null 40-UNIMOD:1031,47-UNIMOD:1031,26-UNIMOD:1031,35-UNIMOD:1031,35-UNIMOD:259,40-UNIMOD:259,55-UNIMOD:267 0.38 30.0 9 5 2 PRT sp|Q8N543|OGFD1_HUMAN Prolyl 3-hydroxylase OGFOD1 OS=Homo sapiens OX=9606 GN=OGFOD1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 30.0 null 91-UNIMOD:1031 0.03 30.0 1 1 1 PRT sp|P28070|PSB4_HUMAN Proteasome subunit beta type-4 OS=Homo sapiens OX=9606 GN=PSMB4 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 30.0 null 201-UNIMOD:1031 0.06 30.0 1 1 1 PRT sp|Q9Y4W6|AFG32_HUMAN AFG3-like protein 2 OS=Homo sapiens OX=9606 GN=AFG3L2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 30.0 null 354-UNIMOD:1031 0.02 30.0 1 1 1 PRT sp|P05114|HMGN1_HUMAN Non-histone chromosomal protein HMG-14 OS=Homo sapiens OX=9606 GN=HMGN1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 30.0 null 61-UNIMOD:1031 0.27 30.0 2 2 2 PRT sp|P33316-2|DUT_HUMAN Isoform 2 of Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=DUT null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 30.0 null 118-UNIMOD:1031 0.09 30.0 1 1 1 PRT sp|P09923|PPBI_HUMAN Intestinal-type alkaline phosphatase OS=Homo sapiens OX=9606 GN=ALPI PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 30.0 null 400-UNIMOD:1031,43-UNIMOD:1031,44-UNIMOD:1031 0.07 30.0 3 3 3 PRT sp|Q58FF8|H90B2_HUMAN Putative heat shock protein HSP 90-beta 2 OS=Homo sapiens OX=9606 GN=HSP90AB2P PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 30.0 null 197-UNIMOD:1031,64-UNIMOD:259 0.13 30.0 4 4 1 PRT sp|P23921|RIR1_HUMAN Ribonucleoside-diphosphate reductase large subunit OS=Homo sapiens OX=9606 GN=RRM1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 30.0 null 88-UNIMOD:1031,414-UNIMOD:1031,14-UNIMOD:35,17-UNIMOD:1031 0.04 30.0 4 3 2 PRT sp|P63173|RL38_HUMAN 60S ribosomal protein L38 OS=Homo sapiens OX=9606 GN=RPL38 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 30.0 null 9-UNIMOD:1031,57-UNIMOD:1031,50-UNIMOD:1031,67-UNIMOD:1031,58-UNIMOD:28 0.60 30.0 7 4 2 PRT sp|O15305-2|PMM2_HUMAN Isoform 2 of Phosphomannomutase 2 OS=Homo sapiens OX=9606 GN=PMM2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 30.0 null 51-UNIMOD:1031 0.20 30.0 1 1 1 PRT sp|Q9Y3B8-2|ORN_HUMAN Isoform 2 of Oligoribonuclease, mitochondrial OS=Homo sapiens OX=9606 GN=REXO2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 30.0 null 135-UNIMOD:1031,138-UNIMOD:4,65-UNIMOD:1031 0.12 30.0 4 2 0 PRT sp|Q13363-2|CTBP1_HUMAN Isoform 2 of C-terminal-binding protein 1 OS=Homo sapiens OX=9606 GN=CTBP1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 30.0 null 337-UNIMOD:1031,339-UNIMOD:4,294-UNIMOD:1031 0.08 30.0 2 2 2 PRT sp|Q9UKG1|DP13A_HUMAN DCC-interacting protein 13-alpha OS=Homo sapiens OX=9606 GN=APPL1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 30.0 null 63-UNIMOD:1031 0.03 30.0 1 1 1 PRT sp|P61586|RHOA_HUMAN Transforming protein RhoA OS=Homo sapiens OX=9606 GN=RHOA PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 30.0 null 7-UNIMOD:1031,16-UNIMOD:4,20-UNIMOD:4 0.11 30.0 2 2 2 PRT sp|P52788|SPSY_HUMAN Spermine synthase OS=Homo sapiens OX=9606 GN=SMS PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 30.0 null 235-UNIMOD:1031,237-UNIMOD:4 0.03 30.0 2 1 0 PRT sp|P27694|RFA1_HUMAN Replication protein A 70 kDa DNA-binding subunit OS=Homo sapiens OX=9606 GN=RPA1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 30.0 null 489-UNIMOD:1031,577-UNIMOD:1031,267-UNIMOD:1031,163-UNIMOD:1031 0.07 30.0 5 4 3 PRT sp|Q9UHW9-6|S12A6_HUMAN Isoform 6 of Solute carrier family 12 member 6 OS=Homo sapiens OX=9606 GN=SLC12A6 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 30.0 null 706-UNIMOD:1031,953-UNIMOD:1031 0.02 30.0 4 2 1 PRT sp|Q9Y305-3|ACOT9_HUMAN Isoform 3 of Acyl-coenzyme A thioesterase 9, mitochondrial OS=Homo sapiens OX=9606 GN=ACOT9 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 30.0 null 234-UNIMOD:1031,239-UNIMOD:4 0.03 30.0 1 1 1 PRT sp|Q13177|PAK2_HUMAN Serine/threonine-protein kinase PAK 2 OS=Homo sapiens OX=9606 GN=PAK2 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 30.0 null 113-UNIMOD:1031,220-UNIMOD:1031,492-UNIMOD:1031,118-UNIMOD:1031,136-UNIMOD:1031 0.14 30.0 5 5 5 PRT sp|Q9NV70-2|EXOC1_HUMAN Isoform 2 of Exocyst complex component 1 OS=Homo sapiens OX=9606 GN=EXOC1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 30.0 null 27-UNIMOD:4,28-UNIMOD:1031 0.01 30.0 1 1 1 PRT sp|Q9BRS2|RIOK1_HUMAN Serine/threonine-protein kinase RIO1 OS=Homo sapiens OX=9606 GN=RIOK1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 30.0 null 134-UNIMOD:1031,218-UNIMOD:1031 0.04 30.0 2 2 2 PRT sp|O75821|EIF3G_HUMAN Eukaryotic translation initiation factor 3 subunit G OS=Homo sapiens OX=9606 GN=EIF3G PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 30.0 null 209-UNIMOD:1031,274-UNIMOD:1031,94-UNIMOD:1031,212-UNIMOD:1031 0.13 30.0 4 4 4 PRT sp|Q13148-4|TADBP_HUMAN Isoform 2 of TAR DNA-binding protein 43 OS=Homo sapiens OX=9606 GN=TARDBP null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 30.0 null 65-UNIMOD:1031 0.05 30.0 1 1 1 PRT sp|Q9Y383-3|LC7L2_HUMAN Isoform 3 of Putative RNA-binding protein Luc7-like 2 OS=Homo sapiens OX=9606 GN=LUC7L2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 30.0 null 174-UNIMOD:35,183-UNIMOD:1031,26-UNIMOD:1031 0.06 30.0 3 2 1 PRT sp|Q9NR45|SIAS_HUMAN Sialic acid synthase OS=Homo sapiens OX=9606 GN=NANS PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 30.0 null 283-UNIMOD:4,287-UNIMOD:4,290-UNIMOD:1031,145-UNIMOD:1031,46-UNIMOD:4,50-UNIMOD:4,52-UNIMOD:1031 0.13 30.0 4 3 2 PRT sp|P10515|ODP2_HUMAN Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Homo sapiens OX=9606 GN=DLAT PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 30.0 null 473-UNIMOD:1031,376-UNIMOD:1031 0.04 30.0 2 2 2 PRT sp|Q16543|CDC37_HUMAN Hsp90 co-chaperone Cdc37 OS=Homo sapiens OX=9606 GN=CDC37 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 30.0 null 121-UNIMOD:1031,69-UNIMOD:1031,110-UNIMOD:1031,101-UNIMOD:1031,144-UNIMOD:267,112-UNIMOD:35,154-UNIMOD:1031,60-UNIMOD:1031,64-UNIMOD:4 0.18 30.0 10 7 4 PRT sp|O75439|MPPB_HUMAN Mitochondrial-processing peptidase subunit beta OS=Homo sapiens OX=9606 GN=PMPCB PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 30.0 null 472-UNIMOD:1031,219-UNIMOD:1031 0.07 30.0 2 2 2 PRT sp|O95347-2|SMC2_HUMAN Isoform 2 of Structural maintenance of chromosomes protein 2 OS=Homo sapiens OX=9606 GN=SMC2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 30.0 null 677-UNIMOD:1031,424-UNIMOD:1031 0.02 30.0 2 2 2 PRT sp|Q2NL82|TSR1_HUMAN Pre-rRNA-processing protein TSR1 homolog OS=Homo sapiens OX=9606 GN=TSR1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 30.0 null 767-UNIMOD:35,771-UNIMOD:1031,611-UNIMOD:1031,618-UNIMOD:4,65-UNIMOD:1031,384-UNIMOD:1031 0.05 30.0 8 4 2 PRT sp|P59998-2|ARPC4_HUMAN Isoform 2 of Actin-related protein 2/3 complex subunit 4 OS=Homo sapiens OX=9606 GN=ARPC4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 30.0 null 44-UNIMOD:1031 0.02 30.0 1 1 1 PRT sp|P09496-5|CLCA_HUMAN Isoform 5 of Clathrin light chain A OS=Homo sapiens OX=9606 GN=CLTA null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 30.0 null 160-UNIMOD:1031,136-UNIMOD:4,141-UNIMOD:1031,104-UNIMOD:1031 0.21 30.0 3 3 2 PRT sp|P61019-2|RAB2A_HUMAN Isoform 2 of Ras-related protein Rab-2A OS=Homo sapiens OX=9606 GN=RAB2A null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 30.0 null 141-UNIMOD:259 0.08 30.0 2 1 0 PRT sp|Q99661-2|KIF2C_HUMAN Isoform 2 of Kinesin-like protein KIF2C OS=Homo sapiens OX=9606 GN=KIF2C null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 30.0 null 304-UNIMOD:35,311-UNIMOD:1031,470-UNIMOD:1031,472-UNIMOD:4 0.04 30.0 3 2 1 PRT sp|P62263|RS14_HUMAN 40S ribosomal protein S14 OS=Homo sapiens OX=9606 GN=RPS14 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 30.0 null 106-UNIMOD:1031,85-UNIMOD:385,85-UNIMOD:4,86-UNIMOD:1031,117-UNIMOD:267,96-UNIMOD:1031,125-UNIMOD:1031 0.33 30.0 9 6 3 PRT sp|O75449-2|KTNA1_HUMAN Isoform 2 of Katanin p60 ATPase-containing subunit A1 OS=Homo sapiens OX=9606 GN=KATNA1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 30.0 null 184-UNIMOD:1031,190-UNIMOD:4 0.04 30.0 1 1 1 PRT sp|O95197-3|RTN3_HUMAN Isoform 3 of Reticulon-3 OS=Homo sapiens OX=9606 GN=RTN3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 30.0 null 226-UNIMOD:1031,222-UNIMOD:1031,213-UNIMOD:267 0.12 30.0 4 3 2 PRT sp|Q96C86|DCPS_HUMAN m7GpppX diphosphatase OS=Homo sapiens OX=9606 GN=DCPS PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 30.0 null 138-UNIMOD:1031,142-UNIMOD:1031 0.05 30.0 2 2 2 PRT sp|Q15369|ELOC_HUMAN Elongin-C OS=Homo sapiens OX=9606 GN=ELOC PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 30.0 null 11-UNIMOD:4,32-UNIMOD:1031,17-UNIMOD:35 0.25 30.0 4 2 1 PRT sp|O43615|TIM44_HUMAN Mitochondrial import inner membrane translocase subunit TIM44 OS=Homo sapiens OX=9606 GN=TIMM44 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 30.0 null 240-UNIMOD:1031,138-UNIMOD:1031,249-UNIMOD:1031 0.10 30.0 3 3 3 PRT sp|P63218|GBG5_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5 OS=Homo sapiens OX=9606 GN=GNG5 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 30.0 null 27-UNIMOD:1031,12-UNIMOD:1031 0.29 30.0 2 2 2 PRT sp|P11216|PYGB_HUMAN Glycogen phosphorylase, brain form OS=Homo sapiens OX=9606 GN=PYGB PE=1 SV=5 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 30.0 null 290-UNIMOD:1031 0.02 30.0 2 1 0 PRT sp|P13984|T2FB_HUMAN General transcription factor IIF subunit 2 OS=Homo sapiens OX=9606 GN=GTF2F2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 30.0 null 154-UNIMOD:1031 0.12 30.0 3 2 1 PRT sp|P10768|ESTD_HUMAN S-formylglutathione hydrolase OS=Homo sapiens OX=9606 GN=ESD PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 30.0 null 200-UNIMOD:1031 0.04 30.0 2 1 0 PRT sp|Q9UKI8-3|TLK1_HUMAN Isoform 3 of Serine/threonine-protein kinase tousled-like 1 OS=Homo sapiens OX=9606 GN=TLK1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 30.0 null 268-UNIMOD:1031 0.02 30.0 2 1 0 PRT sp|P61353|RL27_HUMAN 60S ribosomal protein L27 OS=Homo sapiens OX=9606 GN=RPL27 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 30.0 null 93-UNIMOD:1031,98-UNIMOD:1031 0.14 30.0 2 2 2 PRT sp|P63267|ACTH_HUMAN Actin, gamma-enteric smooth muscle OS=Homo sapiens OX=9606 GN=ACTG2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 30.0 null 3-UNIMOD:1,11-UNIMOD:4,18-UNIMOD:4,19-UNIMOD:1031,29-UNIMOD:267,2-UNIMOD:1,2-UNIMOD:4,19-UNIMOD:259 0.08 30.0 15 3 1 PRT sp|B2RPK0|HGB1A_HUMAN Putative high mobility group protein B1-like 1 OS=Homo sapiens OX=9606 GN=HMGB1P1 PE=5 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 30.0 null 127-UNIMOD:1031,114-UNIMOD:259,127-UNIMOD:259 0.08 30.0 2 2 0 PRT sp|P62987|RL40_HUMAN Ubiquitin-60S ribosomal protein L40 OS=Homo sapiens OX=9606 GN=UBA52 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ] 30.0 null 48-UNIMOD:1031,88-UNIMOD:1031,91-UNIMOD:4,93-UNIMOD:1031,96-UNIMOD:4,94-UNIMOD:35,1-UNIMOD:35,6-UNIMOD:1031,114-UNIMOD:1031,115-UNIMOD:4,33-UNIMOD:1031,84-UNIMOD:28 0.49 30.0 9 6 2 PRT sp|P35908|K22E_HUMAN Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens OX=9606 GN=KRT2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 30.0 null 188-UNIMOD:1031,195-UNIMOD:1031 0.02 30.0 2 2 2 PRT sp|Q96A08|H2B1A_HUMAN Histone H2B type 1-A OS=Homo sapiens OX=9606 GN=H2BC1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 30.0 null 110-UNIMOD:1031 0.14 30.0 1 1 0 PRT sp|P15924|DESP_HUMAN Desmoplakin OS=Homo sapiens OX=9606 GN=DSP PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 30.0 null 2811-UNIMOD:1031,2026-UNIMOD:1031,2592-UNIMOD:1031,1840-UNIMOD:1031,1413-UNIMOD:1031,1069-UNIMOD:4,1073-UNIMOD:1031,2451-UNIMOD:1031,1527-UNIMOD:1031,2702-UNIMOD:1031,154-UNIMOD:1031,2776-UNIMOD:4,2778-UNIMOD:1031,1993-UNIMOD:1031,2753-UNIMOD:1031,2706-UNIMOD:1031,1916-UNIMOD:1031 0.06 30.0 15 15 15 PRT sp|Q92616|GCN1_HUMAN eIF-2-alpha kinase activator GCN1 OS=Homo sapiens OX=9606 GN=GCN1 PE=1 SV=6 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 30.0 null 2280-UNIMOD:1031,436-UNIMOD:1031,17-UNIMOD:1031,1556-UNIMOD:1031,2259-UNIMOD:1031,167-UNIMOD:1031,831-UNIMOD:1031 0.03 30.0 7 7 7 PRT sp|P62191|PRS4_HUMAN 26S proteasome regulatory subunit 4 OS=Homo sapiens OX=9606 GN=PSMC1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 30.0 null 396-UNIMOD:1031,399-UNIMOD:4,405-UNIMOD:35,217-UNIMOD:1031 0.10 30.0 2 2 1 PRT sp|P42685|FRK_HUMAN Tyrosine-protein kinase FRK OS=Homo sapiens OX=9606 GN=FRK PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 30.0 null 398-UNIMOD:1031 0.03 30.0 2 1 0 PRT sp|Q9UHD8|SEPT9_HUMAN Septin-9 OS=Homo sapiens OX=9606 GN=SEPTIN9 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 30.0 null 435-UNIMOD:1031 0.02 30.0 1 1 1 PRT sp|P13693|TCTP_HUMAN Translationally-controlled tumor protein OS=Homo sapiens OX=9606 GN=TPT1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 30.0 null 112-UNIMOD:1031 0.08 30.0 1 1 0 PRT sp|O15439|MRP4_HUMAN Multidrug resistance-associated protein 4 OS=Homo sapiens OX=9606 GN=ABCC4 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 30.0 null 1081-UNIMOD:1031 0.01 30.0 1 1 1 PRT sp|O43379|WDR62_HUMAN WD repeat-containing protein 62 OS=Homo sapiens OX=9606 GN=WDR62 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 30.0 null 102-UNIMOD:1031 0.01 30.0 2 1 0 PRT sp|P49748|ACADV_HUMAN Very long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADVL PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 30.0 null 556-UNIMOD:1031 0.02 30.0 1 1 1 PRT sp|Q14244|MAP7_HUMAN Ensconsin OS=Homo sapiens OX=9606 GN=MAP7 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 30.0 null 406-UNIMOD:1031 0.02 30.0 1 1 1 PRT sp|P24941|CDK2_HUMAN Cyclin-dependent kinase 2 OS=Homo sapiens OX=9606 GN=CDK2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 30.0 null 129-UNIMOD:259,142-UNIMOD:259,129-UNIMOD:1031 0.06 30.0 4 1 0 PRT sp|Q9NPQ8|RIC8A_HUMAN Synembryn-A OS=Homo sapiens OX=9606 GN=RIC8A PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 30.0 null 409-UNIMOD:1031 0.03 30.0 1 1 1 PRT sp|Q8IYD1|ERF3B_HUMAN Eukaryotic peptide chain release factor GTP-binding subunit ERF3B OS=Homo sapiens OX=9606 GN=GSPT2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 30.0 null 383-UNIMOD:1031,390-UNIMOD:4 0.03 30.0 2 1 0 PRT sp|P56537|IF6_HUMAN Eukaryotic translation initiation factor 6 OS=Homo sapiens OX=9606 GN=EIF6 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 30.0 null 85-UNIMOD:267 0.08 30.0 2 1 0 PRT sp|P62195|PRS8_HUMAN 26S proteasome regulatory subunit 8 OS=Homo sapiens OX=9606 GN=PSMC5 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 30.0 null 38-UNIMOD:1031,346-UNIMOD:1031,351-UNIMOD:35 0.08 30.0 3 2 1 PRT sp|P55327|TPD52_HUMAN Tumor protein D52 OS=Homo sapiens OX=9606 GN=TPD52 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 30.0 null 120-UNIMOD:1031,100-UNIMOD:1031,149-UNIMOD:259 0.21 30.0 3 3 1 PRT sp|Q9UNZ2|NSF1C_HUMAN NSFL1 cofactor p47 OS=Homo sapiens OX=9606 GN=NSFL1C PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 30.0 null 127-UNIMOD:1031 0.04 30.0 1 1 0 PRT sp|Q15785|TOM34_HUMAN Mitochondrial import receptor subunit TOM34 OS=Homo sapiens OX=9606 GN=TOMM34 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 29.0 null 60-UNIMOD:4,63-UNIMOD:1031,67-UNIMOD:4,197-UNIMOD:1031,156-UNIMOD:1031,305-UNIMOD:1031,262-UNIMOD:1031 0.18 29.0 5 5 5 PRT sp|P20073-2|ANXA7_HUMAN Isoform 2 of Annexin A7 OS=Homo sapiens OX=9606 GN=ANXA7 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 29.0 null 176-UNIMOD:35,177-UNIMOD:1031,206-UNIMOD:1031 0.06 29.0 2 2 2 PRT sp|Q6NVY1|HIBCH_HUMAN 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=HIBCH PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 29.0 null 353-UNIMOD:1031,92-UNIMOD:1031,95-UNIMOD:4 0.07 29.0 2 2 2 PRT sp|Q15758-3|AAAT_HUMAN Isoform 3 of Neutral amino acid transporter B(0) OS=Homo sapiens OX=9606 GN=SLC1A5 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 29.0 null 135-UNIMOD:4,144-UNIMOD:1031 0.05 29.0 1 1 1 PRT sp|Q9NRM7|LATS2_HUMAN Serine/threonine-protein kinase LATS2 OS=Homo sapiens OX=9606 GN=LATS2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 29.0 null 793-UNIMOD:1031,697-UNIMOD:1031 0.03 29.0 2 2 2 PRT sp|Q96GX5-2|GWL_HUMAN Isoform 2 of Serine/threonine-protein kinase greatwall OS=Homo sapiens OX=9606 GN=MASTL null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 29.0 null 158-UNIMOD:1031,162-UNIMOD:35,48-UNIMOD:1031,62-UNIMOD:1031 0.05 29.0 3 3 3 PRT sp|Q9NQX3|GEPH_HUMAN Gephyrin OS=Homo sapiens OX=9606 GN=GPHN PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 29.0 null 373-UNIMOD:1031,579-UNIMOD:1031 0.05 29.0 5 2 1 PRT sp|Q9UMR2-2|DD19B_HUMAN Isoform 2 of ATP-dependent RNA helicase DDX19B OS=Homo sapiens OX=9606 GN=DDX19B null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 29.0 null 92-UNIMOD:1031,64-UNIMOD:1031,53-UNIMOD:1031 0.08 29.0 3 3 3 PRT sp|Q9UHV9|PFD2_HUMAN Prefoldin subunit 2 OS=Homo sapiens OX=9606 GN=PFDN2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 29.0 null 94-UNIMOD:1031 0.10 29.0 1 1 1 PRT sp|Q14CX7-2|NAA25_HUMAN Isoform 2 of N-alpha-acetyltransferase 25, NatB auxiliary subunit OS=Homo sapiens OX=9606 GN=NAA25 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 29.0 null 362-UNIMOD:1031,364-UNIMOD:4,365-UNIMOD:4 0.02 29.0 1 1 1 PRT sp|Q9UK59-2|DBR1_HUMAN Isoform 2 of Lariat debranching enzyme OS=Homo sapiens OX=9606 GN=DBR1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 29.0 null 24-UNIMOD:1031,25-UNIMOD:4 0.04 29.0 2 1 0 PRT sp|P15170|ERF3A_HUMAN Eukaryotic peptide chain release factor GTP-binding subunit ERF3A OS=Homo sapiens OX=9606 GN=GSPT1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 29.0 null 448-UNIMOD:1031,453-UNIMOD:4,484-UNIMOD:1031,490-UNIMOD:1031,240-UNIMOD:1031,72-UNIMOD:1031,464-UNIMOD:4,469-UNIMOD:259,253-UNIMOD:1031,309-UNIMOD:1031,237-UNIMOD:4,238-UNIMOD:1031 0.24 29.0 12 11 10 PRT sp|P60981-2|DEST_HUMAN Isoform 2 of Destrin OS=Homo sapiens OX=9606 GN=DSTN null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 29.0 null 118-UNIMOD:4,75-UNIMOD:1031,5-UNIMOD:1031,6-UNIMOD:4,13-UNIMOD:1031,28-UNIMOD:1031,29-UNIMOD:4 0.34 29.0 5 5 5 PRT sp|Q99447-4|PCY2_HUMAN Isoform 4 of Ethanolamine-phosphate cytidylyltransferase OS=Homo sapiens OX=9606 GN=PCYT2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 29.0 null 34-UNIMOD:1031 0.04 29.0 1 1 0 PRT sp|Q15125|EBP_HUMAN 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase OS=Homo sapiens OX=9606 GN=EBP PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 29.0 null 0.06 29.0 1 1 1 PRT sp|Q16836|HCDH_HUMAN Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=HADH PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 29.0 null 211-UNIMOD:4,212-UNIMOD:1031,305-UNIMOD:1031,301-UNIMOD:1031,81-UNIMOD:1031 0.17 29.0 6 5 4 PRT sp|Q13057|COASY_HUMAN Bifunctional coenzyme A synthase OS=Homo sapiens OX=9606 GN=COASY PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 29.0 null 330-UNIMOD:1031,235-UNIMOD:1031 0.05 29.0 2 2 2 PRT sp|P32969|RL9_HUMAN 60S ribosomal protein L9 OS=Homo sapiens OX=9606 GN=RPL9 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 29.0 null 174-UNIMOD:1031,21-UNIMOD:1031,121-UNIMOD:1031,184-UNIMOD:259,65-UNIMOD:1031 0.27 29.0 6 5 4 PRT sp|Q6UB35|C1TM_HUMAN Monofunctional C1-tetrahydrofolate synthase, mitochondrial OS=Homo sapiens OX=9606 GN=MTHFD1L PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 29.0 null 586-UNIMOD:1031 0.01 29.0 1 1 1 PRT sp|P51572-2|BAP31_HUMAN Isoform 2 of B-cell receptor-associated protein 31 OS=Homo sapiens OX=9606 GN=BCAP31 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 29.0 null 205-UNIMOD:1031,259-UNIMOD:1031,252-UNIMOD:1031,139-UNIMOD:1031 0.12 29.0 4 4 4 PRT sp|Q9UHX1-4|PUF60_HUMAN Isoform 4 of Poly(U)-binding-splicing factor PUF60 OS=Homo sapiens OX=9606 GN=PUF60 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 29.0 null 481-UNIMOD:1031,193-UNIMOD:1031,195-UNIMOD:4 0.04 29.0 2 2 2 PRT sp|Q14527|HLTF_HUMAN Helicase-like transcription factor OS=Homo sapiens OX=9606 GN=HLTF PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 29.0 null 952-UNIMOD:1031,112-UNIMOD:1031,417-UNIMOD:1031 0.04 29.0 3 3 3 PRT sp|O76024|WFS1_HUMAN Wolframin OS=Homo sapiens OX=9606 GN=WFS1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 29.0 null 836-UNIMOD:1031,843-UNIMOD:1031 0.01 29.0 2 1 0 PRT sp|Q12874|SF3A3_HUMAN Splicing factor 3A subunit 3 OS=Homo sapiens OX=9606 GN=SF3A3 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 29.0 null 264-UNIMOD:1031,420-UNIMOD:1031,466-UNIMOD:1031 0.08 29.0 5 4 3 PRT sp|Q9Y4L1|HYOU1_HUMAN Hypoxia up-regulated protein 1 OS=Homo sapiens OX=9606 GN=HYOU1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 29.0 null 883-UNIMOD:1031,75-UNIMOD:259,308-UNIMOD:1031,306-UNIMOD:35,94-UNIMOD:1031 0.04 29.0 5 4 3 PRT sp|P61916|NPC2_HUMAN NPC intracellular cholesterol transporter 2 OS=Homo sapiens OX=9606 GN=NPC2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 29.0 null 116-UNIMOD:1031 0.08 29.0 1 1 1 PRT sp|P18583-6|SON_HUMAN Isoform E of Protein SON OS=Homo sapiens OX=9606 GN=SON null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 29.0 null 2055-UNIMOD:1031 0.01 29.0 1 1 1 PRT sp|Q9BRA2|TXD17_HUMAN Thioredoxin domain-containing protein 17 OS=Homo sapiens OX=9606 GN=TXNDC17 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 29.0 null 89-UNIMOD:1031,43-UNIMOD:4,46-UNIMOD:4,98-UNIMOD:1031,35-UNIMOD:259 0.37 29.0 5 4 3 PRT sp|Q9UJY1|HSPB8_HUMAN Heat shock protein beta-8 OS=Homo sapiens OX=9606 GN=HSPB8 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 29.0 null 137-UNIMOD:1031 0.07 29.0 1 1 1 PRT sp|Q5T4S7-3|UBR4_HUMAN Isoform 3 of E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 29.0 null 2554-UNIMOD:1031 0.00 29.0 1 1 1 PRT sp|Q13526|PIN1_HUMAN Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 OS=Homo sapiens OX=9606 GN=PIN1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 29.0 null 113-UNIMOD:4,117-UNIMOD:1031 0.13 29.0 1 1 1 PRT sp|Q3ZCQ8-3|TIM50_HUMAN Isoform 3 of Mitochondrial import inner membrane translocase subunit TIM50 OS=Homo sapiens OX=9606 GN=TIMM50 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 29.0 null 221-UNIMOD:1031,182-UNIMOD:267 0.11 29.0 2 2 2 PRT sp|P62857|RS28_HUMAN 40S ribosomal protein S28 OS=Homo sapiens OX=9606 GN=RPS28 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 29.0 null 27-UNIMOD:4,31-UNIMOD:267,16-UNIMOD:1031,47-UNIMOD:1031 0.57 29.0 6 4 2 PRT sp|P68036-2|UB2L3_HUMAN Isoform 2 of Ubiquitin-conjugating enzyme E2 L3 OS=Homo sapiens OX=9606 GN=UBE2L3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 29.0 null 41-UNIMOD:1031,113-UNIMOD:1031 0.17 29.0 2 2 2 PRT sp|Q9UKK9|NUDT5_HUMAN ADP-sugar pyrophosphatase OS=Homo sapiens OX=9606 GN=NUDT5 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 29.0 null 76-UNIMOD:4,81-UNIMOD:259,210-UNIMOD:1031,33-UNIMOD:1031 0.18 29.0 6 3 2 PRT sp|P26038|MOES_HUMAN Moesin OS=Homo sapiens OX=9606 GN=MSN PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 29.0 null 352-UNIMOD:1031,388-UNIMOD:1031,514-UNIMOD:1031,394-UNIMOD:28,400-UNIMOD:1031,3-UNIMOD:1031,151-UNIMOD:259,64-UNIMOD:1031,359-UNIMOD:1031,523-UNIMOD:1031 0.18 29.0 10 10 10 PRT sp|Q00325-2|MPCP_HUMAN Isoform B of Phosphate carrier protein, mitochondrial OS=Homo sapiens OX=9606 GN=SLC25A3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 29.0 null 246-UNIMOD:1031,303-UNIMOD:1031,213-UNIMOD:1031,92-UNIMOD:35,98-UNIMOD:1031 0.12 29.0 4 4 4 PRT sp|Q8WUM4|PDC6I_HUMAN Programmed cell death 6-interacting protein OS=Homo sapiens OX=9606 GN=PDCD6IP PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 29.0 null 501-UNIMOD:1031,339-UNIMOD:1031,239-UNIMOD:1031,690-UNIMOD:1031,691-UNIMOD:4,19-UNIMOD:1031,269-UNIMOD:1031,48-UNIMOD:1031,334-UNIMOD:1031 0.13 29.0 10 9 8 PRT sp|P43487|RANG_HUMAN Ran-specific GTPase-activating protein OS=Homo sapiens OX=9606 GN=RANBP1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 29.0 null 183-UNIMOD:1031,173-UNIMOD:1031,68-UNIMOD:1031,50-UNIMOD:259,154-UNIMOD:1031,158-UNIMOD:4 0.28 29.0 8 5 3 PRT sp|Q01518-2|CAP1_HUMAN Isoform 2 of Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 29.0 null 411-UNIMOD:1031,415-UNIMOD:4,421-UNIMOD:259,374-UNIMOD:4,375-UNIMOD:1031,277-UNIMOD:35,278-UNIMOD:1031,281-UNIMOD:1031 0.10 29.0 10 5 2 PRT sp|Q14151|SAFB2_HUMAN Scaffold attachment factor B2 OS=Homo sapiens OX=9606 GN=SAFB2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 29.0 null 437-UNIMOD:1031,484-UNIMOD:1031 0.02 29.0 2 2 2 PRT sp|P47756-2|CAPZB_HUMAN Isoform 2 of F-actin-capping protein subunit beta OS=Homo sapiens OX=9606 GN=CAPZB null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 29.0 null 57-UNIMOD:1031,62-UNIMOD:4,235-UNIMOD:259,254-UNIMOD:1031 0.12 29.0 3 3 3 PRT sp|O43768-5|ENSA_HUMAN Isoform 5 of Alpha-endosulfine OS=Homo sapiens OX=9606 GN=ENSA null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 29.0 null 70-UNIMOD:1031,76-UNIMOD:1031,43-UNIMOD:1031,103-UNIMOD:1031,110-UNIMOD:1031 0.50 29.0 5 5 5 PRT sp|Q86UE8-3|TLK2_HUMAN Isoform 3 of Serine/threonine-protein kinase tousled-like 2 OS=Homo sapiens OX=9606 GN=TLK2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 29.0 null 437-UNIMOD:1031,443-UNIMOD:1031 0.02 29.0 3 1 0 PRT sp|Q00839|HNRPU_HUMAN Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU PE=1 SV=6 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 29.0 null 551-UNIMOD:1031,635-UNIMOD:1031,682-UNIMOD:1031,620-UNIMOD:259,626-UNIMOD:259,12-UNIMOD:1031 0.06 29.0 5 5 3 PRT sp|Q7L1Q6|BZW1_HUMAN Basic leucine zipper and W2 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=BZW1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 29.0 null 309-UNIMOD:1031,319-UNIMOD:1031 0.04 29.0 4 2 0 PRT sp|P82979|SARNP_HUMAN SAP domain-containing ribonucleoprotein OS=Homo sapiens OX=9606 GN=SARNP PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ] 29.0 null 2-UNIMOD:1,10-UNIMOD:1031,120-UNIMOD:1031,12-UNIMOD:1031,167-UNIMOD:1031 0.22 29.0 5 5 5 PRT sp|P60900|PSA6_HUMAN Proteasome subunit alpha type-6 OS=Homo sapiens OX=9606 GN=PSMA6 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 29.0 null 45-UNIMOD:1031,47-UNIMOD:4,104-UNIMOD:1031,115-UNIMOD:4 0.15 29.0 5 3 2 PRT sp|Q13200|PSMD2_HUMAN 26S proteasome non-ATPase regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PSMD2 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 29.0 null 350-UNIMOD:1031 0.02 29.0 1 1 0 PRT sp|Q9BXS5|AP1M1_HUMAN AP-1 complex subunit mu-1 OS=Homo sapiens OX=9606 GN=AP1M1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 29.0 null 2-UNIMOD:1,12-UNIMOD:1031,326-UNIMOD:1031,217-UNIMOD:1031 0.09 29.0 3 3 3 PRT sp|O76031|CLPX_HUMAN ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial OS=Homo sapiens OX=9606 GN=CLPX PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 29.0 null 286-UNIMOD:1031 0.03 29.0 1 1 1 PRT sp|Q5T1M5|FKB15_HUMAN FK506-binding protein 15 OS=Homo sapiens OX=9606 GN=FKBP15 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 29.0 null 837-UNIMOD:1031 0.01 29.0 1 1 1 PRT sp|Q16799|RTN1_HUMAN Reticulon-1 OS=Homo sapiens OX=9606 GN=RTN1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 29.0 null 650-UNIMOD:1031 0.02 29.0 1 1 1 PRT sp|P63165|SUMO1_HUMAN Small ubiquitin-related modifier 1 OS=Homo sapiens OX=9606 GN=SUMO1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 29.0 null 37-UNIMOD:1031 0.15 29.0 1 1 1 PRT sp|Q99747|SNAG_HUMAN Gamma-soluble NSF attachment protein OS=Homo sapiens OX=9606 GN=NAPG PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 29.0 null 15-UNIMOD:1031 0.04 29.0 1 1 1 PRT sp|P51617|IRAK1_HUMAN Interleukin-1 receptor-associated kinase 1 OS=Homo sapiens OX=9606 GN=IRAK1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 29.0 null 342-UNIMOD:1031 0.04 29.0 1 1 0 PRT sp|O75150|BRE1B_HUMAN E3 ubiquitin-protein ligase BRE1B OS=Homo sapiens OX=9606 GN=RNF40 PE=1 SV=5 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 29.0 null 862-UNIMOD:1031 0.01 29.0 1 1 1 PRT sp|O60610|DIAP1_HUMAN Protein diaphanous homolog 1 OS=Homo sapiens OX=9606 GN=DIAPH1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 29.0 null 1046-UNIMOD:1031 0.01 29.0 1 1 1 PRT sp|Q9UBF8|PI4KB_HUMAN Phosphatidylinositol 4-kinase beta OS=Homo sapiens OX=9606 GN=PI4KB PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 29.0 null 392-UNIMOD:259,394-UNIMOD:259,392-UNIMOD:1031 0.02 29.0 4 1 0 PRT sp|Q9NUQ8|ABCF3_HUMAN ATP-binding cassette sub-family F member 3 OS=Homo sapiens OX=9606 GN=ABCF3 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 29.0 null 522-UNIMOD:4,531-UNIMOD:1031,216-UNIMOD:1031 0.04 29.0 2 2 1 PRT sp|O95197|RTN3_HUMAN Reticulon-3 OS=Homo sapiens OX=9606 GN=RTN3 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 29.0 null 905-UNIMOD:1031 0.03 29.0 2 2 1 PRT sp|Q71U36|TBA1A_HUMAN Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 29.0 null 60-UNIMOD:259,370-UNIMOD:1031,373-UNIMOD:267,394-UNIMOD:1031,398-UNIMOD:35,347-UNIMOD:4,60-UNIMOD:1031,336-UNIMOD:1031 0.19 29.0 8 6 0 PRT sp|P54652|HSP72_HUMAN Heat shock-related 70 kDa protein 2 OS=Homo sapiens OX=9606 GN=HSPA2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 29.0 null 57-UNIMOD:1031,62-UNIMOD:35,454-UNIMOD:1031,360-UNIMOD:1031,113-UNIMOD:1031,188-UNIMOD:259,189-UNIMOD:259,57-UNIMOD:259,72-UNIMOD:259 0.13 29.0 24 5 1 PRT sp|P35580|MYH10_HUMAN Myosin-10 OS=Homo sapiens OX=9606 GN=MYH10 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 29.0 null 1562-UNIMOD:259,1484-UNIMOD:1031 0.01 29.0 2 2 1 PRT sp|P30153|2AAA_HUMAN Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R1A PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 28.0 null 188-UNIMOD:1031,475-UNIMOD:1031,194-UNIMOD:1031,305-UNIMOD:1031,107-UNIMOD:1031 0.09 28.0 5 5 5 PRT sp|P56378|ATP68_HUMAN ATP synthase subunit ATP5MPL, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5MPL PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 28.0 null 49-UNIMOD:1031 0.22 28.0 2 1 0 PRT sp|Q10471|GALT2_HUMAN Polypeptide N-acetylgalactosaminyltransferase 2 OS=Homo sapiens OX=9606 GN=GALNT2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 28.0 null 509-UNIMOD:1031,513-UNIMOD:4,103-UNIMOD:1031,111-UNIMOD:1031,54-UNIMOD:1031 0.07 28.0 5 5 5 PRT sp|P50914|RL14_HUMAN 60S ribosomal protein L14 OS=Homo sapiens OX=9606 GN=RPL14 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 28.0 null 187-UNIMOD:1031,182-UNIMOD:1031,204-UNIMOD:1031,79-UNIMOD:1031,137-UNIMOD:1031,209-UNIMOD:1031,132-UNIMOD:1031,193-UNIMOD:1031,165-UNIMOD:1031 0.32 28.0 10 9 8 PRT sp|Q9HA77|SYCM_HUMAN Probable cysteine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=CARS2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 28.0 null 407-UNIMOD:1031,329-UNIMOD:1031 0.05 28.0 2 2 2 PRT sp|Q9UHR5-2|S30BP_HUMAN Isoform 2 of SAP30-binding protein OS=Homo sapiens OX=9606 GN=SAP30BP null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 28.0 null 111-UNIMOD:4,118-UNIMOD:1031 0.04 28.0 1 1 1 PRT sp|O14757-2|CHK1_HUMAN Isoform 2 of Serine/threonine-protein kinase Chk1 OS=Homo sapiens OX=9606 GN=CHEK1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 28.0 null 38-UNIMOD:1031,351-UNIMOD:1031 0.06 28.0 3 2 1 PRT sp|O75390|CISY_HUMAN Citrate synthase, mitochondrial OS=Homo sapiens OX=9606 GN=CS PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 28.0 null 43-UNIMOD:1031,366-UNIMOD:1031 0.06 28.0 3 2 1 PRT sp|Q86SG6|NEK8_HUMAN Serine/threonine-protein kinase Nek8 OS=Homo sapiens OX=9606 GN=NEK8 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 28.0 null 130-UNIMOD:1031 0.02 28.0 1 1 1 PRT sp|Q02750-2|MP2K1_HUMAN Isoform 2 of Dual specificity mitogen-activated protein kinase kinase 1 OS=Homo sapiens OX=9606 GN=MAP2K1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 28.0 null 166-UNIMOD:1031,104-UNIMOD:1031,97-UNIMOD:1031 0.07 28.0 15 3 0 PRT sp|Q9NRF9|DPOE3_HUMAN DNA polymerase epsilon subunit 3 OS=Homo sapiens OX=9606 GN=POLE3 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 28.0 null 31-UNIMOD:1031,121-UNIMOD:1031 0.31 28.0 3 3 3 PRT sp|O00231|PSD11_HUMAN 26S proteasome non-ATPase regulatory subunit 11 OS=Homo sapiens OX=9606 GN=PSMD11 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 28.0 null 32-UNIMOD:1031,71-UNIMOD:259,185-UNIMOD:259,202-UNIMOD:4,205-UNIMOD:259 0.12 28.0 7 4 2 PRT sp|O60716-32|CTND1_HUMAN Isoform 4 of Catenin delta-1 OS=Homo sapiens OX=9606 GN=CTNND1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 28.0 null 420-UNIMOD:1031,399-UNIMOD:1031 0.04 28.0 2 2 2 PRT sp|Q9Y262-2|EIF3L_HUMAN Isoform 2 of Eukaryotic translation initiation factor 3 subunit L OS=Homo sapiens OX=9606 GN=EIF3L null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 28.0 null 389-UNIMOD:1031,501-UNIMOD:1031 0.07 28.0 3 2 0 PRT sp|O43395|PRPF3_HUMAN U4/U6 small nuclear ribonucleoprotein Prp3 OS=Homo sapiens OX=9606 GN=PRPF3 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 28.0 null 65-UNIMOD:1031,495-UNIMOD:1031,345-UNIMOD:1031,377-UNIMOD:1031 0.07 28.0 4 4 4 PRT sp|Q15631|TSN_HUMAN Translin OS=Homo sapiens OX=9606 GN=TSN PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 28.0 null 219-UNIMOD:1031,225-UNIMOD:4,187-UNIMOD:1031 0.11 28.0 2 2 2 PRT sp|Q9ULX3|NOB1_HUMAN RNA-binding protein NOB1 OS=Homo sapiens OX=9606 GN=NOB1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 28.0 null 333-UNIMOD:1031 0.04 28.0 1 1 1 PRT sp|Q8TDN6|BRX1_HUMAN Ribosome biogenesis protein BRX1 homolog OS=Homo sapiens OX=9606 GN=BRIX1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 28.0 null 44-UNIMOD:267,284-UNIMOD:1031 0.06 28.0 2 2 2 PRT sp|O95071-2|UBR5_HUMAN Isoform 2 of E3 ubiquitin-protein ligase UBR5 OS=Homo sapiens OX=9606 GN=UBR5 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 28.0 null 720-UNIMOD:1031,2655-UNIMOD:1031 0.01 28.0 2 2 1 PRT sp|Q16851-2|UGPA_HUMAN Isoform 2 of UTP--glucose-1-phosphate uridylyltransferase OS=Homo sapiens OX=9606 GN=UGP2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 28.0 null 187-UNIMOD:1031 0.02 28.0 1 1 1 PRT sp|O14684|PTGES_HUMAN Prostaglandin E synthase OS=Homo sapiens OX=9606 GN=PTGES PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 28.0 null 42-UNIMOD:1031,59-UNIMOD:4,60-UNIMOD:267 0.13 28.0 2 2 2 PRT sp|P28340|DPOD1_HUMAN DNA polymerase delta catalytic subunit OS=Homo sapiens OX=9606 GN=POLD1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 28.0 null 1087-UNIMOD:1031,676-UNIMOD:1031 0.02 28.0 2 2 2 PRT sp|Q9H501|ESF1_HUMAN ESF1 homolog OS=Homo sapiens OX=9606 GN=ESF1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 28.0 null 800-UNIMOD:1031 0.01 28.0 1 1 1 PRT sp|Q13464|ROCK1_HUMAN Rho-associated protein kinase 1 OS=Homo sapiens OX=9606 GN=ROCK1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 28.0 null 1036-UNIMOD:1031,105-UNIMOD:1031,104-UNIMOD:35 0.02 28.0 3 2 1 PRT sp|P15311|EZRI_HUMAN Ezrin OS=Homo sapiens OX=9606 GN=EZR PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 28.0 null 296-UNIMOD:1031,263-UNIMOD:1031,412-UNIMOD:1031,558-UNIMOD:35,450-UNIMOD:1031,72-UNIMOD:1031,559-UNIMOD:267,258-UNIMOD:1031,64-UNIMOD:1031,577-UNIMOD:1031,327-UNIMOD:1031,237-UNIMOD:1031 0.22 28.0 15 11 8 PRT sp|Q96RP9|EFGM_HUMAN Elongation factor G, mitochondrial OS=Homo sapiens OX=9606 GN=GFM1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 28.0 null 541-UNIMOD:1031 0.02 28.0 1 1 1 PRT sp|O00571|DDX3X_HUMAN ATP-dependent RNA helicase DDX3X OS=Homo sapiens OX=9606 GN=DDX3X PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 28.0 null 264-UNIMOD:1031,491-UNIMOD:1031,335-UNIMOD:1031,341-UNIMOD:4,118-UNIMOD:1031 0.10 28.0 5 5 5 PRT sp|Q07912-2|ACK1_HUMAN Isoform 2 of Activated CDC42 kinase 1 OS=Homo sapiens OX=9606 GN=TNK2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 28.0 null 291-UNIMOD:1031,297-UNIMOD:4 0.03 28.0 1 1 1 PRT sp|O75400-2|PR40A_HUMAN Isoform 2 of Pre-mRNA-processing factor 40 homolog A OS=Homo sapiens OX=9606 GN=PRPF40A null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 28.0 null 700-UNIMOD:1031 0.02 28.0 2 1 0 PRT sp|P07951-3|TPM2_HUMAN Isoform 3 of Tropomyosin beta chain OS=Homo sapiens OX=9606 GN=TPM2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 28.0 null 215-UNIMOD:1031,116-UNIMOD:1031,228-UNIMOD:259 0.12 28.0 4 3 2 PRT sp|P12081-3|HARS1_HUMAN Isoform 3 of Histidine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=HARS1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 28.0 null 42-UNIMOD:1031,51-UNIMOD:1031 0.03 28.0 2 2 2 PRT sp|O96019-2|ACL6A_HUMAN Isoform 2 of Actin-like protein 6A OS=Homo sapiens OX=9606 GN=ACTL6A null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 28.0 null 337-UNIMOD:1031 0.03 28.0 1 1 1 PRT sp|O95295|SNAPN_HUMAN SNARE-associated protein Snapin OS=Homo sapiens OX=9606 GN=SNAPIN PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 28.0 null 115-UNIMOD:1031,83-UNIMOD:1031 0.18 28.0 4 2 1 PRT sp|Q9BPX6-5|MICU1_HUMAN Isoform 5 of Calcium uptake protein 1, mitochondrial OS=Homo sapiens OX=9606 GN=MICU1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 28.0 null 111-UNIMOD:1031 0.05 28.0 1 1 1 PRT sp|Q4VC31|CCD58_HUMAN Coiled-coil domain-containing protein 58 OS=Homo sapiens OX=9606 GN=CCDC58 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 28.0 null 100-UNIMOD:1031 0.09 28.0 1 1 1 PRT sp|Q14157-4|UBP2L_HUMAN Isoform 4 of Ubiquitin-associated protein 2-like OS=Homo sapiens OX=9606 GN=UBAP2L null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 28.0 null 413-UNIMOD:1031,55-UNIMOD:1031 0.03 28.0 2 2 1 PRT sp|Q02218-2|ODO1_HUMAN Isoform 2 of 2-oxoglutarate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=OGDH null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 28.0 null 966-UNIMOD:1031,996-UNIMOD:1031 0.02 28.0 2 2 2 PRT sp|Q99536-2|VAT1_HUMAN Isoform 2 of Synaptic vesicle membrane protein VAT-1 homolog OS=Homo sapiens OX=9606 GN=VAT1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 28.0 null 248-UNIMOD:1031 0.05 28.0 1 1 1 PRT sp|Q15759|MK11_HUMAN Mitogen-activated protein kinase 11 OS=Homo sapiens OX=9606 GN=MAPK11 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 28.0 null 15-UNIMOD:1031 0.04 28.0 1 1 1 PRT sp|Q9UN86-2|G3BP2_HUMAN Isoform B of Ras GTPase-activating protein-binding protein 2 OS=Homo sapiens OX=9606 GN=G3BP2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 28.0 null 25-UNIMOD:1031,359-UNIMOD:1031 0.06 28.0 2 2 2 PRT sp|O60884|DNJA2_HUMAN DnaJ homolog subfamily A member 2 OS=Homo sapiens OX=9606 GN=DNAJA2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 28.0 null 158-UNIMOD:1031,159-UNIMOD:4,162-UNIMOD:4,134-UNIMOD:1031 0.05 28.0 2 2 2 PRT sp|P18077|RL35A_HUMAN 60S ribosomal protein L35a OS=Homo sapiens OX=9606 GN=RPL35A PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 28.0 null 95-UNIMOD:1031,63-UNIMOD:1031,45-UNIMOD:1031,15-UNIMOD:1031,73-UNIMOD:1031,63-UNIMOD:259,66-UNIMOD:259 0.49 28.0 8 5 3 PRT sp|P62820|RAB1A_HUMAN Ras-related protein Rab-1A OS=Homo sapiens OX=9606 GN=RAB1A PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 28.0 null 191-UNIMOD:1031,156-UNIMOD:259 0.14 28.0 2 2 2 PRT sp|P14174|MIF_HUMAN Macrophage migration inhibitory factor OS=Homo sapiens OX=9606 GN=MIF PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 28.0 null 78-UNIMOD:1031,81-UNIMOD:4,3-UNIMOD:35,87-UNIMOD:267 0.23 28.0 5 3 1 PRT sp|O43242|PSMD3_HUMAN 26S proteasome non-ATPase regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PSMD3 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 28.0 null 65-UNIMOD:267,54-UNIMOD:1031,80-UNIMOD:1031,84-UNIMOD:1031 0.10 28.0 6 5 4 PRT sp|P37235|HPCL1_HUMAN Hippocalcin-like protein 1 OS=Homo sapiens OX=9606 GN=HPCAL1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 28.0 null 83-UNIMOD:267 0.07 28.0 2 1 0 PRT sp|P04844-2|RPN2_HUMAN Isoform 2 of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Homo sapiens OX=9606 GN=RPN2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 28.0 null 424-UNIMOD:259,279-UNIMOD:1031 0.04 28.0 3 2 1 PRT sp|P42765|THIM_HUMAN 3-ketoacyl-CoA thiolase, mitochondrial OS=Homo sapiens OX=9606 GN=ACAA2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 28.0 null 137-UNIMOD:1031,81-UNIMOD:1031,360-UNIMOD:267,306-UNIMOD:1031 0.17 28.0 5 5 5 PRT sp|Q9UKX7-2|NUP50_HUMAN Isoform 2 of Nuclear pore complex protein Nup50 OS=Homo sapiens OX=9606 GN=NUP50 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 28.0 null 422-UNIMOD:1031 0.03 28.0 2 2 2 PRT sp|P00491|PNPH_HUMAN Purine nucleoside phosphorylase OS=Homo sapiens OX=9606 GN=PNP PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 28.0 null 211-UNIMOD:1031 0.08 28.0 1 1 1 PRT sp|P25685|DNJB1_HUMAN DnaJ homolog subfamily B member 1 OS=Homo sapiens OX=9606 GN=DNAJB1 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 28.0 null 179-UNIMOD:4,181-UNIMOD:1031,21-UNIMOD:1031,195-UNIMOD:1031,217-UNIMOD:1031 0.13 28.0 5 5 5 PRT sp|Q13162|PRDX4_HUMAN Peroxiredoxin-4 OS=Homo sapiens OX=9606 GN=PRDX4 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 28.0 null 78-UNIMOD:1031,80-UNIMOD:1031,245-UNIMOD:4,263-UNIMOD:1031,250-UNIMOD:1031 0.18 28.0 7 3 1 PRT sp|A6NDY0|EPAB2_HUMAN Embryonic polyadenylate-binding protein 2 OS=Homo sapiens OX=9606 GN=PABPN1L PE=2 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 28.0 null 180-UNIMOD:4,182-UNIMOD:1031 0.05 28.0 1 1 1 PRT sp|Q14914-2|PTGR1_HUMAN Isoform 2 of Prostaglandin reductase 1 OS=Homo sapiens OX=9606 GN=PTGR1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 28.0 null 75-UNIMOD:1031 0.09 28.0 2 2 2 PRT sp|Q9Y3U8|RL36_HUMAN 60S ribosomal protein L36 OS=Homo sapiens OX=9606 GN=RPL36 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 28.0 null 13-UNIMOD:1031,62-UNIMOD:1031,58-UNIMOD:35,19-UNIMOD:1031 0.29 28.0 6 3 1 PRT sp|Q8NEB9|PK3C3_HUMAN Phosphatidylinositol 3-kinase catalytic subunit type 3 OS=Homo sapiens OX=9606 GN=PIK3C3 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 28.0 null 636-UNIMOD:1031 0.01 28.0 2 1 0 PRT sp|Q58FG1|HS904_HUMAN Putative heat shock protein HSP 90-alpha A4 OS=Homo sapiens OX=9606 GN=HSP90AA4P PE=5 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 28.0 null 38-UNIMOD:35,40-UNIMOD:259,302-UNIMOD:35,303-UNIMOD:1031 0.06 28.0 13 2 0 PRT sp|P08195|4F2_HUMAN 4F2 cell-surface antigen heavy chain OS=Homo sapiens OX=9606 GN=SLC3A2 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 28.0 null 269-UNIMOD:1031,147-UNIMOD:1031 0.06 28.0 2 2 2 PRT sp|Q93079|H2B1H_HUMAN Histone H2B type 1-H OS=Homo sapiens OX=9606 GN=HIST1H2BH PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 28.0 null 6-UNIMOD:1031 0.10 28.0 1 1 1 PRT sp|P12814|ACTN1_HUMAN Alpha-actinin-1 OS=Homo sapiens OX=9606 GN=ACTN1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 28.0 null 436-UNIMOD:1031 0.02 28.0 1 1 1 PRT sp|P20810|ICAL_HUMAN Calpastatin OS=Homo sapiens OX=9606 GN=CAST PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 28.0 null 81-UNIMOD:1031 0.02 28.0 1 1 1 PRT sp|O00410|IPO5_HUMAN Importin-5 OS=Homo sapiens OX=9606 GN=IPO5 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 28.0 null 420-UNIMOD:4,436-UNIMOD:1031 0.02 28.0 1 1 1 PRT sp|Q9H4A3|WNK1_HUMAN Serine/threonine-protein kinase WNK1 OS=Homo sapiens OX=9606 GN=WNK1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 28.0 null 375-UNIMOD:1031 0.01 28.0 1 1 0 PRT sp|P25789|PSA4_HUMAN Proteasome subunit alpha type-4 OS=Homo sapiens OX=9606 GN=PSMA4 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 28.0 null 163-UNIMOD:4,176-UNIMOD:1031,231-UNIMOD:1031,239-UNIMOD:1031,238-UNIMOD:1031 0.15 28.0 4 4 4 PRT sp|O95757|HS74L_HUMAN Heat shock 70 kDa protein 4L OS=Homo sapiens OX=9606 GN=HSPA4L PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 28.0 null 477-UNIMOD:1031,257-UNIMOD:1031,824-UNIMOD:1031,140-UNIMOD:4 0.08 28.0 4 4 4 PRT sp|P12081|HARS1_HUMAN Histidine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=HARS1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 28.0 null 112-UNIMOD:1031 0.03 28.0 1 1 1 PRT sp|O14733|MP2K7_HUMAN Dual specificity mitogen-activated protein kinase kinase 7 OS=Homo sapiens OX=9606 GN=MAP2K7 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ] 28.0 null 2-UNIMOD:1,9-UNIMOD:1031,245-UNIMOD:1031,149-UNIMOD:1031 0.09 28.0 3 3 3 PRT sp|P22061|PIMT_HUMAN Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Homo sapiens OX=9606 GN=PCMT1 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 28.0 null 2-UNIMOD:1,4-UNIMOD:1031,125-UNIMOD:1031,18-UNIMOD:267 0.13 28.0 3 3 3 PRT sp|Q96CT7|CC124_HUMAN Coiled-coil domain-containing protein 124 OS=Homo sapiens OX=9606 GN=CCDC124 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 28.0 null 11-UNIMOD:1031,121-UNIMOD:1031 0.13 28.0 2 2 2 PRT sp|Q7LBR1|CHM1B_HUMAN Charged multivesicular body protein 1b OS=Homo sapiens OX=9606 GN=CHMP1B PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 28.0 null 2-UNIMOD:1,6-UNIMOD:1031 0.06 28.0 1 1 1 PRT sp|P33240|CSTF2_HUMAN Cleavage stimulation factor subunit 2 OS=Homo sapiens OX=9606 GN=CSTF2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 28.0 null 189-UNIMOD:1031 0.02 28.0 1 1 1 PRT sp|Q9UK76|JUPI1_HUMAN Jupiter microtubule associated homolog 1 OS=Homo sapiens OX=9606 GN=JPT1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 28.0 null 2-UNIMOD:1,8-UNIMOD:1031 0.10 28.0 1 1 1 PRT sp|Q8TAT6|NPL4_HUMAN Nuclear protein localization protein 4 homolog OS=Homo sapiens OX=9606 GN=NPLOC4 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 28.0 null 431-UNIMOD:1031,170-UNIMOD:1031 0.04 28.0 2 2 2 PRT sp|P78344|IF4G2_HUMAN Eukaryotic translation initiation factor 4 gamma 2 OS=Homo sapiens OX=9606 GN=EIF4G2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 28.0 null 170-UNIMOD:1031 0.02 28.0 1 1 1 PRT sp|P85037|FOXK1_HUMAN Forkhead box protein K1 OS=Homo sapiens OX=9606 GN=FOXK1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 28.0 null 388-UNIMOD:1031 0.02 28.0 1 1 1 PRT sp|Q9Y3C8|UFC1_HUMAN Ubiquitin-fold modifier-conjugating enzyme 1 OS=Homo sapiens OX=9606 GN=UFC1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 28.0 null 47-UNIMOD:1031 0.09 28.0 1 1 1 PRT sp|P31946|1433B_HUMAN 14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 28.0 null 51-UNIMOD:1031,160-UNIMOD:1031,162-UNIMOD:35,224-UNIMOD:267,3-UNIMOD:1,5-UNIMOD:1031,82-UNIMOD:1031,24-UNIMOD:35,28-UNIMOD:35,29-UNIMOD:259 0.35 28.0 8 7 3 PRT sp|P60174|TPIS_HUMAN Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 28.0 null 231-UNIMOD:1031,150-UNIMOD:259,104-UNIMOD:4,106-UNIMOD:259,225-UNIMOD:259,96-UNIMOD:1031 0.21 28.0 5 5 2 PRT sp|P07108|ACBP_HUMAN Acyl-CoA-binding protein OS=Homo sapiens OX=9606 GN=DBI PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 27.0 null 55-UNIMOD:1031,77-UNIMOD:1031,63-UNIMOD:1031 0.25 27.0 6 2 1 PRT sp|P30405|PPIF_HUMAN Peptidyl-prolyl cis-trans isomerase F, mitochondrial OS=Homo sapiens OX=9606 GN=PPIF PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 27.0 null 82-UNIMOD:4,86-UNIMOD:1031,183-UNIMOD:1031,73-UNIMOD:1031 0.16 27.0 3 3 3 PRT sp|P14868-2|SYDC_HUMAN Isoform 2 of Aspartate--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=DARS1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 27.0 null 351-UNIMOD:1031,97-UNIMOD:267 0.06 27.0 3 2 1 PRT sp|Q9BVC6|TM109_HUMAN Transmembrane protein 109 OS=Homo sapiens OX=9606 GN=TMEM109 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 27.0 null 215-UNIMOD:1031 0.05 27.0 1 1 1 PRT sp|Q969Z0-2|FAKD4_HUMAN Isoform 2 of FAST kinase domain-containing protein 4 OS=Homo sapiens OX=9606 GN=TBRG4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 27.0 null 163-UNIMOD:1031,336-UNIMOD:1031,77-UNIMOD:1031 0.07 27.0 3 3 3 PRT sp|Q9NQW7-2|XPP1_HUMAN Isoform 2 of Xaa-Pro aminopeptidase 1 OS=Homo sapiens OX=9606 GN=XPNPEP1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 27.0 null 304-UNIMOD:1031 0.03 27.0 1 1 1 PRT sp|Q06203|PUR1_HUMAN Amidophosphoribosyltransferase OS=Homo sapiens OX=9606 GN=PPAT PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 27.0 null 339-UNIMOD:4,348-UNIMOD:4,349-UNIMOD:1031,372-UNIMOD:1031,65-UNIMOD:1031 0.09 27.0 3 3 3 PRT sp|P83881|RL36A_HUMAN 60S ribosomal protein L36a OS=Homo sapiens OX=9606 GN=RPL36A PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ] 27.0 null 88-UNIMOD:4,89-UNIMOD:1031,30-UNIMOD:1031,88-UNIMOD:385,22-UNIMOD:1031,15-UNIMOD:4,17-UNIMOD:1031,38-UNIMOD:1031,97-UNIMOD:1031,15-UNIMOD:385 0.36 27.0 11 7 4 PRT sp|Q9Y5S2|MRCKB_HUMAN Serine/threonine-protein kinase MRCK beta OS=Homo sapiens OX=9606 GN=CDC42BPB PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 27.0 null 202-UNIMOD:1031 0.01 27.0 1 1 1 PRT sp|Q96RR4-6|KKCC2_HUMAN Isoform 6 of Calcium/calmodulin-dependent protein kinase kinase 2 OS=Homo sapiens OX=9606 GN=CAMKK2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 27.0 null 314-UNIMOD:1031 0.03 27.0 2 1 0 PRT sp|Q96PY6-5|NEK1_HUMAN Isoform 5 of Serine/threonine-protein kinase Nek1 OS=Homo sapiens OX=9606 GN=NEK1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 27.0 null 130-UNIMOD:1031 0.02 27.0 1 1 1 PRT sp|Q02818|NUCB1_HUMAN Nucleobindin-1 OS=Homo sapiens OX=9606 GN=NUCB1 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 27.0 null 177-UNIMOD:1031,71-UNIMOD:1031 0.06 27.0 2 2 2 PRT sp|P51955-3|NEK2_HUMAN Isoform 3 of Serine/threonine-protein kinase Nek2 OS=Homo sapiens OX=9606 GN=NEK2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 27.0 null 143-UNIMOD:1031 0.04 27.0 1 1 1 PRT sp|Q14680-7|MELK_HUMAN Isoform 7 of Maternal embryonic leucine zipper kinase OS=Homo sapiens OX=9606 GN=MELK null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 27.0 null 134-UNIMOD:1031 0.02 27.0 1 1 1 PRT sp|Q00535|CDK5_HUMAN Cyclin-dependent-like kinase 5 OS=Homo sapiens OX=9606 GN=CDK5 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 27.0 null 128-UNIMOD:1031,33-UNIMOD:1031,25-UNIMOD:27 0.08 27.0 16 2 0 PRT sp|P51957-3|NEK4_HUMAN Isoform 3 of Serine/threonine-protein kinase Nek4 OS=Homo sapiens OX=9606 GN=NEK4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 27.0 null 44-UNIMOD:1031 0.02 27.0 1 1 1 PRT sp|Q86UE4|LYRIC_HUMAN Protein LYRIC OS=Homo sapiens OX=9606 GN=MTDH PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 27.0 null 107-UNIMOD:1031,174-UNIMOD:1031 0.06 27.0 2 2 2 PRT sp|P41227-2|NAA10_HUMAN Isoform 2 of N-alpha-acetyltransferase 10 OS=Homo sapiens OX=9606 GN=NAA10 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 27.0 null 183-UNIMOD:1031,133-UNIMOD:1031 0.14 27.0 2 2 2 PRT sp|P08581|MET_HUMAN Hepatocyte growth factor receptor OS=Homo sapiens OX=9606 GN=MET PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 27.0 null 1240-UNIMOD:1031,1107-UNIMOD:4,1110-UNIMOD:1031,1244-UNIMOD:1031,1248-UNIMOD:1031,1229-UNIMOD:35,1232-UNIMOD:1031 0.02 27.0 7 4 1 PRT sp|P04040|CATA_HUMAN Catalase OS=Homo sapiens OX=9606 GN=CAT PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 27.0 null 237-UNIMOD:1031,243-UNIMOD:1031,306-UNIMOD:1031 0.05 27.0 11 2 1 PRT sp|Q9P2R7-2|SUCB1_HUMAN Isoform 2 of Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=SUCLA2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 27.0 null 86-UNIMOD:1031,94-UNIMOD:1031 0.02 27.0 2 1 0 PRT sp|P00387-2|NB5R3_HUMAN Isoform 2 of NADH-cytochrome b5 reductase 3 OS=Homo sapiens OX=9606 GN=CYB5R3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 27.0 null 131-UNIMOD:1031,97-UNIMOD:1031 0.09 27.0 3 2 1 PRT sp|Q9H2U1-3|DHX36_HUMAN Isoform 3 of ATP-dependent DNA/RNA helicase DHX36 OS=Homo sapiens OX=9606 GN=DHX36 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 27.0 null 573-UNIMOD:1031,918-UNIMOD:1031 0.03 27.0 2 2 2 PRT sp|Q07666-2|KHDR1_HUMAN Isoform 2 of KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Homo sapiens OX=9606 GN=KHDRBS1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 27.0 null 160-UNIMOD:1031,140-UNIMOD:1031 0.06 27.0 2 2 2 PRT sp|Q14152-2|EIF3A_HUMAN Isoform 2 of Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens OX=9606 GN=EIF3A null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 27.0 null 598-UNIMOD:1031,34-UNIMOD:1031,504-UNIMOD:1031,617-UNIMOD:1031,713-UNIMOD:1031,557-UNIMOD:1031,611-UNIMOD:1031 0.05 27.0 8 7 5 PRT sp|Q9P2E9|RRBP1_HUMAN Ribosome-binding protein 1 OS=Homo sapiens OX=9606 GN=RRBP1 PE=1 SV=5 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 27.0 null 261-UNIMOD:1031,321-UNIMOD:1031,301-UNIMOD:1031,270-UNIMOD:1031,1175-UNIMOD:1031,56-UNIMOD:1031,1014-UNIMOD:1031,699-UNIMOD:1031 0.19 27.0 9 7 5 PRT sp|Q99584|S10AD_HUMAN Protein S100-A13 OS=Homo sapiens OX=9606 GN=S100A13 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 27.0 null 30-UNIMOD:1031,85-UNIMOD:1031 0.22 27.0 2 2 2 PRT sp|P55060-3|XPO2_HUMAN Isoform 3 of Exportin-2 OS=Homo sapiens OX=9606 GN=CSE1L null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 27.0 null 912-UNIMOD:1031,272-UNIMOD:4,281-UNIMOD:259,17-UNIMOD:1031,158-UNIMOD:1031,425-UNIMOD:1031,706-UNIMOD:267,839-UNIMOD:1031 0.08 27.0 8 7 4 PRT sp|O00764-3|PDXK_HUMAN Isoform 3 of Pyridoxal kinase OS=Homo sapiens OX=9606 GN=PDXK null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 27.0 null 88-UNIMOD:1031 0.05 27.0 2 1 0 PRT sp|Q9UQE7|SMC3_HUMAN Structural maintenance of chromosomes protein 3 OS=Homo sapiens OX=9606 GN=SMC3 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 27.0 null 968-UNIMOD:1031,972-UNIMOD:4,140-UNIMOD:1031 0.02 27.0 2 2 2 PRT sp|Q5VTE6-2|ANGE2_HUMAN Isoform 2 of Protein angel homolog 2 OS=Homo sapiens OX=9606 GN=ANGEL2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 27.0 null 81-UNIMOD:1031,85-UNIMOD:4,88-UNIMOD:4 0.03 27.0 1 1 1 PRT sp|O75347|TBCA_HUMAN Tubulin-specific chaperone A OS=Homo sapiens OX=9606 GN=TBCA PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 27.0 null 52-UNIMOD:1031,28-UNIMOD:1031,12-UNIMOD:1031 0.26 27.0 3 3 3 PRT sp|P41223|BUD31_HUMAN Protein BUD31 homolog OS=Homo sapiens OX=9606 GN=BUD31 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 27.0 null 94-UNIMOD:1031,101-UNIMOD:4,102-UNIMOD:4 0.08 27.0 1 1 1 PRT sp|P50570-3|DYN2_HUMAN Isoform 3 of Dynamin-2 OS=Homo sapiens OX=9606 GN=DNM2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 27.0 null 558-UNIMOD:1031,240-UNIMOD:1031 0.02 27.0 2 2 1 PRT sp|O14874-2|BCKD_HUMAN Isoform 2 of [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial OS=Homo sapiens OX=9606 GN=BCKDK null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 27.0 null 242-UNIMOD:4,245-UNIMOD:1031 0.04 27.0 1 1 1 PRT sp|Q9P2K8-2|E2AK4_HUMAN Isoform 2 of eIF-2-alpha kinase GCN2 OS=Homo sapiens OX=9606 GN=EIF2AK4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 27.0 null 614-UNIMOD:4,615-UNIMOD:4,619-UNIMOD:1031 0.01 27.0 2 1 0 PRT sp|P48047|ATPO_HUMAN ATP synthase subunit O, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5PO PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 27.0 null 60-UNIMOD:1031,84-UNIMOD:1031,90-UNIMOD:1031,54-UNIMOD:1031,98-UNIMOD:1031,176-UNIMOD:1031,185-UNIMOD:35 0.27 27.0 7 6 5 PRT sp|Q00688|FKBP3_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP3 OS=Homo sapiens OX=9606 GN=FKBP3 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 27.0 null 48-UNIMOD:1031,80-UNIMOD:1031 0.17 27.0 3 3 3 PRT sp|Q7L014|DDX46_HUMAN Probable ATP-dependent RNA helicase DDX46 OS=Homo sapiens OX=9606 GN=DDX46 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 27.0 null 1025-UNIMOD:1031,248-UNIMOD:1031,666-UNIMOD:1031,670-UNIMOD:4,776-UNIMOD:1031,1010-UNIMOD:1031,123-UNIMOD:1031,256-UNIMOD:1031,769-UNIMOD:1031,272-UNIMOD:1031,417-UNIMOD:1031 0.10 27.0 11 10 9 PRT sp|Q8NCM8|DYHC2_HUMAN Cytoplasmic dynein 2 heavy chain 1 OS=Homo sapiens OX=9606 GN=DYNC2H1 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 27.0 null 2359-UNIMOD:1031 0.00 27.0 1 1 1 PRT sp|Q5VW32-2|BROX_HUMAN Isoform 2 of BRO1 domain-containing protein BROX OS=Homo sapiens OX=9606 GN=BROX null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 27.0 null 251-UNIMOD:1031,256-UNIMOD:4 0.03 27.0 1 1 1 PRT sp|O14802|RPC1_HUMAN DNA-directed RNA polymerase III subunit RPC1 OS=Homo sapiens OX=9606 GN=POLR3A PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 27.0 null 440-UNIMOD:35,445-UNIMOD:1031,398-UNIMOD:1031 0.02 27.0 2 2 2 PRT sp|Q96QK1|VPS35_HUMAN Vacuolar protein sorting-associated protein 35 OS=Homo sapiens OX=9606 GN=VPS35 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 27.0 null 694-UNIMOD:1031,515-UNIMOD:1031 0.03 27.0 3 2 1 PRT sp|Q92621|NU205_HUMAN Nuclear pore complex protein Nup205 OS=Homo sapiens OX=9606 GN=NUP205 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 27.0 null 66-UNIMOD:1031,892-UNIMOD:1031 0.01 27.0 2 2 2 PRT sp|O95433-2|AHSA1_HUMAN Isoform 2 of Activator of 90 kDa heat shock protein ATPase homolog 1 OS=Homo sapiens OX=9606 GN=AHSA1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 27.0 null 203-UNIMOD:1031,207-UNIMOD:4,208-UNIMOD:1031,189-UNIMOD:1031 0.08 27.0 3 3 1 PRT sp|P29084|T2EB_HUMAN Transcription initiation factor IIE subunit beta OS=Homo sapiens OX=9606 GN=GTF2E2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 27.0 null 37-UNIMOD:1031 0.05 27.0 1 1 1 PRT sp|P12270|TPR_HUMAN Nucleoprotein TPR OS=Homo sapiens OX=9606 GN=TPR PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 27.0 null 1563-UNIMOD:1031,315-UNIMOD:1031,854-UNIMOD:1031,1561-UNIMOD:1031,1053-UNIMOD:267,1555-UNIMOD:1031,252-UNIMOD:259,1361-UNIMOD:1031 0.03 27.0 10 8 6 PRT sp|Q9Y6V7|DDX49_HUMAN Probable ATP-dependent RNA helicase DDX49 OS=Homo sapiens OX=9606 GN=DDX49 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 27.0 null 52-UNIMOD:1031 0.04 27.0 1 1 1 PRT sp|P22695|QCR2_HUMAN Cytochrome b-c1 complex subunit 2, mitochondrial OS=Homo sapiens OX=9606 GN=UQCRC2 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 27.0 null 375-UNIMOD:259,250-UNIMOD:1031,315-UNIMOD:259 0.10 27.0 3 3 3 PRT sp|P50897-2|PPT1_HUMAN Isoform 2 of Palmitoyl-protein thioesterase 1 OS=Homo sapiens OX=9606 GN=PPT1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 27.0 null 71-UNIMOD:1031,62-UNIMOD:1031 0.08 27.0 2 2 2 PRT sp|Q9UMY1|NOL7_HUMAN Nucleolar protein 7 OS=Homo sapiens OX=9606 GN=NOL7 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 27.0 null 210-UNIMOD:1031 0.05 27.0 1 1 1 PRT sp|Q13596-2|SNX1_HUMAN Isoform 1A of Sorting nexin-1 OS=Homo sapiens OX=9606 GN=SNX1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 27.0 null 161-UNIMOD:1031 0.03 27.0 1 1 1 PRT sp|Q99460-2|PSMD1_HUMAN Isoform 2 of 26S proteasome non-ATPase regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PSMD1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 27.0 null 720-UNIMOD:1031,725-UNIMOD:35,319-UNIMOD:259 0.02 27.0 4 2 0 PRT sp|P30043|BLVRB_HUMAN Flavin reductase (NADPH) OS=Homo sapiens OX=9606 GN=BLVRB PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 27.0 null 178-UNIMOD:1031,134-UNIMOD:267 0.12 27.0 2 2 2 PRT sp|O60493|SNX3_HUMAN Sorting nexin-3 OS=Homo sapiens OX=9606 GN=SNX3 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 27.0 null 95-UNIMOD:1031,54-UNIMOD:1031,61-UNIMOD:1031 0.16 27.0 4 3 2 PRT sp|Q93009-3|UBP7_HUMAN Isoform 3 of Ubiquitin carboxyl-terminal hydrolase 7 OS=Homo sapiens OX=9606 GN=USP7 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 27.0 null 462-UNIMOD:4,463-UNIMOD:1031,808-UNIMOD:1031,898-UNIMOD:1031,901-UNIMOD:4 0.04 27.0 3 3 3 PRT sp|P04439|HLAA_HUMAN HLA class I histocompatibility antigen, A alpha chain OS=Homo sapiens OX=9606 GN=HLA-A PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 27.0 null 200-UNIMOD:1031,92-UNIMOD:1031 0.06 27.0 2 2 2 PRT sp|Q16881|TRXR1_HUMAN Thioredoxin reductase 1, cytoplasmic OS=Homo sapiens OX=9606 GN=TXNRD1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 27.0 null 218-UNIMOD:1031,220-UNIMOD:35,274-UNIMOD:1031,416-UNIMOD:267 0.07 27.0 3 3 0 PRT sp|Q04637|IF4G1_HUMAN Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 27.0 null 832-UNIMOD:1031,1024-UNIMOD:35,1026-UNIMOD:1031 0.02 27.0 2 2 1 PRT sp|O60361|NDK8_HUMAN Putative nucleoside diphosphate kinase OS=Homo sapiens OX=9606 GN=NME2P1 PE=5 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 27.0 null 109-UNIMOD:1031,109-UNIMOD:259 0.11 27.0 2 2 1 PRT sp|P20290-2|BTF3_HUMAN Isoform 2 of Transcription factor BTF3 OS=Homo sapiens OX=9606 GN=BTF3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ] 27.0 null 2-UNIMOD:1031,1-UNIMOD:35,3-UNIMOD:1,10-UNIMOD:1031,6-UNIMOD:35 0.09 27.0 7 2 0 PRT sp|Q12906|ILF3_HUMAN Interleukin enhancer-binding factor 3 OS=Homo sapiens OX=9606 GN=ILF3 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 27.0 null 224-UNIMOD:1031,226-UNIMOD:4,454-UNIMOD:1031,413-UNIMOD:1031,553-UNIMOD:1031 0.06 27.0 4 4 2 PRT sp|Q9Y230|RUVB2_HUMAN RuvB-like 2 OS=Homo sapiens OX=9606 GN=RUVBL2 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 27.0 null 2-UNIMOD:1,9-UNIMOD:1031,168-UNIMOD:35,177-UNIMOD:259 0.06 27.0 2 2 2 PRT sp|P48637|GSHB_HUMAN Glutathione synthetase OS=Homo sapiens OX=9606 GN=GSS PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 27.0 null 294-UNIMOD:385,294-UNIMOD:4,305-UNIMOD:1031,178-UNIMOD:1031,306-UNIMOD:1031 0.09 27.0 5 4 2 PRT sp|Q9H2G2|SLK_HUMAN STE20-like serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=SLK PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 27.0 null 55-UNIMOD:27,63-UNIMOD:1031 0.01 27.0 1 1 0 PRT sp|P04843|RPN1_HUMAN Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Homo sapiens OX=9606 GN=RPN1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 27.0 null 553-UNIMOD:1031,587-UNIMOD:1031,294-UNIMOD:267,545-UNIMOD:4,517-UNIMOD:1031,547-UNIMOD:267,516-UNIMOD:1031 0.11 27.0 8 6 4 PRT sp|P54819|KAD2_HUMAN Adenylate kinase 2, mitochondrial OS=Homo sapiens OX=9606 GN=AK2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 27.0 null 28-UNIMOD:1031,34-UNIMOD:267,14-UNIMOD:1031 0.14 27.0 18 2 1 PRT sp|Q7KZI7|MARK2_HUMAN Serine/threonine-protein kinase MARK2 OS=Homo sapiens OX=9606 GN=MARK2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 27.0 null 177-UNIMOD:1031,187-UNIMOD:35 0.02 27.0 2 1 0 PRT sp|Q9H2K8|TAOK3_HUMAN Serine/threonine-protein kinase TAO3 OS=Homo sapiens OX=9606 GN=TAOK3 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 27.0 null 439-UNIMOD:1031,398-UNIMOD:1031 0.02 27.0 3 2 1 PRT sp|Q9UQM7|KCC2A_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Homo sapiens OX=9606 GN=CAMK2A PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 27.0 null 137-UNIMOD:1031 0.03 27.0 1 1 1 PRT sp|Q92597|NDRG1_HUMAN Protein NDRG1 OS=Homo sapiens OX=9606 GN=NDRG1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 27.0 null 285-UNIMOD:1031,289-UNIMOD:4 0.05 27.0 1 1 1 PRT sp|P61289|PSME3_HUMAN Proteasome activator complex subunit 3 OS=Homo sapiens OX=9606 GN=PSME3 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 27.0 null 2-UNIMOD:1,6-UNIMOD:1031,12-UNIMOD:1031,14-UNIMOD:1031,192-UNIMOD:1031 0.11 27.0 5 4 3 PRT sp|P14866|HNRPL_HUMAN Heterogeneous nuclear ribonucleoprotein L OS=Homo sapiens OX=9606 GN=HNRNPL PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 27.0 null 568-UNIMOD:1031,493-UNIMOD:1031,269-UNIMOD:1031 0.08 27.0 3 3 2 PRT sp|P52564|MP2K6_HUMAN Dual specificity mitogen-activated protein kinase kinase 6 OS=Homo sapiens OX=9606 GN=MAP2K6 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 27.0 null 181-UNIMOD:1031,79-UNIMOD:35,82-UNIMOD:1031 0.09 27.0 6 2 0 PRT sp|P68400|CSK21_HUMAN Casein kinase II subunit alpha OS=Homo sapiens OX=9606 GN=CSNK2A1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 27.0 null 158-UNIMOD:1031,163-UNIMOD:35 0.04 27.0 1 1 0 PRT sp|P50570|DYN2_HUMAN Dynamin-2 OS=Homo sapiens OX=9606 GN=DNM2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 27.0 null 562-UNIMOD:1031,564-UNIMOD:35,191-UNIMOD:1031 0.03 27.0 3 2 1 PRT sp|Q8IZ83|A16A1_HUMAN Aldehyde dehydrogenase family 16 member A1 OS=Homo sapiens OX=9606 GN=ALDH16A1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 27.0 null 564-UNIMOD:1031 0.02 27.0 7 1 0 PRT sp|Q9H082|RB33B_HUMAN Ras-related protein Rab-33B OS=Homo sapiens OX=9606 GN=RAB33B PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 27.0 null 83-UNIMOD:1031 0.06 27.0 1 1 1 PRT sp|P33552|CKS2_HUMAN Cyclin-dependent kinases regulatory subunit 2 OS=Homo sapiens OX=9606 GN=CKS2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 27.0 null 2-UNIMOD:1,4-UNIMOD:1031 0.14 27.0 1 1 1 PRT sp|Q71UM5|RS27L_HUMAN 40S ribosomal protein S27-like OS=Homo sapiens OX=9606 GN=RPS27L PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 27.0 null 16-UNIMOD:1031 0.15 27.0 1 1 1 PRT sp|O75380|NDUS6_HUMAN NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS6 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 27.0 null 108-UNIMOD:1031,112-UNIMOD:4,115-UNIMOD:4 0.13 27.0 1 1 1 PRT sp|O76094|SRP72_HUMAN Signal recognition particle subunit SRP72 OS=Homo sapiens OX=9606 GN=SRP72 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 27.0 null 287-UNIMOD:1031 0.02 27.0 1 1 1 PRT sp|Q14203|DCTN1_HUMAN Dynactin subunit 1 OS=Homo sapiens OX=9606 GN=DCTN1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 27.0 null 962-UNIMOD:1031 0.01 27.0 1 1 1 PRT sp|P30049|ATPD_HUMAN ATP synthase subunit delta, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1D PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 26.0 null 0.09 26.0 1 1 1 PRT sp|P14314-2|GLU2B_HUMAN Isoform 2 of Glucosidase 2 subunit beta OS=Homo sapiens OX=9606 GN=PRKCSH null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 26.0 null 219-UNIMOD:259,158-UNIMOD:1031,487-UNIMOD:35,191-UNIMOD:1031,167-UNIMOD:1031,433-UNIMOD:1031 0.10 26.0 7 6 4 PRT sp|O75477|ERLN1_HUMAN Erlin-1 OS=Homo sapiens OX=9606 GN=ERLIN1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 26.0 null 222-UNIMOD:1031,207-UNIMOD:1031,275-UNIMOD:1031 0.10 26.0 3 3 3 PRT sp|Q9BV44|THUM3_HUMAN THUMP domain-containing protein 3 OS=Homo sapiens OX=9606 GN=THUMPD3 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 26.0 null 449-UNIMOD:1031,450-UNIMOD:4,369-UNIMOD:1031 0.06 26.0 3 2 1 PRT sp|Q96GD4-4|AURKB_HUMAN Isoform 4 of Aurora kinase B OS=Homo sapiens OX=9606 GN=AURKB null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 26.0 null 161-UNIMOD:1031 0.04 26.0 1 1 1 PRT sp|P13489|RINI_HUMAN Ribonuclease inhibitor OS=Homo sapiens OX=9606 GN=RNH1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 26.0 null 220-UNIMOD:4,226-UNIMOD:1031 0.03 26.0 1 1 1 PRT sp|Q9Y2H9|MAST1_HUMAN Microtubule-associated serine/threonine-protein kinase 1 OS=Homo sapiens OX=9606 GN=MAST1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 26.0 null 499-UNIMOD:1031,508-UNIMOD:35 0.01 26.0 2 1 0 PRT sp|Q8TDC3-3|BRSK1_HUMAN Isoform 3 of Serine/threonine-protein kinase BRSK1 OS=Homo sapiens OX=9606 GN=BRSK1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 26.0 null 158-UNIMOD:1031 0.04 26.0 1 1 1 PRT sp|O75116|ROCK2_HUMAN Rho-associated protein kinase 2 OS=Homo sapiens OX=9606 GN=ROCK2 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 26.0 null 216-UNIMOD:1031,120-UNIMOD:35,121-UNIMOD:1031,220-UNIMOD:35,1076-UNIMOD:1031,1022-UNIMOD:1031,1065-UNIMOD:1031,1068-UNIMOD:35,1065-UNIMOD:259,1071-UNIMOD:259 0.04 26.0 14 5 2 PRT sp|Q9Y6M4-6|KC1G3_HUMAN Isoform 6 of Casein kinase I isoform gamma-3 OS=Homo sapiens OX=9606 GN=CSNK1G3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 26.0 null 51-UNIMOD:1031 0.04 26.0 1 1 1 PRT sp|P78368|KC1G2_HUMAN Casein kinase I isoform gamma-2 OS=Homo sapiens OX=9606 GN=CSNK1G2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 26.0 null 167-UNIMOD:1031 0.03 26.0 1 1 1 PRT sp|Q9UNH7-2|SNX6_HUMAN Isoform 2 of Sorting nexin-6 OS=Homo sapiens OX=9606 GN=SNX6 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 26.0 null 191-UNIMOD:1031,109-UNIMOD:1031 0.07 26.0 2 2 2 PRT sp|P35232|PHB_HUMAN Prohibitin OS=Homo sapiens OX=9606 GN=PHB PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ] 26.0 null 202-UNIMOD:1031,2-UNIMOD:1,4-UNIMOD:1031 0.12 26.0 3 3 3 PRT sp|Q9BUP3|HTAI2_HUMAN Oxidoreductase HTATIP2 OS=Homo sapiens OX=9606 GN=HTATIP2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 26.0 null 98-UNIMOD:1031 0.08 26.0 2 2 2 PRT sp|Q9Y243-2|AKT3_HUMAN Isoform 2 of RAC-gamma serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=AKT3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 26.0 null 161-UNIMOD:1031 0.02 26.0 1 1 0 PRT sp|Q12959-8|DLG1_HUMAN Isoform 8 of Disks large homolog 1 OS=Homo sapiens OX=9606 GN=DLG1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 26.0 null 690-UNIMOD:4,700-UNIMOD:1031 0.02 26.0 2 1 0 PRT sp|P06746|DPOLB_HUMAN DNA polymerase beta OS=Homo sapiens OX=9606 GN=POLB PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 26.0 null 72-UNIMOD:1031 0.04 26.0 1 1 1 PRT sp|Q15393|SF3B3_HUMAN Splicing factor 3B subunit 3 OS=Homo sapiens OX=9606 GN=SF3B3 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 26.0 null 109-UNIMOD:1031,112-UNIMOD:4,942-UNIMOD:1031,958-UNIMOD:267,690-UNIMOD:267,139-UNIMOD:1031 0.05 26.0 6 5 4 PRT sp|Q3LXA3-2|TKFC_HUMAN Isoform 2 of Triokinase/FMN cyclase OS=Homo sapiens OX=9606 GN=TKFC null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 26.0 null 230-UNIMOD:1031,487-UNIMOD:1031 0.04 26.0 2 2 2 PRT sp|A2A3N6|PIPSL_HUMAN Putative PIP5K1A and PSMD4-like protein OS=Homo sapiens OX=9606 GN=PIPSL PE=5 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 26.0 null 559-UNIMOD:1031,87-UNIMOD:1031,223-UNIMOD:1031 0.04 26.0 4 3 1 PRT sp|Q9UNZ5|L10K_HUMAN Leydig cell tumor 10 kDa protein homolog OS=Homo sapiens OX=9606 GN=C19orf53 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 26.0 null 87-UNIMOD:1031,17-UNIMOD:1031,25-UNIMOD:1031,48-UNIMOD:1031 0.33 26.0 4 4 4 PRT sp|P33176|KINH_HUMAN Kinesin-1 heavy chain OS=Homo sapiens OX=9606 GN=KIF5B PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 26.0 null 801-UNIMOD:1031 0.01 26.0 1 1 1 PRT sp|Q8N7H5-3|PAF1_HUMAN Isoform 3 of RNA polymerase II-associated factor 1 homolog OS=Homo sapiens OX=9606 GN=PAF1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 26.0 null 123-UNIMOD:1031 0.02 26.0 1 1 1 PRT sp|O14974-5|MYPT1_HUMAN Isoform 5 of Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens OX=9606 GN=PPP1R12A null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 26.0 null 355-UNIMOD:1031 0.02 26.0 1 1 1 PRT sp|Q8IX18-3|DHX40_HUMAN Isoform 3 of Probable ATP-dependent RNA helicase DHX40 OS=Homo sapiens OX=9606 GN=DHX40 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 26.0 null 108-UNIMOD:1031 0.02 26.0 1 1 1 PRT sp|Q96TA1-2|NIBA2_HUMAN Isoform 2 of Protein Niban 2 OS=Homo sapiens OX=9606 GN=NIBAN2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 26.0 null 466-UNIMOD:1031,70-UNIMOD:1031,494-UNIMOD:1031,499-UNIMOD:4 0.05 26.0 3 3 3 PRT sp|P33993-3|MCM7_HUMAN Isoform 3 of DNA replication licensing factor MCM7 OS=Homo sapiens OX=9606 GN=MCM7 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 26.0 null 176-UNIMOD:1031 0.03 26.0 1 1 1 PRT sp|O15371|EIF3D_HUMAN Eukaryotic translation initiation factor 3 subunit D OS=Homo sapiens OX=9606 GN=EIF3D PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 26.0 null 505-UNIMOD:1031,90-UNIMOD:1031,142-UNIMOD:1031,275-UNIMOD:1031,53-UNIMOD:1031,458-UNIMOD:1031 0.11 26.0 6 6 6 PRT sp|Q9NW13-2|RBM28_HUMAN Isoform 2 of RNA-binding protein 28 OS=Homo sapiens OX=9606 GN=RBM28 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 26.0 null 337-UNIMOD:1031 0.02 26.0 1 1 1 PRT sp|Q9Y535-2|RPC8_HUMAN Isoform 2 of DNA-directed RNA polymerase III subunit RPC8 OS=Homo sapiens OX=9606 GN=POLR3H null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 26.0 null 32-UNIMOD:1031 0.07 26.0 1 1 1 PRT sp|Q01082|SPTB2_HUMAN Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 26.0 null 1878-UNIMOD:1031 0.01 26.0 1 1 1 PRT sp|P30626-3|SORCN_HUMAN Isoform 3 of Sorcin OS=Homo sapiens OX=9606 GN=SRI null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 26.0 null 131-UNIMOD:1031 0.07 26.0 1 1 1 PRT sp|P51970|NDUA8_HUMAN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 OS=Homo sapiens OX=9606 GN=NDUFA8 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 26.0 null 65-UNIMOD:1031,66-UNIMOD:4 0.07 26.0 1 1 1 PRT sp|Q13155|AIMP2_HUMAN Aminoacyl tRNA synthase complex-interacting multifunctional protein 2 OS=Homo sapiens OX=9606 GN=AIMP2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ] 26.0 null 70-UNIMOD:1031,3-UNIMOD:1,7-UNIMOD:1031,168-UNIMOD:4,174-UNIMOD:1031 0.12 26.0 3 3 3 PRT sp|P31947-2|1433S_HUMAN Isoform 2 of 14-3-3 protein sigma OS=Homo sapiens OX=9606 GN=SFN null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 26.0 null 49-UNIMOD:1031,123-UNIMOD:35,127-UNIMOD:259,27-UNIMOD:1031,38-UNIMOD:4 0.24 26.0 5 4 3 PRT sp|Q13501-2|SQSTM_HUMAN Isoform 2 of Sequestosome-1 OS=Homo sapiens OX=9606 GN=SQSTM1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 26.0 null 351-UNIMOD:1031 0.04 26.0 1 1 1 PRT sp|Q8TED1|GPX8_HUMAN Probable glutathione peroxidase 8 OS=Homo sapiens OX=9606 GN=GPX8 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 26.0 null 120-UNIMOD:1031 0.05 26.0 1 1 1 PRT sp|Q9UK39|NOCT_HUMAN Nocturnin OS=Homo sapiens OX=9606 GN=NOCT PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 26.0 null 281-UNIMOD:4,288-UNIMOD:1031 0.03 26.0 2 1 0 PRT sp|Q96PZ0|PUS7_HUMAN Pseudouridylate synthase 7 homolog OS=Homo sapiens OX=9606 GN=PUS7 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 26.0 null 415-UNIMOD:1031 0.02 26.0 1 1 1 PRT sp|O60869|EDF1_HUMAN Endothelial differentiation-related factor 1 OS=Homo sapiens OX=9606 GN=EDF1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 26.0 null 25-UNIMOD:1031,93-UNIMOD:1031,131-UNIMOD:1031,60-UNIMOD:1031,102-UNIMOD:1031 0.41 26.0 6 6 6 PRT sp|P35613-2|BASI_HUMAN Isoform 2 of Basigin OS=Homo sapiens OX=9606 GN=BSG null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 26.0 null 259-UNIMOD:1031,71-UNIMOD:1031 0.09 26.0 2 2 2 PRT sp|Q9NU22|MDN1_HUMAN Midasin OS=Homo sapiens OX=9606 GN=MDN1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 26.0 null 1266-UNIMOD:1031,3250-UNIMOD:1031 0.01 26.0 4 3 2 PRT sp|P63208-2|SKP1_HUMAN Isoform 2 of S-phase kinase-associated protein 1 OS=Homo sapiens OX=9606 GN=SKP1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 26.0 null 94-UNIMOD:259 0.09 26.0 2 1 0 PRT sp|P13995-2|MTDC_HUMAN Isoform 2 of Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=MTHFD2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 26.0 null 92-UNIMOD:1031 0.06 26.0 1 1 1 PRT sp|Q07955|SRSF1_HUMAN Serine/arginine-rich splicing factor 1 OS=Homo sapiens OX=9606 GN=SRSF1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 26.0 null 30-UNIMOD:1031,165-UNIMOD:1031,193-UNIMOD:1031 0.12 26.0 3 3 3 PRT sp|Q9BTD8-4|RBM42_HUMAN Isoform 4 of RNA-binding protein 42 OS=Homo sapiens OX=9606 GN=RBM42 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 26.0 null 388-UNIMOD:1031 0.02 26.0 1 1 1 PRT sp|O15144|ARPC2_HUMAN Actin-related protein 2/3 complex subunit 2 OS=Homo sapiens OX=9606 GN=ARPC2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 26.0 null 275-UNIMOD:1031,295-UNIMOD:1031 0.07 26.0 2 2 2 PRT sp|P42285|MTREX_HUMAN Exosome RNA helicase MTR4 OS=Homo sapiens OX=9606 GN=MTREX PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 26.0 null 852-UNIMOD:1031,853-UNIMOD:4,848-UNIMOD:35,198-UNIMOD:1031 0.02 26.0 4 2 1 PRT sp|O94762-4|RECQ5_HUMAN Isoform 4 of ATP-dependent DNA helicase Q5 OS=Homo sapiens OX=9606 GN=RECQL5 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 26.0 null 571-UNIMOD:1031 0.01 26.0 1 1 1 PRT sp|Q14498-3|RBM39_HUMAN Isoform 3 of RNA-binding protein 39 OS=Homo sapiens OX=9606 GN=RBM39 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 26.0 null 210-UNIMOD:1031,156-UNIMOD:1031 0.06 26.0 2 2 2 PRT sp|O00170|AIP_HUMAN AH receptor-interacting protein OS=Homo sapiens OX=9606 GN=AIP PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 26.0 null 266-UNIMOD:1031,54-UNIMOD:267 0.08 26.0 2 2 2 PRT sp|P05067-10|A4_HUMAN Isoform APP639 of Amyloid-beta precursor protein OS=Homo sapiens OX=9606 GN=APP null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 26.0 null 264-UNIMOD:1031,379-UNIMOD:1031 0.05 26.0 2 2 1 PRT sp|Q6NVV1|R13P3_HUMAN Putative 60S ribosomal protein L13a protein RPL13AP3 OS=Homo sapiens OX=9606 GN=RPL13AP3 PE=5 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 26.0 null 0.12 26.0 1 1 0 PRT sp|P16403|H12_HUMAN Histone H1.2 OS=Homo sapiens OX=9606 GN=H1-2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 26.0 null 34-UNIMOD:1031,160-UNIMOD:1031,63-UNIMOD:1031,130-UNIMOD:1031,187-UNIMOD:1031 0.24 26.0 5 5 3 PRT sp|P07910|HNRPC_HUMAN Heterogeneous nuclear ribonucleoproteins C1/C2 OS=Homo sapiens OX=9606 GN=HNRNPC PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 26.0 null 2-UNIMOD:1,8-UNIMOD:1031,42-UNIMOD:1031,46-UNIMOD:4 0.08 26.0 2 2 2 PRT sp|Q05397|FAK1_HUMAN Focal adhesion kinase 1 OS=Homo sapiens OX=9606 GN=PTK2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 26.0 null 467-UNIMOD:1031,475-UNIMOD:35 0.01 26.0 3 1 0 PRT sp|Q13557|KCC2D_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Homo sapiens OX=9606 GN=CAMK2D PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 26.0 null 43-UNIMOD:1031 0.03 26.0 2 1 0 PRT sp|Q14974|IMB1_HUMAN Importin subunit beta-1 OS=Homo sapiens OX=9606 GN=KPNB1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 26.0 null 859-UNIMOD:1031,835-UNIMOD:1031 0.02 26.0 2 2 1 PRT sp|P30085|KCY_HUMAN UMP-CMP kinase OS=Homo sapiens OX=9606 GN=CMPK1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 26.0 null 16-UNIMOD:1031,20-UNIMOD:4 0.11 26.0 2 1 0 PRT sp|P17655|CAN2_HUMAN Calpain-2 catalytic subunit OS=Homo sapiens OX=9606 GN=CAPN2 PE=1 SV=6 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 26.0 null 26-UNIMOD:1031,2-UNIMOD:1,7-UNIMOD:1031 0.03 26.0 2 2 2 PRT sp|Q96KB5|TOPK_HUMAN Lymphokine-activated killer T-cell-originated protein kinase OS=Homo sapiens OX=9606 GN=PBK PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ] 26.0 null 1-UNIMOD:1,8-UNIMOD:1031,65-UNIMOD:1031,70-UNIMOD:4 0.08 26.0 2 2 2 PRT sp|Q9NT62|ATG3_HUMAN Ubiquitin-like-conjugating enzyme ATG3 OS=Homo sapiens OX=9606 GN=ATG3 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 26.0 null 1-UNIMOD:1,9-UNIMOD:1031 0.04 26.0 1 1 1 PRT sp|P48556|PSMD8_HUMAN 26S proteasome non-ATPase regulatory subunit 8 OS=Homo sapiens OX=9606 GN=PSMD8 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 26.0 null 138-UNIMOD:1031 0.03 26.0 2 1 0 PRT sp|P11177|ODPB_HUMAN Pyruvate dehydrogenase E1 component subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=PDHB PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 26.0 null 0.05 26.0 1 1 1 PRT sp|Q16539|MK14_HUMAN Mitogen-activated protein kinase 14 OS=Homo sapiens OX=9606 GN=MAPK14 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 26.0 null 11-UNIMOD:28,15-UNIMOD:1031 0.04 26.0 6 1 0 PRT sp|P51659|DHB4_HUMAN Peroxisomal multifunctional enzyme type 2 OS=Homo sapiens OX=9606 GN=HSD17B4 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 26.0 null 50-UNIMOD:1031,46-UNIMOD:1031 0.04 26.0 2 2 2 PRT sp|Q99733|NP1L4_HUMAN Nucleosome assembly protein 1-like 4 OS=Homo sapiens OX=9606 GN=NAP1L4 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 26.0 null 61-UNIMOD:1031,263-UNIMOD:1031,192-UNIMOD:1031 0.10 26.0 3 3 3 PRT sp|Q9ULP9|TBC24_HUMAN TBC1 domain family member 24 OS=Homo sapiens OX=9606 GN=TBC1D24 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 26.0 null 29-UNIMOD:4,36-UNIMOD:1031 0.03 26.0 1 1 1 PRT sp|O95817|BAG3_HUMAN BAG family molecular chaperone regulator 3 OS=Homo sapiens OX=9606 GN=BAG3 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 26.0 null 445-UNIMOD:1031,249-UNIMOD:259,133-UNIMOD:267 0.08 26.0 4 3 2 PRT sp|P26368|U2AF2_HUMAN Splicing factor U2AF 65 kDa subunit OS=Homo sapiens OX=9606 GN=U2AF2 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 26.0 null 70-UNIMOD:1031 0.03 26.0 1 1 0 PRT sp|Q00610|CLH1_HUMAN Clathrin heavy chain 1 OS=Homo sapiens OX=9606 GN=CLTC PE=1 SV=5 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 26.0 null 1612-UNIMOD:1031,892-UNIMOD:267,1461-UNIMOD:1031,1347-UNIMOD:1031 0.04 26.0 4 4 3 PRT sp|P13073|COX41_HUMAN Cytochrome c oxidase subunit 4 isoform 1, mitochondrial OS=Homo sapiens OX=9606 GN=COX4I1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 26.0 null 53-UNIMOD:1031,87-UNIMOD:1031,93-UNIMOD:35,60-UNIMOD:1031 0.24 26.0 5 4 3 PRT sp|P30533|AMRP_HUMAN Alpha-2-macroglobulin receptor-associated protein OS=Homo sapiens OX=9606 GN=LRPAP1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ] 26.0 null 163-UNIMOD:1031,225-UNIMOD:1031,287-UNIMOD:1031,297-UNIMOD:28,304-UNIMOD:1031,43-UNIMOD:1031,340-UNIMOD:1031 0.17 26.0 6 6 6 PRT sp|Q92979|NEP1_HUMAN Ribosomal RNA small subunit methyltransferase NEP1 OS=Homo sapiens OX=9606 GN=EMG1 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 25.0 null 154-UNIMOD:1031 0.05 25.0 1 1 1 PRT sp|Q9HB21|PKHA1_HUMAN Pleckstrin homology domain-containing family A member 1 OS=Homo sapiens OX=9606 GN=PLEKHA1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 25.0 null 198-UNIMOD:4,200-UNIMOD:1031 0.03 25.0 1 1 1 PRT sp|P78344-2|IF4G2_HUMAN Isoform 2 of Eukaryotic translation initiation factor 4 gamma 2 OS=Homo sapiens OX=9606 GN=EIF4G2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 25.0 null 537-UNIMOD:1031,491-UNIMOD:1031 0.04 25.0 3 3 3 PRT sp|P50238|CRIP1_HUMAN Cysteine-rich protein 1 OS=Homo sapiens OX=9606 GN=CRIP1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 25.0 null 7-UNIMOD:4,9-UNIMOD:1031 0.14 25.0 1 1 1 PRT sp|A3KMH1-2|VWA8_HUMAN Isoform 2 of von Willebrand factor A domain-containing protein 8 OS=Homo sapiens OX=9606 GN=VWA8 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 25.0 null 444-UNIMOD:4,449-UNIMOD:1031,451-UNIMOD:4,453-UNIMOD:1031 0.02 25.0 2 2 2 PRT sp|O15440-4|MRP5_HUMAN Isoform 4 of Multidrug resistance-associated protein 5 OS=Homo sapiens OX=9606 GN=ABCC5 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 25.0 null 8-UNIMOD:1031 0.08 25.0 1 1 1 PRT sp|Q00537-2|CDK17_HUMAN Isoform 2 of Cyclin-dependent kinase 17 OS=Homo sapiens OX=9606 GN=CDK17 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 25.0 null 315-UNIMOD:1031,221-UNIMOD:1031 0.05 25.0 2 2 2 PRT sp|Q9NZJ5|E2AK3_HUMAN Eukaryotic translation initiation factor 2-alpha kinase 3 OS=Homo sapiens OX=9606 GN=EIF2AK3 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 25.0 null 939-UNIMOD:1031,947-UNIMOD:35,939-UNIMOD:259,952-UNIMOD:259 0.02 25.0 2 1 0 PRT sp|P45984-5|MK09_HUMAN Isoform 5 of Mitogen-activated protein kinase 9 OS=Homo sapiens OX=9606 GN=MAPK9 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 25.0 null 153-UNIMOD:1031,160-UNIMOD:1031 0.05 25.0 2 1 0 PRT sp|Q15131-4|CDK10_HUMAN Isoform 4 of Cyclin-dependent kinase 10 OS=Homo sapiens OX=9606 GN=CDK10 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 25.0 null 94-UNIMOD:1031,100-UNIMOD:35 0.05 25.0 1 1 1 PRT sp|Q15436|SC23A_HUMAN Protein transport protein Sec23A OS=Homo sapiens OX=9606 GN=SEC23A PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 25.0 null 198-UNIMOD:1031 0.02 25.0 1 1 1 PRT sp|P43034|LIS1_HUMAN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens OX=9606 GN=PAFAH1B1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 25.0 null 88-UNIMOD:1031 0.03 25.0 1 1 1 PRT sp|P53350|PLK1_HUMAN Serine/threonine-protein kinase PLK1 OS=Homo sapiens OX=9606 GN=PLK1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 25.0 null 82-UNIMOD:1031,86-UNIMOD:1031,2-UNIMOD:1,9-UNIMOD:1031,77-UNIMOD:27 0.04 25.0 8 2 1 PRT sp|Q14997|PSME4_HUMAN Proteasome activator complex subunit 4 OS=Homo sapiens OX=9606 GN=PSME4 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 25.0 null 30-UNIMOD:1031 0.01 25.0 1 1 1 PRT sp|Q9Y2S6|TMA7_HUMAN Translation machinery-associated protein 7 OS=Homo sapiens OX=9606 GN=TMA7 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 25.0 null 59-UNIMOD:1031 0.17 25.0 1 1 1 PRT sp|P35249-2|RFC4_HUMAN Isoform 2 of Replication factor C subunit 4 OS=Homo sapiens OX=9606 GN=RFC4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 25.0 null 33-UNIMOD:1031 0.05 25.0 1 1 1 PRT sp|P28074-2|PSB5_HUMAN Isoform 2 of Proteasome subunit beta type-5 OS=Homo sapiens OX=9606 GN=PSMB5 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 25.0 null 0.05 25.0 1 1 1 PRT sp|P49257|LMAN1_HUMAN Protein ERGIC-53 OS=Homo sapiens OX=9606 GN=LMAN1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 25.0 null 346-UNIMOD:1031,447-UNIMOD:1031 0.04 25.0 2 2 2 PRT sp|Q8NBS9-2|TXND5_HUMAN Isoform 2 of Thioredoxin domain-containing protein 5 OS=Homo sapiens OX=9606 GN=TXNDC5 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 25.0 null 258-UNIMOD:1031,35-UNIMOD:1031 0.07 25.0 2 2 2 PRT sp|Q9NP81|SYSM_HUMAN Serine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=SARS2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 25.0 null 403-UNIMOD:1031 0.02 25.0 1 1 1 PRT sp|P43897-3|EFTS_HUMAN Isoform 3 of Elongation factor Ts, mitochondrial OS=Homo sapiens OX=9606 GN=TSFM null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 25.0 null 56-UNIMOD:1031,64-UNIMOD:4 0.07 25.0 1 1 1 PRT sp|Q6FIF0-2|ZFAN6_HUMAN Isoform 2 of AN1-type zinc finger protein 6 OS=Homo sapiens OX=9606 GN=ZFAND6 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 25.0 null 143-UNIMOD:1031,151-UNIMOD:4 0.06 25.0 1 1 1 PRT sp|Q99848|EBP2_HUMAN Probable rRNA-processing protein EBP2 OS=Homo sapiens OX=9606 GN=EBNA1BP2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 25.0 null 179-UNIMOD:1031,229-UNIMOD:1031,187-UNIMOD:1031 0.07 25.0 3 3 3 PRT sp|Q9BZZ5-3|API5_HUMAN Isoform 3 of Apoptosis inhibitor 5 OS=Homo sapiens OX=9606 GN=API5 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 25.0 null 51-UNIMOD:1031 0.03 25.0 1 1 1 PRT sp|Q9BQI3-2|E2AK1_HUMAN Isoform 2 of Eukaryotic translation initiation factor 2-alpha kinase 1 OS=Homo sapiens OX=9606 GN=EIF2AK1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 25.0 null 196-UNIMOD:1031 0.02 25.0 1 1 1 PRT sp|O60488-2|ACSL4_HUMAN Isoform Short of Long-chain-fatty-acid--CoA ligase 4 OS=Homo sapiens OX=9606 GN=ACSL4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 25.0 null 48-UNIMOD:1031 0.02 25.0 1 1 1 PRT sp|O75223|GGCT_HUMAN Gamma-glutamylcyclotransferase OS=Homo sapiens OX=9606 GN=GGCT PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 25.0 null 161-UNIMOD:1031,101-UNIMOD:259 0.14 25.0 2 2 2 PRT sp|P11117|PPAL_HUMAN Lysosomal acid phosphatase OS=Homo sapiens OX=9606 GN=ACP2 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 25.0 null 153-UNIMOD:1031,159-UNIMOD:4 0.03 25.0 1 1 1 PRT sp|Q7L0Y3|TM10C_HUMAN tRNA methyltransferase 10 homolog C OS=Homo sapiens OX=9606 GN=TRMT10C PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 25.0 null 276-UNIMOD:1031,134-UNIMOD:1031,327-UNIMOD:1031 0.10 25.0 3 3 3 PRT sp|Q9BXJ9|NAA15_HUMAN N-alpha-acetyltransferase 15, NatA auxiliary subunit OS=Homo sapiens OX=9606 GN=NAA15 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 25.0 null 320-UNIMOD:1031,322-UNIMOD:4,33-UNIMOD:4,34-UNIMOD:1031,649-UNIMOD:1031,305-UNIMOD:1031,419-UNIMOD:1031,101-UNIMOD:1031,102-UNIMOD:4,448-UNIMOD:4,450-UNIMOD:1031,452-UNIMOD:35,447-UNIMOD:1031,15-UNIMOD:1031,459-UNIMOD:1031,465-UNIMOD:4 0.12 25.0 13 10 8 PRT sp|Q9ULV4|COR1C_HUMAN Coronin-1C OS=Homo sapiens OX=9606 GN=CORO1C PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 25.0 null 391-UNIMOD:1031 0.04 25.0 2 1 0 PRT sp|Q13045-2|FLII_HUMAN Isoform 2 of Protein flightless-1 homolog OS=Homo sapiens OX=9606 GN=FLII null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 25.0 null 576-UNIMOD:1031 0.01 25.0 1 1 1 PRT sp|Q9BV40|VAMP8_HUMAN Vesicle-associated membrane protein 8 OS=Homo sapiens OX=9606 GN=VAMP8 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 25.0 null 47-UNIMOD:1031 0.15 25.0 1 1 1 PRT sp|O15226|NKRF_HUMAN NF-kappa-B-repressing factor OS=Homo sapiens OX=9606 GN=NKRF PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 25.0 null 648-UNIMOD:1031 0.02 25.0 1 1 1 PRT sp|Q9H078-5|CLPB_HUMAN Isoform 5 of Caseinolytic peptidase B protein homolog OS=Homo sapiens OX=9606 GN=CLPB null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 25.0 null 191-UNIMOD:1031,422-UNIMOD:1031,195-UNIMOD:1031,197-UNIMOD:35 0.05 25.0 6 3 0 PRT sp|P43243|MATR3_HUMAN Matrin-3 OS=Homo sapiens OX=9606 GN=MATR3 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 25.0 null 625-UNIMOD:1031,491-UNIMOD:1031,711-UNIMOD:1031,836-UNIMOD:1031,611-UNIMOD:1031,588-UNIMOD:1031,473-UNIMOD:1031 0.08 25.0 7 7 7 PRT sp|P36542-2|ATPG_HUMAN Isoform Heart of ATP synthase subunit gamma, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1C null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 25.0 null 154-UNIMOD:1031,48-UNIMOD:35,49-UNIMOD:1031,50-UNIMOD:35,90-UNIMOD:1031,39-UNIMOD:1031,43-UNIMOD:1031 0.16 25.0 7 5 3 PRT sp|Q7Z5K2|WAPL_HUMAN Wings apart-like protein homolog OS=Homo sapiens OX=9606 GN=WAPL PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 25.0 null 303-UNIMOD:1031,552-UNIMOD:1031 0.02 25.0 2 2 2 PRT sp|P56385|ATP5I_HUMAN ATP synthase subunit e, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5ME PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 25.0 null 12-UNIMOD:1031 0.22 25.0 1 1 1 PRT sp|Q9UNX3|RL26L_HUMAN 60S ribosomal protein L26-like 1 OS=Homo sapiens OX=9606 GN=RPL26L1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 25.0 null 69-UNIMOD:1031,63-UNIMOD:1031,89-UNIMOD:1031,51-UNIMOD:259,59-UNIMOD:267 0.37 25.0 5 5 2 PRT sp|P18206|VINC_HUMAN Vinculin OS=Homo sapiens OX=9606 GN=VCL PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 25.0 null 802-UNIMOD:1031 0.02 25.0 1 1 1 PRT sp|P20839|IMDH1_HUMAN Inosine-5'-monophosphate dehydrogenase 1 OS=Homo sapiens OX=9606 GN=IMPDH1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 25.0 null 495-UNIMOD:35,511-UNIMOD:1031,436-UNIMOD:1031 0.06 25.0 2 2 1 PRT sp|P62899|RL31_HUMAN 60S ribosomal protein L31 OS=Homo sapiens OX=9606 GN=RPL31 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 25.0 null 55-UNIMOD:1031 0.10 25.0 1 1 1 PRT sp|P52701|MSH6_HUMAN DNA mismatch repair protein Msh6 OS=Homo sapiens OX=9606 GN=MSH6 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 25.0 null 1014-UNIMOD:1031,185-UNIMOD:1031,13-UNIMOD:1031,1291-UNIMOD:1031,1294-UNIMOD:4,923-UNIMOD:1031,70-UNIMOD:1031 0.05 25.0 8 6 4 PRT sp|Q05682|CALD1_HUMAN Caldesmon OS=Homo sapiens OX=9606 GN=CALD1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 25.0 null 664-UNIMOD:1031,674-UNIMOD:1031,605-UNIMOD:1031 0.04 25.0 3 3 3 PRT sp|O94906|PRP6_HUMAN Pre-mRNA-processing factor 6 OS=Homo sapiens OX=9606 GN=PRPF6 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 25.0 null 178-UNIMOD:1031,146-UNIMOD:1031,395-UNIMOD:1031,679-UNIMOD:35,680-UNIMOD:1031 0.05 25.0 4 4 4 PRT sp|O00425|IF2B3_HUMAN Insulin-like growth factor 2 mRNA-binding protein 3 OS=Homo sapiens OX=9606 GN=IGF2BP3 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 25.0 null 567-UNIMOD:1031,450-UNIMOD:1031,223-UNIMOD:1031,301-UNIMOD:1031 0.09 25.0 4 4 4 PRT sp|Q9BRX2|PELO_HUMAN Protein pelota homolog OS=Homo sapiens OX=9606 GN=PELO PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 25.0 null 337-UNIMOD:1031,270-UNIMOD:1031 0.07 25.0 2 2 2 PRT sp|O14757|CHK1_HUMAN Serine/threonine-protein kinase Chk1 OS=Homo sapiens OX=9606 GN=CHEK1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 25.0 null 445-UNIMOD:1031 0.02 25.0 1 1 0 PRT sp|O75348|VATG1_HUMAN V-type proton ATPase subunit G 1 OS=Homo sapiens OX=9606 GN=ATP6V1G1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ] 25.0 null 2-UNIMOD:1,16-UNIMOD:1031,21-UNIMOD:1031 0.22 25.0 2 2 2 PRT sp|Q99805|TM9S2_HUMAN Transmembrane 9 superfamily member 2 OS=Homo sapiens OX=9606 GN=TM9SF2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 25.0 null 191-UNIMOD:1031,194-UNIMOD:4,234-UNIMOD:1031 0.04 25.0 2 2 2 PRT sp|Q99447|PCY2_HUMAN Ethanolamine-phosphate cytidylyltransferase OS=Homo sapiens OX=9606 GN=PCYT2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 25.0 null 66-UNIMOD:1031 0.03 25.0 1 1 0 PRT sp|Q9GZQ8|MLP3B_HUMAN Microtubule-associated proteins 1A/1B light chain 3B OS=Homo sapiens OX=9606 GN=MAP1LC3B PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 25.0 null 30-UNIMOD:1031,51-UNIMOD:1031 0.25 25.0 2 2 2 PRT sp|P36543|VATE1_HUMAN V-type proton ATPase subunit E 1 OS=Homo sapiens OX=9606 GN=ATP6V1E1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 25.0 null 2-UNIMOD:1,10-UNIMOD:1031 0.06 25.0 1 1 1 PRT sp|P0DP23|CALM1_HUMAN Calmodulin-1 OS=Homo sapiens OX=9606 GN=CALM1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 25.0 null 31-UNIMOD:1031,37-UNIMOD:35 0.11 25.0 1 1 1 PRT sp|Q9NS87|KIF15_HUMAN Kinesin-like protein KIF15 OS=Homo sapiens OX=9606 GN=KIF15 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 25.0 null 812-UNIMOD:1031 0.01 25.0 1 1 1 PRT sp|Q16637|SMN_HUMAN Survival motor neuron protein OS=Homo sapiens OX=9606 GN=SMN1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 25.0 null 45-UNIMOD:1031,209-UNIMOD:1031,285-UNIMOD:1031 0.10 25.0 3 3 3 PRT sp|Q8NC51|PAIRB_HUMAN Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 25.0 null 228-UNIMOD:1031,345-UNIMOD:267 0.09 25.0 2 2 2 PRT sp|P02533|K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens OX=9606 GN=KRT14 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 25.0 null 328-UNIMOD:1031 0.04 25.0 1 1 1 PRT sp|P07992|ERCC1_HUMAN DNA excision repair protein ERCC-1 OS=Homo sapiens OX=9606 GN=ERCC1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 25.0 null 238-UNIMOD:4,243-UNIMOD:1031 0.05 25.0 1 1 1 PRT sp|O14828|SCAM3_HUMAN Secretory carrier-associated membrane protein 3 OS=Homo sapiens OX=9606 GN=SCAMP3 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 25.0 null 313-UNIMOD:1031 0.07 25.0 1 1 1 PRT sp|Q99613|EIF3C_HUMAN Eukaryotic translation initiation factor 3 subunit C OS=Homo sapiens OX=9606 GN=EIF3C PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 25.0 null 320-UNIMOD:1031,862-UNIMOD:259,752-UNIMOD:4,760-UNIMOD:259 0.05 25.0 3 3 1 PRT sp|Q9UQ88|CD11A_HUMAN Cyclin-dependent kinase 11A OS=Homo sapiens OX=9606 GN=CDK11A PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 25.0 null 552-UNIMOD:259,565-UNIMOD:259 0.02 25.0 1 1 0 PRT sp|P82914|RT15_HUMAN 28S ribosomal protein S15, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS15 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 24.0 null 235-UNIMOD:1031,228-UNIMOD:1031 0.05 24.0 2 2 2 PRT sp|Q12789-3|TF3C1_HUMAN Isoform 2 of General transcription factor 3C polypeptide 1 OS=Homo sapiens OX=9606 GN=GTF3C1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 24.0 null 1535-UNIMOD:1031 0.01 24.0 1 1 1 PRT sp|Q14318-3|FKBP8_HUMAN Isoform 3 of Peptidyl-prolyl cis-trans isomerase FKBP8 OS=Homo sapiens OX=9606 GN=FKBP8 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 24.0 null 175-UNIMOD:1031 0.04 24.0 1 1 1 PRT sp|P24666|PPAC_HUMAN Low molecular weight phosphotyrosine protein phosphatase OS=Homo sapiens OX=9606 GN=ACP1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 24.0 null 113-UNIMOD:1031,156-UNIMOD:1031 0.14 24.0 4 2 0 PRT sp|O75531|BAF_HUMAN Barrier-to-autointegration factor OS=Homo sapiens OX=9606 GN=BANF1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 24.0 null 53-UNIMOD:259,2-UNIMOD:1,6-UNIMOD:1031 0.24 24.0 4 2 1 PRT sp|O95249-2|GOSR1_HUMAN Isoform 2 of Golgi SNAP receptor complex member 1 OS=Homo sapiens OX=9606 GN=GOSR1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 24.0 null 61-UNIMOD:1031 0.08 24.0 1 1 1 PRT sp|Q6P2Q9|PRP8_HUMAN Pre-mRNA-processing-splicing factor 8 OS=Homo sapiens OX=9606 GN=PRPF8 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 24.0 null 609-UNIMOD:1031,1020-UNIMOD:1031,1291-UNIMOD:4,1294-UNIMOD:1031,2244-UNIMOD:1031 0.02 24.0 5 4 3 PRT sp|Q8IZL9-2|CDK20_HUMAN Isoform 2 of Cyclin-dependent kinase 20 OS=Homo sapiens OX=9606 GN=CDK20 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 24.0 null 129-UNIMOD:1031 0.07 24.0 1 1 0 PRT sp|O43930|PRKY_HUMAN Putative serine/threonine-protein kinase PRKY OS=Homo sapiens OX=9606 GN=PRKY PE=5 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 24.0 null 174-UNIMOD:1031 0.04 24.0 1 1 1 PRT sp|Q13233|M3K1_HUMAN Mitogen-activated protein kinase kinase kinase 1 OS=Homo sapiens OX=9606 GN=MAP3K1 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 24.0 null 1371-UNIMOD:1031 0.01 24.0 1 1 1 PRT sp|Q71DI3|H32_HUMAN Histone H3.2 OS=Homo sapiens OX=9606 GN=HIST2H3A PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 24.0 null 80-UNIMOD:1031,24-UNIMOD:1031,15-UNIMOD:1031 0.22 24.0 3 3 3 PRT sp|Q9BUL8|PDC10_HUMAN Programmed cell death protein 10 OS=Homo sapiens OX=9606 GN=PDCD10 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 24.0 null 150-UNIMOD:1031 0.06 24.0 1 1 1 PRT sp|O43379-3|WDR62_HUMAN Isoform 3 of WD repeat-containing protein 62 OS=Homo sapiens OX=9606 GN=WDR62 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 24.0 null 102-UNIMOD:1031 0.03 24.0 1 1 0 PRT sp|Q9Y4A5-2|TRRAP_HUMAN Isoform 2 of Transformation/transcription domain-associated protein OS=Homo sapiens OX=9606 GN=TRRAP null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 24.0 null 1673-UNIMOD:1031 0.00 24.0 1 1 1 PRT sp|Q9HAV4|XPO5_HUMAN Exportin-5 OS=Homo sapiens OX=9606 GN=XPO5 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 24.0 null 1173-UNIMOD:1031 0.01 24.0 1 1 1 PRT sp|P56192|SYMC_HUMAN Methionine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=MARS1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 24.0 null 823-UNIMOD:1031,109-UNIMOD:1031 0.03 24.0 2 2 2 PRT sp|Q9H0R8|GBRL1_HUMAN Gamma-aminobutyric acid receptor-associated protein-like 1 OS=Homo sapiens OX=9606 GN=GABARAPL1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 24.0 null 6-UNIMOD:1031 0.11 24.0 1 1 1 PRT sp|Q14203-3|DCTN1_HUMAN Isoform 3 of Dynactin subunit 1 OS=Homo sapiens OX=9606 GN=DCTN1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 24.0 null 51-UNIMOD:1031 0.01 24.0 1 1 1 PRT sp|Q7L1Q6-2|BZW1_HUMAN Isoform 2 of Basic leucine zipper and W2 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=BZW1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 24.0 null 324-UNIMOD:1031,331-UNIMOD:35,60-UNIMOD:1031,333-UNIMOD:1031,133-UNIMOD:1031 0.11 24.0 4 4 4 PRT sp|P61758-2|PFD3_HUMAN Isoform 2 of Prefoldin subunit 3 OS=Homo sapiens OX=9606 GN=VBP1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 24.0 null 77-UNIMOD:1031,70-UNIMOD:1031,66-UNIMOD:1031,184-UNIMOD:1031 0.19 24.0 4 4 4 PRT sp|P43487-2|RANG_HUMAN Isoform 2 of Ran-specific GTPase-activating protein OS=Homo sapiens OX=9606 GN=RANBP1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 24.0 null 172-UNIMOD:1031 0.06 24.0 1 1 1 PRT sp|P35610|SOAT1_HUMAN Sterol O-acyltransferase 1 OS=Homo sapiens OX=9606 GN=SOAT1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 24.0 null 45-UNIMOD:1031 0.02 24.0 1 1 1 PRT sp|Q9NSI2-2|F207A_HUMAN Isoform B of Protein FAM207A OS=Homo sapiens OX=9606 GN=FAM207A null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 24.0 null 108-UNIMOD:1031 0.05 24.0 1 1 1 PRT sp|Q06787-11|FMR1_HUMAN Isoform 11 of Synaptic functional regulator FMR1 OS=Homo sapiens OX=9606 GN=FMR1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 24.0 null 130-UNIMOD:1031 0.02 24.0 1 1 0 PRT sp|Q96ST2-2|IWS1_HUMAN Isoform 2 of Protein IWS1 homolog OS=Homo sapiens OX=9606 GN=IWS1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 24.0 null 328-UNIMOD:1031 0.04 24.0 1 1 1 PRT sp|Q8N4J0|CARME_HUMAN Carnosine N-methyltransferase OS=Homo sapiens OX=9606 GN=CARNMT1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 24.0 null 148-UNIMOD:35,155-UNIMOD:35,159-UNIMOD:1031 0.03 24.0 1 1 1 PRT sp|O95336|6PGL_HUMAN 6-phosphogluconolactonase OS=Homo sapiens OX=9606 GN=PGLS PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 24.0 null 180-UNIMOD:1031,254-UNIMOD:1031 0.11 24.0 2 2 2 PRT sp|Q15819|UB2V2_HUMAN Ubiquitin-conjugating enzyme E2 variant 2 OS=Homo sapiens OX=9606 GN=UBE2V2 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ] 24.0 null 66-UNIMOD:1031,69-UNIMOD:4,2-UNIMOD:1,8-UNIMOD:1031 0.16 24.0 2 2 2 PRT sp|O75323-2|NIPS2_HUMAN Isoform 2 of Protein NipSnap homolog 2 OS=Homo sapiens OX=9606 GN=NIPSNAP2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 24.0 null 58-UNIMOD:1031,68-UNIMOD:1031 0.08 24.0 3 2 1 PRT sp|Q9NZM3-4|ITSN2_HUMAN Isoform 4 of Intersectin-2 OS=Homo sapiens OX=9606 GN=ITSN2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 24.0 null 913-UNIMOD:1031 0.01 24.0 1 1 1 PRT sp|Q9UPN9-2|TRI33_HUMAN Isoform Beta of E3 ubiquitin-protein ligase TRIM33 OS=Homo sapiens OX=9606 GN=TRIM33 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 24.0 null 334-UNIMOD:1031 0.01 24.0 1 1 1 PRT sp|Q9NW64|RBM22_HUMAN Pre-mRNA-splicing factor RBM22 OS=Homo sapiens OX=9606 GN=RBM22 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 24.0 null 67-UNIMOD:1031,71-UNIMOD:4,74-UNIMOD:4 0.03 24.0 1 1 1 PRT sp|P49005|DPOD2_HUMAN DNA polymerase delta subunit 2 OS=Homo sapiens OX=9606 GN=POLD2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 24.0 null 267-UNIMOD:1031 0.03 24.0 1 1 1 PRT sp|O76080|ZFAN5_HUMAN AN1-type zinc finger protein 5 OS=Homo sapiens OX=9606 GN=ZFAND5 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 24.0 null 160-UNIMOD:1031,168-UNIMOD:4 0.05 24.0 1 1 1 PRT sp|O75083|WDR1_HUMAN WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=WDR1 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 24.0 null 170-UNIMOD:4,180-UNIMOD:1031,321-UNIMOD:1031,325-UNIMOD:4,569-UNIMOD:1031 0.07 24.0 4 3 2 PRT sp|P09543-2|CN37_HUMAN Isoform CNPI of 2',3'-cyclic-nucleotide 3'-phosphodiesterase OS=Homo sapiens OX=9606 GN=CNP null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 24.0 null 138-UNIMOD:4,142-UNIMOD:1031,380-UNIMOD:1031,382-UNIMOD:1031 0.07 24.0 3 3 3 PRT sp|P49792|RBP2_HUMAN E3 SUMO-protein ligase RanBP2 OS=Homo sapiens OX=9606 GN=RANBP2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 24.0 null 2125-UNIMOD:1031,2064-UNIMOD:1031 0.01 24.0 2 2 2 PRT sp|O94776-2|MTA2_HUMAN Isoform 2 of Metastasis-associated protein MTA2 OS=Homo sapiens OX=9606 GN=MTA2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 24.0 null 150-UNIMOD:1031,112-UNIMOD:1031,157-UNIMOD:1031,419-UNIMOD:1031 0.06 24.0 4 4 4 PRT sp|Q9NZB2-2|F120A_HUMAN Isoform B of Constitutive coactivator of PPAR-gamma-like protein 1 OS=Homo sapiens OX=9606 GN=FAM120A null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 24.0 null 426-UNIMOD:1031 0.04 24.0 1 1 1 PRT sp|Q7Z4V5-2|HDGR2_HUMAN Isoform 2 of Hepatoma-derived growth factor-related protein 2 OS=Homo sapiens OX=9606 GN=HDGFL2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 24.0 null 524-UNIMOD:1031,560-UNIMOD:1031 0.03 24.0 2 2 2 PRT sp|Q8TBC4-2|UBA3_HUMAN Isoform 2 of NEDD8-activating enzyme E1 catalytic subunit OS=Homo sapiens OX=9606 GN=UBA3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 24.0 null 110-UNIMOD:1031 0.03 24.0 1 1 1 PRT sp|P48507|GSH0_HUMAN Glutamate--cysteine ligase regulatory subunit OS=Homo sapiens OX=9606 GN=GCLM PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 24.0 null 263-UNIMOD:1031,34-UNIMOD:1031,35-UNIMOD:4,46-UNIMOD:4,9-UNIMOD:1031 0.13 24.0 4 3 2 PRT sp|Q9NT62-2|ATG3_HUMAN Isoform 2 of Ubiquitin-like-conjugating enzyme ATG3 OS=Homo sapiens OX=9606 GN=ATG3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 24.0 null 198-UNIMOD:267 0.05 24.0 1 1 1 PRT sp|Q14974-2|IMB1_HUMAN Isoform 2 of Importin subunit beta-1 OS=Homo sapiens OX=9606 GN=KPNB1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 24.0 null 722-UNIMOD:1031,690-UNIMOD:1031,38-UNIMOD:1031 0.04 24.0 3 3 2 PRT sp|P55084-2|ECHB_HUMAN Isoform 2 of Trifunctional enzyme subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=HADHB null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 24.0 null 250-UNIMOD:1031,179-UNIMOD:1031 0.07 24.0 3 3 2 PRT sp|Q5JTZ9|SYAM_HUMAN Alanine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=AARS2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 24.0 null 107-UNIMOD:1031,108-UNIMOD:4 0.01 24.0 1 1 1 PRT sp|P78406|RAE1L_HUMAN mRNA export factor OS=Homo sapiens OX=9606 GN=RAE1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 24.0 null 106-UNIMOD:4,108-UNIMOD:1031 0.03 24.0 1 1 1 PRT sp|Q13618-3|CUL3_HUMAN Isoform 3 of Cullin-3 OS=Homo sapiens OX=9606 GN=CUL3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 24.0 null 607-UNIMOD:1031,634-UNIMOD:1031 0.03 24.0 2 2 2 PRT sp|Q9BYC8|RM32_HUMAN 39S ribosomal protein L32, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL32 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 24.0 null 104-UNIMOD:1031,110-UNIMOD:4,113-UNIMOD:4 0.09 24.0 1 1 1 PRT sp|P49189-2|AL9A1_HUMAN Isoform 2 of 4-trimethylaminobutyraldehyde dehydrogenase OS=Homo sapiens OX=9606 GN=ALDH9A1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 24.0 null 274-UNIMOD:1031,179-UNIMOD:1031,277-UNIMOD:1031 0.07 24.0 3 3 3 PRT sp|O00244|ATOX1_HUMAN Copper transport protein ATOX1 OS=Homo sapiens OX=9606 GN=ATOX1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 24.0 null 25-UNIMOD:1031 0.15 24.0 1 1 1 PRT sp|P07951|TPM2_HUMAN Tropomyosin beta chain OS=Homo sapiens OX=9606 GN=TPM2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 24.0 null 15-UNIMOD:1031,70-UNIMOD:1031 0.08 24.0 2 2 2 PRT sp|Q9UKA9|PTBP2_HUMAN Polypyrimidine tract-binding protein 2 OS=Homo sapiens OX=9606 GN=PTBP2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 24.0 null 92-UNIMOD:1031,528-UNIMOD:1031,268-UNIMOD:1031 0.05 24.0 3 3 3 PRT sp|P53396|ACLY_HUMAN ATP-citrate synthase OS=Homo sapiens OX=9606 GN=ACLY PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 24.0 null 2-UNIMOD:1,4-UNIMOD:1031,259-UNIMOD:1031,780-UNIMOD:1031,607-UNIMOD:267,968-UNIMOD:1031,468-UNIMOD:1031 0.08 24.0 7 6 5 PRT sp|P54886|P5CS_HUMAN Delta-1-pyrroline-5-carboxylate synthase OS=Homo sapiens OX=9606 GN=ALDH18A1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 24.0 null 605-UNIMOD:1031,606-UNIMOD:4,612-UNIMOD:4,507-UNIMOD:1031,308-UNIMOD:35,311-UNIMOD:1031,643-UNIMOD:1031 0.07 24.0 4 4 2 PRT sp|Q6PKG0|LARP1_HUMAN La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 24.0 null 539-UNIMOD:1031,367-UNIMOD:1031,892-UNIMOD:1031,465-UNIMOD:1031,211-UNIMOD:1031,193-UNIMOD:1031,152-UNIMOD:1031 0.11 24.0 9 8 7 PRT sp|Q00325|MPCP_HUMAN Phosphate carrier protein, mitochondrial OS=Homo sapiens OX=9606 GN=SLC25A3 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 24.0 null 295-UNIMOD:1031,209-UNIMOD:1031 0.06 24.0 3 2 1 PRT sp|Q9Y6E2|BZW2_HUMAN Basic leucine zipper and W2 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=BZW2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 24.0 null 117-UNIMOD:1031 0.03 24.0 1 1 1 PRT sp|Q13813|SPTN1_HUMAN Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 24.0 null 824-UNIMOD:1031,613-UNIMOD:1031,758-UNIMOD:1031 0.02 24.0 3 3 3 PRT sp|Q969Z0|FAKD4_HUMAN FAST kinase domain-containing protein 4 OS=Homo sapiens OX=9606 GN=TBRG4 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 24.0 null 70-UNIMOD:1031 0.03 24.0 1 1 1 PRT sp|Q03252|LMNB2_HUMAN Lamin-B2 OS=Homo sapiens OX=9606 GN=LMNB2 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 24.0 null 285-UNIMOD:1031,150-UNIMOD:1031 0.04 24.0 2 2 2 PRT sp|Q9NQW6|ANLN_HUMAN Anillin OS=Homo sapiens OX=9606 GN=ANLN PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 24.0 null 428-UNIMOD:1031,254-UNIMOD:1031,260-UNIMOD:4 0.03 24.0 2 2 2 PRT sp|Q99460|PSMD1_HUMAN 26S proteasome non-ATPase regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PSMD1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 24.0 null 720-UNIMOD:1031,725-UNIMOD:35 0.01 24.0 1 1 0 PRT sp|Q969T9|WBP2_HUMAN WW domain-binding protein 2 OS=Homo sapiens OX=9606 GN=WBP2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 24.0 null 93-UNIMOD:1031 0.06 24.0 1 1 1 PRT sp|A8MWD9|RUXGL_HUMAN Putative small nuclear ribonucleoprotein G-like protein 15 OS=Homo sapiens OX=9606 GN=SNRPGP15 PE=5 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 24.0 null 2-UNIMOD:1,3-UNIMOD:1031 0.13 24.0 2 1 0 PRT sp|Q9Y6M9|NDUB9_HUMAN NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 OS=Homo sapiens OX=9606 GN=NDUFB9 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 24.0 null 2-UNIMOD:1,15-UNIMOD:1031 0.10 24.0 1 1 1 PRT sp|Q96A26|F162A_HUMAN Protein FAM162A OS=Homo sapiens OX=9606 GN=FAM162A PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 24.0 null 96-UNIMOD:1031 0.13 24.0 1 1 1 PRT sp|P30419|NMT1_HUMAN Glycylpeptide N-tetradecanoyltransferase 1 OS=Homo sapiens OX=9606 GN=NMT1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 24.0 null 55-UNIMOD:1031 0.03 24.0 1 1 1 PRT sp|O60563|CCNT1_HUMAN Cyclin-T1 OS=Homo sapiens OX=9606 GN=CCNT1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 24.0 null 485-UNIMOD:1031 0.01 24.0 1 1 1 PRT sp|Q8IVM0|CCD50_HUMAN Coiled-coil domain-containing protein 50 OS=Homo sapiens OX=9606 GN=CCDC50 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 24.0 null 119-UNIMOD:1031 0.04 24.0 1 1 1 PRT sp|Q14CN4|K2C72_HUMAN Keratin, type II cytoskeletal 72 OS=Homo sapiens OX=9606 GN=KRT72 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 24.0 null 233-UNIMOD:259 0.02 24.0 1 1 1 PRT sp|Q13616|CUL1_HUMAN Cullin-1 OS=Homo sapiens OX=9606 GN=CUL1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 24.0 null 493-UNIMOD:1031,496-UNIMOD:4 0.02 24.0 1 1 1 PRT sp|O94903|PLPHP_HUMAN Pyridoxal phosphate homeostasis protein OS=Homo sapiens OX=9606 GN=PLPBP PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 24.0 null 76-UNIMOD:259 0.05 24.0 2 1 0 PRT sp|Q05086-2|UBE3A_HUMAN Isoform I of Ubiquitin-protein ligase E3A OS=Homo sapiens OX=9606 GN=UBE3A null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 23.0 null 7-UNIMOD:1031 0.01 23.0 1 1 1 PRT sp|P61970|NTF2_HUMAN Nuclear transport factor 2 OS=Homo sapiens OX=9606 GN=NUTF2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 23.0 null 55-UNIMOD:1031 0.12 23.0 1 1 1 PRT sp|P52758|RIDA_HUMAN 2-iminobutanoate/2-iminopropanoate deaminase OS=Homo sapiens OX=9606 GN=RIDA PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 23.0 null 117-UNIMOD:1031 0.10 23.0 2 1 0 PRT sp|Q9NXW2|DJB12_HUMAN DnaJ homolog subfamily B member 12 OS=Homo sapiens OX=9606 GN=DNAJB12 PE=1 SV=5 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 23.0 null 357-UNIMOD:1031,358-UNIMOD:35,363-UNIMOD:4 0.03 23.0 1 1 1 PRT sp|Q9BPX3|CND3_HUMAN Condensin complex subunit 3 OS=Homo sapiens OX=9606 GN=NCAPG PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 23.0 null 522-UNIMOD:1031,995-UNIMOD:1031 0.02 23.0 2 2 2 PRT sp|Q9UJU6-5|DBNL_HUMAN Isoform 5 of Drebrin-like protein OS=Homo sapiens OX=9606 GN=DBNL null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 23.0 null 41-UNIMOD:1031 0.08 23.0 2 2 2 PRT sp|O75874|IDHC_HUMAN Isocitrate dehydrogenase [NADP] cytoplasmic OS=Homo sapiens OX=9606 GN=IDH1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 23.0 null 73-UNIMOD:4,81-UNIMOD:1031,314-UNIMOD:267,66-UNIMOD:1031 0.08 23.0 3 3 3 PRT sp|Q9UKD2|MRT4_HUMAN mRNA turnover protein 4 homolog OS=Homo sapiens OX=9606 GN=MRTO4 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 23.0 null 94-UNIMOD:1031 0.04 23.0 1 1 1 PRT sp|Q86UX6-2|ST32C_HUMAN Isoform 2 of Serine/threonine-protein kinase 32C OS=Homo sapiens OX=9606 GN=STK32C null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 23.0 null 101-UNIMOD:1031 0.04 23.0 1 1 1 PRT sp|Q00765|REEP5_HUMAN Receptor expression-enhancing protein 5 OS=Homo sapiens OX=9606 GN=REEP5 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 23.0 null 172-UNIMOD:1031,164-UNIMOD:1031 0.07 23.0 2 2 2 PRT sp|Q96BR1-2|SGK3_HUMAN Isoform 2 of Serine/threonine-protein kinase Sgk3 OS=Homo sapiens OX=9606 GN=SGK3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 23.0 null 191-UNIMOD:1031 0.02 23.0 1 1 1 PRT sp|P41252|SYIC_HUMAN Isoleucine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=IARS1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 23.0 null 910-UNIMOD:1031,382-UNIMOD:1031 0.02 23.0 2 2 2 PRT sp|Q92841-3|DDX17_HUMAN Isoform 4 of Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens OX=9606 GN=DDX17 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 23.0 null 484-UNIMOD:1031,368-UNIMOD:4,373-UNIMOD:1031,515-UNIMOD:1031 0.08 23.0 4 4 4 PRT sp|P55039|DRG2_HUMAN Developmentally-regulated GTP-binding protein 2 OS=Homo sapiens OX=9606 GN=DRG2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 23.0 null 6-UNIMOD:1031 0.03 23.0 1 1 1 PRT sp|P22087|FBRL_HUMAN rRNA 2'-O-methyltransferase fibrillarin OS=Homo sapiens OX=9606 GN=FBL PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 23.0 null 102-UNIMOD:1031 0.03 23.0 1 1 1 PRT sp|Q15637-4|SF01_HUMAN Isoform 4 of Splicing factor 1 OS=Homo sapiens OX=9606 GN=SF1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 23.0 null 165-UNIMOD:1031,169-UNIMOD:1031,171-UNIMOD:4,279-UNIMOD:4,184-UNIMOD:1031 0.06 23.0 4 4 4 PRT sp|Q96CW1-2|AP2M1_HUMAN Isoform 2 of AP-2 complex subunit mu OS=Homo sapiens OX=9606 GN=AP2M1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 23.0 null 233-UNIMOD:1031,279-UNIMOD:1031,403-UNIMOD:1031,225-UNIMOD:1031,236-UNIMOD:1031,244-UNIMOD:4,249-UNIMOD:4 0.12 23.0 5 5 5 PRT sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens OX=9606 GN=APOB PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 23.0 null 1121-UNIMOD:1031 0.00 23.0 1 1 1 PRT sp|Q6P996-3|PDXD1_HUMAN Isoform 3 of Pyridoxal-dependent decarboxylase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PDXDC1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 23.0 null 267-UNIMOD:1031,270-UNIMOD:4 0.02 23.0 2 1 0 PRT sp|P17858|PFKAL_HUMAN ATP-dependent 6-phosphofructokinase, liver type OS=Homo sapiens OX=9606 GN=PFKL PE=1 SV=6 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 23.0 null 556-UNIMOD:1031,392-UNIMOD:1031,392-UNIMOD:259,395-UNIMOD:259,395-UNIMOD:1031,2-UNIMOD:1,8-UNIMOD:1031,89-UNIMOD:4,90-UNIMOD:1031 0.05 23.0 10 4 3 PRT sp|P61077|UB2D3_HUMAN Ubiquitin-conjugating enzyme E2 D3 OS=Homo sapiens OX=9606 GN=UBE2D3 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 23.0 null 8-UNIMOD:1031 0.07 23.0 1 1 1 PRT sp|Q9NQC3-3|RTN4_HUMAN Isoform C of Reticulon-4 OS=Homo sapiens OX=9606 GN=RTN4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 23.0 null 190-UNIMOD:1031,73-UNIMOD:1031,186-UNIMOD:1031,181-UNIMOD:1031,184-UNIMOD:35 0.18 23.0 4 4 4 PRT sp|P07384|CAN1_HUMAN Calpain-1 catalytic subunit OS=Homo sapiens OX=9606 GN=CAPN1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 23.0 null 229-UNIMOD:1031,79-UNIMOD:1031 0.04 23.0 2 2 2 PRT sp|Q9GZZ1|NAA50_HUMAN N-alpha-acetyltransferase 50 OS=Homo sapiens OX=9606 GN=NAA50 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 23.0 null 126-UNIMOD:1031,70-UNIMOD:1031,34-UNIMOD:1031 0.22 23.0 3 3 3 PRT sp|O00762-3|UBE2C_HUMAN Isoform 3 of Ubiquitin-conjugating enzyme E2 C OS=Homo sapiens OX=9606 GN=UBE2C null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 23.0 null 18-UNIMOD:1031 0.08 23.0 1 1 1 PRT sp|P46778|RL21_HUMAN 60S ribosomal protein L21 OS=Homo sapiens OX=9606 GN=RPL21 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 23.0 null 21-UNIMOD:1031,36-UNIMOD:1031,56-UNIMOD:4,60-UNIMOD:1031,122-UNIMOD:1031,110-UNIMOD:1031,97-UNIMOD:1031 0.36 23.0 8 6 5 PRT sp|P50402|EMD_HUMAN Emerin OS=Homo sapiens OX=9606 GN=EMD PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 23.0 null 37-UNIMOD:1031,115-UNIMOD:267 0.09 23.0 2 2 2 PRT sp|Q9UPY5|XCT_HUMAN Cystine/glutamate transporter OS=Homo sapiens OX=9606 GN=SLC7A11 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 23.0 null 4-UNIMOD:1031 0.02 23.0 1 1 1 PRT sp|Q8WY22|BRI3B_HUMAN BRI3-binding protein OS=Homo sapiens OX=9606 GN=BRI3BP PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 23.0 null 229-UNIMOD:1031 0.04 23.0 1 1 1 PRT sp|P38606|VATA_HUMAN V-type proton ATPase catalytic subunit A OS=Homo sapiens OX=9606 GN=ATP6V1A PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 23.0 null 8-UNIMOD:1031,393-UNIMOD:1031,394-UNIMOD:4 0.03 23.0 2 2 2 PRT sp|P50416-2|CPT1A_HUMAN Isoform 2 of Carnitine O-palmitoyltransferase 1, liver isoform OS=Homo sapiens OX=9606 GN=CPT1A null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 23.0 null 180-UNIMOD:1031 0.02 23.0 1 1 1 PRT sp|Q969H8|MYDGF_HUMAN Myeloid-derived growth factor OS=Homo sapiens OX=9606 GN=MYDGF PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 23.0 null 167-UNIMOD:1031 0.06 23.0 1 1 1 PRT sp|Q9NVS9-4|PNPO_HUMAN Isoform 4 of Pyridoxine-5'-phosphate oxidase OS=Homo sapiens OX=9606 GN=PNPO null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 23.0 null 100-UNIMOD:1031 0.05 23.0 1 1 1 PRT sp|Q05513|KPCZ_HUMAN Protein kinase C zeta type OS=Homo sapiens OX=9606 GN=PRKCZ PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 23.0 null 281-UNIMOD:1031 0.02 23.0 1 1 1 PRT sp|Q9H9Y6-4|RPA2_HUMAN Isoform 4 of DNA-directed RNA polymerase I subunit RPA2 OS=Homo sapiens OX=9606 GN=POLR1B null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 23.0 null 671-UNIMOD:1031 0.01 23.0 1 1 1 PRT sp|Q9Y2Q3-2|GSTK1_HUMAN Isoform 2 of Glutathione S-transferase kappa 1 OS=Homo sapiens OX=9606 GN=GSTK1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 23.0 null 225-UNIMOD:1031,232-UNIMOD:4 0.05 23.0 1 1 1 PRT sp|P51965-3|UB2E1_HUMAN Isoform 3 of Ubiquitin-conjugating enzyme E2 E1 OS=Homo sapiens OX=9606 GN=UBE2E1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 23.0 null 43-UNIMOD:1031 0.06 23.0 1 1 1 PRT sp|P30566-2|PUR8_HUMAN Isoform 2 of Adenylosuccinate lyase OS=Homo sapiens OX=9606 GN=ADSL null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 23.0 null 295-UNIMOD:1031 0.03 23.0 1 1 1 PRT sp|O14579-3|COPE_HUMAN Isoform 3 of Coatomer subunit epsilon OS=Homo sapiens OX=9606 GN=COPE null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 23.0 null 236-UNIMOD:1031 0.05 23.0 1 1 1 PRT sp|O60610-2|DIAP1_HUMAN Isoform 2 of Protein diaphanous homolog 1 OS=Homo sapiens OX=9606 GN=DIAPH1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 23.0 null 35-UNIMOD:1031 0.01 23.0 1 1 1 PRT sp|Q8IX12-2|CCAR1_HUMAN Isoform 2 of Cell division cycle and apoptosis regulator protein 1 OS=Homo sapiens OX=9606 GN=CCAR1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 23.0 null 131-UNIMOD:1031 0.01 23.0 1 1 1 PRT sp|Q9NR31-2|SAR1A_HUMAN Isoform 2 of GTP-binding protein SAR1a OS=Homo sapiens OX=9606 GN=SAR1A null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 23.0 null 103-UNIMOD:1031 0.07 23.0 1 1 1 PRT sp|Q8TD08|MK15_HUMAN Mitogen-activated protein kinase 15 OS=Homo sapiens OX=9606 GN=MAPK15 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 23.0 null 42-UNIMOD:1031 0.02 23.0 1 1 1 PRT sp|O95831-5|AIFM1_HUMAN Isoform 5 of Apoptosis-inducing factor 1, mitochondrial OS=Homo sapiens OX=9606 GN=AIFM1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 23.0 null 0.06 23.0 1 1 1 PRT sp|O60888-3|CUTA_HUMAN Isoform C of Protein CutA OS=Homo sapiens OX=9606 GN=CUTA null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 23.0 null 59-UNIMOD:1031 0.15 23.0 2 2 1 PRT sp|Q92989-2|CLP1_HUMAN Isoform 2 of Polyribonucleotide 5'-hydroxyl-kinase Clp1 OS=Homo sapiens OX=9606 GN=CLP1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 23.0 null 217-UNIMOD:1031 0.04 23.0 1 1 0 PRT sp|P30154-3|2AAB_HUMAN Isoform 3 of Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform OS=Homo sapiens OX=9606 GN=PPP2R1B null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 23.0 null 255-UNIMOD:1031 0.02 23.0 1 1 1 PRT sp|Q96KA5-2|CLP1L_HUMAN Isoform 2 of Cleft lip and palate transmembrane protein 1-like protein OS=Homo sapiens OX=9606 GN=CLPTM1L null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 23.0 null 494-UNIMOD:1031 0.03 23.0 1 1 1 PRT sp|Q05048|CSTF1_HUMAN Cleavage stimulation factor subunit 1 OS=Homo sapiens OX=9606 GN=CSTF1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 23.0 null 326-UNIMOD:1031 0.03 23.0 1 1 1 PRT sp|Q00341-2|VIGLN_HUMAN Isoform 2 of Vigilin OS=Homo sapiens OX=9606 GN=HDLBP null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 23.0 null 958-UNIMOD:1031,1038-UNIMOD:1031,350-UNIMOD:1031 0.02 23.0 3 3 3 PRT sp|Q13428|TCOF_HUMAN Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 null 1335-UNIMOD:1031,74-UNIMOD:1031,449-UNIMOD:1031,725-UNIMOD:1031,470-UNIMOD:259,842-UNIMOD:267,400-UNIMOD:1031,732-UNIMOD:1031,909-UNIMOD:1031 0.07 23.0 9 9 6 PRT sp|P21333|FLNA_HUMAN Filamin-A OS=Homo sapiens OX=9606 GN=FLNA PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 null 1593-UNIMOD:1031,355-UNIMOD:259,338-UNIMOD:1031 0.02 23.0 3 3 1 PRT sp|Q02539|H11_HUMAN Histone H1.1 OS=Homo sapiens OX=9606 GN=H1-1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 null 88-UNIMOD:1031 0.05 23.0 1 1 1 PRT sp|O43390|HNRPR_HUMAN Heterogeneous nuclear ribonucleoprotein R OS=Homo sapiens OX=9606 GN=HNRNPR PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 23.0 null 292-UNIMOD:4,300-UNIMOD:1031,255-UNIMOD:1031,374-UNIMOD:1031 0.07 23.0 3 3 2 PRT sp|Q2VIR3|IF2GL_HUMAN Eukaryotic translation initiation factor 2 subunit 3B OS=Homo sapiens OX=9606 GN=EIF2S3B PE=2 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 null 285-UNIMOD:1031 0.03 23.0 1 1 1 PRT sp|Q6S8J3|POTEE_HUMAN POTE ankyrin domain family member E OS=Homo sapiens OX=9606 GN=POTEE PE=2 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 null 717-UNIMOD:4,718-UNIMOD:1031,768-UNIMOD:259 0.06 23.0 2 2 2 PRT sp|P19525|E2AK2_HUMAN Interferon-induced, double-stranded RNA-activated protein kinase OS=Homo sapiens OX=9606 GN=EIF2AK2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 null 440-UNIMOD:1031,416-UNIMOD:259,426-UNIMOD:259,416-UNIMOD:1031 0.05 23.0 4 2 0 PRT sp|P62841|RS15_HUMAN 40S ribosomal protein S15 OS=Homo sapiens OX=9606 GN=RPS15 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ] 23.0 null 72-UNIMOD:1031,52-UNIMOD:1031,58-UNIMOD:1031,53-UNIMOD:28,2-UNIMOD:1,7-UNIMOD:1031 0.21 23.0 7 4 2 PRT sp|P52948|NUP98_HUMAN Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens OX=9606 GN=NUP98 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 null 551-UNIMOD:1031 0.01 23.0 1 1 0 PRT sp|P62633|CNBP_HUMAN Cellular nucleic acid-binding protein OS=Homo sapiens OX=9606 GN=CNBP PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 23.0 null 2-UNIMOD:1,6-UNIMOD:4,8-UNIMOD:1031,9-UNIMOD:4 0.06 23.0 1 1 1 PRT sp|Q13501|SQSTM_HUMAN Sequestosome-1 OS=Homo sapiens OX=9606 GN=SQSTM1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 null 13-UNIMOD:1031 0.03 23.0 1 1 1 PRT sp|Q9Y262|EIF3L_HUMAN Eukaryotic translation initiation factor 3 subunit L OS=Homo sapiens OX=9606 GN=EIF3L PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 23.0 null 549-UNIMOD:1031,546-UNIMOD:28,527-UNIMOD:35,534-UNIMOD:1031 0.04 23.0 4 2 1 PRT sp|O95071|UBR5_HUMAN E3 ubiquitin-protein ligase UBR5 OS=Homo sapiens OX=9606 GN=UBR5 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 null 2656-UNIMOD:1031 0.00 23.0 1 1 0 PRT sp|P02768|ALBU_HUMAN Serum albumin OS=Homo sapiens OX=9606 GN=ALB PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 null 224-UNIMOD:4,229-UNIMOD:1031 0.02 23.0 1 1 1 PRT sp|Q9H0A0|NAT10_HUMAN RNA cytidine acetyltransferase OS=Homo sapiens OX=9606 GN=NAT10 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 null 61-UNIMOD:1031 0.02 23.0 2 2 2 PRT sp|O43660|PLRG1_HUMAN Pleiotropic regulator 1 OS=Homo sapiens OX=9606 GN=PLRG1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 null 320-UNIMOD:1031 0.04 23.0 1 1 1 PRT sp|Q9NY93|DDX56_HUMAN Probable ATP-dependent RNA helicase DDX56 OS=Homo sapiens OX=9606 GN=DDX56 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 null 337-UNIMOD:1031 0.03 23.0 1 1 1 PRT sp|P0DMM9|ST1A3_HUMAN Sulfotransferase 1A3 OS=Homo sapiens OX=9606 GN=SULT1A3 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 null 106-UNIMOD:1031 0.07 23.0 1 1 1 PRT sp|Q15003|CND2_HUMAN Condensin complex subunit 2 OS=Homo sapiens OX=9606 GN=NCAPH PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 null 674-UNIMOD:1031 0.02 23.0 1 1 1 PRT sp|Q9Y6D6|BIG1_HUMAN Brefeldin A-inhibited guanine nucleotide-exchange protein 1 OS=Homo sapiens OX=9606 GN=ARFGEF1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 null 898-UNIMOD:1031 0.01 23.0 1 1 1 PRT sp|P52298|NCBP2_HUMAN Nuclear cap-binding protein subunit 2 OS=Homo sapiens OX=9606 GN=NCBP2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 23.0 null 2-UNIMOD:1,7-UNIMOD:1031 0.06 23.0 1 1 1 PRT sp|Q07866|KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens OX=9606 GN=KLC1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 null 382-UNIMOD:1031 0.02 23.0 1 1 1 PRT sp|Q15041|AR6P1_HUMAN ADP-ribosylation factor-like protein 6-interacting protein 1 OS=Homo sapiens OX=9606 GN=ARL6IP1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 null 109-UNIMOD:4,114-UNIMOD:1031 0.06 23.0 1 1 0 PRT sp|Q92989|CLP1_HUMAN Polyribonucleotide 5'-hydroxyl-kinase Clp1 OS=Homo sapiens OX=9606 GN=CLP1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 null 281-UNIMOD:1031 0.03 23.0 1 1 0 PRT sp|O15446|RPA34_HUMAN DNA-directed RNA polymerase I subunit RPA34 OS=Homo sapiens OX=9606 GN=CD3EAP PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 null 70-UNIMOD:1031 0.03 23.0 1 1 1 PRT sp|Q9NUQ6|SPS2L_HUMAN SPATS2-like protein OS=Homo sapiens OX=9606 GN=SPATS2L PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 null 507-UNIMOD:1031 0.02 23.0 1 1 1 PRT sp|P67775|PP2AA_HUMAN Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Homo sapiens OX=9606 GN=PPP2CA PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 null 41-UNIMOD:1031 0.05 23.0 1 1 1 PRT sp|Q53FA7|QORX_HUMAN Quinone oxidoreductase PIG3 OS=Homo sapiens OX=9606 GN=TP53I3 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 23.0 null 193-UNIMOD:1031 0.04 23.0 1 1 1 PRT sp|Q9Y2W1|TR150_HUMAN Thyroid hormone receptor-associated protein 3 OS=Homo sapiens OX=9606 GN=THRAP3 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 null 697-UNIMOD:1031 0.01 23.0 1 1 1 PRT sp|P23763|VAMP1_HUMAN Vesicle-associated membrane protein 1 OS=Homo sapiens OX=9606 GN=VAMP1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 null 54-UNIMOD:1031 0.08 23.0 1 1 1 PRT sp|Q6XQN6|PNCB_HUMAN Nicotinate phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=NAPRT PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 null 407-UNIMOD:1031 0.02 23.0 1 1 1 PRT sp|O00233|PSMD9_HUMAN 26S proteasome non-ATPase regulatory subunit 9 OS=Homo sapiens OX=9606 GN=PSMD9 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 null 81-UNIMOD:4,87-UNIMOD:1031,90-UNIMOD:35 0.07 23.0 3 1 0 PRT sp|Q8TEX9|IPO4_HUMAN Importin-4 OS=Homo sapiens OX=9606 GN=IPO4 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 null 715-UNIMOD:1031,725-UNIMOD:4,726-UNIMOD:4 0.02 23.0 1 1 1 PRT sp|Q9UHI6|DDX20_HUMAN Probable ATP-dependent RNA helicase DDX20 OS=Homo sapiens OX=9606 GN=DDX20 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 null 507-UNIMOD:1031,473-UNIMOD:1031 0.04 23.0 2 2 2 PRT sp|Q02252|MMSA_HUMAN Methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial OS=Homo sapiens OX=9606 GN=ALDH6A1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 null 264-UNIMOD:1031 0.03 23.0 1 1 1 PRT sp|Q9ULX6|AKP8L_HUMAN A-kinase anchor protein 8-like OS=Homo sapiens OX=9606 GN=AKAP8L PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 null 426-UNIMOD:1031 0.03 23.0 1 1 1 PRT sp|Q99567|NUP88_HUMAN Nuclear pore complex protein Nup88 OS=Homo sapiens OX=9606 GN=NUP88 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 null 584-UNIMOD:1031 0.01 23.0 1 1 1 PRT sp|P61923-3|COPZ1_HUMAN Isoform 3 of Coatomer subunit zeta-1 OS=Homo sapiens OX=9606 GN=COPZ1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 22.0 null 23-UNIMOD:1031 0.06 22.0 1 1 0 PRT sp|P52948-6|NUP98_HUMAN Isoform 6 of Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens OX=9606 GN=NUP98 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 22.0 null 551-UNIMOD:1031,1543-UNIMOD:4,1545-UNIMOD:1031 0.01 22.0 2 2 1 PRT sp|Q15054-3|DPOD3_HUMAN Isoform 3 of DNA polymerase delta subunit 3 OS=Homo sapiens OX=9606 GN=POLD3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 22.0 null 48-UNIMOD:1031 0.03 22.0 1 1 1 PRT sp|Q92620|PRP16_HUMAN Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Homo sapiens OX=9606 GN=DHX38 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 22.0 null 1049-UNIMOD:1031 0.01 22.0 1 1 1 PRT sp|Q96P70|IPO9_HUMAN Importin-9 OS=Homo sapiens OX=9606 GN=IPO9 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 22.0 null 277-UNIMOD:1031 0.01 22.0 1 1 1 PRT sp|Q9H4A4|AMPB_HUMAN Aminopeptidase B OS=Homo sapiens OX=9606 GN=RNPEP PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 22.0 null 446-UNIMOD:1031 0.02 22.0 1 1 1 PRT sp|Q96DG6|CMBL_HUMAN Carboxymethylenebutenolidase homolog OS=Homo sapiens OX=9606 GN=CMBL PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 22.0 null 193-UNIMOD:1031,36-UNIMOD:1031 0.10 22.0 3 2 1 PRT sp|P30519-2|HMOX2_HUMAN Isoform 2 of Heme oxygenase 2 OS=Homo sapiens OX=9606 GN=HMOX2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 22.0 null 13-UNIMOD:1031 0.03 22.0 1 1 1 PRT sp|O95232|LC7L3_HUMAN Luc7-like protein 3 OS=Homo sapiens OX=9606 GN=LUC7L3 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 22.0 null 398-UNIMOD:1031 0.03 22.0 1 1 1 PRT sp|O75330-4|HMMR_HUMAN Isoform 4 of Hyaluronan mediated motility receptor OS=Homo sapiens OX=9606 GN=HMMR null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 22.0 null 441-UNIMOD:1031,559-UNIMOD:1031 0.04 22.0 2 2 2 PRT sp|O15530-2|PDPK1_HUMAN Isoform 2 of 3-phosphoinositide-dependent protein kinase 1 OS=Homo sapiens OX=9606 GN=PDPK1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 22.0 null 61-UNIMOD:1031,157-UNIMOD:1031,167-UNIMOD:35,73-UNIMOD:1031,415-UNIMOD:1031,410-UNIMOD:35 0.10 22.0 5 4 3 PRT sp|Q9H3K6-2|BOLA2_HUMAN Isoform 2 of BolA-like protein 2 OS=Homo sapiens OX=9606 GN=BOLA2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 22.0 null 47-UNIMOD:1031 0.17 22.0 1 1 1 PRT sp|P62861|RS30_HUMAN 40S ribosomal protein S30 OS=Homo sapiens OX=9606 GN=FAU PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 22.0 null 51-UNIMOD:1031,1-UNIMOD:1031,52-UNIMOD:1031 0.36 22.0 3 2 1 PRT sp|Q8NE01|CNNM3_HUMAN Metal transporter CNNM3 OS=Homo sapiens OX=9606 GN=CNNM3 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 22.0 null 410-UNIMOD:1031 0.02 22.0 1 1 1 PRT sp|Q96JP5-2|ZFP91_HUMAN Isoform 2 of E3 ubiquitin-protein ligase ZFP91 OS=Homo sapiens OX=9606 GN=ZFP91 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 22.0 null 364-UNIMOD:1031 0.02 22.0 2 1 0 PRT sp|P42685-2|FRK_HUMAN Isoform 2 of Tyrosine-protein kinase FRK OS=Homo sapiens OX=9606 GN=FRK null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 22.0 null 252-UNIMOD:1031 0.02 22.0 1 1 1 PRT sp|Q96ST3|SIN3A_HUMAN Paired amphipathic helix protein Sin3a OS=Homo sapiens OX=9606 GN=SIN3A PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 22.0 null 469-UNIMOD:1031 0.01 22.0 1 1 1 PRT sp|P62491-2|RB11A_HUMAN Isoform 2 of Ras-related protein Rab-11A OS=Homo sapiens OX=9606 GN=RAB11A null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 22.0 null 0.06 22.0 1 1 1 PRT sp|Q9Y6X1|SERP1_HUMAN Stress-associated endoplasmic reticulum protein 1 OS=Homo sapiens OX=9606 GN=SERP1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 22.0 null 16-UNIMOD:1031,26-UNIMOD:1031 0.26 22.0 2 2 2 PRT sp|O95382-3|M3K6_HUMAN Isoform 3 of Mitogen-activated protein kinase kinase kinase 6 OS=Homo sapiens OX=9606 GN=MAP3K6 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 22.0 null 669-UNIMOD:1031,787-UNIMOD:1031 0.02 22.0 2 2 1 PRT sp|P67812-2|SC11A_HUMAN Isoform 2 of Signal peptidase complex catalytic subunit SEC11A OS=Homo sapiens OX=9606 GN=SEC11A null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 22.0 null 78-UNIMOD:1031 0.07 22.0 1 1 1 PRT sp|Q14008-2|CKAP5_HUMAN Isoform 2 of Cytoskeleton-associated protein 5 OS=Homo sapiens OX=9606 GN=CKAP5 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 22.0 null 163-UNIMOD:1031 0.01 22.0 1 1 1 PRT sp|P61086-3|UBE2K_HUMAN Isoform 3 of Ubiquitin-conjugating enzyme E2 K OS=Homo sapiens OX=9606 GN=UBE2K null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 22.0 null 72-UNIMOD:1031 0.09 22.0 1 1 1 PRT sp|Q9UPT8|ZC3H4_HUMAN Zinc finger CCCH domain-containing protein 4 OS=Homo sapiens OX=9606 GN=ZC3H4 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 22.0 null 776-UNIMOD:1031,851-UNIMOD:1031 0.02 22.0 2 2 2 PRT sp|Q9Y5V0|ZN706_HUMAN Zinc finger protein 706 OS=Homo sapiens OX=9606 GN=ZNF706 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ] 22.0 null 13-UNIMOD:1031,25-UNIMOD:28,30-UNIMOD:1031 0.28 22.0 3 2 1 PRT sp|P62140|PP1B_HUMAN Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Homo sapiens OX=9606 GN=PPP1CB PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 22.0 null 139-UNIMOD:4,140-UNIMOD:1031,126-UNIMOD:4 0.06 22.0 2 2 1 PRT sp|P55011-3|S12A2_HUMAN Isoform 2 of Solute carrier family 12 member 2 OS=Homo sapiens OX=9606 GN=SLC12A2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 22.0 null 890-UNIMOD:1031 0.01 22.0 1 1 0 PRT sp|P61081|UBC12_HUMAN NEDD8-conjugating enzyme Ubc12 OS=Homo sapiens OX=9606 GN=UBE2M PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 22.0 null 12-UNIMOD:1031 0.06 22.0 1 1 1 PRT sp|Q96EK6|GNA1_HUMAN Glucosamine 6-phosphate N-acetyltransferase OS=Homo sapiens OX=9606 GN=GNPNAT1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 22.0 null 167-UNIMOD:1031,179-UNIMOD:4 0.08 22.0 1 1 1 PRT sp|Q12849-5|GRSF1_HUMAN Isoform 2 of G-rich sequence factor 1 OS=Homo sapiens OX=9606 GN=GRSF1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 22.0 null 178-UNIMOD:1031 0.03 22.0 1 1 1 PRT sp|Q9NZC9|SMAL1_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Homo sapiens OX=9606 GN=SMARCAL1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 22.0 null 660-UNIMOD:1031 0.01 22.0 1 1 1 PRT sp|Q15003-2|CND2_HUMAN Isoform 2 of Condensin complex subunit 2 OS=Homo sapiens OX=9606 GN=NCAPH null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 22.0 null 316-UNIMOD:1031,352-UNIMOD:1031 0.04 22.0 2 2 2 PRT sp|P98175-4|RBM10_HUMAN Isoform 4 of RNA-binding protein 10 OS=Homo sapiens OX=9606 GN=RBM10 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 22.0 null 803-UNIMOD:1031,693-UNIMOD:1031 0.03 22.0 2 2 1 PRT sp|Q8NCW5-2|NNRE_HUMAN Isoform 2 of NAD(P)H-hydrate epimerase OS=Homo sapiens OX=9606 GN=NAXE null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 22.0 null 143-UNIMOD:1031 0.05 22.0 1 1 1 PRT sp|P19623|SPEE_HUMAN Spermidine synthase OS=Homo sapiens OX=9606 GN=SRM PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 22.0 null 96-UNIMOD:1031 0.05 22.0 1 1 1 PRT sp|P21912|SDHB_HUMAN Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Homo sapiens OX=9606 GN=SDHB PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 22.0 null 233-UNIMOD:1031,123-UNIMOD:1031,261-UNIMOD:1031,268-UNIMOD:1031 0.14 22.0 4 4 4 PRT sp|Q14257|RCN2_HUMAN Reticulocalbin-2 OS=Homo sapiens OX=9606 GN=RCN2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 22.0 null 64-UNIMOD:1031 0.03 22.0 2 1 0 PRT sp|Q16181-2|SEPT7_HUMAN Isoform 2 of Septin-7 OS=Homo sapiens OX=9606 GN=SEPTIN7 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 22.0 null 185-UNIMOD:1031 0.03 22.0 1 1 1 PRT sp|Q9H1E3|NUCKS_HUMAN Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 OS=Homo sapiens OX=9606 GN=NUCKS1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 22.0 null 175-UNIMOD:1031,35-UNIMOD:1031 0.09 22.0 2 2 2 PRT sp|Q99614|TTC1_HUMAN Tetratricopeptide repeat protein 1 OS=Homo sapiens OX=9606 GN=TTC1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 22.0 null 120-UNIMOD:1031 0.08 22.0 2 2 2 PRT sp|O14787|TNPO2_HUMAN Transportin-2 OS=Homo sapiens OX=9606 GN=TNPO2 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 22.0 null 56-UNIMOD:1031 0.01 22.0 1 1 1 PRT sp|Q16531-2|DDB1_HUMAN Isoform 2 of DNA damage-binding protein 1 OS=Homo sapiens OX=9606 GN=DDB1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 22.0 null 175-UNIMOD:1031 0.02 22.0 1 1 1 PRT sp|Q9Y676|RT18B_HUMAN 28S ribosomal protein S18b, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS18B PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 22.0 null 156-UNIMOD:1031 0.04 22.0 1 1 1 PRT sp|Q9NYY8-2|FAKD2_HUMAN Isoform 2 of FAST kinase domain-containing protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=FASTKD2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 22.0 null 539-UNIMOD:1031,546-UNIMOD:4 0.02 22.0 1 1 1 PRT sp|Q15029-2|U5S1_HUMAN Isoform 2 of 116 kDa U5 small nuclear ribonucleoprotein component OS=Homo sapiens OX=9606 GN=EFTUD2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 22.0 null 649-UNIMOD:1031 0.01 22.0 1 1 1 PRT sp|P51114-3|FXR1_HUMAN Isoform 3 of Fragile X mental retardation syndrome-related protein 1 OS=Homo sapiens OX=9606 GN=FXR1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 22.0 null 210-UNIMOD:1031,67-UNIMOD:1031,72-UNIMOD:4 0.03 22.0 2 2 2 PRT sp|O95352-2|ATG7_HUMAN Isoform 2 of Ubiquitin-like modifier-activating enzyme ATG7 OS=Homo sapiens OX=9606 GN=ATG7 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 22.0 null 309-UNIMOD:1031,312-UNIMOD:35 0.01 22.0 2 1 0 PRT sp|Q9Y3C1|NOP16_HUMAN Nucleolar protein 16 OS=Homo sapiens OX=9606 GN=NOP16 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 22.0 null 146-UNIMOD:1031 0.07 22.0 1 1 1 PRT sp|Q14444-2|CAPR1_HUMAN Isoform 2 of Caprin-1 OS=Homo sapiens OX=9606 GN=CAPRIN1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 22.0 null 63-UNIMOD:1031,223-UNIMOD:1031,226-UNIMOD:4,13-UNIMOD:1031 0.05 22.0 4 3 1 PRT sp|P15954|COX7C_HUMAN Cytochrome c oxidase subunit 7C, mitochondrial OS=Homo sapiens OX=9606 GN=COX7C PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 22.0 null 25-UNIMOD:259 0.16 22.0 1 1 1 PRT sp|Q13951|PEBB_HUMAN Core-binding factor subunit beta OS=Homo sapiens OX=9606 GN=CBFB PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 22.0 null 11-UNIMOD:1031 0.06 22.0 1 1 1 PRT sp|P55786-2|PSA_HUMAN Isoform 2 of Puromycin-sensitive aminopeptidase OS=Homo sapiens OX=9606 GN=NPEPPS null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 22.0 null 119-UNIMOD:1031,635-UNIMOD:1031 0.02 22.0 2 2 2 PRT sp|Q96J01-2|THOC3_HUMAN Isoform 2 of THO complex subunit 3 OS=Homo sapiens OX=9606 GN=THOC3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 22.0 null 86-UNIMOD:1031 0.04 22.0 1 1 1 PRT sp|Q9NRN9|METL5_HUMAN Methyltransferase-like protein 5 OS=Homo sapiens OX=9606 GN=METTL5 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 22.0 null 158-UNIMOD:1031 0.06 22.0 1 1 1 PRT sp|Q05519-2|SRS11_HUMAN Isoform 2 of Serine/arginine-rich splicing factor 11 OS=Homo sapiens OX=9606 GN=SRSF11 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 22.0 null 452-UNIMOD:1031,454-UNIMOD:4 0.02 22.0 1 1 1 PRT sp|Q9UQ35|SRRM2_HUMAN Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 22.0 null 0.01 22.0 2 2 2 PRT sp|O00625|PIR_HUMAN Pirin OS=Homo sapiens OX=9606 GN=PIR PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 22.0 null 175-UNIMOD:259,275-UNIMOD:1031 0.07 22.0 4 2 1 PRT sp|P68402|PA1B2_HUMAN Platelet-activating factor acetylhydrolase IB subunit beta OS=Homo sapiens OX=9606 GN=PAFAH1B2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 22.0 null 161-UNIMOD:1031,155-UNIMOD:1031 0.07 22.0 2 2 2 PRT sp|O00767|ACOD_HUMAN Acyl-CoA desaturase OS=Homo sapiens OX=9606 GN=SCD PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 22.0 null 341-UNIMOD:1031 0.03 22.0 1 1 1 PRT sp|P00973-2|OAS1_HUMAN Isoform p41 of 2'-5'-oligoadenylate synthase 1 OS=Homo sapiens OX=9606 GN=OAS1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 22.0 null 60-UNIMOD:1031 0.03 22.0 1 1 1 PRT sp|P08047-3|SP1_HUMAN Isoform 3 of Transcription factor Sp1 OS=Homo sapiens OX=9606 GN=SP1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 22.0 null 591-UNIMOD:1031 0.01 22.0 2 1 0 PRT sp|Q9Y315|DEOC_HUMAN Deoxyribose-phosphate aldolase OS=Homo sapiens OX=9606 GN=DERA PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 22.0 null 0.03 22.0 1 1 1 PRT sp|O43809|CPSF5_HUMAN Cleavage and polyadenylation specificity factor subunit 5 OS=Homo sapiens OX=9606 GN=NUDT21 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 22.0 null 29-UNIMOD:1031,23-UNIMOD:1031 0.09 22.0 2 2 2 PRT sp|Q9H4B7|TBB1_HUMAN Tubulin beta-1 chain OS=Homo sapiens OX=9606 GN=TUBB1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 null 257-UNIMOD:35,262-UNIMOD:267,251-UNIMOD:267,354-UNIMOD:4 0.07 22.0 11 3 0 PRT sp|P68032|ACTC_HUMAN Actin, alpha cardiac muscle 1 OS=Homo sapiens OX=9606 GN=ACTC1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 22.0 null 12-UNIMOD:4,20-UNIMOD:1031,2-UNIMOD:4,30-UNIMOD:267,1-UNIMOD:35,20-UNIMOD:259 0.08 22.0 4 3 2 PRT sp|O60664|PLIN3_HUMAN Perilipin-3 OS=Homo sapiens OX=9606 GN=PLIN3 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 22.0 null 102-UNIMOD:1031,248-UNIMOD:28,257-UNIMOD:1031 0.07 22.0 4 2 0 PRT sp|P23193|TCEA1_HUMAN Transcription elongation factor A protein 1 OS=Homo sapiens OX=9606 GN=TCEA1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 null 84-UNIMOD:1031 0.05 22.0 1 1 1 PRT sp|P55060|XPO2_HUMAN Exportin-2 OS=Homo sapiens OX=9606 GN=CSE1L PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 null 912-UNIMOD:1031,920-UNIMOD:35,425-UNIMOD:1031 0.03 22.0 2 2 0 PRT sp|Q13043|STK4_HUMAN Serine/threonine-protein kinase 4 OS=Homo sapiens OX=9606 GN=STK4 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 null 59-UNIMOD:1031 0.05 22.0 1 1 1 PRT sp|P36542|ATPG_HUMAN ATP synthase subunit gamma, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1C PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 null 49-UNIMOD:1031,50-UNIMOD:35,39-UNIMOD:1031 0.06 22.0 3 2 0 PRT sp|P54725|RD23A_HUMAN UV excision repair protein RAD23 homolog A OS=Homo sapiens OX=9606 GN=RAD23A PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 null 47-UNIMOD:1031 0.04 22.0 1 1 0 PRT sp|O95347|SMC2_HUMAN Structural maintenance of chromosomes protein 2 OS=Homo sapiens OX=9606 GN=SMC2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 null 919-UNIMOD:1031,911-UNIMOD:1031 0.01 22.0 3 2 1 PRT sp|P33993|MCM7_HUMAN DNA replication licensing factor MCM7 OS=Homo sapiens OX=9606 GN=MCM7 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 22.0 null 2-UNIMOD:1,4-UNIMOD:1031 0.01 22.0 1 1 1 PRT sp|Q15907|RB11B_HUMAN Ras-related protein Rab-11B OS=Homo sapiens OX=9606 GN=RAB11B PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 22.0 null 179-UNIMOD:1031 0.05 22.0 1 1 1 PRT sp|Q5SY16|NOL9_HUMAN Polynucleotide 5'-hydroxyl-kinase NOL9 OS=Homo sapiens OX=9606 GN=NOL9 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 22.0 null 2-UNIMOD:1,9-UNIMOD:1031 0.01 22.0 1 1 1 PRT sp|P23919|KTHY_HUMAN Thymidylate kinase OS=Homo sapiens OX=9606 GN=DTYMK PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 null 25-UNIMOD:1031,31-UNIMOD:4 0.06 22.0 1 1 1 PRT sp|Q8WX93|PALLD_HUMAN Palladin OS=Homo sapiens OX=9606 GN=PALLD PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 null 659-UNIMOD:1031 0.01 22.0 1 1 1 PRT sp|Q9Y4P8|WIPI2_HUMAN WD repeat domain phosphoinositide-interacting protein 2 OS=Homo sapiens OX=9606 GN=WIPI2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 null 223-UNIMOD:1031 0.03 22.0 1 1 1 PRT sp|Q99439|CNN2_HUMAN Calponin-2 OS=Homo sapiens OX=9606 GN=CNN2 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 null 74-UNIMOD:1031 0.04 22.0 1 1 1 PRT sp|Q8WWM7|ATX2L_HUMAN Ataxin-2-like protein OS=Homo sapiens OX=9606 GN=ATXN2L PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 null 207-UNIMOD:1031 0.04 22.0 2 2 2 PRT sp|P26358|DNMT1_HUMAN DNA (cytosine-5)-methyltransferase 1 OS=Homo sapiens OX=9606 GN=DNMT1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 null 617-UNIMOD:1031 0.01 22.0 1 1 1 PRT sp|Q15366|PCBP2_HUMAN Poly(rC)-binding protein 2 OS=Homo sapiens OX=9606 GN=PCBP2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 null 109-UNIMOD:4,115-UNIMOD:259 0.07 22.0 2 2 2 PRT sp|P12235|ADT1_HUMAN ADP/ATP translocase 1 OS=Homo sapiens OX=9606 GN=SLC25A4 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 null 92-UNIMOD:259 0.04 22.0 1 1 0 PRT sp|P31947|1433S_HUMAN 14-3-3 protein sigma OS=Homo sapiens OX=9606 GN=SFN PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 null 214-UNIMOD:259 0.08 22.0 1 1 1 PRT sp|P49321|NASP_HUMAN Nuclear autoantigenic sperm protein OS=Homo sapiens OX=9606 GN=NASP PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 null 0.01 22.0 1 1 1 PRT sp|Q58A45|PAN3_HUMAN PAN2-PAN3 deadenylation complex subunit PAN3 OS=Homo sapiens OX=9606 GN=PAN3 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 null 641-UNIMOD:35,645-UNIMOD:1031 0.01 22.0 5 1 0 PRT sp|Q08257|QOR_HUMAN Quinone oxidoreductase OS=Homo sapiens OX=9606 GN=CRYZ PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 null 23-UNIMOD:1031 0.04 22.0 1 1 1 PRT sp|Q15020|SART3_HUMAN Squamous cell carcinoma antigen recognized by T-cells 3 OS=Homo sapiens OX=9606 GN=SART3 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 null 841-UNIMOD:1031,859-UNIMOD:35 0.02 22.0 1 1 0 PRT sp|Q96TA2|YMEL1_HUMAN ATP-dependent zinc metalloprotease YME1L1 OS=Homo sapiens OX=9606 GN=YME1L1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 null 334-UNIMOD:1031 0.03 22.0 1 1 1 PRT sp|P55011|S12A2_HUMAN Solute carrier family 12 member 2 OS=Homo sapiens OX=9606 GN=SLC12A2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 null 890-UNIMOD:1031,897-UNIMOD:35 0.01 22.0 1 1 0 PRT sp|P82933|RT09_HUMAN 28S ribosomal protein S9, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS9 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 287-UNIMOD:1031 0.03 21.0 1 1 1 PRT sp|P09493-4|TPM1_HUMAN Isoform 4 of Tropomyosin alpha-1 chain OS=Homo sapiens OX=9606 GN=TPM1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 213-UNIMOD:1031 0.05 21.0 1 1 1 PRT sp|Q9BR76|COR1B_HUMAN Coronin-1B OS=Homo sapiens OX=9606 GN=CORO1B PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 468-UNIMOD:1031,216-UNIMOD:1031 0.04 21.0 2 2 2 PRT sp|Q86VZ2|WDR5B_HUMAN WD repeat-containing protein 5B OS=Homo sapiens OX=9606 GN=WDR5B PE=2 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 244-UNIMOD:4,246-UNIMOD:1031 0.03 21.0 1 1 1 PRT sp|Q9NQE9|HINT3_HUMAN Histidine triad nucleotide-binding protein 3 OS=Homo sapiens OX=9606 GN=HINT3 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 78-UNIMOD:1031 0.09 21.0 1 1 1 PRT sp|Q14164-2|IKKE_HUMAN Isoform 2 of Inhibitor of nuclear factor kappa-B kinase subunit epsilon OS=Homo sapiens OX=9606 GN=IKBKE null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 52-UNIMOD:1031,57-UNIMOD:35 0.02 21.0 2 1 0 PRT sp|Q13303-5|KCAB2_HUMAN Isoform 5 of Voltage-gated potassium channel subunit beta-2 OS=Homo sapiens OX=9606 GN=KCNAB2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 276-UNIMOD:1031 0.03 21.0 1 1 1 PRT sp|Q9P0L2-3|MARK1_HUMAN Isoform 3 of Serine/threonine-protein kinase MARK1 OS=Homo sapiens OX=9606 GN=MARK1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 162-UNIMOD:1031,172-UNIMOD:35 0.02 21.0 1 1 0 PRT sp|Q9C098|DCLK3_HUMAN Serine/threonine-protein kinase DCLK3 OS=Homo sapiens OX=9606 GN=DCLK3 PE=2 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 479-UNIMOD:1031 0.02 21.0 2 1 0 PRT sp|Q9P013|CWC15_HUMAN Spliceosome-associated protein CWC15 homolog OS=Homo sapiens OX=9606 GN=CWC15 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 40-UNIMOD:1031 0.04 21.0 1 1 1 PRT sp|Q9H9T3-4|ELP3_HUMAN Isoform 3 of Elongator complex protein 3 OS=Homo sapiens OX=9606 GN=ELP3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 372-UNIMOD:1031 0.05 21.0 1 1 1 PRT sp|P21796|VDAC1_HUMAN Voltage-dependent anion-selective channel protein 1 OS=Homo sapiens OX=9606 GN=VDAC1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 20-UNIMOD:1031 0.05 21.0 1 1 1 PRT sp|Q04323|UBXN1_HUMAN UBX domain-containing protein 1 OS=Homo sapiens OX=9606 GN=UBXN1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 154-UNIMOD:1031 0.03 21.0 1 1 1 PRT sp|O15427|MOT4_HUMAN Monocarboxylate transporter 4 OS=Homo sapiens OX=9606 GN=SLC16A3 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 21.0 null 448-UNIMOD:1031,431-UNIMOD:1031 0.06 21.0 2 2 2 PRT sp|Q15041-2|AR6P1_HUMAN Isoform 2 of ADP-ribosylation factor-like protein 6-interacting protein 1 OS=Homo sapiens OX=9606 GN=ARL6IP1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 80-UNIMOD:4,85-UNIMOD:1031 0.07 21.0 1 1 0 PRT sp|O14657|TOR1B_HUMAN Torsin-1B OS=Homo sapiens OX=9606 GN=TOR1B PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 326-UNIMOD:4,327-UNIMOD:1031 0.03 21.0 1 1 1 PRT sp|P60604-2|UB2G2_HUMAN Isoform 2 of Ubiquitin-conjugating enzyme E2 G2 OS=Homo sapiens OX=9606 GN=UBE2G2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 128-UNIMOD:1031 0.07 21.0 1 1 0 PRT sp|Q12907|LMAN2_HUMAN Vesicular integral-membrane protein VIP36 OS=Homo sapiens OX=9606 GN=LMAN2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 300-UNIMOD:1031 0.04 21.0 1 1 1 PRT sp|P62899-3|RL31_HUMAN Isoform 3 of 60S ribosomal protein L31 OS=Homo sapiens OX=9606 GN=RPL31 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 39-UNIMOD:1031,70-UNIMOD:1031,75-UNIMOD:1031,40-UNIMOD:1031,31-UNIMOD:1031 0.25 21.0 7 4 3 PRT sp|Q8N183|NDUF2_HUMAN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 2 OS=Homo sapiens OX=9606 GN=NDUFAF2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 101-UNIMOD:1031,165-UNIMOD:1031 0.11 21.0 2 2 2 PRT sp|O94973|AP2A2_HUMAN AP-2 complex subunit alpha-2 OS=Homo sapiens OX=9606 GN=AP2A2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 35-UNIMOD:1031,298-UNIMOD:1031 0.02 21.0 2 2 2 PRT sp|Q86V81|THOC4_HUMAN THO complex subunit 4 OS=Homo sapiens OX=9606 GN=ALYREF PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 21.0 null 134-UNIMOD:1031,81-UNIMOD:1031 0.07 21.0 3 2 1 PRT sp|Q5JTH9-2|RRP12_HUMAN Isoform 2 of RRP12-like protein OS=Homo sapiens OX=9606 GN=RRP12 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 914-UNIMOD:1031,689-UNIMOD:1031 0.01 21.0 2 2 2 PRT sp|O14530|TXND9_HUMAN Thioredoxin domain-containing protein 9 OS=Homo sapiens OX=9606 GN=TXNDC9 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 201-UNIMOD:1031 0.04 21.0 1 1 1 PRT sp|Q15008-3|PSMD6_HUMAN Isoform 3 of 26S proteasome non-ATPase regulatory subunit 6 OS=Homo sapiens OX=9606 GN=PSMD6 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 333-UNIMOD:1031 0.03 21.0 1 1 1 PRT sp|P63010|AP2B1_HUMAN AP-2 complex subunit beta OS=Homo sapiens OX=9606 GN=AP2B1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 12-UNIMOD:1031 0.01 21.0 1 1 1 PRT sp|P30520|PURA2_HUMAN Adenylosuccinate synthetase isozyme 2 OS=Homo sapiens OX=9606 GN=ADSS2 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 164-UNIMOD:1031,157-UNIMOD:1031 0.05 21.0 2 2 2 PRT sp|P82675|RT05_HUMAN 28S ribosomal protein S5, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS5 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 366-UNIMOD:1031 0.02 21.0 1 1 1 PRT sp|P07602|SAP_HUMAN Prosaposin OS=Homo sapiens OX=9606 GN=PSAP PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 21.0 null 414-UNIMOD:1031,304-UNIMOD:1031,409-UNIMOD:4,412-UNIMOD:4,413-UNIMOD:259 0.09 21.0 5 5 5 PRT sp|P60468|SC61B_HUMAN Protein transport protein Sec61 subunit beta OS=Homo sapiens OX=9606 GN=SEC61B PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 35-UNIMOD:1031,39-UNIMOD:4 0.09 21.0 1 1 1 PRT sp|P14324-2|FPPS_HUMAN Isoform 2 of Farnesyl pyrophosphate synthase OS=Homo sapiens OX=9606 GN=FDPS null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 76-UNIMOD:1031 0.03 21.0 1 1 1 PRT sp|Q14258|TRI25_HUMAN E3 ubiquitin/ISG15 ligase TRIM25 OS=Homo sapiens OX=9606 GN=TRIM25 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 285-UNIMOD:1031 0.01 21.0 1 1 1 PRT sp|P51659-3|DHB4_HUMAN Isoform 3 of Peroxisomal multifunctional enzyme type 2 OS=Homo sapiens OX=9606 GN=HSD17B4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 166-UNIMOD:1031,171-UNIMOD:4,656-UNIMOD:1031 0.04 21.0 2 2 2 PRT sp|Q7L2J0-2|MEPCE_HUMAN Isoform 2 of 7SK snRNA methylphosphate capping enzyme OS=Homo sapiens OX=9606 GN=MEPCE null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 158-UNIMOD:1031 0.05 21.0 1 1 1 PRT sp|Q8NF37|PCAT1_HUMAN Lysophosphatidylcholine acyltransferase 1 OS=Homo sapiens OX=9606 GN=LPCAT1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 93-UNIMOD:1031,468-UNIMOD:1031 0.04 21.0 2 2 2 PRT sp|P62273|RS29_HUMAN 40S ribosomal protein S29 OS=Homo sapiens OX=9606 GN=RPS29 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 21.0 null 33-UNIMOD:1031,39-UNIMOD:4,38-UNIMOD:35,13-UNIMOD:1031 0.30 21.0 3 2 1 PRT sp|Q14739|LBR_HUMAN Delta(14)-sterol reductase LBR OS=Homo sapiens OX=9606 GN=LBR PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 21.0 null 594-UNIMOD:1031,64-UNIMOD:1031,178-UNIMOD:1031 0.05 21.0 3 3 3 PRT sp|Q9H0C8|ILKAP_HUMAN Integrin-linked kinase-associated serine/threonine phosphatase 2C OS=Homo sapiens OX=9606 GN=ILKAP PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 373-UNIMOD:1031 0.02 21.0 1 1 1 PRT sp|Q6DN12-4|MCTP2_HUMAN Isoform 4 of Multiple C2 and transmembrane domain-containing protein 2 OS=Homo sapiens OX=9606 GN=MCTP2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 23-UNIMOD:4,24-UNIMOD:1031 0.05 21.0 1 1 1 PRT sp|Q9BTW9-5|TBCD_HUMAN Isoform 5 of Tubulin-specific chaperone D OS=Homo sapiens OX=9606 GN=TBCD null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 282-UNIMOD:1031 0.01 21.0 1 1 1 PRT sp|Q9H089|LSG1_HUMAN Large subunit GTPase 1 homolog OS=Homo sapiens OX=9606 GN=LSG1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 81-UNIMOD:1031 0.02 21.0 1 1 1 PRT sp|O43237-2|DC1L2_HUMAN Isoform 2 of Cytoplasmic dynein 1 light intermediate chain 2 OS=Homo sapiens OX=9606 GN=DYNC1LI2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 81-UNIMOD:1031 0.02 21.0 1 1 1 PRT sp|P84090|ERH_HUMAN Enhancer of rudimentary homolog OS=Homo sapiens OX=9606 GN=ERH PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 41-UNIMOD:1031 0.09 21.0 1 1 1 PRT sp|A6NDG6|PGP_HUMAN Glycerol-3-phosphate phosphatase OS=Homo sapiens OX=9606 GN=PGP PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 297-UNIMOD:4,300-UNIMOD:1031 0.04 21.0 1 1 1 PRT sp|Q9UBB6-2|NCDN_HUMAN Isoform 2 of Neurochondrin OS=Homo sapiens OX=9606 GN=NCDN null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 266-UNIMOD:1031 0.01 21.0 1 1 1 PRT sp|Q9BY44-4|EIF2A_HUMAN Isoform 4 of Eukaryotic translation initiation factor 2A OS=Homo sapiens OX=9606 GN=EIF2A null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 506-UNIMOD:1031,484-UNIMOD:1031 0.03 21.0 2 2 2 PRT sp|Q13151|ROA0_HUMAN Heterogeneous nuclear ribonucleoprotein A0 OS=Homo sapiens OX=9606 GN=HNRNPA0 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 96-UNIMOD:1031 0.03 21.0 1 1 1 PRT sp|O15042-2|SR140_HUMAN Isoform 2 of U2 snRNP-associated SURP motif-containing protein OS=Homo sapiens OX=9606 GN=U2SURP null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 80-UNIMOD:1031 0.01 21.0 1 1 1 PRT sp|P20810-9|ICAL_HUMAN Isoform 9 of Calpastatin OS=Homo sapiens OX=9606 GN=CAST null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 137-UNIMOD:1031,726-UNIMOD:1031 0.05 21.0 3 3 3 PRT sp|P62316|SMD2_HUMAN Small nuclear ribonucleoprotein Sm D2 OS=Homo sapiens OX=9606 GN=SNRPD2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 18-UNIMOD:1031 0.10 21.0 1 1 1 PRT sp|O43493-4|TGON2_HUMAN Isoform 4 of Trans-Golgi network integral membrane protein 2 OS=Homo sapiens OX=9606 GN=TGOLN2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 89-UNIMOD:1031 0.08 21.0 1 1 1 PRT sp|Q8IVT5-4|KSR1_HUMAN Isoform 4 of Kinase suppressor of Ras 1 OS=Homo sapiens OX=9606 GN=KSR1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 600-UNIMOD:1031,608-UNIMOD:1031 0.01 21.0 1 1 1 PRT sp|Q6JQN1-3|ACD10_HUMAN Isoform 3 of Acyl-CoA dehydrogenase family member 10 OS=Homo sapiens OX=9606 GN=ACAD10 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 186-UNIMOD:1031 0.03 21.0 2 1 0 PRT sp|P09525-2|ANXA4_HUMAN Isoform 2 of Annexin A4 OS=Homo sapiens OX=9606 GN=ANXA4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 177-UNIMOD:1031 0.06 21.0 1 1 1 PRT sp|Q8IV48|ERI1_HUMAN 3'-5' exoribonuclease 1 OS=Homo sapiens OX=9606 GN=ERI1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 276-UNIMOD:1031,280-UNIMOD:35 0.03 21.0 1 1 1 PRT sp|P04080|CYTB_HUMAN Cystatin-B OS=Homo sapiens OX=9606 GN=CSTB PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 21.0 null 30-UNIMOD:1031,91-UNIMOD:1031 0.34 21.0 3 3 3 PRT sp|Q9NPA0|EMC7_HUMAN ER membrane protein complex subunit 7 OS=Homo sapiens OX=9606 GN=EMC7 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 232-UNIMOD:1031 0.05 21.0 1 1 1 PRT sp|Q07960|RHG01_HUMAN Rho GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=ARHGAP1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 222-UNIMOD:1031 0.03 21.0 1 1 1 PRT sp|Q16401-2|PSMD5_HUMAN Isoform 2 of 26S proteasome non-ATPase regulatory subunit 5 OS=Homo sapiens OX=9606 GN=PSMD5 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 407-UNIMOD:1031 0.02 21.0 1 1 1 PRT sp|O60684|IMA7_HUMAN Importin subunit alpha-7 OS=Homo sapiens OX=9606 GN=KPNA6 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 18-UNIMOD:1031,457-UNIMOD:1031 0.04 21.0 2 2 2 PRT sp|Q9H6T3-2|RPAP3_HUMAN Isoform 2 of RNA polymerase II-associated protein 3 OS=Homo sapiens OX=9606 GN=RPAP3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 202-UNIMOD:1031,271-UNIMOD:1031,137-UNIMOD:1031 0.04 21.0 3 3 3 PRT sp|Q7L7L0|H2A3_HUMAN Histone H2A type 3 OS=Homo sapiens OX=9606 GN=HIST3H2A PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 126-UNIMOD:1031,120-UNIMOD:1031,37-UNIMOD:1031 0.20 21.0 5 4 3 PRT sp|Q9UNN5-2|FAF1_HUMAN Isoform Short of FAS-associated factor 1 OS=Homo sapiens OX=9606 GN=FAF1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 0.02 21.0 1 1 1 PRT sp|Q9UHG3-2|PCYOX_HUMAN Isoform 2 of Prenylcysteine oxidase 1 OS=Homo sapiens OX=9606 GN=PCYOX1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 128-UNIMOD:1031 0.04 21.0 1 1 1 PRT sp|P82094|TMF1_HUMAN TATA element modulatory factor OS=Homo sapiens OX=9606 GN=TMF1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 457-UNIMOD:1031 0.01 21.0 1 1 1 PRT sp|O60568|PLOD3_HUMAN Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3 OS=Homo sapiens OX=9606 GN=PLOD3 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 89-UNIMOD:1031,215-UNIMOD:1031 0.03 21.0 3 2 1 PRT sp|Q9NRH2-2|SNRK_HUMAN Isoform 2 of SNF-related serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=SNRK null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 45-UNIMOD:1031 0.04 21.0 1 1 1 PRT sp|P98179|RBM3_HUMAN RNA-binding protein 3 OS=Homo sapiens OX=9606 GN=RBM3 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 84-UNIMOD:1031 0.06 21.0 1 1 1 PRT sp|P84103-2|SRSF3_HUMAN Isoform 2 of Serine/arginine-rich splicing factor 3 OS=Homo sapiens OX=9606 GN=SRSF3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 85-UNIMOD:1031 0.08 21.0 1 1 1 PRT sp|O00763-2|ACACB_HUMAN Isoform 2 of Acetyl-CoA carboxylase 2 OS=Homo sapiens OX=9606 GN=ACACB null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 262-UNIMOD:1031 0.01 21.0 1 1 1 PRT sp|Q86UP2-2|KTN1_HUMAN Isoform 2 of Kinectin OS=Homo sapiens OX=9606 GN=KTN1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 806-UNIMOD:1031,352-UNIMOD:1031 0.01 21.0 2 2 1 PRT sp|Q14134-2|TRI29_HUMAN Isoform Beta of Tripartite motif-containing protein 29 OS=Homo sapiens OX=9606 GN=TRIM29 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 361-UNIMOD:1031 0.02 21.0 1 1 1 PRT sp|Q9C0C2|TB182_HUMAN 182 kDa tankyrase-1-binding protein OS=Homo sapiens OX=9606 GN=TNKS1BP1 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 1657-UNIMOD:1031 0.01 21.0 1 1 1 PRT sp|Q2KHR3-2|QSER1_HUMAN Isoform 2 of Glutamine and serine-rich protein 1 OS=Homo sapiens OX=9606 GN=QSER1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 1149-UNIMOD:1031 0.01 21.0 1 1 1 PRT sp|O60942-3|MCE1_HUMAN Isoform 3 of mRNA-capping enzyme OS=Homo sapiens OX=9606 GN=RNGTT null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 294-UNIMOD:1031 0.02 21.0 1 1 1 PRT sp|O00264-2|PGRC1_HUMAN Isoform 2 of Membrane-associated progesterone receptor component 1 OS=Homo sapiens OX=9606 GN=PGRMC1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 117-UNIMOD:1031,102-UNIMOD:1031 0.13 21.0 2 2 2 PRT sp|O43847|NRDC_HUMAN Nardilysin OS=Homo sapiens OX=9606 GN=NRDC PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 21.0 null 993-UNIMOD:1031 0.01 21.0 1 1 1 PRT sp|P33778|H2B1B_HUMAN Histone H2B type 1-B OS=Homo sapiens OX=9606 GN=HIST1H2BB PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 21.0 null 35-UNIMOD:1031 0.09 21.0 1 1 1 PRT sp|O75369|FLNB_HUMAN Filamin-B OS=Homo sapiens OX=9606 GN=FLNB PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 21.0 null 681-UNIMOD:1031,2576-UNIMOD:1031,1780-UNIMOD:259 0.02 21.0 3 3 1 PRT sp|P35606|COPB2_HUMAN Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 21.0 null 318-UNIMOD:1031 0.02 21.0 1 1 1 PRT sp|Q7L7X3|TAOK1_HUMAN Serine/threonine-protein kinase TAO1 OS=Homo sapiens OX=9606 GN=TAOK1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 21.0 null 153-UNIMOD:1031 0.02 21.0 2 1 0 PRT sp|P16615|AT2A2_HUMAN Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Homo sapiens OX=9606 GN=ATP2A2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 21.0 null 169-UNIMOD:1031 0.01 21.0 1 1 0 PRT sp|P61758|PFD3_HUMAN Prefoldin subunit 3 OS=Homo sapiens OX=9606 GN=VBP1 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 21.0 null 2-UNIMOD:1,5-UNIMOD:1031,8-UNIMOD:4,52-UNIMOD:1031,185-UNIMOD:1031 0.14 21.0 3 3 3 PRT sp|Q8IVH8|M4K3_HUMAN Mitogen-activated protein kinase kinase kinase kinase 3 OS=Homo sapiens OX=9606 GN=MAP4K3 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 21.0 null 138-UNIMOD:1031 0.02 21.0 2 1 0 PRT sp|Q02750|MP2K1_HUMAN Dual specificity mitogen-activated protein kinase kinase 1 OS=Homo sapiens OX=9606 GN=MAP2K1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 21.0 null 192-UNIMOD:1031 0.03 21.0 1 1 0 PRT sp|O95433|AHSA1_HUMAN Activator of 90 kDa heat shock protein ATPase homolog 1 OS=Homo sapiens OX=9606 GN=AHSA1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 21.0 null 203-UNIMOD:1031,207-UNIMOD:4,189-UNIMOD:1031 0.06 21.0 2 2 0 PRT sp|Q9H078-2|CLPB_HUMAN Isoform 2 of Caseinolytic peptidase B protein homolog OS=Homo sapiens OX=9606 GN=CLPB null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 21.0 null 207-UNIMOD:1031 0.03 21.0 1 1 1 PRT sp|P98175|RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens OX=9606 GN=RBM10 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 21.0 null 881-UNIMOD:1031 0.02 21.0 1 1 0 PRT sp|Q86UP2|KTN1_HUMAN Kinectin OS=Homo sapiens OX=9606 GN=KTN1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 21.0 null 806-UNIMOD:1031 0.01 21.0 1 1 0 PRT sp|Q9BZZ5|API5_HUMAN Apoptosis inhibitor 5 OS=Homo sapiens OX=9606 GN=API5 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 21.0 null 404-UNIMOD:1031,36-UNIMOD:1031 0.05 21.0 3 2 1 PRT sp|P09960|LKHA4_HUMAN Leukotriene A-4 hydrolase OS=Homo sapiens OX=9606 GN=LTA4H PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 21.0 null 64-UNIMOD:1031,519-UNIMOD:1031 0.04 21.0 2 2 2 PRT sp|P02788|TRFL_HUMAN Lactotransferrin OS=Homo sapiens OX=9606 GN=LTF PE=1 SV=6 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 21.0 null 476-UNIMOD:1031,478-UNIMOD:4,320-UNIMOD:1031 0.03 21.0 2 2 2 PRT sp|Q8N1G4|LRC47_HUMAN Leucine-rich repeat-containing protein 47 OS=Homo sapiens OX=9606 GN=LRRC47 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 21.0 null 353-UNIMOD:1031,228-UNIMOD:1031 0.04 21.0 3 2 1 PRT sp|Q9Y678|COPG1_HUMAN Coatomer subunit gamma-1 OS=Homo sapiens OX=9606 GN=COPG1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 21.0 null 387-UNIMOD:4,389-UNIMOD:1031,213-UNIMOD:1031,313-UNIMOD:1031 0.04 21.0 3 3 3 PRT sp|Q13564|ULA1_HUMAN NEDD8-activating enzyme E1 regulatory subunit OS=Homo sapiens OX=9606 GN=NAE1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 21.0 null 2-UNIMOD:1,6-UNIMOD:1031 0.02 21.0 1 1 1 PRT sp|P48729|KC1A_HUMAN Casein kinase I isoform alpha OS=Homo sapiens OX=9606 GN=CSNK1A1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 21.0 null 138-UNIMOD:1031,144-UNIMOD:35 0.04 21.0 2 1 0 PRT sp|O00764|PDXK_HUMAN Pyridoxal kinase OS=Homo sapiens OX=9606 GN=PDXK PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 21.0 null 161-UNIMOD:1031 0.04 21.0 1 1 0 PRT sp|Q8IW41|MAPK5_HUMAN MAP kinase-activated protein kinase 5 OS=Homo sapiens OX=9606 GN=MAPKAPK5 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 21.0 null 454-UNIMOD:1031 0.02 21.0 1 1 1 PRT sp|Q15005|SPCS2_HUMAN Signal peptidase complex subunit 2 OS=Homo sapiens OX=9606 GN=SPCS2 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 21.0 null 191-UNIMOD:1031 0.05 21.0 1 1 1 PRT sp|Q6IAA8|LTOR1_HUMAN Ragulator complex protein LAMTOR1 OS=Homo sapiens OX=9606 GN=LAMTOR1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 21.0 null 0.09 21.0 1 1 1 PRT sp|Q9NP97|DLRB1_HUMAN Dynein light chain roadblock-type 1 OS=Homo sapiens OX=9606 GN=DYNLRB1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 21.0 null 2-UNIMOD:1,9-UNIMOD:1031 0.10 21.0 1 1 1 PRT sp|Q8NC96|NECP1_HUMAN Adaptin ear-binding coat-associated protein 1 OS=Homo sapiens OX=9606 GN=NECAP1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 21.0 null 162-UNIMOD:4,169-UNIMOD:1031 0.04 21.0 1 1 1 PRT sp|O43488|ARK72_HUMAN Aflatoxin B1 aldehyde reductase member 2 OS=Homo sapiens OX=9606 GN=AKR7A2 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 21.0 null 236-UNIMOD:1031 0.05 21.0 1 1 1 PRT sp|Q9NUT2|MITOS_HUMAN Mitochondrial potassium channel ATP-binding subunit OS=Homo sapiens OX=9606 GN=ABCB8 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 21.0 null 513-UNIMOD:1031 0.03 21.0 1 1 1 PRT sp|Q9NZT2|OGFR_HUMAN Opioid growth factor receptor OS=Homo sapiens OX=9606 GN=OGFR PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 21.0 null 296-UNIMOD:1031 0.02 21.0 1 1 1 PRT sp|O15260|SURF4_HUMAN Surfeit locus protein 4 OS=Homo sapiens OX=9606 GN=SURF4 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 21.0 null 22-UNIMOD:1031 0.04 21.0 1 1 1 PRT sp|Q9UBT2|SAE2_HUMAN SUMO-activating enzyme subunit 2 OS=Homo sapiens OX=9606 GN=UBA2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 21.0 null 236-UNIMOD:1031,72-UNIMOD:259,77-UNIMOD:259,65-UNIMOD:1031 0.04 21.0 3 3 3 PRT sp|Q9GZS1|RPA49_HUMAN DNA-directed RNA polymerase I subunit RPA49 OS=Homo sapiens OX=9606 GN=POLR1E PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 21.0 null 170-UNIMOD:1031 0.03 21.0 1 1 1 PRT sp|O43396|TXNL1_HUMAN Thioredoxin-like protein 1 OS=Homo sapiens OX=9606 GN=TXNL1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 21.0 null 104-UNIMOD:1031 0.07 21.0 1 1 1 PRT sp|Q6NZI2|CAVN1_HUMAN Caveolae-associated protein 1 OS=Homo sapiens OX=9606 GN=CAVIN1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 21.0 null 299-UNIMOD:1031 0.03 21.0 1 1 1 PRT sp|Q9Y3B4|SF3B6_HUMAN Splicing factor 3B subunit 6 OS=Homo sapiens OX=9606 GN=SF3B6 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 20.0 null 100-UNIMOD:1031,101-UNIMOD:35 0.07 20.0 2 1 0 PRT sp|Q8TAQ2-2|SMRC2_HUMAN Isoform 2 of SWI/SNF complex subunit SMARCC2 OS=Homo sapiens OX=9606 GN=SMARCC2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 20.0 null 905-UNIMOD:1031 0.01 20.0 1 1 1 PRT sp|Q13823|NOG2_HUMAN Nucleolar GTP-binding protein 2 OS=Homo sapiens OX=9606 GN=GNL2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 20.0 null 603-UNIMOD:1031 0.01 20.0 2 1 0 PRT sp|Q9ULR0|ISY1_HUMAN Pre-mRNA-splicing factor ISY1 homolog OS=Homo sapiens OX=9606 GN=ISY1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 20.0 null 79-UNIMOD:1031 0.04 20.0 1 1 1 PRT sp|Q92734-4|TFG_HUMAN Isoform 4 of Protein TFG OS=Homo sapiens OX=9606 GN=TFG null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 20.0 null 147-UNIMOD:1031 0.04 20.0 1 1 1 PRT sp|Q9H299|SH3L3_HUMAN SH3 domain-binding glutamic acid-rich-like protein 3 OS=Homo sapiens OX=9606 GN=SH3BGRL3 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 20.0 null 18-UNIMOD:1031 0.13 20.0 1 1 1 PRT sp|P49903-2|SPS1_HUMAN Isoform 2 of Selenide, water dikinase 1 OS=Homo sapiens OX=9606 GN=SEPHS1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 20.0 null 266-UNIMOD:4,270-UNIMOD:1031 0.03 20.0 1 1 1 PRT sp|O14656|TOR1A_HUMAN Torsin-1A OS=Homo sapiens OX=9606 GN=TOR1A PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 20.0 null 319-UNIMOD:4,320-UNIMOD:1031,325-UNIMOD:1031 0.03 20.0 1 1 1 PRT sp|Q92783-2|STAM1_HUMAN Isoform 2 of Signal transducing adapter molecule 1 OS=Homo sapiens OX=9606 GN=STAM null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 20.0 null 103-UNIMOD:1031,105-UNIMOD:4 0.02 20.0 1 1 1 PRT sp|Q9ULI2-2|RIMKB_HUMAN Isoform 2 of Beta-citrylglutamate synthase B OS=Homo sapiens OX=9606 GN=RIMKLB null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 20.0 null 166-UNIMOD:1031 0.03 20.0 1 1 1 PRT sp|O43447-2|PPIH_HUMAN Isoform 2 of Peptidyl-prolyl cis-trans isomerase H OS=Homo sapiens OX=9606 GN=PPIH null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 20.0 null 58-UNIMOD:1031,10-UNIMOD:1031 0.16 20.0 2 2 2 PRT sp|Q13895|BYST_HUMAN Bystin OS=Homo sapiens OX=9606 GN=BYSL PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 20.0 null 15-UNIMOD:1031 0.05 20.0 1 1 1 PRT sp|Q9Y6E2-2|BZW2_HUMAN Isoform 2 of Basic leucine zipper and W2 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=BZW2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 20.0 null 6-UNIMOD:1031 0.05 20.0 2 1 0 PRT sp|P62837|UB2D2_HUMAN Ubiquitin-conjugating enzyme E2 D2 OS=Homo sapiens OX=9606 GN=UBE2D2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 20.0 null 8-UNIMOD:1031 0.07 20.0 1 1 1 PRT sp|P49721|PSB2_HUMAN Proteasome subunit beta type-2 OS=Homo sapiens OX=9606 GN=PSMB2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 20.0 null 162-UNIMOD:1031,163-UNIMOD:4 0.04 20.0 1 1 1 PRT sp|P07311|ACYP1_HUMAN Acylphosphatase-1 OS=Homo sapiens OX=9606 GN=ACYP1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 20.0 null 25-UNIMOD:1031 0.09 20.0 1 1 1 PRT sp|Q96EY4|TMA16_HUMAN Translation machinery-associated protein 16 OS=Homo sapiens OX=9606 GN=TMA16 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 20.0 null 160-UNIMOD:1031,162-UNIMOD:4,23-UNIMOD:1031 0.09 20.0 2 2 2 PRT sp|P0DPI2-2|GAL3A_HUMAN Isoform 2 of Glutamine amidotransferase-like class 1 domain-containing protein 3A, mitochondrial OS=Homo sapiens OX=9606 GN=GATD3A null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 20.0 null 230-UNIMOD:1031 0.04 20.0 1 1 1 PRT sp|O95299|NDUAA_HUMAN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFA10 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 20.0 null 75-UNIMOD:1031 0.03 20.0 1 1 1 PRT sp|Q15269|PWP2_HUMAN Periodic tryptophan protein 2 homolog OS=Homo sapiens OX=9606 GN=PWP2 PE=2 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 20.0 null 279-UNIMOD:1031 0.01 20.0 1 1 1 PRT sp|O95630-2|STABP_HUMAN Isoform 2 of STAM-binding protein OS=Homo sapiens OX=9606 GN=STAMBP null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 20.0 null 96-UNIMOD:1031 0.03 20.0 1 1 0 PRT sp|Q9UKS6|PACN3_HUMAN Protein kinase C and casein kinase substrate in neurons protein 3 OS=Homo sapiens OX=9606 GN=PACSIN3 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 20.0 null 148-UNIMOD:1031 0.02 20.0 1 1 1 PRT sp|P43308|SSRB_HUMAN Translocon-associated protein subunit beta OS=Homo sapiens OX=9606 GN=SSR2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 20.0 null 27-UNIMOD:1031 0.06 20.0 1 1 1 PRT sp|Q9NWX6|THG1_HUMAN Probable tRNA(His) guanylyltransferase OS=Homo sapiens OX=9606 GN=THG1L PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 20.0 null 260-UNIMOD:35,263-UNIMOD:1031,34-UNIMOD:1031 0.06 20.0 2 2 2 PRT sp|Q8IUD2-5|RB6I2_HUMAN Isoform 5 of ELKS/Rab6-interacting/CAST family member 1 OS=Homo sapiens OX=9606 GN=ERC1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 20.0 null 609-UNIMOD:1031 0.03 20.0 1 1 1 PRT sp|O43143|DHX15_HUMAN Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 OS=Homo sapiens OX=9606 GN=DHX15 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 20.0 null 488-UNIMOD:1031,25-UNIMOD:1031,786-UNIMOD:1031,608-UNIMOD:1031,750-UNIMOD:4,132-UNIMOD:1031 0.09 20.0 8 7 6 PRT sp|P06748-3|NPM_HUMAN Isoform 3 of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 20.0 null 251-UNIMOD:35,257-UNIMOD:1031 0.04 20.0 2 1 0 PRT sp|Q99426-2|TBCB_HUMAN Isoform 2 of Tubulin-folding cofactor B OS=Homo sapiens OX=9606 GN=TBCB null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 20.0 null 160-UNIMOD:1031 0.05 20.0 1 1 1 PRT sp|Q96EP5-2|DAZP1_HUMAN Isoform 2 of DAZ-associated protein 1 OS=Homo sapiens OX=9606 GN=DAZAP1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 20.0 null 83-UNIMOD:1031,85-UNIMOD:4,45-UNIMOD:1031,57-UNIMOD:1031 0.07 20.0 3 3 3 PRT sp|Q9P2N5|RBM27_HUMAN RNA-binding protein 27 OS=Homo sapiens OX=9606 GN=RBM27 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 20.0 null 601-UNIMOD:1031,594-UNIMOD:1031 0.01 20.0 2 2 2 PRT sp|Q96ES7|SGF29_HUMAN SAGA-associated factor 29 OS=Homo sapiens OX=9606 GN=SGF29 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 20.0 null 161-UNIMOD:1031 0.03 20.0 1 1 1 PRT sp|Q8N4E7|FTMT_HUMAN Ferritin, mitochondrial OS=Homo sapiens OX=9606 GN=FTMT PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 20.0 null 56-UNIMOD:267,67-UNIMOD:267 0.09 20.0 1 1 1 PRT sp|P12931|SRC_HUMAN Proto-oncogene tyrosine-protein kinase Src OS=Homo sapiens OX=9606 GN=SRC PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 20.0 null 426-UNIMOD:1031 0.02 20.0 1 1 0 PRT sp|O95671-3|ASML_HUMAN Isoform 3 of Probable bifunctional dTTP/UTP pyrophosphatase/methyltransferase protein OS=Homo sapiens OX=9606 GN=ASMTL null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 20.0 null 7-UNIMOD:1031 0.02 20.0 1 1 1 PRT sp|O15439-4|MRP4_HUMAN Isoform 4 of Multidrug resistance-associated protein 4 OS=Homo sapiens OX=9606 GN=ABCC4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 20.0 null 557-UNIMOD:1031 0.02 20.0 1 1 1 PRT sp|Q8NC51-4|PAIRB_HUMAN Isoform 4 of Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 20.0 null 205-UNIMOD:1031 0.02 20.0 1 1 1 PRT sp|Q9Y2Q9|RT28_HUMAN 28S ribosomal protein S28, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS28 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 20.0 null 181-UNIMOD:1031 0.05 20.0 1 1 1 PRT sp|P31939-2|PUR9_HUMAN Isoform 2 of Bifunctional purine biosynthesis protein PURH OS=Homo sapiens OX=9606 GN=ATIC null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 20.0 null 405-UNIMOD:1031,460-UNIMOD:1031 0.06 20.0 3 3 2 PRT sp|Q92917|GPKOW_HUMAN G-patch domain and KOW motifs-containing protein OS=Homo sapiens OX=9606 GN=GPKOW PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 20.0 null 0.02 20.0 1 1 1 PRT sp|Q9HAV0|GBB4_HUMAN Guanine nucleotide-binding protein subunit beta-4 OS=Homo sapiens OX=9606 GN=GNB4 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 20.0 null 204-UNIMOD:4 0.04 20.0 1 1 1 PRT sp|Q06609-3|RAD51_HUMAN Isoform 3 of DNA repair protein RAD51 homolog 1 OS=Homo sapiens OX=9606 GN=RAD51 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 20.0 null 133-UNIMOD:1031,137-UNIMOD:4,144-UNIMOD:4 0.08 20.0 1 1 1 PRT sp|Q9UBQ0|VPS29_HUMAN Vacuolar protein sorting-associated protein 29 OS=Homo sapiens OX=9606 GN=VPS29 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 20.0 null 24-UNIMOD:1031,60-UNIMOD:267 0.10 20.0 3 2 1 PRT sp|Q9UBC2-4|EP15R_HUMAN Isoform 4 of Epidermal growth factor receptor substrate 15-like 1 OS=Homo sapiens OX=9606 GN=EPS15L1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 20.0 null 0.02 20.0 1 1 1 PRT sp|P28072|PSB6_HUMAN Proteasome subunit beta type-6 OS=Homo sapiens OX=9606 GN=PSMB6 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 20.0 null 63-UNIMOD:267 0.05 20.0 4 1 0 PRT sp|P14550|AK1A1_HUMAN Aldo-keto reductase family 1 member A1 OS=Homo sapiens OX=9606 GN=AKR1A1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 20.0 null 260-UNIMOD:4,263-UNIMOD:1031 0.04 20.0 1 1 1 PRT sp|Q4G0J3|LARP7_HUMAN La-related protein 7 OS=Homo sapiens OX=9606 GN=LARP7 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 20.0 null 32-UNIMOD:1031 0.02 20.0 1 1 1 PRT sp|Q13561|DCTN2_HUMAN Dynactin subunit 2 OS=Homo sapiens OX=9606 GN=DCTN2 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 20.0 null 295-UNIMOD:1031,188-UNIMOD:1031 0.05 20.0 2 2 2 PRT sp|Q9BYD2|RM09_HUMAN 39S ribosomal protein L9, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL9 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 20.0 null 81-UNIMOD:1031 0.04 20.0 1 1 1 PRT sp|Q9BXP5-5|SRRT_HUMAN Isoform 5 of Serrate RNA effector molecule homolog OS=Homo sapiens OX=9606 GN=SRRT null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 20.0 null 176-UNIMOD:1031,686-UNIMOD:1031,698-UNIMOD:1031 0.03 20.0 3 3 3 PRT sp|O95202|LETM1_HUMAN Mitochondrial proton/calcium exchanger protein OS=Homo sapiens OX=9606 GN=LETM1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 20.0 null 603-UNIMOD:1031,162-UNIMOD:1031 0.03 20.0 2 2 2 PRT sp|P61326-2|MGN_HUMAN Isoform 2 of Protein mago nashi homolog OS=Homo sapiens OX=9606 GN=MAGOH null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 20.0 null 14-UNIMOD:1031 0.08 20.0 1 1 1 PRT sp|Q92901|RL3L_HUMAN 60S ribosomal protein L3-like OS=Homo sapiens OX=9606 GN=RPL3L PE=2 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 null 250-UNIMOD:1031,253-UNIMOD:4 0.03 20.0 1 1 0 PRT sp|P06753|TPM3_HUMAN Tropomyosin alpha-3 chain OS=Homo sapiens OX=9606 GN=TPM3 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 null 169-UNIMOD:1031,91-UNIMOD:267 0.09 20.0 2 2 2 PRT sp|Q9Y2H1|ST38L_HUMAN Serine/threonine-protein kinase 38-like OS=Homo sapiens OX=9606 GN=STK38L PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 null 215-UNIMOD:1031,119-UNIMOD:1031 0.06 20.0 2 2 0 PRT sp|Q13247|SRSF6_HUMAN Serine/arginine-rich splicing factor 6 OS=Homo sapiens OX=9606 GN=SRSF6 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 null 0.03 20.0 1 1 0 PRT sp|Q9NZM1|MYOF_HUMAN Myoferlin OS=Homo sapiens OX=9606 GN=MYOF PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 20.0 null 1714-UNIMOD:1031,1156-UNIMOD:1031,1167-UNIMOD:4,1344-UNIMOD:1031,1386-UNIMOD:1031,1392-UNIMOD:4 0.03 20.0 4 4 4 PRT sp|P60763|RAC3_HUMAN Ras-related C3 botulinum toxin substrate 3 OS=Homo sapiens OX=9606 GN=RAC3 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 20.0 null 148-UNIMOD:27,153-UNIMOD:1031,157-UNIMOD:4 0.09 20.0 1 1 1 PRT sp|Q08945|SSRP1_HUMAN FACT complex subunit SSRP1 OS=Homo sapiens OX=9606 GN=SSRP1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 20.0 null 33-UNIMOD:1031,413-UNIMOD:1031,319-UNIMOD:1031,580-UNIMOD:1031 0.06 20.0 4 4 4 PRT sp|P05067|A4_HUMAN Amyloid-beta precursor protein OS=Homo sapiens OX=9606 GN=APP PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 20.0 null 506-UNIMOD:28,510-UNIMOD:1031 0.02 20.0 1 1 0 PRT sp|Q06787|FMR1_HUMAN Synaptic functional regulator FMR1 OS=Homo sapiens OX=9606 GN=FMR1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 null 130-UNIMOD:1031 0.02 20.0 1 1 0 PRT sp|P21281|VATB2_HUMAN V-type proton ATPase subunit B, brain isoform OS=Homo sapiens OX=9606 GN=ATP6V1B2 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 20.0 null 48-UNIMOD:1031,112-UNIMOD:4 0.06 20.0 2 2 2 PRT sp|Q8IYB3|SRRM1_HUMAN Serine/arginine repetitive matrix protein 1 OS=Homo sapiens OX=9606 GN=SRRM1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 null 249-UNIMOD:1031 0.01 20.0 1 1 1 PRT sp|P48449|ERG7_HUMAN Lanosterol synthase OS=Homo sapiens OX=9606 GN=LSS PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 null 470-UNIMOD:1031,471-UNIMOD:4 0.03 20.0 1 1 0 PRT sp|Q12904|AIMP1_HUMAN Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 OS=Homo sapiens OX=9606 GN=AIMP1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 20.0 null 114-UNIMOD:1031 0.04 20.0 1 1 1 PRT sp|O60832|DKC1_HUMAN H/ACA ribonucleoprotein complex subunit DKC1 OS=Homo sapiens OX=9606 GN=DKC1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 20.0 null 2-UNIMOD:1,11-UNIMOD:1031 0.02 20.0 1 1 1 PRT sp|O60888|CUTA_HUMAN Protein CutA OS=Homo sapiens OX=9606 GN=CUTA PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 null 0.08 20.0 1 1 0 PRT sp|P51580|TPMT_HUMAN Thiopurine S-methyltransferase OS=Homo sapiens OX=9606 GN=TPMT PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 20.0 null 216-UNIMOD:385,216-UNIMOD:4,219-UNIMOD:1031 0.05 20.0 2 1 0 PRT sp|Q9ULG6|CCPG1_HUMAN Cell cycle progression protein 1 OS=Homo sapiens OX=9606 GN=CCPG1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 20.0 null 356-UNIMOD:28,362-UNIMOD:1031 0.01 20.0 1 1 1 PRT sp|O95487|SC24B_HUMAN Protein transport protein Sec24B OS=Homo sapiens OX=9606 GN=SEC24B PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 null 622-UNIMOD:267 0.01 20.0 1 1 1 PRT sp|P29144|TPP2_HUMAN Tripeptidyl-peptidase 2 OS=Homo sapiens OX=9606 GN=TPP2 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 null 983-UNIMOD:1031 0.01 20.0 1 1 1 PRT sp|Q9HAU0|PKHA5_HUMAN Pleckstrin homology domain-containing family A member 5 OS=Homo sapiens OX=9606 GN=PLEKHA5 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 null 514-UNIMOD:1031 0.01 20.0 1 1 1 PRT sp|Q7L2J0|MEPCE_HUMAN 7SK snRNA methylphosphate capping enzyme OS=Homo sapiens OX=9606 GN=MEPCE PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 null 412-UNIMOD:1031,419-UNIMOD:4 0.01 20.0 1 1 1 PRT sp|Q6PI48|SYDM_HUMAN Aspartate--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=DARS2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 20.0 null 224-UNIMOD:1031,152-UNIMOD:4 0.04 20.0 2 2 2 PRT sp|Q8TCJ2|STT3B_HUMAN Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Homo sapiens OX=9606 GN=STT3B PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 20.0 null 2-UNIMOD:1,10-UNIMOD:1031 0.01 20.0 1 1 1 PRT sp|Q9UJZ1|STML2_HUMAN Stomatin-like protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=STOML2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 null 221-UNIMOD:1031 0.03 20.0 1 1 1 PRT sp|Q15759-3|MK11_HUMAN Isoform 2 of Mitogen-activated protein kinase 11 OS=Homo sapiens OX=9606 GN=MAPK11 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 20.0 null 117-UNIMOD:4,118-UNIMOD:35,122-UNIMOD:267 0.06 20.0 1 1 1 PRT sp|P54105|ICLN_HUMAN Methylosome subunit pICln OS=Homo sapiens OX=9606 GN=CLNS1A PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 null 0.06 20.0 1 1 1 PRT sp|P57772|SELB_HUMAN Selenocysteine-specific elongation factor OS=Homo sapiens OX=9606 GN=EEFSEC PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 null 475-UNIMOD:1031 0.02 20.0 1 1 0 PRT sp|Q96NC0|ZMAT2_HUMAN Zinc finger matrin-type protein 2 OS=Homo sapiens OX=9606 GN=ZMAT2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 null 102-UNIMOD:1031 0.07 20.0 1 1 1 PRT sp|Q1KMD3|HNRL2_HUMAN Heterogeneous nuclear ribonucleoprotein U-like protein 2 OS=Homo sapiens OX=9606 GN=HNRNPUL2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 null 26-UNIMOD:1031 0.01 20.0 1 1 1 PRT sp|Q9H3P7|GCP60_HUMAN Golgi resident protein GCP60 OS=Homo sapiens OX=9606 GN=ACBD3 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 null 183-UNIMOD:1031 0.02 20.0 1 1 1 PRT sp|P61086|UBE2K_HUMAN Ubiquitin-conjugating enzyme E2 K OS=Homo sapiens OX=9606 GN=UBE2K PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 null 18-UNIMOD:1031 0.06 20.0 2 1 0 PRT sp|P15531|NDKA_HUMAN Nucleoside diphosphate kinase A OS=Homo sapiens OX=9606 GN=NME1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 null 12-UNIMOD:259,18-UNIMOD:267 0.09 20.0 2 1 0 PRT sp|P42680|TEC_HUMAN Tyrosine-protein kinase Tec OS=Homo sapiens OX=9606 GN=TEC PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 null 526-UNIMOD:1031 0.03 20.0 1 1 1 PRT sp|P35613|BASI_HUMAN Basigin OS=Homo sapiens OX=9606 GN=BSG PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 null 227-UNIMOD:1031,242-UNIMOD:4 0.05 20.0 1 1 1 PRT sp|Q9H0H5|RGAP1_HUMAN Rac GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RACGAP1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 null 93-UNIMOD:4,95-UNIMOD:1031 0.02 20.0 1 1 1 PRT sp|Q15717|ELAV1_HUMAN ELAV-like protein 1 OS=Homo sapiens OX=9606 GN=ELAVL1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 null 104-UNIMOD:1031,50-UNIMOD:1031 0.11 20.0 2 2 2 PRT sp|Q5TCX8|M3K21_HUMAN Mitogen-activated protein kinase kinase kinase 21 OS=Homo sapiens OX=9606 GN=MAP3K21 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 null 265-UNIMOD:259,274-UNIMOD:259 0.01 20.0 1 1 1 PRT sp|Q9NPA8-2|ENY2_HUMAN Isoform 2 of Transcription and mRNA export factor ENY2 OS=Homo sapiens OX=9606 GN=ENY2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 19.0 null 14-UNIMOD:1031 0.15 19.0 1 1 1 PRT sp|Q96I25|SPF45_HUMAN Splicing factor 45 OS=Homo sapiens OX=9606 GN=RBM17 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 19.0 null 41-UNIMOD:1031 0.03 19.0 2 1 0 PRT sp|P11717|MPRI_HUMAN Cation-independent mannose-6-phosphate receptor OS=Homo sapiens OX=9606 GN=IGF2R PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 19.0 null 1545-UNIMOD:1031 0.00 19.0 1 1 1 PRT sp|Q9UKB3-2|DJC12_HUMAN Isoform B of DnaJ homolog subfamily C member 12 OS=Homo sapiens OX=9606 GN=DNAJC12 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 19.0 null 41-UNIMOD:4,45-UNIMOD:1031 0.14 19.0 1 1 1 PRT sp|Q9UNS1-2|TIM_HUMAN Isoform 2 of Protein timeless homolog OS=Homo sapiens OX=9606 GN=TIMELESS null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 19.0 null 1195-UNIMOD:1031 0.01 19.0 1 1 1 PRT sp|P0DP25|CALM3_HUMAN Calmodulin-3 OS=Homo sapiens OX=9606 GN=CALM3 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 19.0 null 31-UNIMOD:259 0.07 19.0 1 1 1 PRT sp|P61024|CKS1_HUMAN Cyclin-dependent kinases regulatory subunit 1 OS=Homo sapiens OX=9606 GN=CKS1B PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 19.0 null 30-UNIMOD:1031,26-UNIMOD:1031 0.19 19.0 2 2 2 PRT sp|O00311|CDC7_HUMAN Cell division cycle 7-related protein kinase OS=Homo sapiens OX=9606 GN=CDC7 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 19.0 null 179-UNIMOD:1031 0.02 19.0 1 1 1 PRT sp|Q05193-5|DYN1_HUMAN Isoform 4 of Dynamin-1 OS=Homo sapiens OX=9606 GN=DNM1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 19.0 null 223-UNIMOD:1031 0.01 19.0 1 1 1 PRT sp|Q8N999-3|CL029_HUMAN Isoform 3 of Uncharacterized protein C12orf29 OS=Homo sapiens OX=9606 GN=C12orf29 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 19.0 null 67-UNIMOD:1031 0.03 19.0 1 1 1 PRT sp|Q8WXF1-2|PSPC1_HUMAN Isoform 2 of Paraspeckle component 1 OS=Homo sapiens OX=9606 GN=PSPC1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 19.0 null 206-UNIMOD:1031 0.03 19.0 1 1 1 PRT sp|P23381-2|SYWC_HUMAN Isoform 2 of Tryptophan--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=WARS1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 19.0 null 61-UNIMOD:1031,73-UNIMOD:1031 0.05 19.0 2 2 2 PRT sp|P52292|IMA1_HUMAN Importin subunit alpha-1 OS=Homo sapiens OX=9606 GN=KPNA2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 19.0 null 22-UNIMOD:1031,27-UNIMOD:35 0.02 19.0 2 1 0 PRT sp|P53007|TXTP_HUMAN Tricarboxylate transport protein, mitochondrial OS=Homo sapiens OX=9606 GN=SLC25A1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 19.0 null 97-UNIMOD:1031 0.05 19.0 1 1 1 PRT sp|O43324-2|MCA3_HUMAN Isoform 2 of Eukaryotic translation elongation factor 1 epsilon-1 OS=Homo sapiens OX=9606 GN=EEF1E1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 19.0 null 21-UNIMOD:1031 0.08 19.0 1 1 1 PRT sp|Q9Y478|AAKB1_HUMAN 5'-AMP-activated protein kinase subunit beta-1 OS=Homo sapiens OX=9606 GN=PRKAB1 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 19.0 null 18-UNIMOD:1031 0.03 19.0 1 1 1 PRT sp|Q96G46-3|DUS3L_HUMAN Isoform 3 of tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Homo sapiens OX=9606 GN=DUS3L null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 19.0 null 403-UNIMOD:1031 0.02 19.0 1 1 1 PRT sp|P35606-2|COPB2_HUMAN Isoform 2 of Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 19.0 null 586-UNIMOD:1031,651-UNIMOD:1031 0.04 19.0 3 3 3 PRT sp|Q04941|PLP2_HUMAN Proteolipid protein 2 OS=Homo sapiens OX=9606 GN=PLP2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 19.0 null 0.09 19.0 1 1 1 PRT sp|P12955-2|PEPD_HUMAN Isoform 2 of Xaa-Pro dipeptidase OS=Homo sapiens OX=9606 GN=PEPD null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 19.0 null 114-UNIMOD:1031 0.02 19.0 1 1 1 PRT sp|Q13243-3|SRSF5_HUMAN Isoform SRP40-4 of Serine/arginine-rich splicing factor 5 OS=Homo sapiens OX=9606 GN=SRSF5 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 19.0 null 172-UNIMOD:1031 0.03 19.0 1 1 1 PRT sp|P17655-2|CAN2_HUMAN Isoform 2 of Calpain-2 catalytic subunit OS=Homo sapiens OX=9606 GN=CAPN2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 19.0 null 551-UNIMOD:1031 0.02 19.0 1 1 1 PRT sp|P55809|SCOT1_HUMAN Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=OXCT1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 19.0 null 286-UNIMOD:1031,504-UNIMOD:4,511-UNIMOD:259,185-UNIMOD:1031 0.06 19.0 3 3 3 PRT sp|Q15428|SF3A2_HUMAN Splicing factor 3A subunit 2 OS=Homo sapiens OX=9606 GN=SF3A2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 19.0 null 77-UNIMOD:1031,103-UNIMOD:1031 0.05 19.0 2 2 2 PRT sp|Q9BVP2-2|GNL3_HUMAN Isoform 2 of Guanine nucleotide-binding protein-like 3 OS=Homo sapiens OX=9606 GN=GNL3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 19.0 null 116-UNIMOD:1031,119-UNIMOD:4 0.02 19.0 1 1 1 PRT sp|P53990-2|IST1_HUMAN Isoform 2 of IST1 homolog OS=Homo sapiens OX=9606 GN=IST1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 19.0 null 29-UNIMOD:1031 0.02 19.0 1 1 1 PRT sp|Q9NVI7-3|ATD3A_HUMAN Isoform 3 of ATPase family AAA domain-containing protein 3A OS=Homo sapiens OX=9606 GN=ATAD3A null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 19.0 null 38-UNIMOD:1031,135-UNIMOD:1031 0.03 19.0 2 2 2 PRT sp|P78316-2|NOP14_HUMAN Isoform 2 of Nucleolar protein 14 OS=Homo sapiens OX=9606 GN=NOP14 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 19.0 null 175-UNIMOD:1031 0.01 19.0 1 1 1 PRT sp|P24928-2|RPB1_HUMAN Isoform 2 of DNA-directed RNA polymerase II subunit RPB1 OS=Homo sapiens OX=9606 GN=POLR2A null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 19.0 null 285-UNIMOD:1031 0.02 19.0 1 1 1 PRT sp|P35244|RFA3_HUMAN Replication protein A 14 kDa subunit OS=Homo sapiens OX=9606 GN=RPA3 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 19.0 null 33-UNIMOD:1031 0.08 19.0 1 1 1 PRT sp|P61201|CSN2_HUMAN COP9 signalosome complex subunit 2 OS=Homo sapiens OX=9606 GN=COPS2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 19.0 null 157-UNIMOD:1031,73-UNIMOD:1031,75-UNIMOD:35,43-UNIMOD:1031 0.06 19.0 5 3 2 PRT sp|Q92466-4|DDB2_HUMAN Isoform D3 of DNA damage-binding protein 2 OS=Homo sapiens OX=9606 GN=DDB2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 19.0 null 245-UNIMOD:1031 0.03 19.0 1 1 1 PRT sp|Q9NTX5-3|ECHD1_HUMAN Isoform 3 of Ethylmalonyl-CoA decarboxylase OS=Homo sapiens OX=9606 GN=ECHDC1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 19.0 null 98-UNIMOD:1031 0.04 19.0 1 1 1 PRT sp|Q01581|HMCS1_HUMAN Hydroxymethylglutaryl-CoA synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=HMGCS1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 19.0 null 273-UNIMOD:1031 0.02 19.0 1 1 1 PRT sp|Q9C0C9|UBE2O_HUMAN (E3-independent) E2 ubiquitin-conjugating enzyme OS=Homo sapiens OX=9606 GN=UBE2O PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 19.0 null 375-UNIMOD:4,384-UNIMOD:1031 0.01 19.0 1 1 1 PRT sp|O14617-3|AP3D1_HUMAN Isoform 3 of AP-3 complex subunit delta-1 OS=Homo sapiens OX=9606 GN=AP3D1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 19.0 null 29-UNIMOD:1031 0.01 19.0 1 1 1 PRT sp|Q8IWX8|CHERP_HUMAN Calcium homeostasis endoplasmic reticulum protein OS=Homo sapiens OX=9606 GN=CHERP PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 19.0 null 901-UNIMOD:1031 0.01 19.0 1 1 1 PRT sp|Q12873-2|CHD3_HUMAN Isoform 2 of Chromodomain-helicase-DNA-binding protein 3 OS=Homo sapiens OX=9606 GN=CHD3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 19.0 null 894-UNIMOD:1031 0.00 19.0 1 1 1 PRT sp|Q14244-2|MAP7_HUMAN Isoform 2 of Ensconsin OS=Homo sapiens OX=9606 GN=MAP7 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 19.0 null 101-UNIMOD:1031,444-UNIMOD:267 0.04 19.0 2 2 2 PRT sp|Q29RF7|PDS5A_HUMAN Sister chromatid cohesion protein PDS5 homolog A OS=Homo sapiens OX=9606 GN=PDS5A PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 19.0 null 935-UNIMOD:1031 0.01 19.0 1 1 1 PRT sp|Q7Z4S6-6|KI21A_HUMAN Isoform 6 of Kinesin-like protein KIF21A OS=Homo sapiens OX=9606 GN=KIF21A null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 19.0 null 646-UNIMOD:1031 0.01 19.0 1 1 0 PRT sp|O15533-4|TPSN_HUMAN Isoform 4 of Tapasin OS=Homo sapiens OX=9606 GN=TAPBP null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 19.0 null 255-UNIMOD:1031 0.02 19.0 1 1 1 PRT sp|O95861-4|BPNT1_HUMAN Isoform 4 of 3'(2'),5'-bisphosphate nucleotidase 1 OS=Homo sapiens OX=9606 GN=BPNT1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 19.0 null 42-UNIMOD:4,49-UNIMOD:259 0.04 19.0 1 1 1 PRT sp|P28838-2|AMPL_HUMAN Isoform 2 of Cytosol aminopeptidase OS=Homo sapiens OX=9606 GN=LAP3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 19.0 null 0.03 19.0 1 1 1 PRT sp|Q96AH0-3|SOSB2_HUMAN Isoform 3 of SOSS complex subunit B2 OS=Homo sapiens OX=9606 GN=NABP1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 19.0 null 37-UNIMOD:1031 0.07 19.0 1 1 1 PRT sp|Q96GC5-3|RM48_HUMAN Isoform 2 of 39S ribosomal protein L48, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL48 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 19.0 null 33-UNIMOD:1031 0.05 19.0 1 1 1 PRT sp|O43592|XPOT_HUMAN Exportin-T OS=Homo sapiens OX=9606 GN=XPOT PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 19.0 null 663-UNIMOD:1031,553-UNIMOD:1031 0.02 19.0 2 2 2 PRT sp|P55265-5|DSRAD_HUMAN Isoform 5 of Double-stranded RNA-specific adenosine deaminase OS=Homo sapiens OX=9606 GN=ADAR null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 19.0 null 374-UNIMOD:1031 0.01 19.0 1 1 1 PRT sp|P52597|HNRPF_HUMAN Heterogeneous nuclear ribonucleoprotein F OS=Homo sapiens OX=9606 GN=HNRNPF PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 19.0 null 87-UNIMOD:1031 0.02 19.0 1 1 1 PRT sp|Q9BYX7|ACTBM_HUMAN Putative beta-actin-like protein 3 OS=Homo sapiens OX=9606 GN=POTEKP PE=5 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 null 372-UNIMOD:267,313-UNIMOD:35,315-UNIMOD:1031 0.08 19.0 2 2 1 PRT sp|Q05639|EF1A2_HUMAN Elongation factor 1-alpha 2 OS=Homo sapiens OX=9606 GN=EEF1A2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 19.0 null 450-UNIMOD:1031,404-UNIMOD:35,408-UNIMOD:1031,410-UNIMOD:35,411-UNIMOD:4,276-UNIMOD:35 0.12 19.0 3 3 3 PRT sp|P13647|K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens OX=9606 GN=KRT5 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 null 426-UNIMOD:1031,443-UNIMOD:1031 0.03 19.0 2 2 2 PRT sp|P17844|DDX5_HUMAN Probable ATP-dependent RNA helicase DDX5 OS=Homo sapiens OX=9606 GN=DDX5 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 null 77-UNIMOD:267,80-UNIMOD:1031 0.03 19.0 2 2 1 PRT sp|Q01518|CAP1_HUMAN Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1 PE=1 SV=5 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 null 298-UNIMOD:1031 0.02 19.0 1 1 1 PRT sp|Q9H2U2|IPYR2_HUMAN Inorganic pyrophosphatase 2, mitochondrial OS=Homo sapiens OX=9606 GN=PPA2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 null 0.03 19.0 1 1 1 PRT sp|O75521|ECI2_HUMAN Enoyl-CoA delta isomerase 2, mitochondrial OS=Homo sapiens OX=9606 GN=ECI2 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 null 90-UNIMOD:1031,161-UNIMOD:1031,168-UNIMOD:35,173-UNIMOD:35,349-UNIMOD:1031 0.09 19.0 3 3 2 PRT sp|Q13492|PICAL_HUMAN Phosphatidylinositol-binding clathrin assembly protein OS=Homo sapiens OX=9606 GN=PICALM PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 null 291-UNIMOD:1031 0.02 19.0 1 1 1 PRT sp|Q96K17|BT3L4_HUMAN Transcription factor BTF3 homolog 4 OS=Homo sapiens OX=9606 GN=BTF3L4 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 19.0 null 1-UNIMOD:1,5-UNIMOD:1031,38-UNIMOD:1031 0.11 19.0 2 2 2 PRT sp|Q13535|ATR_HUMAN Serine/threonine-protein kinase ATR OS=Homo sapiens OX=9606 GN=ATR PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 null 2325-UNIMOD:35,2326-UNIMOD:4,2327-UNIMOD:1031 0.00 19.0 3 1 0 PRT sp|Q9HC98|NEK6_HUMAN Serine/threonine-protein kinase Nek6 OS=Homo sapiens OX=9606 GN=NEK6 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 null 174-UNIMOD:1031,174-UNIMOD:259,187-UNIMOD:259 0.05 19.0 2 1 0 PRT sp|O95382|M3K6_HUMAN Mitogen-activated protein kinase kinase kinase 6 OS=Homo sapiens OX=9606 GN=MAP3K6 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 null 773-UNIMOD:1031 0.01 19.0 1 1 1 PRT sp|Q96TA1|NIBA2_HUMAN Protein Niban 2 OS=Homo sapiens OX=9606 GN=NIBAN2 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 null 462-UNIMOD:1031,466-UNIMOD:4 0.01 19.0 1 1 1 PRT sp|Q99755|PI51A_HUMAN Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha OS=Homo sapiens OX=9606 GN=PIP5K1A PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 null 140-UNIMOD:1031 0.02 19.0 1 1 0 PRT sp|Q15029|U5S1_HUMAN 116 kDa U5 small nuclear ribonucleoprotein component OS=Homo sapiens OX=9606 GN=EFTUD2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 null 194-UNIMOD:1031,244-UNIMOD:1031 0.03 19.0 2 2 2 PRT sp|Q14444|CAPR1_HUMAN Caprin-1 OS=Homo sapiens OX=9606 GN=CAPRIN1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 19.0 null 13-UNIMOD:1031,56-UNIMOD:28,63-UNIMOD:1031,74-UNIMOD:1031 0.05 19.0 4 3 0 PRT sp|P14324|FPPS_HUMAN Farnesyl pyrophosphate synthase OS=Homo sapiens OX=9606 GN=FDPS PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 null 353-UNIMOD:1031 0.04 19.0 1 1 1 PRT sp|Q16851|UGPA_HUMAN UTP--glucose-1-phosphate uridylyltransferase OS=Homo sapiens OX=9606 GN=UGP2 PE=1 SV=5 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 null 312-UNIMOD:1031,184-UNIMOD:1031 0.06 19.0 2 2 2 PRT sp|Q05932|FOLC_HUMAN Folylpolyglutamate synthase, mitochondrial OS=Homo sapiens OX=9606 GN=FPGS PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 19.0 null 107-UNIMOD:1031,111-UNIMOD:4,116-UNIMOD:4 0.03 19.0 1 1 0 PRT sp|O15042|SR140_HUMAN U2 snRNP-associated SURP motif-containing protein OS=Homo sapiens OX=9606 GN=U2SURP PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 null 208-UNIMOD:1031 0.01 19.0 1 1 1 PRT sp|Q9GZT3|SLIRP_HUMAN SRA stem-loop-interacting RNA-binding protein, mitochondrial OS=Homo sapiens OX=9606 GN=SLIRP PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 19.0 null 48-UNIMOD:385,48-UNIMOD:4,54-UNIMOD:1031 0.13 19.0 1 1 1 PRT sp|Q5JSH3|WDR44_HUMAN WD repeat-containing protein 44 OS=Homo sapiens OX=9606 GN=WDR44 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 null 440-UNIMOD:1031 0.01 19.0 1 1 1 PRT sp|Q8TEQ6|GEMI5_HUMAN Gem-associated protein 5 OS=Homo sapiens OX=9606 GN=GEMIN5 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 null 1363-UNIMOD:1031 0.01 19.0 2 1 0 PRT sp|Q96E11|RRFM_HUMAN Ribosome-recycling factor, mitochondrial OS=Homo sapiens OX=9606 GN=MRRF PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 19.0 null 65-UNIMOD:1031,198-UNIMOD:1031 0.07 19.0 2 2 2 PRT sp|Q96S99|PKHF1_HUMAN Pleckstrin homology domain-containing family F member 1 OS=Homo sapiens OX=9606 GN=PLEKHF1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 null 44-UNIMOD:1031,46-UNIMOD:4 0.05 19.0 1 1 1 PRT sp|Q7Z4S6|KI21A_HUMAN Kinesin-like protein KIF21A OS=Homo sapiens OX=9606 GN=KIF21A PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 null 659-UNIMOD:1031 0.01 19.0 1 1 0 PRT sp|Q9BYE2|TMPSD_HUMAN Transmembrane protease serine 13 OS=Homo sapiens OX=9606 GN=TMPRSS13 PE=2 SV=5 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 null 0.02 19.0 1 1 1 PRT sp|P14635|CCNB1_HUMAN G2/mitotic-specific cyclin-B1 OS=Homo sapiens OX=9606 GN=CCNB1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 null 408-UNIMOD:1031 0.02 19.0 1 1 1 PRT sp|Q9H252|KCNH6_HUMAN Potassium voltage-gated channel subfamily H member 6 OS=Homo sapiens OX=9606 GN=KCNH6 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 19.0 null 238-UNIMOD:1031 0.02 19.0 1 1 1 PRT sp|Q13825|AUHM_HUMAN Methylglutaconyl-CoA hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=AUH PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 19.0 null 100-UNIMOD:1031 0.03 19.0 1 1 1 PRT sp|Q9NRG4|SMYD2_HUMAN N-lysine methyltransferase SMYD2 OS=Homo sapiens OX=9606 GN=SMYD2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 null 407-UNIMOD:1031 0.03 19.0 1 1 1 PRT sp|O75312|ZPR1_HUMAN Zinc finger protein ZPR1 OS=Homo sapiens OX=9606 GN=ZPR1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 null 459-UNIMOD:267 0.03 19.0 1 1 1 PRT sp|Q15751|HERC1_HUMAN Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens OX=9606 GN=HERC1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 null 3419-UNIMOD:4,3423-UNIMOD:1031 0.00 19.0 1 1 1 PRT sp|Q86U90|YRDC_HUMAN YrdC domain-containing protein, mitochondrial OS=Homo sapiens OX=9606 GN=YRDC PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 null 116-UNIMOD:1031,121-UNIMOD:4 0.05 19.0 1 1 1 PRT sp|P42229|STA5A_HUMAN Signal transducer and activator of transcription 5A OS=Homo sapiens OX=9606 GN=STAT5A PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 null 71-UNIMOD:1031 0.02 19.0 1 1 1 PRT sp|P55735|SEC13_HUMAN Protein SEC13 homolog OS=Homo sapiens OX=9606 GN=SEC13 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 null 0.04 19.0 1 1 1 PRT sp|P55265|DSRAD_HUMAN Double-stranded RNA-specific adenosine deaminase OS=Homo sapiens OX=9606 GN=ADAR PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 null 781-UNIMOD:1031,637-UNIMOD:1031 0.02 19.0 2 2 2 PRT sp|O00401|WASL_HUMAN Neural Wiskott-Aldrich syndrome protein OS=Homo sapiens OX=9606 GN=WASL PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 null 186-UNIMOD:1031 0.03 19.0 1 1 1 PRT sp|O95801|TTC4_HUMAN Tetratricopeptide repeat protein 4 OS=Homo sapiens OX=9606 GN=TTC4 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 null 107-UNIMOD:1031 0.03 19.0 1 1 1 PRT sp|Q9Y3A6|TMED5_HUMAN Transmembrane emp24 domain-containing protein 5 OS=Homo sapiens OX=9606 GN=TMED5 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 19.0 null 164-UNIMOD:1031 0.07 19.0 1 1 1 PRT sp|O95630|STABP_HUMAN STAM-binding protein OS=Homo sapiens OX=9606 GN=STAMBP PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 null 96-UNIMOD:1031 0.02 19.0 1 1 0 PRT sp|Q14558|KPRA_HUMAN Phosphoribosyl pyrophosphate synthase-associated protein 1 OS=Homo sapiens OX=9606 GN=PRPSAP1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 null 52-UNIMOD:1031 0.03 19.0 1 1 1 PRT sp|Q99615|DNJC7_HUMAN DnaJ homolog subfamily C member 7 OS=Homo sapiens OX=9606 GN=DNAJC7 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 null 155-UNIMOD:1031 0.02 19.0 1 1 1 PRT sp|Q12982|BNIP2_HUMAN BCL2/adenovirus E1B 19 kDa protein-interacting protein 2 OS=Homo sapiens OX=9606 GN=BNIP2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 null 228-UNIMOD:1031,229-UNIMOD:4 0.03 19.0 1 1 1 PRT sp|Q9P0L2|MARK1_HUMAN Serine/threonine-protein kinase MARK1 OS=Homo sapiens OX=9606 GN=MARK1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 null 184-UNIMOD:259,194-UNIMOD:35,197-UNIMOD:259 0.02 19.0 1 1 0 PRT sp|O75330|HMMR_HUMAN Hyaluronan mediated motility receptor OS=Homo sapiens OX=9606 GN=HMMR PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 null 391-UNIMOD:1031 0.02 19.0 1 1 1 PRT sp|Q05519|SRS11_HUMAN Serine/arginine-rich splicing factor 11 OS=Homo sapiens OX=9606 GN=SRSF11 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 null 211-UNIMOD:1031 0.04 19.0 2 1 0 PRT sp|P61163|ACTZ_HUMAN Alpha-centractin OS=Homo sapiens OX=9606 GN=ACTR1A PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 null 81-UNIMOD:1031 0.05 19.0 1 1 1 PRT sp|P51991|ROA3_HUMAN Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 null 196-UNIMOD:4,199-UNIMOD:1031 0.04 19.0 1 1 0 PRT sp|P35080|PROF2_HUMAN Profilin-2 OS=Homo sapiens OX=9606 GN=PFN2 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 null 91-UNIMOD:1031 0.12 19.0 1 1 1 PRT sp|Q6P3X3|TTC27_HUMAN Tetratricopeptide repeat protein 27 OS=Homo sapiens OX=9606 GN=TTC27 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 null 778-UNIMOD:1031 0.02 19.0 1 1 1 PRT sp|Q7L2H7|EIF3M_HUMAN Eukaryotic translation initiation factor 3 subunit M OS=Homo sapiens OX=9606 GN=EIF3M PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 null 149-UNIMOD:1031 0.03 19.0 1 1 1 PRT sp|Q15019|SEPT2_HUMAN Septin-2 OS=Homo sapiens OX=9606 GN=SEPTIN2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 190-UNIMOD:1031,251-UNIMOD:1031 0.08 18.0 2 2 2 PRT sp|P60896|SEM1_HUMAN 26S proteasome complex subunit SEM1 OS=Homo sapiens OX=9606 GN=SEM1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 62-UNIMOD:1031 0.14 18.0 1 1 1 PRT sp|P23919-2|KTHY_HUMAN Isoform 2 of Thymidylate kinase OS=Homo sapiens OX=9606 GN=DTYMK null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 19-UNIMOD:1031 0.05 18.0 1 1 1 PRT sp|Q9NY61|AATF_HUMAN Protein AATF OS=Homo sapiens OX=9606 GN=AATF PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 283-UNIMOD:1031 0.01 18.0 1 1 1 PRT sp|Q9NPD8|UBE2T_HUMAN Ubiquitin-conjugating enzyme E2 T OS=Homo sapiens OX=9606 GN=UBE2T PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 192-UNIMOD:1031 0.06 18.0 1 1 1 PRT sp|Q9BWT3-2|PAPOG_HUMAN Isoform 2 of Poly(A) polymerase gamma OS=Homo sapiens OX=9606 GN=PAPOLG null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 227-UNIMOD:1031 0.01 18.0 1 1 1 PRT sp|P62314|SMD1_HUMAN Small nuclear ribonucleoprotein Sm D1 OS=Homo sapiens OX=9606 GN=SNRPD1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 44-UNIMOD:1031 0.07 18.0 1 1 1 PRT sp|Q01081-3|U2AF1_HUMAN Isoform 3 of Splicing factor U2AF 35 kDa subunit OS=Homo sapiens OX=9606 GN=U2AF1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 15-UNIMOD:1031,18-UNIMOD:4 0.15 18.0 1 1 1 PRT sp|Q5JSH3-4|WDR44_HUMAN Isoform 4 of WD repeat-containing protein 44 OS=Homo sapiens OX=9606 GN=WDR44 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 689-UNIMOD:35,690-UNIMOD:1031,409-UNIMOD:1031 0.02 18.0 2 2 2 PRT sp|O43719|HTSF1_HUMAN HIV Tat-specific factor 1 OS=Homo sapiens OX=9606 GN=HTATSF1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 169-UNIMOD:1031,303-UNIMOD:1031 0.03 18.0 2 2 2 PRT sp|P45974-2|UBP5_HUMAN Isoform Short of Ubiquitin carboxyl-terminal hydrolase 5 OS=Homo sapiens OX=9606 GN=USP5 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 720-UNIMOD:1031 0.01 18.0 1 1 1 PRT sp|O43252|PAPS1_HUMAN Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 1 OS=Homo sapiens OX=9606 GN=PAPSS1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 171-UNIMOD:1031 0.01 18.0 1 1 1 PRT sp|Q5VTR2|BRE1A_HUMAN E3 ubiquitin-protein ligase BRE1A OS=Homo sapiens OX=9606 GN=RNF20 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 510-UNIMOD:1031 0.01 18.0 1 1 1 PRT sp|Q13409-6|DC1I2_HUMAN Isoform 2F of Cytoplasmic dynein 1 intermediate chain 2 OS=Homo sapiens OX=9606 GN=DYNC1I2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 55-UNIMOD:1031 0.03 18.0 1 1 1 PRT sp|Q8WVY7|UBCP1_HUMAN Ubiquitin-like domain-containing CTD phosphatase 1 OS=Homo sapiens OX=9606 GN=UBLCP1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 117-UNIMOD:1031 0.03 18.0 1 1 1 PRT sp|Q96AT1|K1143_HUMAN Uncharacterized protein KIAA1143 OS=Homo sapiens OX=9606 GN=KIAA1143 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 36-UNIMOD:1031 0.06 18.0 1 1 1 PRT sp|Q9UGP8|SEC63_HUMAN Translocation protein SEC63 homolog OS=Homo sapiens OX=9606 GN=SEC63 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 287-UNIMOD:1031 0.01 18.0 1 1 1 PRT sp|Q5BKZ1-3|ZN326_HUMAN Isoform 3 of DBIRD complex subunit ZNF326 OS=Homo sapiens OX=9606 GN=ZNF326 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 253-UNIMOD:1031 0.05 18.0 1 1 0 PRT sp|P62495-2|ERF1_HUMAN Isoform 2 of Eukaryotic peptide chain release factor subunit 1 OS=Homo sapiens OX=9606 GN=ETF1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 145-UNIMOD:1031 0.02 18.0 1 1 1 PRT sp|O43505|B4GA1_HUMAN Beta-1,4-glucuronyltransferase 1 OS=Homo sapiens OX=9606 GN=B4GAT1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 377-UNIMOD:1031 0.02 18.0 1 1 1 PRT sp|P06213-2|INSR_HUMAN Isoform Short of Insulin receptor OS=Homo sapiens OX=9606 GN=INSR null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 1183-UNIMOD:1031 0.01 18.0 1 1 1 PRT sp|O60828-3|PQBP1_HUMAN Isoform 3 of Polyglutamine-binding protein 1 OS=Homo sapiens OX=9606 GN=PQBP1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 116-UNIMOD:1031,167-UNIMOD:1031 0.14 18.0 2 2 2 PRT sp|P05204|HMGN2_HUMAN Non-histone chromosomal protein HMG-17 OS=Homo sapiens OX=9606 GN=HMGN2 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 59-UNIMOD:1031,36-UNIMOD:1031 0.20 18.0 2 2 2 PRT sp|O15258|RER1_HUMAN Protein RER1 OS=Homo sapiens OX=9606 GN=RER1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 187-UNIMOD:1031 0.04 18.0 1 1 1 PRT sp|O94768|ST17B_HUMAN Serine/threonine-protein kinase 17B OS=Homo sapiens OX=9606 GN=STK17B PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 43-UNIMOD:1031 0.02 18.0 1 1 0 PRT sp|Q9Y696|CLIC4_HUMAN Chloride intracellular channel protein 4 OS=Homo sapiens OX=9606 GN=CLIC4 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 18.0 null 146-UNIMOD:1031,199-UNIMOD:1031 0.08 18.0 2 2 2 PRT sp|P49756|RBM25_HUMAN RNA-binding protein 25 OS=Homo sapiens OX=9606 GN=RBM25 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 18.0 null 734-UNIMOD:1031,160-UNIMOD:1031,69-UNIMOD:1031 0.03 18.0 3 3 3 PRT sp|Q9NP72-3|RAB18_HUMAN Isoform 3 of Ras-related protein Rab-18 OS=Homo sapiens OX=9606 GN=RAB18 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 122-UNIMOD:1031 0.06 18.0 1 1 0 PRT sp|P53611|PGTB2_HUMAN Geranylgeranyl transferase type-2 subunit beta OS=Homo sapiens OX=9606 GN=RABGGTB PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 0.04 18.0 1 1 1 PRT sp|Q9Y4W2-4|LAS1L_HUMAN Isoform 4 of Ribosomal biogenesis protein LAS1L OS=Homo sapiens OX=9606 GN=LAS1L null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 161-UNIMOD:1031 0.03 18.0 1 1 1 PRT sp|Q9NZM1-5|MYOF_HUMAN Isoform 5 of Myoferlin OS=Homo sapiens OX=9606 GN=MYOF null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 884-UNIMOD:1031,16-UNIMOD:1031 0.02 18.0 2 2 2 PRT sp|P51570|GALK1_HUMAN Galactokinase OS=Homo sapiens OX=9606 GN=GALK1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 18.0 null 272-UNIMOD:1031 0.06 18.0 2 2 2 PRT sp|Q9BQG2-2|NUD12_HUMAN Isoform 2 of Peroxisomal NADH pyrophosphatase NUDT12 OS=Homo sapiens OX=9606 GN=NUDT12 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 281-UNIMOD:1031 0.02 18.0 1 1 1 PRT sp|Q8TEA1|NSUN6_HUMAN tRNA (cytosine(72)-C(5))-methyltransferase NSUN6 OS=Homo sapiens OX=9606 GN=NSUN6 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 271-UNIMOD:1031 0.02 18.0 1 1 1 PRT sp|P24844-2|MYL9_HUMAN Isoform 2 of Myosin regulatory light polypeptide 9 OS=Homo sapiens OX=9606 GN=MYL9 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 110-UNIMOD:1031 0.07 18.0 1 1 1 PRT sp|Q13315|ATM_HUMAN Serine-protein kinase ATM OS=Homo sapiens OX=9606 GN=ATM PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 2585-UNIMOD:1031 0.00 18.0 2 1 0 PRT sp|O15067|PUR4_HUMAN Phosphoribosylformylglycinamidine synthase OS=Homo sapiens OX=9606 GN=PFAS PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 639-UNIMOD:1031 0.01 18.0 1 1 1 PRT sp|P51149|RAB7A_HUMAN Ras-related protein Rab-7a OS=Homo sapiens OX=9606 GN=RAB7A PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 32-UNIMOD:1031 0.04 18.0 1 1 1 PRT sp|Q9BWD1|THIC_HUMAN Acetyl-CoA acetyltransferase, cytosolic OS=Homo sapiens OX=9606 GN=ACAT2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 211-UNIMOD:1031 0.02 18.0 1 1 1 PRT sp|Q9NQG5|RPR1B_HUMAN Regulation of nuclear pre-mRNA domain-containing protein 1B OS=Homo sapiens OX=9606 GN=RPRD1B PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 73-UNIMOD:1031 0.02 18.0 1 1 1 PRT sp|Q96JM3|CHAP1_HUMAN Chromosome alignment-maintaining phosphoprotein 1 OS=Homo sapiens OX=9606 GN=CHAMP1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 782-UNIMOD:1031,787-UNIMOD:4 0.01 18.0 1 1 1 PRT sp|Q96EK5|KBP_HUMAN KIF-binding protein OS=Homo sapiens OX=9606 GN=KIFBP PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 505-UNIMOD:1031 0.01 18.0 1 1 1 PRT sp|Q9Y285-2|SYFA_HUMAN Isoform 2 of Phenylalanine--tRNA ligase alpha subunit OS=Homo sapiens OX=9606 GN=FARSA null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 312-UNIMOD:1031 0.02 18.0 1 1 1 PRT sp|Q7L2H7-2|EIF3M_HUMAN Isoform 2 of Eukaryotic translation initiation factor 3 subunit M OS=Homo sapiens OX=9606 GN=EIF3M null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 45-UNIMOD:1031,199-UNIMOD:1031 0.08 18.0 2 2 2 PRT sp|P01215|GLHA_HUMAN Glycoprotein hormones alpha chain OS=Homo sapiens OX=9606 GN=CGA PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 69-UNIMOD:1031,71-UNIMOD:35 0.07 18.0 3 1 0 PRT sp|P63151|2ABA_HUMAN Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R2A PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 396-UNIMOD:1031,398-UNIMOD:4 0.02 18.0 1 1 1 PRT sp|P35269|T2FA_HUMAN General transcription factor IIF subunit 1 OS=Homo sapiens OX=9606 GN=GTF2F1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 83-UNIMOD:1031,105-UNIMOD:1031 0.03 18.0 2 2 2 PRT sp|Q9H910-2|JUPI2_HUMAN Isoform 2 of Jupiter microtubule associated homolog 2 OS=Homo sapiens OX=9606 GN=JPT2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 94-UNIMOD:1031 0.05 18.0 1 1 1 PRT sp|Q16718-2|NDUA5_HUMAN Isoform 2 of NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 OS=Homo sapiens OX=9606 GN=NDUFA5 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 60-UNIMOD:1031 0.10 18.0 1 1 1 PRT sp|Q14376-2|GALE_HUMAN Isoform 2 of UDP-glucose 4-epimerase OS=Homo sapiens OX=9606 GN=GALE null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 185-UNIMOD:1031,188-UNIMOD:4,190-UNIMOD:4 0.03 18.0 1 1 1 PRT sp|O00541-2|PESC_HUMAN Isoform 2 of Pescadillo homolog OS=Homo sapiens OX=9606 GN=PES1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 436-UNIMOD:1031 0.02 18.0 1 1 1 PRT sp|Q9UBQ5-2|EIF3K_HUMAN Isoform 2 of Eukaryotic translation initiation factor 3 subunit K OS=Homo sapiens OX=9606 GN=EIF3K null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 16-UNIMOD:1031 0.04 18.0 1 1 1 PRT sp|Q86VP1-3|TAXB1_HUMAN Isoform 3 of Tax1-binding protein 1 OS=Homo sapiens OX=9606 GN=TAX1BP1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 277-UNIMOD:1031 0.01 18.0 1 1 0 PRT sp|Q96QC0|PP1RA_HUMAN Serine/threonine-protein phosphatase 1 regulatory subunit 10 OS=Homo sapiens OX=9606 GN=PPP1R10 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 118-UNIMOD:1031 0.01 18.0 1 1 1 PRT sp|Q16763|UBE2S_HUMAN Ubiquitin-conjugating enzyme E2 S OS=Homo sapiens OX=9606 GN=UBE2S PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 18.0 null 63-UNIMOD:1031 0.04 18.0 2 1 0 PRT sp|Q99757|THIOM_HUMAN Thioredoxin, mitochondrial OS=Homo sapiens OX=9606 GN=TXN2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 106-UNIMOD:1031 0.05 18.0 1 1 1 PRT sp|Q9Y4E1-5|WAC2C_HUMAN Isoform 5 of WASH complex subunit 2C OS=Homo sapiens OX=9606 GN=WASHC2C null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 842-UNIMOD:1031 0.01 18.0 1 1 1 PRT sp|Q99961-3|SH3G1_HUMAN Isoform 3 of Endophilin-A2 OS=Homo sapiens OX=9606 GN=SH3GL1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 125-UNIMOD:1031 0.04 18.0 1 1 1 PRT sp|Q9NQW6-2|ANLN_HUMAN Isoform 2 of Anillin OS=Homo sapiens OX=9606 GN=ANLN null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 607-UNIMOD:1031,476-UNIMOD:1031 0.02 18.0 2 2 2 PRT sp|Q14653-2|IRF3_HUMAN Isoform 2 of Interferon regulatory factor 3 OS=Homo sapiens OX=9606 GN=IRF3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 98-UNIMOD:1031 0.03 18.0 1 1 1 PRT sp|O95456-2|PSMG1_HUMAN Isoform 2 of Proteasome assembly chaperone 1 OS=Homo sapiens OX=9606 GN=PSMG1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 239-UNIMOD:1031 0.03 18.0 1 1 1 PRT sp|Q9Y2B0-2|CNPY2_HUMAN Isoform 2 of Protein canopy homolog 2 OS=Homo sapiens OX=9606 GN=CNPY2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 28-UNIMOD:4,31-UNIMOD:4,49-UNIMOD:1031 0.25 18.0 2 2 2 PRT sp|Q14789-4|GOGB1_HUMAN Isoform 4 of Golgin subfamily B member 1 OS=Homo sapiens OX=9606 GN=GOLGB1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 480-UNIMOD:1031 0.01 18.0 1 1 1 PRT sp|Q13470-2|TNK1_HUMAN Isoform 2 of Non-receptor tyrosine-protein kinase TNK1 OS=Homo sapiens OX=9606 GN=TNK1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 148-UNIMOD:1031 0.02 18.0 1 1 1 PRT sp|P31150|GDIA_HUMAN Rab GDP dissociation inhibitor alpha OS=Homo sapiens OX=9606 GN=GDI1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 202-UNIMOD:4,208-UNIMOD:267 0.04 18.0 1 1 1 PRT sp|O14929|HAT1_HUMAN Histone acetyltransferase type B catalytic subunit OS=Homo sapiens OX=9606 GN=HAT1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 0.05 18.0 1 1 1 PRT sp|P62879-2|GBB2_HUMAN Isoform 2 of Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Homo sapiens OX=9606 GN=GNB2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 104-UNIMOD:4,109-UNIMOD:259 0.05 18.0 1 1 1 PRT sp|Q92887|MRP2_HUMAN Canalicular multispecific organic anion transporter 1 OS=Homo sapiens OX=9606 GN=ABCC2 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 1340-UNIMOD:1031,1346-UNIMOD:4 0.01 18.0 1 1 1 PRT sp|P50452-2|SPB8_HUMAN Isoform 2 of Serpin B8 OS=Homo sapiens OX=9606 GN=SERPINB8 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 87-UNIMOD:267 0.04 18.0 2 1 0 PRT sp|P41214-2|EIF2D_HUMAN Isoform 2 of Eukaryotic translation initiation factor 2D OS=Homo sapiens OX=9606 GN=EIF2D null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 296-UNIMOD:1031 0.02 18.0 1 1 0 PRT sp|Q5T0F9-2|C2D1B_HUMAN Isoform 2 of Coiled-coil and C2 domain-containing protein 1B OS=Homo sapiens OX=9606 GN=CC2D1B null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 298-UNIMOD:1031 0.01 18.0 1 1 1 PRT sp|P11362-13|FGFR1_HUMAN Isoform 13 of Fibroblast growth factor receptor 1 OS=Homo sapiens OX=9606 GN=FGFR1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 352-UNIMOD:1031 0.02 18.0 1 1 1 PRT sp|O15145|ARPC3_HUMAN Actin-related protein 2/3 complex subunit 3 OS=Homo sapiens OX=9606 GN=ARPC3 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 155-UNIMOD:1031 0.07 18.0 1 1 1 PRT sp|Q969T9-2|WBP2_HUMAN Isoform 2 of WW domain-binding protein 2 OS=Homo sapiens OX=9606 GN=WBP2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 62-UNIMOD:1031 0.04 18.0 1 1 1 PRT sp|Q9Y5K5-2|UCHL5_HUMAN Isoform 2 of Ubiquitin carboxyl-terminal hydrolase isozyme L5 OS=Homo sapiens OX=9606 GN=UCHL5 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 281-UNIMOD:1031 0.03 18.0 1 1 1 PRT sp|O94826|TOM70_HUMAN Mitochondrial import receptor subunit TOM70 OS=Homo sapiens OX=9606 GN=TOMM70 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 18.0 null 188-UNIMOD:1031 0.01 18.0 1 1 1 PRT sp|P22626|ROA2_HUMAN Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 104-UNIMOD:1031 0.04 18.0 1 1 0 PRT sp|P78347|GTF2I_HUMAN General transcription factor II-I OS=Homo sapiens OX=9606 GN=GTF2I PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 435-UNIMOD:1031,353-UNIMOD:1031,879-UNIMOD:1031 0.04 18.0 3 3 2 PRT sp|P09496|CLCA_HUMAN Clathrin light chain A OS=Homo sapiens OX=9606 GN=CLTA PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 218-UNIMOD:4,223-UNIMOD:1031 0.04 18.0 1 1 0 PRT sp|O43768|ENSA_HUMAN Alpha-endosulfine OS=Homo sapiens OX=9606 GN=ENSA PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 56-UNIMOD:1031 0.09 18.0 1 1 1 PRT sp|Q96SB4|SRPK1_HUMAN SRSF protein kinase 1 OS=Homo sapiens OX=9606 GN=SRPK1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 215-UNIMOD:1031 0.03 18.0 1 1 1 PRT sp|A0AVT1|UBA6_HUMAN Ubiquitin-like modifier-activating enzyme 6 OS=Homo sapiens OX=9606 GN=UBA6 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 18.0 null 871-UNIMOD:1031 0.01 18.0 1 1 1 PRT sp|Q93009|UBP7_HUMAN Ubiquitin carboxyl-terminal hydrolase 7 OS=Homo sapiens OX=9606 GN=USP7 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 18.0 null 327-UNIMOD:1031,334-UNIMOD:4,1096-UNIMOD:1031 0.02 18.0 3 2 1 PRT sp|Q96GD4|AURKB_HUMAN Aurora kinase B OS=Homo sapiens OX=9606 GN=AURKB PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 164-UNIMOD:1031 0.03 18.0 1 1 1 PRT sp|P30566|PUR8_HUMAN Adenylosuccinate lyase OS=Homo sapiens OX=9606 GN=ADSL PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 18.0 null 147-UNIMOD:1031,399-UNIMOD:4,402-UNIMOD:1031 0.04 18.0 2 2 2 PRT sp|Q12873|CHD3_HUMAN Chromodomain-helicase-DNA-binding protein 3 OS=Homo sapiens OX=9606 GN=CHD3 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 969-UNIMOD:1031 0.00 18.0 1 1 1 PRT sp|Q8N7H5|PAF1_HUMAN RNA polymerase II-associated factor 1 homolog OS=Homo sapiens OX=9606 GN=PAF1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 68-UNIMOD:1031 0.02 18.0 1 1 1 PRT sp|Q9BTC8|MTA3_HUMAN Metastasis-associated protein MTA3 OS=Homo sapiens OX=9606 GN=MTA3 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 18.0 null 326-UNIMOD:1031 0.02 18.0 1 1 1 PRT sp|Q9UL54|TAOK2_HUMAN Serine/threonine-protein kinase TAO2 OS=Homo sapiens OX=9606 GN=TAOK2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 153-UNIMOD:1031 0.01 18.0 1 1 0 PRT sp|Q14839|CHD4_HUMAN Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 297-UNIMOD:1031 0.01 18.0 1 1 1 PRT sp|O43324|MCA3_HUMAN Eukaryotic translation elongation factor 1 epsilon-1 OS=Homo sapiens OX=9606 GN=EEF1E1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 88-UNIMOD:1031 0.11 18.0 1 1 1 PRT sp|Q8WZ42|TITIN_HUMAN Titin OS=Homo sapiens OX=9606 GN=TTN PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 18.0 null 10263-UNIMOD:1031 0.00 18.0 1 1 1 PRT sp|Q8IZL9|CDK20_HUMAN Cyclin-dependent kinase 20 OS=Homo sapiens OX=9606 GN=CDK20 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 129-UNIMOD:1031 0.05 18.0 1 1 0 PRT sp|Q9NZ63|TLS1_HUMAN Telomere length and silencing protein 1 homolog OS=Homo sapiens OX=9606 GN=C9orf78 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 18.0 null 185-UNIMOD:1031,283-UNIMOD:1031 0.08 18.0 2 2 2 PRT sp|Q5T4S7|UBR4_HUMAN E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 459-UNIMOD:1031 0.00 18.0 1 1 1 PRT sp|Q49AG3|ZBED5_HUMAN Zinc finger BED domain-containing protein 5 OS=Homo sapiens OX=9606 GN=ZBED5 PE=2 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 562-UNIMOD:1031 0.03 18.0 1 1 1 PRT sp|Q969S3|ZN622_HUMAN Zinc finger protein 622 OS=Homo sapiens OX=9606 GN=ZNF622 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 467-UNIMOD:1031 0.02 18.0 1 1 1 PRT sp|Q9P0V9|SEP10_HUMAN Septin-10 OS=Homo sapiens OX=9606 GN=SEPTIN10 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 18.0 null 377-UNIMOD:1031,382-UNIMOD:1031 0.03 18.0 2 2 2 PRT sp|Q96SU4|OSBL9_HUMAN Oxysterol-binding protein-related protein 9 OS=Homo sapiens OX=9606 GN=OSBPL9 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 688-UNIMOD:1031 0.02 18.0 1 1 1 PRT sp|Q96B36|AKTS1_HUMAN Proline-rich AKT1 substrate 1 OS=Homo sapiens OX=9606 GN=AKT1S1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 251-UNIMOD:1031 0.04 18.0 1 1 1 PRT sp|Q14241|ELOA1_HUMAN Elongin-A OS=Homo sapiens OX=9606 GN=ELOA PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 288-UNIMOD:1031 0.01 18.0 1 1 1 PRT sp|Q96DC9|OTUB2_HUMAN Ubiquitin thioesterase OTUB2 OS=Homo sapiens OX=9606 GN=OTUB2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 18.0 null 31-UNIMOD:1031 0.03 18.0 1 1 1 PRT sp|Q9NVA1|UQCC1_HUMAN Ubiquinol-cytochrome-c reductase complex assembly factor 1 OS=Homo sapiens OX=9606 GN=UQCC1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 114-UNIMOD:1031 0.03 18.0 1 1 1 PRT sp|O75718|CRTAP_HUMAN Cartilage-associated protein OS=Homo sapiens OX=9606 GN=CRTAP PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 122-UNIMOD:4,123-UNIMOD:1031 0.02 18.0 1 1 1 PRT sp|Q9NRG0|CHRC1_HUMAN Chromatin accessibility complex protein 1 OS=Homo sapiens OX=9606 GN=CHRAC1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 18.0 null 2-UNIMOD:1,8-UNIMOD:1031 0.08 18.0 1 1 1 PRT sp|Q9BY32|ITPA_HUMAN Inosine triphosphate pyrophosphatase OS=Homo sapiens OX=9606 GN=ITPA PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 18.0 null 2-UNIMOD:1,8-UNIMOD:1031 0.05 18.0 1 1 1 PRT sp|O43172|PRP4_HUMAN U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens OX=9606 GN=PRPF4 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 146-UNIMOD:1031 0.03 18.0 1 1 1 PRT sp|Q86VP1|TAXB1_HUMAN Tax1-binding protein 1 OS=Homo sapiens OX=9606 GN=TAX1BP1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 461-UNIMOD:1031 0.01 18.0 1 1 0 PRT sp|P11310|ACADM_HUMAN Medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADM PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 256-UNIMOD:1031 0.03 18.0 1 1 1 PRT sp|Q9NV96|CC50A_HUMAN Cell cycle control protein 50A OS=Homo sapiens OX=9606 GN=TMEM30A PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 18.0 null 279-UNIMOD:1031 0.04 18.0 1 1 1 PRT sp|Q9UQN3|CHM2B_HUMAN Charged multivesicular body protein 2b OS=Homo sapiens OX=9606 GN=CHMP2B PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 55-UNIMOD:1031,58-UNIMOD:4 0.04 18.0 1 1 1 PRT sp|Q9UHQ9|NB5R1_HUMAN NADH-cytochrome b5 reductase 1 OS=Homo sapiens OX=9606 GN=CYB5R1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 124-UNIMOD:1031 0.04 18.0 1 1 1 PRT sp|Q15843|NEDD8_HUMAN NEDD8 OS=Homo sapiens OX=9606 GN=NEDD8 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 6-UNIMOD:1031 0.10 18.0 1 1 1 PRT sp|Q5JTW2|CEP78_HUMAN Centrosomal protein of 78 kDa OS=Homo sapiens OX=9606 GN=CEP78 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 578-UNIMOD:1031 0.01 18.0 1 1 1 PRT sp|P20645|MPRD_HUMAN Cation-dependent mannose-6-phosphate receptor OS=Homo sapiens OX=9606 GN=M6PR PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 18.0 null 53-UNIMOD:1031,50-UNIMOD:1031 0.05 18.0 2 2 2 PRT sp|Q04760|LGUL_HUMAN Lactoylglutathione lyase OS=Homo sapiens OX=9606 GN=GLO1 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 44-UNIMOD:1031 0.05 18.0 1 1 1 PRT sp|Q96HS1|PGAM5_HUMAN Serine/threonine-protein phosphatase PGAM5, mitochondrial OS=Homo sapiens OX=9606 GN=PGAM5 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 141-UNIMOD:1031 0.04 18.0 1 1 1 PRT sp|Q06481|APLP2_HUMAN Amyloid-like protein 2 OS=Homo sapiens OX=9606 GN=APLP2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 449-UNIMOD:1031 0.02 18.0 1 1 1 PRT sp|P36507|MP2K2_HUMAN Dual specificity mitogen-activated protein kinase kinase 2 OS=Homo sapiens OX=9606 GN=MAP2K2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 88-UNIMOD:1031 0.05 18.0 1 1 1 PRT sp|Q96CS3|FAF2_HUMAN FAS-associated factor 2 OS=Homo sapiens OX=9606 GN=FAF2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 367-UNIMOD:1031 0.02 18.0 1 1 1 PRT sp|P04908|H2A1B_HUMAN Histone H2A type 1-B/E OS=Homo sapiens OX=9606 GN=H2AC4 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 96-UNIMOD:1031 0.09 18.0 1 1 1 PRT sp|P31483|TIA1_HUMAN Nucleolysin TIA-1 isoform p40 OS=Homo sapiens OX=9606 GN=TIA1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 88-UNIMOD:1031 0.03 18.0 1 1 1 PRT sp|Q9UKX7|NUP50_HUMAN Nuclear pore complex protein Nup50 OS=Homo sapiens OX=9606 GN=NUP50 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 151-UNIMOD:4,158-UNIMOD:1031,165-UNIMOD:4 0.04 18.0 1 1 1 PRT sp|O00743|PPP6_HUMAN Serine/threonine-protein phosphatase 6 catalytic subunit OS=Homo sapiens OX=9606 GN=PPP6C PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 16-UNIMOD:4,17-UNIMOD:1031 0.04 18.0 1 1 1 PRT sp|Q9NY33|DPP3_HUMAN Dipeptidyl peptidase 3 OS=Homo sapiens OX=9606 GN=DPP3 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 629-UNIMOD:1031 0.02 18.0 1 1 1 PRT sp|P55854|SUMO3_HUMAN Small ubiquitin-related modifier 3 OS=Homo sapiens OX=9606 GN=SUMO3 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 20-UNIMOD:1031 0.21 18.0 1 1 1 PRT sp|Q9NRZ9|HELLS_HUMAN Lymphoid-specific helicase OS=Homo sapiens OX=9606 GN=HELLS PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 753-UNIMOD:1031 0.02 18.0 1 1 1 PRT sp|Q641Q2|WAC2A_HUMAN WASH complex subunit 2A OS=Homo sapiens OX=9606 GN=WASHC2A PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 765-UNIMOD:1031,399-UNIMOD:1031 0.02 18.0 2 2 2 PRT sp|O00541|PESC_HUMAN Pescadillo homolog OS=Homo sapiens OX=9606 GN=PES1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 38-UNIMOD:4,41-UNIMOD:1031 0.02 18.0 1 1 1 PRT sp|Q99873|ANM1_HUMAN Protein arginine N-methyltransferase 1 OS=Homo sapiens OX=9606 GN=PRMT1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 113-UNIMOD:259,119-UNIMOD:4,128-UNIMOD:259 0.05 18.0 1 1 1 PRT sp|Q9UKM9|RALY_HUMAN RNA-binding protein Raly OS=Homo sapiens OX=9606 GN=RALY PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 216-UNIMOD:1031 0.05 18.0 1 1 1 PRT sp|Q86WW8|COA5_HUMAN Cytochrome c oxidase assembly factor 5 OS=Homo sapiens OX=9606 GN=COA5 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 57-UNIMOD:4,58-UNIMOD:1031 0.12 18.0 1 1 1 PRT sp|P46459|NSF_HUMAN Vesicle-fusing ATPase OS=Homo sapiens OX=9606 GN=NSF PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 264-UNIMOD:4,266-UNIMOD:1031 0.02 18.0 1 1 0 PRT sp|Q96RR4|KKCC2_HUMAN Calcium/calmodulin-dependent protein kinase kinase 2 OS=Homo sapiens OX=9606 GN=CAMKK2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 193-UNIMOD:35,194-UNIMOD:1031 0.03 18.0 1 1 1 PRT sp|Q07666|KHDR1_HUMAN KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Homo sapiens OX=9606 GN=KHDRBS1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 194-UNIMOD:1031 0.03 18.0 1 1 1 PRT sp|O43670|ZN207_HUMAN BUB3-interacting and GLEBS motif-containing protein ZNF207 OS=Homo sapiens OX=9606 GN=ZNF207 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 31-UNIMOD:1031 0.02 18.0 1 1 0 PRT sp|Q9H9Q2-2|CSN7B_HUMAN Isoform 2 of COP9 signalosome complex subunit 7b OS=Homo sapiens OX=9606 GN=COPS7B null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 17.0 null 92-UNIMOD:1031 0.07 17.0 1 1 1 PRT sp|O76021|RL1D1_HUMAN Ribosomal L1 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RSL1D1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 17.0 null 478-UNIMOD:1031,408-UNIMOD:1031,120-UNIMOD:1031,211-UNIMOD:4,215-UNIMOD:267 0.08 17.0 4 4 4 PRT sp|O00629|IMA3_HUMAN Importin subunit alpha-3 OS=Homo sapiens OX=9606 GN=KPNA4 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 17.0 null 47-UNIMOD:1031 0.02 17.0 1 1 1 PRT sp|P20674|COX5A_HUMAN Cytochrome c oxidase subunit 5A, mitochondrial OS=Homo sapiens OX=9606 GN=COX5A PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 17.0 null 115-UNIMOD:1031 0.05 17.0 1 1 1 PRT sp|Q9NP73-4|ALG13_HUMAN Isoform 4 of Putative bifunctional UDP-N-acetylglucosamine transferase and deubiquitinase ALG13 OS=Homo sapiens OX=9606 GN=ALG13 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 17.0 null 278-UNIMOD:259 0.01 17.0 1 1 1 PRT sp|P07948-2|LYN_HUMAN Isoform 2 of Tyrosine-protein kinase Lyn OS=Homo sapiens OX=9606 GN=LYN null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 17.0 null 383-UNIMOD:1031 0.02 17.0 1 1 1 PRT sp|Q13426-3|XRCC4_HUMAN Isoform 3 of DNA repair protein XRCC4 OS=Homo sapiens OX=9606 GN=XRCC4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 17.0 null 188-UNIMOD:1031 0.03 17.0 1 1 1 PRT sp|P23786|CPT2_HUMAN Carnitine O-palmitoyltransferase 2, mitochondrial OS=Homo sapiens OX=9606 GN=CPT2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 17.0 null 453-UNIMOD:1031 0.01 17.0 2 1 0 PRT sp|Q8N1G0|ZN687_HUMAN Zinc finger protein 687 OS=Homo sapiens OX=9606 GN=ZNF687 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 17.0 null 0.01 17.0 1 1 1 PRT sp|Q86V21-3|AACS_HUMAN Isoform 3 of Acetoacetyl-CoA synthetase OS=Homo sapiens OX=9606 GN=AACS null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 17.0 null 231-UNIMOD:1031 0.04 17.0 1 1 1 PRT sp|O00487|PSDE_HUMAN 26S proteasome non-ATPase regulatory subunit 14 OS=Homo sapiens OX=9606 GN=PSMD14 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 17.0 null 246-UNIMOD:259 0.03 17.0 1 1 1 PRT sp|O95166|GBRAP_HUMAN Gamma-aminobutyric acid receptor-associated protein OS=Homo sapiens OX=9606 GN=GABARAP PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 17.0 null 47-UNIMOD:1031 0.07 17.0 1 1 1 PRT sp|O60701-3|UGDH_HUMAN Isoform 3 of UDP-glucose 6-dehydrogenase OS=Homo sapiens OX=9606 GN=UGDH null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 17.0 null 167-UNIMOD:1031 0.02 17.0 1 1 1 PRT sp|Q9H845|ACAD9_HUMAN Complex I assembly factor ACAD9, mitochondrial OS=Homo sapiens OX=9606 GN=ACAD9 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 17.0 null 456-UNIMOD:1031 0.01 17.0 1 1 1 PRT sp|Q9BTU6|P4K2A_HUMAN Phosphatidylinositol 4-kinase type 2-alpha OS=Homo sapiens OX=9606 GN=PI4K2A PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 17.0 null 152-UNIMOD:1031 0.02 17.0 1 1 1 PRT sp|O60763|USO1_HUMAN General vesicular transport factor p115 OS=Homo sapiens OX=9606 GN=USO1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 17.0 null 924-UNIMOD:1031 0.01 17.0 1 1 1 PRT sp|Q92522|H1X_HUMAN Histone H1x OS=Homo sapiens OX=9606 GN=H1FX PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 17.0 null 146-UNIMOD:1031 0.05 17.0 1 1 1 PRT sp|Q9HCE1-2|MOV10_HUMAN Isoform 2 of Helicase MOV-10 OS=Homo sapiens OX=9606 GN=MOV10 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 17.0 null 148-UNIMOD:1031 0.01 17.0 1 1 1 PRT sp|P80303-2|NUCB2_HUMAN Isoform 2 of Nucleobindin-2 OS=Homo sapiens OX=9606 GN=NUCB2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 17.0 null 213-UNIMOD:1031 0.02 17.0 1 1 1 PRT sp|Q15811-13|ITSN1_HUMAN Isoform 13 of Intersectin-1 OS=Homo sapiens OX=9606 GN=ITSN1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 17.0 null 675-UNIMOD:1031 0.01 17.0 1 1 1 PRT sp|O43747|AP1G1_HUMAN AP-1 complex subunit gamma-1 OS=Homo sapiens OX=9606 GN=AP1G1 PE=1 SV=5 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 17.0 null 214-UNIMOD:1031 0.01 17.0 1 1 1 PRT sp|P04150-7|GCR_HUMAN Isoform GR-A beta of Glucocorticoid receptor OS=Homo sapiens OX=9606 GN=NR3C1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 17.0 null 471-UNIMOD:1031,473-UNIMOD:4,476-UNIMOD:4 0.01 17.0 1 1 1 PRT sp|Q9UL46|PSME2_HUMAN Proteasome activator complex subunit 2 OS=Homo sapiens OX=9606 GN=PSME2 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 17.0 null 15-UNIMOD:1031 0.03 17.0 1 1 1 PRT sp|P18859|ATP5J_HUMAN ATP synthase-coupling factor 6, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5PF PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 17.0 null 46-UNIMOD:1031 0.07 17.0 1 1 1 PRT sp|Q9H0S4-2|DDX47_HUMAN Isoform 2 of Probable ATP-dependent RNA helicase DDX47 OS=Homo sapiens OX=9606 GN=DDX47 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 17.0 null 259-UNIMOD:1031 0.02 17.0 1 1 1 PRT sp|Q01844-2|EWS_HUMAN Isoform EWS-B of RNA-binding protein EWS OS=Homo sapiens OX=9606 GN=EWSR1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 17.0 null 368-UNIMOD:1031 0.01 17.0 1 1 1 PRT sp|Q8N5I9|CL045_HUMAN Uncharacterized protein C12orf45 OS=Homo sapiens OX=9606 GN=C12orf45 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 17.0 null 51-UNIMOD:1031 0.06 17.0 1 1 1 PRT sp|O75131|CPNE3_HUMAN Copine-3 OS=Homo sapiens OX=9606 GN=CPNE3 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 17.0 null 533-UNIMOD:1031 0.02 17.0 1 1 1 PRT sp|O76003|GLRX3_HUMAN Glutaredoxin-3 OS=Homo sapiens OX=9606 GN=GLRX3 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 17.0 null 96-UNIMOD:1031 0.02 17.0 1 1 1 PRT sp|Q9NYL9|TMOD3_HUMAN Tropomodulin-3 OS=Homo sapiens OX=9606 GN=TMOD3 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 17.0 null 103-UNIMOD:1031 0.03 17.0 1 1 1 PRT sp|O75694-2|NU155_HUMAN Isoform 2 of Nuclear pore complex protein Nup155 OS=Homo sapiens OX=9606 GN=NUP155 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 17.0 null 831-UNIMOD:1031 0.01 17.0 1 1 1 PRT sp|P51571|SSRD_HUMAN Translocon-associated protein subunit delta OS=Homo sapiens OX=9606 GN=SSR4 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 17.0 null 105-UNIMOD:267 0.06 17.0 2 1 0 PRT sp|P51946|CCNH_HUMAN Cyclin-H OS=Homo sapiens OX=9606 GN=CCNH PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 17.0 null 276-UNIMOD:1031 0.03 17.0 1 1 1 PRT sp|Q92878-3|RAD50_HUMAN Isoform 3 of DNA repair protein RAD50 OS=Homo sapiens OX=9606 GN=RAD50 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 17.0 null 446-UNIMOD:1031 0.01 17.0 1 1 1 PRT sp|O60256-4|KPRB_HUMAN Isoform 4 of Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Homo sapiens OX=9606 GN=PRPSAP2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 17.0 null 108-UNIMOD:1031 0.03 17.0 1 1 1 PRT sp|P62891|RL39_HUMAN 60S ribosomal protein L39 OS=Homo sapiens OX=9606 GN=RPL39 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 17.0 null 5-UNIMOD:1031 0.16 17.0 1 1 1 PRT sp|Q12769|NU160_HUMAN Nuclear pore complex protein Nup160 OS=Homo sapiens OX=9606 GN=NUP160 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 17.0 null 0.01 17.0 1 1 1 PRT sp|Q9UEU5|GGE2D_HUMAN G antigen 2D OS=Homo sapiens OX=9606 GN=GAGE2D PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 17.0 null 112-UNIMOD:1031,116-UNIMOD:4 0.10 17.0 1 1 1 PRT sp|P40121-2|CAPG_HUMAN Isoform 2 of Macrophage-capping protein OS=Homo sapiens OX=9606 GN=CAPG null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 17.0 null 138-UNIMOD:1031 0.04 17.0 1 1 1 PRT sp|P08174-3|DAF_HUMAN Isoform 3 of Complement decay-accelerating factor OS=Homo sapiens OX=9606 GN=CD55 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 17.0 null 338-UNIMOD:1031 0.03 17.0 1 1 1 PRT sp|Q92896|GSLG1_HUMAN Golgi apparatus protein 1 OS=Homo sapiens OX=9606 GN=GLG1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 17.0 null 884-UNIMOD:4,885-UNIMOD:1031 0.01 17.0 1 1 1 PRT sp|P36952|SPB5_HUMAN Serpin B5 OS=Homo sapiens OX=9606 GN=SERPINB5 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 17.0 null 270-UNIMOD:1031 0.02 17.0 1 1 1 PRT sp|Q9BZE4|NOG1_HUMAN Nucleolar GTP-binding protein 1 OS=Homo sapiens OX=9606 GN=GTPBP4 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 17.0 null 332-UNIMOD:1031,336-UNIMOD:4 0.01 17.0 1 1 1 PRT sp|Q969E8|TSR2_HUMAN Pre-rRNA-processing protein TSR2 homolog OS=Homo sapiens OX=9606 GN=TSR2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 17.0 null 128-UNIMOD:1031 0.06 17.0 1 1 1 PRT sp|O60285-2|NUAK1_HUMAN Isoform 2 of NUAK family SNF1-like kinase 1 OS=Homo sapiens OX=9606 GN=NUAK1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 17.0 null 84-UNIMOD:1031 0.04 17.0 1 1 1 PRT sp|Q9H4L5-6|OSBL3_HUMAN Isoform 2b of Oxysterol-binding protein-related protein 3 OS=Homo sapiens OX=9606 GN=OSBPL3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 17.0 null 85-UNIMOD:1031 0.02 17.0 1 1 1 PRT sp|Q03701|CEBPZ_HUMAN CCAAT/enhancer-binding protein zeta OS=Homo sapiens OX=9606 GN=CEBPZ PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 17.0 null 206-UNIMOD:1031 0.01 17.0 1 1 1 PRT sp|P49959-2|MRE11_HUMAN Isoform 2 of Double-strand break repair protein MRE11 OS=Homo sapiens OX=9606 GN=MRE11 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 17.0 null 480-UNIMOD:1031 0.01 17.0 1 1 0 PRT sp|Q8NFH5-2|NUP35_HUMAN Isoform 2 of Nucleoporin NUP35 OS=Homo sapiens OX=9606 GN=NUP35 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 17.0 null 201-UNIMOD:1031 0.03 17.0 1 1 1 PRT sp|Q14103-3|HNRPD_HUMAN Isoform 3 of Heterogeneous nuclear ribonucleoprotein D0 OS=Homo sapiens OX=9606 GN=HNRNPD null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 17.0 null 252-UNIMOD:385,252-UNIMOD:4,255-UNIMOD:1031 0.03 17.0 1 1 0 PRT sp|Q99729-2|ROAA_HUMAN Isoform 2 of Heterogeneous nuclear ribonucleoprotein A/B OS=Homo sapiens OX=9606 GN=HNRNPAB null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 17.0 null 224-UNIMOD:385,224-UNIMOD:4,227-UNIMOD:1031 0.03 17.0 1 1 0 PRT sp|P34897|GLYM_HUMAN Serine hydroxymethyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=SHMT2 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 297-UNIMOD:1031 0.02 17.0 1 1 1 PRT sp|Q562R1|ACTBL_HUMAN Beta-actin-like protein 2 OS=Homo sapiens OX=9606 GN=ACTBL2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 17.0 null 3-UNIMOD:1,17-UNIMOD:35,18-UNIMOD:4,19-UNIMOD:1031,19-UNIMOD:259,2-UNIMOD:1 0.08 17.0 6 3 0 PRT sp|Q14152|EIF3A_HUMAN Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens OX=9606 GN=EIF3A PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 651-UNIMOD:1031 0.01 17.0 1 1 0 PRT sp|P55209|NP1L1_HUMAN Nucleosome assembly protein 1-like 1 OS=Homo sapiens OX=9606 GN=NAP1L1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 271-UNIMOD:1031,104-UNIMOD:267 0.05 17.0 2 2 1 PRT sp|Q8NE71|ABCF1_HUMAN ATP-binding cassette sub-family F member 1 OS=Homo sapiens OX=9606 GN=ABCF1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 17.0 null 263-UNIMOD:1031,342-UNIMOD:259,347-UNIMOD:259 0.02 17.0 2 2 1 PRT sp|P28482|MK01_HUMAN Mitogen-activated protein kinase 1 OS=Homo sapiens OX=9606 GN=MAPK1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 285-UNIMOD:1031 0.04 17.0 1 1 1 PRT sp|O95218|ZRAB2_HUMAN Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 109-UNIMOD:267 0.03 17.0 1 1 1 PRT sp|P28066|PSA5_HUMAN Proteasome subunit alpha type-5 OS=Homo sapiens OX=9606 GN=PSMA5 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 17.0 null 0.08 17.0 2 2 2 PRT sp|P05165|PCCA_HUMAN Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Homo sapiens OX=9606 GN=PCCA PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 217-UNIMOD:35,219-UNIMOD:1031 0.02 17.0 1 1 0 PRT sp|Q8IU85|KCC1D_HUMAN Calcium/calmodulin-dependent protein kinase type 1D OS=Homo sapiens OX=9606 GN=CAMK1D PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 52-UNIMOD:1031,53-UNIMOD:4 0.03 17.0 2 1 0 PRT sp|P36776|LONM_HUMAN Lon protease homolog, mitochondrial OS=Homo sapiens OX=9606 GN=LONP1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 682-UNIMOD:4,688-UNIMOD:1031,896-UNIMOD:1031 0.02 17.0 2 2 2 PRT sp|P46734|MP2K3_HUMAN Dual specificity mitogen-activated protein kinase kinase 3 OS=Homo sapiens OX=9606 GN=MAP2K3 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 17.0 null 90-UNIMOD:35,93-UNIMOD:1031 0.04 17.0 1 1 0 PRT sp|Q9NW13|RBM28_HUMAN RNA-binding protein 28 OS=Homo sapiens OX=9606 GN=RBM28 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 490-UNIMOD:4,496-UNIMOD:1031 0.02 17.0 1 1 1 PRT sp|Q13011|ECH1_HUMAN Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial OS=Homo sapiens OX=9606 GN=ECH1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 0.03 17.0 2 1 0 PRT sp|P09104|ENOG_HUMAN Gamma-enolase OS=Homo sapiens OX=9606 GN=ENO2 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 17.0 null 2-UNIMOD:1,5-UNIMOD:1031 0.02 17.0 1 1 1 PRT sp|P38935|SMBP2_HUMAN DNA-binding protein SMUBP-2 OS=Homo sapiens OX=9606 GN=IGHMBP2 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 150-UNIMOD:1031 0.01 17.0 1 1 1 PRT sp|Q16822|PCKGM_HUMAN Phosphoenolpyruvate carboxykinase [GTP], mitochondrial OS=Homo sapiens OX=9606 GN=PCK2 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 0.02 17.0 1 1 1 PRT sp|P49959|MRE11_HUMAN Double-strand break repair protein MRE11 OS=Homo sapiens OX=9606 GN=MRE11 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 480-UNIMOD:1031 0.01 17.0 1 1 0 PRT sp|Q99798|ACON_HUMAN Aconitate hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=ACO2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 723-UNIMOD:1031 0.02 17.0 1 1 1 PRT sp|Q9NP72|RAB18_HUMAN Ras-related protein Rab-18 OS=Homo sapiens OX=9606 GN=RAB18 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 186-UNIMOD:1031 0.04 17.0 1 1 0 PRT sp|Q9NXR1|NDE1_HUMAN Nuclear distribution protein nudE homolog 1 OS=Homo sapiens OX=9606 GN=NDE1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 263-UNIMOD:1031 0.03 17.0 1 1 1 PRT sp|P0DMU9|CT45A_HUMAN Cancer/testis antigen family 45 member A10 OS=Homo sapiens OX=9606 GN=CT45A10 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 0.10 17.0 1 1 1 PRT sp|Q9UEE5|ST17A_HUMAN Serine/threonine-protein kinase 17A OS=Homo sapiens OX=9606 GN=STK17A PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 71-UNIMOD:1031 0.02 17.0 1 1 0 PRT sp|Q4U2R6|RM51_HUMAN 39S ribosomal protein L51, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL51 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 112-UNIMOD:1031 0.10 17.0 1 1 1 PRT sp|Q6P1J9|CDC73_HUMAN Parafibromin OS=Homo sapiens OX=9606 GN=CDC73 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 186-UNIMOD:1031 0.02 17.0 1 1 1 PRT sp|Q9NR46|SHLB2_HUMAN Endophilin-B2 OS=Homo sapiens OX=9606 GN=SH3GLB2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 45-UNIMOD:267 0.04 17.0 1 1 1 PRT sp|P49760|CLK2_HUMAN Dual specificity protein kinase CLK2 OS=Homo sapiens OX=9606 GN=CLK2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 193-UNIMOD:1031 0.02 17.0 1 1 1 PRT sp|P36957|ODO2_HUMAN Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial OS=Homo sapiens OX=9606 GN=DLST PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 17.0 null 267-UNIMOD:1031 0.02 17.0 1 1 1 PRT sp|Q8IW45|NNRD_HUMAN ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Homo sapiens OX=9606 GN=NAXD PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 70-UNIMOD:1031 0.02 17.0 1 1 1 PRT sp|P51452|DUS3_HUMAN Dual specificity protein phosphatase 3 OS=Homo sapiens OX=9606 GN=DUSP3 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 53-UNIMOD:1031 0.09 17.0 1 1 1 PRT sp|Q09028|RBBP4_HUMAN Histone-binding protein RBBP4 OS=Homo sapiens OX=9606 GN=RBBP4 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 17.0 null 160-UNIMOD:1031,167-UNIMOD:4 0.04 17.0 1 1 1 PRT sp|Q9NRN7|ADPPT_HUMAN L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase OS=Homo sapiens OX=9606 GN=AASDHPPT PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 149-UNIMOD:1031 0.04 17.0 1 1 1 PRT sp|Q6WKZ4|RFIP1_HUMAN Rab11 family-interacting protein 1 OS=Homo sapiens OX=9606 GN=RAB11FIP1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 218-UNIMOD:1031 0.01 17.0 1 1 1 PRT sp|Q9BXF6|RFIP5_HUMAN Rab11 family-interacting protein 5 OS=Homo sapiens OX=9606 GN=RAB11FIP5 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 504-UNIMOD:1031 0.03 17.0 1 1 1 PRT sp|P43246|MSH2_HUMAN DNA mismatch repair protein Msh2 OS=Homo sapiens OX=9606 GN=MSH2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 635-UNIMOD:1031 0.01 17.0 1 1 1 PRT sp|O95239|KIF4A_HUMAN Chromosome-associated kinesin KIF4A OS=Homo sapiens OX=9606 GN=KIF4A PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 235-UNIMOD:1031 0.01 17.0 1 1 1 PRT sp|Q7RTN6|STRAA_HUMAN STE20-related kinase adapter protein alpha OS=Homo sapiens OX=9606 GN=STRADA PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 197-UNIMOD:1031 0.03 17.0 1 1 1 PRT sp|Q6P5R6|RL22L_HUMAN 60S ribosomal protein L22-like 1 OS=Homo sapiens OX=9606 GN=RPL22L1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 78-UNIMOD:259,82-UNIMOD:259 0.07 17.0 1 1 0 PRT sp|Q5RI15|COX20_HUMAN Cytochrome c oxidase assembly protein COX20, mitochondrial OS=Homo sapiens OX=9606 GN=COX20 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 98-UNIMOD:1031 0.12 17.0 1 1 1 PRT sp|Q9H3U1|UN45A_HUMAN Protein unc-45 homolog A OS=Homo sapiens OX=9606 GN=UNC45A PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 104-UNIMOD:1031 0.01 17.0 1 1 1 PRT sp|P61923|COPZ1_HUMAN Coatomer subunit zeta-1 OS=Homo sapiens OX=9606 GN=COPZ1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 46-UNIMOD:1031,51-UNIMOD:1031 0.07 17.0 2 2 1 PRT sp|P22307|NLTP_HUMAN Non-specific lipid-transfer protein OS=Homo sapiens OX=9606 GN=SCP2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 453-UNIMOD:259 0.02 17.0 1 1 1 PRT sp|P14314|GLU2B_HUMAN Glucosidase 2 subunit beta OS=Homo sapiens OX=9606 GN=PRKCSH PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 0.03 17.0 1 1 0 PRT sp|Q8WUB8|PHF10_HUMAN PHD finger protein 10 OS=Homo sapiens OX=9606 GN=PHF10 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 206-UNIMOD:1031 0.02 17.0 1 1 1 PRT sp|Q9Y592|CEP83_HUMAN Centrosomal protein of 83 kDa OS=Homo sapiens OX=9606 GN=CEP83 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 0.01 17.0 1 1 1 PRT sp|Q9UBC2|EP15R_HUMAN Epidermal growth factor receptor substrate 15-like 1 OS=Homo sapiens OX=9606 GN=EPS15L1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 44-UNIMOD:1031 0.03 17.0 2 2 2 PRT sp|Q92797|SYMPK_HUMAN Symplekin OS=Homo sapiens OX=9606 GN=SYMPK PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 1147-UNIMOD:1031 0.01 17.0 1 1 1 PRT sp|Q9UBI6|GBG12_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12 OS=Homo sapiens OX=9606 GN=GNG12 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 64-UNIMOD:259 0.24 17.0 1 1 1 PRT sp|Q86YC3|LRC33_HUMAN Transforming growth factor beta activator LRRC33 OS=Homo sapiens OX=9606 GN=NRROS PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 455-UNIMOD:4,459-UNIMOD:267,465-UNIMOD:267 0.02 17.0 1 1 1 PRT sp|Q6ZN16|M3K15_HUMAN Mitogen-activated protein kinase kinase kinase 15 OS=Homo sapiens OX=9606 GN=MAP3K15 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 681-UNIMOD:1031 0.01 17.0 1 1 0 PRT sp|Q15392|DHC24_HUMAN Delta(24)-sterol reductase OS=Homo sapiens OX=9606 GN=DHCR24 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 252-UNIMOD:4,254-UNIMOD:1031 0.03 17.0 1 1 1 PRT sp|Q12905|ILF2_HUMAN Interleukin enhancer-binding factor 2 OS=Homo sapiens OX=9606 GN=ILF2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 186-UNIMOD:1031 0.03 17.0 1 1 1 PRT sp|P10398|ARAF_HUMAN Serine/threonine-protein kinase A-Raf OS=Homo sapiens OX=9606 GN=ARAF PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 431-UNIMOD:259,444-UNIMOD:259 0.03 17.0 1 1 1 PRT sp|O60716|CTND1_HUMAN Catenin delta-1 OS=Homo sapiens OX=9606 GN=CTNND1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 429-UNIMOD:4,433-UNIMOD:1031 0.02 17.0 1 1 1 PRT sp|Q15061|WDR43_HUMAN WD repeat-containing protein 43 OS=Homo sapiens OX=9606 GN=WDR43 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 309-UNIMOD:1031,315-UNIMOD:4,324-UNIMOD:1031 0.03 17.0 1 1 1 PRT sp|Q13185|CBX3_HUMAN Chromobox protein homolog 3 OS=Homo sapiens OX=9606 GN=CBX3 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 16.0 null 113-UNIMOD:1031 0.04 16.0 1 1 1 PRT sp|Q9H3U1-2|UN45A_HUMAN Isoform 2 of Protein unc-45 homolog A OS=Homo sapiens OX=9606 GN=UNC45A null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 16.0 null 78-UNIMOD:1031 0.01 16.0 1 1 1 PRT sp|P49137-2|MAPK2_HUMAN Isoform 2 of MAP kinase-activated protein kinase 2 OS=Homo sapiens OX=9606 GN=MAPKAPK2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 16.0 null 188-UNIMOD:1031 0.04 16.0 1 1 1 PRT sp|Q6GMV3|PTRD1_HUMAN Putative peptidyl-tRNA hydrolase PTRHD1 OS=Homo sapiens OX=9606 GN=PTRHD1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 16.0 null 134-UNIMOD:1031 0.07 16.0 1 1 1 PRT sp|O75496|GEMI_HUMAN Geminin OS=Homo sapiens OX=9606 GN=GMNN PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 16.0 null 50-UNIMOD:1031 0.06 16.0 1 1 1 PRT sp|Q15257-3|PTPA_HUMAN Isoform 3 of Serine/threonine-protein phosphatase 2A activator OS=Homo sapiens OX=9606 GN=PTPA null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 16.0 null 74-UNIMOD:1031 0.03 16.0 1 1 1 PRT sp|Q9H4M9|EHD1_HUMAN EH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=EHD1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 16.0 null 375-UNIMOD:1031 0.01 16.0 1 1 1 PRT sp|Q5JNZ5|RS26L_HUMAN Putative 40S ribosomal protein S26-like 1 OS=Homo sapiens OX=9606 GN=RPS26P11 PE=5 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 16.0 null 74-UNIMOD:4,77-UNIMOD:4,82-UNIMOD:1031 0.21 16.0 2 2 2 PRT sp|Q9BSH4|TACO1_HUMAN Translational activator of cytochrome c oxidase 1 OS=Homo sapiens OX=9606 GN=TACO1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 16.0 null 73-UNIMOD:1031 0.03 16.0 1 1 1 PRT sp|P57772-2|SELB_HUMAN Isoform 2 of Selenocysteine-specific elongation factor OS=Homo sapiens OX=9606 GN=EEFSEC null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 16.0 null 448-UNIMOD:1031 0.02 16.0 1 1 0 PRT sp|Q9UL25|RAB21_HUMAN Ras-related protein Rab-21 OS=Homo sapiens OX=9606 GN=RAB21 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 16.0 null 164-UNIMOD:259 0.04 16.0 1 1 1 PRT sp|Q15031|SYLM_HUMAN Probable leucine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=LARS2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 16.0 null 68-UNIMOD:1031 0.01 16.0 1 1 1 PRT sp|P42336|PK3CA_HUMAN Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform OS=Homo sapiens OX=9606 GN=PIK3CA PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 16.0 null 772-UNIMOD:35,776-UNIMOD:1031 0.01 16.0 1 1 1 PRT sp|Q13144|EI2BE_HUMAN Translation initiation factor eIF-2B subunit epsilon OS=Homo sapiens OX=9606 GN=EIF2B5 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 16.0 null 699-UNIMOD:1031 0.01 16.0 1 1 1 PRT sp|Q96QD9-3|UIF_HUMAN Isoform 3 of UAP56-interacting factor OS=Homo sapiens OX=9606 GN=FYTTD1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 16.0 null 0.03 16.0 1 1 1 PRT sp|Q92922|SMRC1_HUMAN SWI/SNF complex subunit SMARCC1 OS=Homo sapiens OX=9606 GN=SMARCC1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 16.0 null 740-UNIMOD:1031 0.01 16.0 1 1 1 PRT sp|O75607|NPM3_HUMAN Nucleoplasmin-3 OS=Homo sapiens OX=9606 GN=NPM3 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 16.0 null 125-UNIMOD:1031 0.06 16.0 1 1 1 PRT sp|P51790-4|CLCN3_HUMAN Isoform 3 of H(+)/Cl(-) exchange transporter 3 OS=Homo sapiens OX=9606 GN=CLCN3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 16.0 null 771-UNIMOD:1031 0.01 16.0 1 1 1 PRT sp|Q9Y5L4|TIM13_HUMAN Mitochondrial import inner membrane translocase subunit Tim13 OS=Homo sapiens OX=9606 GN=TIMM13 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 16.0 null 42-UNIMOD:35,45-UNIMOD:1031,46-UNIMOD:4 0.08 16.0 1 1 1 PRT sp|Q07157-2|ZO1_HUMAN Isoform Short of Tight junction protein ZO-1 OS=Homo sapiens OX=9606 GN=TJP1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 16.0 null 567-UNIMOD:1031 0.00 16.0 1 1 1 PRT sp|A1L0T0|ILVBL_HUMAN Acetolactate synthase-like protein OS=Homo sapiens OX=9606 GN=ILVBL PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 16.0 null 429-UNIMOD:1031 0.01 16.0 1 1 1 PRT sp|Q9H0U4|RAB1B_HUMAN Ras-related protein Rab-1B OS=Homo sapiens OX=9606 GN=RAB1B PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 16.0 null 128-UNIMOD:1031 0.04 16.0 1 1 1 PRT sp|Q9Y6G9|DC1L1_HUMAN Cytoplasmic dynein 1 light intermediate chain 1 OS=Homo sapiens OX=9606 GN=DYNC1LI1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 16.0 null 63-UNIMOD:1031 0.02 16.0 1 1 1 PRT sp|Q96BW9-2|TAM41_HUMAN Isoform 2 of Phosphatidate cytidylyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=TAMM41 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 16.0 null 303-UNIMOD:1031 0.04 16.0 1 1 1 PRT sp|Q7Z739|YTHD3_HUMAN YTH domain-containing family protein 3 OS=Homo sapiens OX=9606 GN=YTHDF3 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 16.0 null 0.02 16.0 1 1 1 PRT sp|Q93100-4|KPBB_HUMAN Isoform 4 of Phosphorylase b kinase regulatory subunit beta OS=Homo sapiens OX=9606 GN=PHKB null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 16.0 null 69-UNIMOD:4,74-UNIMOD:1031 0.01 16.0 1 1 1 PRT sp|Q5SSJ5-3|HP1B3_HUMAN Isoform 3 of Heterochromatin protein 1-binding protein 3 OS=Homo sapiens OX=9606 GN=HP1BP3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 16.0 null 207-UNIMOD:4,214-UNIMOD:1031 0.02 16.0 1 1 1 PRT sp|P09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A OS=Homo sapiens OX=9606 GN=SNRPA PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 16.0 null 0.03 16.0 1 1 1 PRT sp|Q7Z7K6-2|CENPV_HUMAN Isoform 2 of Centromere protein V OS=Homo sapiens OX=9606 GN=CENPV null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 16.0 null 113-UNIMOD:1031 0.07 16.0 1 1 1 PRT sp|Q6NUP7|PP4R4_HUMAN Serine/threonine-protein phosphatase 4 regulatory subunit 4 OS=Homo sapiens OX=9606 GN=PPP4R4 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 16.0 null 46-UNIMOD:267 0.01 16.0 1 1 1 PRT sp|P14678-2|RSMB_HUMAN Isoform SM-B of Small nuclear ribonucleoprotein-associated proteins B and B' OS=Homo sapiens OX=9606 GN=SNRPB null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 16.0 null 5-UNIMOD:1031 0.03 16.0 1 1 1 PRT sp|O95486-2|SC24A_HUMAN Isoform 2 of Protein transport protein Sec24A OS=Homo sapiens OX=9606 GN=SEC24A null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 16.0 null 0.02 16.0 1 1 1 PRT sp|Q9Y2C2|UST_HUMAN Uronyl 2-sulfotransferase OS=Homo sapiens OX=9606 GN=UST PE=2 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 16.0 null 112-UNIMOD:1031,113-UNIMOD:4 0.02 16.0 1 1 1 PRT sp|Q9UK45|LSM7_HUMAN U6 snRNA-associated Sm-like protein LSm7 OS=Homo sapiens OX=9606 GN=LSM7 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 16.0 null 26-UNIMOD:1031 0.08 16.0 1 1 1 PRT sp|Q8TD43-2|TRPM4_HUMAN Isoform 2 of Transient receptor potential cation channel subfamily M member 4 OS=Homo sapiens OX=9606 GN=TRPM4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 16.0 null 941-UNIMOD:1031 0.01 16.0 1 1 1 PRT sp|Q9NQH7|XPP3_HUMAN Xaa-Pro aminopeptidase 3 OS=Homo sapiens OX=9606 GN=XPNPEP3 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 155-UNIMOD:267 0.02 16.0 1 1 1 PRT sp|Q58FF3|ENPLL_HUMAN Putative endoplasmin-like protein OS=Homo sapiens OX=9606 GN=HSP90B2P PE=5 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 62-UNIMOD:1031,62-UNIMOD:259,67-UNIMOD:259 0.02 16.0 3 1 0 PRT sp|P23588|IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens OX=9606 GN=EIF4B PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 16.0 null 386-UNIMOD:1031 0.01 16.0 1 1 1 PRT sp|Q99729|ROAA_HUMAN Heterogeneous nuclear ribonucleoprotein A/B OS=Homo sapiens OX=9606 GN=HNRNPAB PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 98-UNIMOD:4,101-UNIMOD:1031,102-UNIMOD:35 0.05 16.0 1 1 0 PRT sp|P07954|FUMH_HUMAN Fumarate hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=FH PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 100-UNIMOD:1031,292-UNIMOD:1031 0.04 16.0 2 2 0 PRT sp|P15559|NQO1_HUMAN NAD(P)H dehydrogenase [quinone] 1 OS=Homo sapiens OX=9606 GN=NQO1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 54-UNIMOD:1031 0.03 16.0 1 1 1 PRT sp|O43707|ACTN4_HUMAN Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 632-UNIMOD:1031 0.01 16.0 1 1 0 PRT sp|O43491|E41L2_HUMAN Band 4.1-like protein 2 OS=Homo sapiens OX=9606 GN=EPB41L2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 206-UNIMOD:1031 0.01 16.0 1 1 0 PRT sp|Q9H4G0|E41L1_HUMAN Band 4.1-like protein 1 OS=Homo sapiens OX=9606 GN=EPB41L1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 326-UNIMOD:1031 0.01 16.0 1 1 1 PRT sp|O43399|TPD54_HUMAN Tumor protein D54 OS=Homo sapiens OX=9606 GN=TPD52L2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 165-UNIMOD:1031 0.06 16.0 1 1 1 PRT sp|O94776|MTA2_HUMAN Metastasis-associated protein MTA2 OS=Homo sapiens OX=9606 GN=MTA2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 84-UNIMOD:1031 0.01 16.0 1 1 1 PRT sp|P43686|PRS6B_HUMAN 26S proteasome regulatory subunit 6B OS=Homo sapiens OX=9606 GN=PSMC4 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 204-UNIMOD:35,210-UNIMOD:4,212-UNIMOD:1031 0.04 16.0 1 1 0 PRT sp|O96017|CHK2_HUMAN Serine/threonine-protein kinase Chk2 OS=Homo sapiens OX=9606 GN=CHEK2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 381-UNIMOD:35,382-UNIMOD:267 0.03 16.0 1 1 0 PRT sp|P55084|ECHB_HUMAN Trifunctional enzyme subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=HADHB PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.03 16.0 1 1 0 PRT sp|P09543|CN37_HUMAN 2',3'-cyclic-nucleotide 3'-phosphodiesterase OS=Homo sapiens OX=9606 GN=CNP PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 204-UNIMOD:1031 0.04 16.0 1 1 1 PRT sp|Q9NUQ3|TXLNG_HUMAN Gamma-taxilin OS=Homo sapiens OX=9606 GN=TXLNG PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 466-UNIMOD:1031 0.02 16.0 1 1 1 PRT sp|Q9UBC1|IKBL1_HUMAN NF-kappa-B inhibitor-like protein 1 OS=Homo sapiens OX=9606 GN=NFKBIL1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 253-UNIMOD:1031 0.02 16.0 1 1 1 PRT sp|P50416|CPT1A_HUMAN Carnitine O-palmitoyltransferase 1, liver isoform OS=Homo sapiens OX=9606 GN=CPT1A PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 634-UNIMOD:1031 0.01 16.0 1 1 1 PRT sp|P35237|SPB6_HUMAN Serpin B6 OS=Homo sapiens OX=9606 GN=SERPINB6 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 89-UNIMOD:267 0.02 16.0 1 1 0 PRT sp|P62495|ERF1_HUMAN Eukaryotic peptide chain release factor subunit 1 OS=Homo sapiens OX=9606 GN=ETF1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 22-UNIMOD:1031 0.02 16.0 1 1 1 PRT sp|P41214|EIF2D_HUMAN Eukaryotic translation initiation factor 2D OS=Homo sapiens OX=9606 GN=EIF2D PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 420-UNIMOD:1031 0.02 16.0 1 1 0 PRT sp|Q99961|SH3G1_HUMAN Endophilin-A2 OS=Homo sapiens OX=9606 GN=SH3GL1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 16.0 null 2-UNIMOD:1,7-UNIMOD:1031 0.02 16.0 1 1 1 PRT sp|P19105|ML12A_HUMAN Myosin regulatory light chain 12A OS=Homo sapiens OX=9606 GN=MYL12A PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 167-UNIMOD:1031 0.04 16.0 1 1 1 PRT sp|P31751|AKT2_HUMAN RAC-beta serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=AKT2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 165-UNIMOD:1031 0.02 16.0 1 1 0 PRT sp|P06241|FYN_HUMAN Tyrosine-protein kinase Fyn OS=Homo sapiens OX=9606 GN=FYN PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 16.0 null 424-UNIMOD:28,427-UNIMOD:1031,427-UNIMOD:259,431-UNIMOD:259 0.02 16.0 2 1 0 PRT sp|Q96C36|P5CR2_HUMAN Pyrroline-5-carboxylate reductase 2 OS=Homo sapiens OX=9606 GN=PYCR2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 283-UNIMOD:1031 0.03 16.0 1 1 1 PRT sp|Q8IXH7|NELFD_HUMAN Negative elongation factor C/D OS=Homo sapiens OX=9606 GN=NELFCD PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 494-UNIMOD:1031 0.01 16.0 1 1 1 PRT sp|Q02218|ODO1_HUMAN 2-oxoglutarate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=OGDH PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 999-UNIMOD:1031 0.01 16.0 1 1 1 PRT sp|Q5BKZ1|ZN326_HUMAN DBIRD complex subunit ZNF326 OS=Homo sapiens OX=9606 GN=ZNF326 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 459-UNIMOD:1031 0.03 16.0 1 1 0 PRT sp|P05062|ALDOB_HUMAN Fructose-bisphosphate aldolase B OS=Homo sapiens OX=9606 GN=ALDOB PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 121-UNIMOD:1031 0.07 16.0 1 1 1 PRT sp|Q96MV1|TLCD4_HUMAN TLC domain-containing protein 4 OS=Homo sapiens OX=9606 GN=TLCD4 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 16.0 null 180-UNIMOD:35,188-UNIMOD:267 0.07 16.0 1 1 1 PRT sp|P17706|PTN2_HUMAN Tyrosine-protein phosphatase non-receptor type 2 OS=Homo sapiens OX=9606 GN=PTPN2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 38-UNIMOD:1031 0.02 16.0 1 1 1 PRT sp|Q96MU6-2|ZN778_HUMAN Isoform 2 of Zinc finger protein 778 OS=Homo sapiens OX=9606 GN=ZNF778 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 16.0 null 0.01 16.0 1 1 1 PRT sp|Q8N0X7|SPART_HUMAN Spartin OS=Homo sapiens OX=9606 GN=SPART PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 16.0 null 451-UNIMOD:1031 0.01 16.0 1 1 1 PRT sp|P51153|RAB13_HUMAN Ras-related protein Rab-13 OS=Homo sapiens OX=9606 GN=RAB13 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 172-UNIMOD:1031 0.05 16.0 1 1 1 PRT sp|P56545|CTBP2_HUMAN C-terminal-binding protein 2 OS=Homo sapiens OX=9606 GN=CTBP2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 16.0 null 2-UNIMOD:1,6-UNIMOD:1031 0.02 16.0 1 1 1 PRT sp|Q9UKW4|VAV3_HUMAN Guanine nucleotide exchange factor VAV3 OS=Homo sapiens OX=9606 GN=VAV3 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 800-UNIMOD:4 0.02 16.0 1 1 1 PRT sp|Q5T011|SZT2_HUMAN KICSTOR complex protein SZT2 OS=Homo sapiens OX=9606 GN=SZT2 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 16.0 null 780-UNIMOD:267 0.01 16.0 1 1 1 PRT sp|Q99996|AKAP9_HUMAN A-kinase anchor protein 9 OS=Homo sapiens OX=9606 GN=AKAP9 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 16.0 null 3658-UNIMOD:27 0.00 16.0 1 1 1 PRT sp|P13051|UNG_HUMAN Uracil-DNA glycosylase OS=Homo sapiens OX=9606 GN=UNG PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 16.0 null 78-UNIMOD:1031 0.03 16.0 1 1 1 PRT sp|Q27J81|INF2_HUMAN Inverted formin-2 OS=Homo sapiens OX=9606 GN=INF2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 941-UNIMOD:1031 0.01 16.0 1 1 1 PRT sp|P36871|PGM1_HUMAN Phosphoglucomutase-1 OS=Homo sapiens OX=9606 GN=PGM1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 16.0 null 3-UNIMOD:1031 0.01 16.0 1 1 1 PRT sp|Q9NR50|EI2BG_HUMAN Translation initiation factor eIF-2B subunit gamma OS=Homo sapiens OX=9606 GN=EIF2B3 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 16.0 null 170-UNIMOD:35 0.05 16.0 1 1 1 PRT sp|A6NK89|RASFA_HUMAN Ras association domain-containing protein 10 OS=Homo sapiens OX=9606 GN=RASSF10 PE=2 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 16.0 null 363-UNIMOD:28,369-UNIMOD:267,389-UNIMOD:267 0.06 16.0 1 1 1 PRT sp|Q5JR12|PPM1J_HUMAN Protein phosphatase 1J OS=Homo sapiens OX=9606 GN=PPM1J PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 353-UNIMOD:1031 0.02 16.0 1 1 1 PRT sp|Q9UNS2|CSN3_HUMAN COP9 signalosome complex subunit 3 OS=Homo sapiens OX=9606 GN=COPS3 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 125-UNIMOD:1031 0.03 16.0 1 1 1 PRT sp|Q8WYA6|CTBL1_HUMAN Beta-catenin-like protein 1 OS=Homo sapiens OX=9606 GN=CTNNBL1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 95-UNIMOD:1031 0.02 16.0 1 1 1 PRT sp|Q6R327|RICTR_HUMAN Rapamycin-insensitive companion of mTOR OS=Homo sapiens OX=9606 GN=RICTOR PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 826-UNIMOD:1031 0.01 16.0 1 1 1 PRT sp|P22830|HEMH_HUMAN Ferrochelatase, mitochondrial OS=Homo sapiens OX=9606 GN=FECH PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 118-UNIMOD:1031 0.02 16.0 1 1 1 PRT sp|Q9BTE6|AASD1_HUMAN Alanyl-tRNA editing protein Aarsd1 OS=Homo sapiens OX=9606 GN=AARSD1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 376-UNIMOD:1031 0.03 16.0 1 1 1 PRT sp|P12111|CO6A3_HUMAN Collagen alpha-3(VI) chain OS=Homo sapiens OX=9606 GN=COL6A3 PE=1 SV=5 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 16.0 null 2921-UNIMOD:1031 0.00 16.0 1 1 1 PRT sp|Q96HC4|PDLI5_HUMAN PDZ and LIM domain protein 5 OS=Homo sapiens OX=9606 GN=PDLIM5 PE=1 SV=5 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 296-UNIMOD:1031 0.04 16.0 1 1 1 PRT sp|Q9UNY4|TTF2_HUMAN Transcription termination factor 2 OS=Homo sapiens OX=9606 GN=TTF2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 1109-UNIMOD:1031 0.01 16.0 1 1 1 PRT sp|Q9BQ75|CMS1_HUMAN Protein CMSS1 OS=Homo sapiens OX=9606 GN=CMSS1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 16.0 null 77-UNIMOD:1031 0.03 16.0 1 1 1 PRT sp|Q96S59|RANB9_HUMAN Ran-binding protein 9 OS=Homo sapiens OX=9606 GN=RANBP9 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 412-UNIMOD:1031 0.01 16.0 1 1 1 PRT sp|Q9HAV7|GRPE1_HUMAN GrpE protein homolog 1, mitochondrial OS=Homo sapiens OX=9606 GN=GRPEL1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 94-UNIMOD:1031 0.05 16.0 1 1 1 PRT sp|P23258|TBG1_HUMAN Tubulin gamma-1 chain OS=Homo sapiens OX=9606 GN=TUBG1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 16.0 null 301-UNIMOD:1031,304-UNIMOD:35 0.03 16.0 1 1 1 PRT sp|B3EWF7|EP2A2_HUMAN Laforin, isoform 9 OS=Homo sapiens OX=9606 GN=EPM2A PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 63-UNIMOD:267 0.05 16.0 1 1 1 PRT sp|P17661|DESM_HUMAN Desmin OS=Homo sapiens OX=9606 GN=DES PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.02 16.0 1 1 1 PRT sp|Q13243|SRSF5_HUMAN Serine/arginine-rich splicing factor 5 OS=Homo sapiens OX=9606 GN=SRSF5 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 181-UNIMOD:1031 0.03 16.0 1 1 1 PRT sp|O60812|HNRC1_HUMAN Heterogeneous nuclear ribonucleoprotein C-like 1 OS=Homo sapiens OX=9606 GN=HNRNPCL1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 157-UNIMOD:1031 0.03 16.0 1 1 1 PRT sp|P53609|PGTB1_HUMAN Geranylgeranyl transferase type-1 subunit beta OS=Homo sapiens OX=9606 GN=PGGT1B PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 195-UNIMOD:1031,201-UNIMOD:267 0.02 16.0 1 1 1 PRT sp|Q5I0G3|MDH1B_HUMAN Putative malate dehydrogenase 1B OS=Homo sapiens OX=9606 GN=MDH1B PE=2 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 36-UNIMOD:1031,40-UNIMOD:267 0.02 16.0 1 1 1 PRT sp|O00178|GTPB1_HUMAN GTP-binding protein 1 OS=Homo sapiens OX=9606 GN=GTPBP1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 565-UNIMOD:1031 0.01 16.0 1 1 1 PRT sp|P60604|UB2G2_HUMAN Ubiquitin-conjugating enzyme E2 G2 OS=Homo sapiens OX=9606 GN=UBE2G2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 156-UNIMOD:1031 0.05 16.0 1 1 0 PRT sp|P14854|CX6B1_HUMAN Cytochrome c oxidase subunit 6B1 OS=Homo sapiens OX=9606 GN=COX6B1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 40-UNIMOD:4,42-UNIMOD:1031 0.10 16.0 1 1 1 PRT sp|Q0VDD8|DYH14_HUMAN Dynein heavy chain 14, axonemal OS=Homo sapiens OX=9606 GN=DNAH14 PE=2 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.00 16.0 1 1 1 PRT sp|Q5T5P2|SKT_HUMAN Sickle tail protein homolog OS=Homo sapiens OX=9606 GN=KIAA1217 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 1674-UNIMOD:259 0.01 16.0 1 1 1 PRT sp|Q13541|4EBP1_HUMAN Eukaryotic translation initiation factor 4E-binding protein 1 OS=Homo sapiens OX=9606 GN=EIF4EBP1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 57-UNIMOD:1031,62-UNIMOD:4 0.07 16.0 1 1 1 PRT sp|Q49AR2|CE022_HUMAN UPF0489 protein C5orf22 OS=Homo sapiens OX=9606 GN=C5orf22 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 158-UNIMOD:35,160-UNIMOD:259 0.02 16.0 1 1 1 PRT sp|Q8NBS9|TXND5_HUMAN Thioredoxin domain-containing protein 5 OS=Homo sapiens OX=9606 GN=TXNDC5 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 365-UNIMOD:259 0.03 16.0 1 1 1 PRT sp|Q8TEK3|DOT1L_HUMAN Histone-lysine N-methyltransferase, H3 lysine-79 specific OS=Homo sapiens OX=9606 GN=DOT1L PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 330-UNIMOD:259 0.01 16.0 1 1 1 PRT sp|Q92802-2|N42L2_HUMAN Isoform 2 of NEDD4-binding protein 2-like 2 OS=Homo sapiens OX=9606 GN=N4BP2L2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 637-UNIMOD:259 0.02 16.0 1 1 1 PRT sp|Q9H8V3|ECT2_HUMAN Protein ECT2 OS=Homo sapiens OX=9606 GN=ECT2 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 384-UNIMOD:1031 0.01 16.0 1 1 1 PRT sp|Q9H074|PAIP1_HUMAN Polyadenylate-binding protein-interacting protein 1 OS=Homo sapiens OX=9606 GN=PAIP1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 358-UNIMOD:4 0.03 16.0 1 1 1 PRT sp|P00813|ADA_HUMAN Adenosine deaminase OS=Homo sapiens OX=9606 GN=ADA PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 225-UNIMOD:259 0.04 16.0 1 1 1 PRT sp|O43837|IDH3B_HUMAN Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=IDH3B PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 199-UNIMOD:1031 0.03 16.0 1 1 1 PRT sp|Q96A57|TM230_HUMAN Transmembrane protein 230 OS=Homo sapiens OX=9606 GN=TMEM230 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 16-UNIMOD:1031 0.12 16.0 1 1 1 PRT sp|O60306|AQR_HUMAN RNA helicase aquarius OS=Homo sapiens OX=9606 GN=AQR PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 1111-UNIMOD:1031 0.01 16.0 1 1 1 PRT sp|Q14677|EPN4_HUMAN Clathrin interactor 1 OS=Homo sapiens OX=9606 GN=CLINT1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 13-UNIMOD:1031 0.03 16.0 1 1 1 PRT sp|P43490|NAMPT_HUMAN Nicotinamide phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=NAMPT PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 107-UNIMOD:1031 0.04 16.0 1 1 1 PRT sp|P51532|SMCA4_HUMAN Transcription activator BRG1 OS=Homo sapiens OX=9606 GN=SMARCA4 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 1375-UNIMOD:1031 0.01 16.0 1 1 1 PRT sp|P63208|SKP1_HUMAN S-phase kinase-associated protein 1 OS=Homo sapiens OX=9606 GN=SKP1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 94-UNIMOD:259 0.09 16.0 1 1 0 PRT sp|P19256|LFA3_HUMAN Lymphocyte function-associated antigen 3 OS=Homo sapiens OX=9606 GN=CD58 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 62-UNIMOD:1031 0.05 16.0 1 1 1 PRT sp|O00159|MYO1C_HUMAN Unconventional myosin-Ic OS=Homo sapiens OX=9606 GN=MYO1C PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 927-UNIMOD:1031 0.02 16.0 1 1 1 PRT sp|P43307|SSRA_HUMAN Translocon-associated protein subunit alpha OS=Homo sapiens OX=9606 GN=SSR1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 125-UNIMOD:267 0.06 16.0 1 1 1 PRT sp|Q12792|TWF1_HUMAN Twinfilin-1 OS=Homo sapiens OX=9606 GN=TWF1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 135-UNIMOD:1031 0.03 16.0 1 1 1 PRT sp|Q9UNF0|PACN2_HUMAN Protein kinase C and casein kinase substrate in neurons protein 2 OS=Homo sapiens OX=9606 GN=PACSIN2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 53-UNIMOD:1031 0.03 16.0 1 1 0 PRT sp|Q13554|KCC2B_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Homo sapiens OX=9606 GN=CAMK2B PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 35-UNIMOD:4,43-UNIMOD:1031 0.02 16.0 1 1 1 PRT sp|Q16719|KYNU_HUMAN Kynureninase OS=Homo sapiens OX=9606 GN=KYNU PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 319-UNIMOD:1031,327-UNIMOD:4 0.03 16.0 1 1 1 PRT sp|P14136|GFAP_HUMAN Glial fibrillary acidic protein OS=Homo sapiens OX=9606 GN=GFAP PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 415-UNIMOD:35,416-UNIMOD:267,422-UNIMOD:259 0.03 16.0 1 1 1 PRT sp|Q9H0K1|SIK2_HUMAN Serine/threonine-protein kinase SIK2 OS=Homo sapiens OX=9606 GN=SIK2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 144-UNIMOD:1031,154-UNIMOD:35 0.02 16.0 1 1 1 PRT sp|O75376|NCOR1_HUMAN Nuclear receptor corepressor 1 OS=Homo sapiens OX=9606 GN=NCOR1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 457-UNIMOD:1031 0.01 16.0 1 1 1 PRT sp|Q9Y2Q3|GSTK1_HUMAN Glutathione S-transferase kappa 1 OS=Homo sapiens OX=9606 GN=GSTK1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 71-UNIMOD:1031,66-UNIMOD:35 0.06 16.0 2 1 0 PSH sequence PSM_ID accession unique database database_version search_engine search_engine_score[1] modifications spectra_ref retention_time charge exp_mass_to_charge calc_mass_to_charge pre post start end PSM KEAESCDCLQGFQLTHSLGGGTGSGMGTLLISK 1 sp|P04350|TBB4A_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 78 1-UNIMOD:1031,6-UNIMOD:4,8-UNIMOD:4 ms_run[1]:scan=28980 83.543282 3 3634.748875 3634.742954 R I 122 155 PSM WGDAGAEYVVESTGVFTTMEKAGAHLQGGAK 2 sp|P04406|G3P_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 74 21-UNIMOD:1031 ms_run[2]:scan=33156 95.571 3 3362.6241 3362.6241 K R 87 118 PSM KLGVNNISGIEEVNMFTNQGTVIHFNNPK 3 sp|P20290|BTF3_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 72 1-UNIMOD:1031 ms_run[2]:scan=31284 90.038 3 3409.7453 3409.7453 K V 94 123 PSM AEGSDVANAVLDGADCIMLSGETAKGDYPLEAVR 4 sp|P14618|KPYM_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 71 16-UNIMOD:4,25-UNIMOD:1031 ms_run[2]:scan=33419 96.256 3 3689.7553 3689.7553 R M 343 377 PSM KLGVNNISGIEEVNMFTNQGTVIHFNNPK 5 sp|P20290|BTF3_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 70 1-UNIMOD:1031,15-UNIMOD:35 ms_run[2]:scan=29494 84.977 3 3425.7402 3425.7402 K V 94 123 PSM VIHDNFGIVEGLMTTVHAITATQKTVDGPSGK 6 sp|P04406|G3P_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 70 13-UNIMOD:35,24-UNIMOD:1031 ms_run[1]:scan=32765 94.422889 3 3547.839907 3547.834470 K L 163 195 PSM VVVCDNGTGFVKCGYAGSNFPEHIFPALVGR 7 sp|P61160|ARP2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 69 4-UNIMOD:4,12-UNIMOD:1031,13-UNIMOD:4 ms_run[2]:scan=32457 93.495 3 3562.749 3562.7490 K P 8 39 PSM VIHDNFGIVEGLMTTVHAITATQKTVDGPSGK 8 sp|P04406|G3P_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 69 13-UNIMOD:35,24-UNIMOD:1031 ms_run[1]:scan=32754 94.392281 4 3547.843068 3547.834470 K L 163 195 PSM LPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIK 9 sp|P61158|ARP3_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 68 4-UNIMOD:4,8-UNIMOD:4,14-UNIMOD:1031,30-UNIMOD:4 ms_run[2]:scan=33310 95.976 3 3908.9515 3908.9515 R E 5 39 PSM STVHEILCKLSLEGDHSTPPSAYGSVK 10 sp|P07355|ANXA2_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 68 1-UNIMOD:1,8-UNIMOD:4,9-UNIMOD:1031 ms_run[1]:scan=33144 95.537467 3 3149.5912 3149.5702 M A 2 29 PSM KEGICALGGTSELSSEGTQHSYSEEEK 11 sp|P13797-2|PLST_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 67 1-UNIMOD:1031,5-UNIMOD:4 ms_run[2]:scan=19715 58.373 3 3108.4194 3108.4194 R Y 78 105 PSM VVVCDNGTGFVKCGYAGSNFPEHIFPALVGR 12 sp|P61160|ARP2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 67 4-UNIMOD:4,12-UNIMOD:1031,13-UNIMOD:4 ms_run[2]:scan=32565 93.837 3 3562.749 3562.7490 K P 8 39 PSM VVVCDNGTGFVKCGYAGSNFPEHIFPALVGR 13 sp|P61160|ARP2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 66 4-UNIMOD:4,12-UNIMOD:1031,13-UNIMOD:4 ms_run[2]:scan=32574 93.868 4 3562.749 3562.7490 K P 8 39 PSM HQKIIEEAPATIATPAVFEHMEQCAVK 14 sp|Q13085|ACACA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 65 3-UNIMOD:1031,24-UNIMOD:4 ms_run[2]:scan=27792 80.269 3 3243.642 3243.6420 R L 384 411 PSM KAAEAHVDAHYYEQNEQPTGTCAACITGDNR 15 sp|P55263-3|ADK_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 65 1-UNIMOD:1031,22-UNIMOD:4,25-UNIMOD:4 ms_run[2]:scan=15642 47.636 4 3672.6322 3672.6322 R S 119 150 PSM LEHAAKQAAASATQTIAAAQHAASTPK 16 sp|Q9Y490|TLN1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 64 6-UNIMOD:1031 ms_run[2]:scan=21081 62 3 2839.4941 2839.4941 R A 917 944 PSM VIHDNFGIVEGLMTTVHAITATQKTVDGPSGK 17 sp|P04406|G3P_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 64 13-UNIMOD:35,24-UNIMOD:1031 ms_run[2]:scan=32638 94.056 3 3547.8345 3547.8345 K L 163 195 PSM VVVCDNGTGFVKCGYAGSNFPEHIFPALVGR 18 sp|P61160|ARP2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 64 4-UNIMOD:4,12-UNIMOD:1031,13-UNIMOD:4 ms_run[2]:scan=32468 93.527 4 3562.749 3562.7490 K P 8 39 PSM VIHDNFGIVEGLMTTVHAITATQKTVDGPSGK 19 sp|P04406|G3P_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 63 13-UNIMOD:35,24-UNIMOD:1031 ms_run[2]:scan=32624 94.018 4 3547.8345 3547.8345 K L 163 195 PSM SKPHSEAGTAFIQTQQLHAAMADTFLEHMCR 20 sp|P14618|KPYM_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 62 1-UNIMOD:1,2-UNIMOD:1031,30-UNIMOD:4 ms_run[1]:scan=30050 86.527679 4 3750.7668 3750.7700 M L 2 33 PSM MEEEIAALVIDNGSGMCKAGFAGDDAPR 21 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 62 1-UNIMOD:1,17-UNIMOD:4,18-UNIMOD:1031 ms_run[1]:scan=33770 97.177153 3 3163.4512 3161.4462 - A 1 29 PSM EALGIPAAASFKHVSPAGAAVGIPLSEDEAK 22 sp|P31939|PUR9_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 62 12-UNIMOD:1031 ms_run[1]:scan=30749 88.517803 3 3198.682474 3198.692480 K V 255 286 PSM ENIQKSLAGSSGPGASSGTSGDHGELVVR 23 sp|P29692|EF1D_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 61 5-UNIMOD:1031 ms_run[2]:scan=19067 56.669 3 2992.485 2992.4850 R I 55 84 PSM TLVIKEVSSEDIADMHSNLSNYHQYIVK 24 sp|Q8TBX8|PI42C_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 61 5-UNIMOD:1031 ms_run[2]:scan=28760 82.928 4 3428.7286 3428.7286 R C 148 176 PSM KLNCQVIGASVDSHFCHLAWVNTPK 25 sp|Q06830|PRDX1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 60 1-UNIMOD:1031,4-UNIMOD:4,16-UNIMOD:4 ms_run[2]:scan=26087 75.484 3 3076.5375 3076.5375 K K 68 93 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 26 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 60 1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=33243 95.802911 3 2991.3552 2990.3382 M A 2 29 PSM EGNVPNIIIAGPPGTGKTTSILCLAR 27 sp|P35250|RFC2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 59 17-UNIMOD:1031,23-UNIMOD:4 ms_run[2]:scan=33264 95.855 2 2844.5531 2844.5531 R A 66 92 PSM KIEPELDGSAQVTSHDASTNGLINFIK 28 sp|P06744|G6PI_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 59 1-UNIMOD:1031 ms_run[2]:scan=28440 82.05 3 3079.5826 3079.5826 K Q 524 551 PSM SSKGGPGSAVSPYPTFNPSSDVAALHK 29 sp|P04083|ANXA1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 59 3-UNIMOD:1031 ms_run[2]:scan=23296 67.903 3 2853.4297 2853.4297 K A 27 54 PSM TLKLTTPTYGDLNHLVSATMSGVTTCLR 30 sp|P07437|TBB5_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 59 3-UNIMOD:1031,20-UNIMOD:35,26-UNIMOD:4 ms_run[2]:scan=31093 89.496 3 3261.6737 3261.6737 R F 214 242 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 31 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 59 1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=32211 92.671405 2 2990.3272 2990.3382 M A 2 29 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 32 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 59 1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=33108 95.434498 3 2990.3382 2990.3381 M A 2 29 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 33 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 59 1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=32512 93.675645 3 2990.3359 2990.3381 M A 2 29 PSM MEEEIAALVIDNGSGMCKAGFAGDDAPR 34 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 59 1-UNIMOD:1,16-UNIMOD:35,17-UNIMOD:4,18-UNIMOD:1031 ms_run[1]:scan=33662 96.890844 3 3178.4462 3177.4412 - A 1 29 PSM EEEIAALVIDNGSGMCKAGFAGDDAPR 35 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 59 1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=33440 96.311655 2 3046.3907 3046.4007 M A 2 29 PSM CIGEGQFGDVHQGIYMSPENPALAVAIKTCK 36 sp|Q05397-7|FAK1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 58 1-UNIMOD:4,28-UNIMOD:1031,30-UNIMOD:4 ms_run[2]:scan=30064 86.565 3 3585.7418 3585.7418 R N 427 458 PSM EGNVPNIIIAGPPGTGKTTSILCLAR 37 sp|P35250|RFC2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 58 17-UNIMOD:1031,23-UNIMOD:4 ms_run[2]:scan=33259 95.843 3 2844.5531 2844.5531 R A 66 92 PSM GMLFLHNGAICSHGNLKSSNCVVDGR 38 sp|P16066|ANPRA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 58 2-UNIMOD:35,11-UNIMOD:4,17-UNIMOD:1031,21-UNIMOD:4 ms_run[2]:scan=19693 58.315 3 3054.4586 3054.4586 K F 646 672 PSM HQKIIEEAPATIATPAVFEHMEQCAVK 39 sp|Q13085|ACACA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 58 3-UNIMOD:1031,21-UNIMOD:35,24-UNIMOD:4 ms_run[2]:scan=24342 70.703 3 3259.637 3259.6370 R L 384 411 PSM INEVQTDVGVDTKHQTLQGVAFPISR 40 sp|Q12792-4|TWF1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 58 13-UNIMOD:1031 ms_run[2]:scan=26597 76.86 3 3047.604 3047.6040 K E 61 87 PSM ISIPVDISDSDMMLNIINSSITTKAISR 41 sp|P49368|TCPG_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 58 24-UNIMOD:1031 ms_run[2]:scan=33713 97.028 3 3229.6938 3229.6938 K W 140 168 PSM KELEQVCNPIISGLYQGAGGPGPGGFGAQGPK 42 sp|P0DMV9|HS71B_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 58 1-UNIMOD:1031,7-UNIMOD:4 ms_run[2]:scan=31197 89.791 3 3378.7031 3378.7031 R G 597 629 PSM KFACNGTVIEHPEYGEVIQLQGDQR 43 sp|P41567|EIF1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 58 1-UNIMOD:1031,4-UNIMOD:4 ms_run[2]:scan=23704 68.987 3 3083.5135 3083.5135 K K 66 91 PSM NIGAKLVQDVANNTNEEAGDGTTTATVLAR 44 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 58 5-UNIMOD:1031 ms_run[2]:scan=28658 82.647 3 3238.643 3238.6430 K S 92 122 PSM NMSVIAHVDHGKSTLTDSLVCK 45 sp|P13639|EF2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 58 12-UNIMOD:1031,21-UNIMOD:4 ms_run[2]:scan=23182 67.599 3 2607.3149 2607.3149 R A 21 43 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 46 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 58 1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=32405 93.322162 3 2990.3359 2990.3381 M A 2 29 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 47 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 58 1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=32198 92.63319 3 2990.3359 2990.3381 M A 2 29 PSM AFLADPSAFVAAAPVAAATTAAPAAAAAPAKVEAK 48 sp|P05388-2|RLA0_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 57 31-UNIMOD:1031 ms_run[2]:scan=33245 95.808 3 3374.8238 3374.8238 K E 205 240 PSM HQKIIEEAPATIATPAVFEHMEQCAVK 49 sp|Q13085|ACACA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 57 3-UNIMOD:1031,21-UNIMOD:35,24-UNIMOD:4 ms_run[2]:scan=24212 70.349 3 3259.637 3259.6370 R L 384 411 PSM QLSQMLKSSAPAQEEEEDPLAYYENHTSQIEIVR 50 sp|Q14573|ITPR3_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 57 7-UNIMOD:1031 ms_run[2]:scan=30105 86.685 3 4128.995 4128.9950 K Q 2095 2129 PSM VMIGENVDEKHLPTLDHPIIPADYVAIK 51 sp|P31327|CPSM_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 57 2-UNIMOD:35,10-UNIMOD:1031 ms_run[2]:scan=29868 86.018 4 3338.7584 3338.7585 K A 1282 1310 PSM VVVCDNGTGFVKCGYAGSNFPEHIFPALVGR 52 sp|P61160|ARP2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 57 4-UNIMOD:4,12-UNIMOD:1031,13-UNIMOD:4 ms_run[2]:scan=33101 95.414 3 3562.749 3562.7490 K P 8 39 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 53 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 57 1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=33282 95.903148 2 2991.3542 2990.3382 M A 2 29 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 54 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 57 1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=32305 93.010203 2 2990.3272 2990.3382 M A 2 29 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 55 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 57 1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=33035 95.214131 2 2990.3325 2990.3381 M A 2 29 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 56 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 57 1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=32413 93.347953 2 2991.3352 2990.3382 M A 2 29 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 57 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 57 1-UNIMOD:1,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=33338 96.047461 3 2974.3444 2974.3432 M A 2 29 PSM VVVCDNGTGFVKCGYAGSNFPEHIFPALVGR 58 sp|P61160|ARP2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 57 4-UNIMOD:4,12-UNIMOD:1031,13-UNIMOD:4 ms_run[1]:scan=32985 95.067535 3 3563.730523 3562.748966 K P 8 39 PSM GADINAPDKHHITPLLSAVYEGHVSCVK 59 sp|P58546|MTPN_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 56 9-UNIMOD:1031,26-UNIMOD:4 ms_run[2]:scan=25262 73.252 3 3223.6448 3223.6448 K L 58 86 PSM ISIPVDISDSDMMLNIINSSITTKAISR 60 sp|P49368|TCPG_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 56 12-UNIMOD:35,24-UNIMOD:1031 ms_run[2]:scan=33583 96.681 3 3245.6887 3245.6887 K W 140 168 PSM KAAEAHVDAHYYEQNEQPTGTCAACITGDNR 61 sp|P55263-3|ADK_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 56 1-UNIMOD:1031,22-UNIMOD:4,25-UNIMOD:4 ms_run[2]:scan=15653 47.665 3 3672.6322 3672.6322 R S 119 150 PSM LASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEKK 62 sp|P05387|RLA2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 56 33-UNIMOD:1031 ms_run[2]:scan=21217 62.377 3 3097.6408 3097.6408 K D 62 96 PSM VVCDENGSKGYGFVHFETQEAAER 63 sp|P11940|PABP1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 56 3-UNIMOD:4,9-UNIMOD:1031 ms_run[2]:scan=22851 66.716 3 2924.3399 2924.3399 K A 130 154 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 64 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 56 1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=32294 92.977332 3 2990.3359 2990.3381 M A 2 29 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 65 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 56 1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=32875 94.743971 3 2990.3359 2990.3381 M A 2 29 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 66 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 56 1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=32622 94.012381 3 2990.3359 2990.3381 M A 2 29 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 67 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 56 1-UNIMOD:1,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=33397 96.198973 4 2974.3407 2974.3432 M A 2 29 PSM VVVCDNGTGFVKCGYAGSNFPEHIFPALVGR 68 sp|P61160|ARP2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 56 4-UNIMOD:4,12-UNIMOD:1031,13-UNIMOD:4 ms_run[1]:scan=32692 94.216772 3 3563.744145 3562.748966 K P 8 39 PSM VIHDNFGIVEGLMTTVHAITATQKTVDGPSGK 69 sp|P04406|G3P_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 56 13-UNIMOD:35,24-UNIMOD:1031 ms_run[1]:scan=33140 95.52739 4 3546.852767 3547.834470 K L 163 195 PSM AYHEQLSVAEITNACFEPANQMVKCDPR 70 sp|P68363|TBA1B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 55 15-UNIMOD:4,22-UNIMOD:35,24-UNIMOD:1031,25-UNIMOD:4 ms_run[2]:scan=24539 71.231 3 3489.6115 3489.6115 K H 281 309 PSM AYHEQLSVAEITNACFEPANQMVKCDPR 71 sp|P68363|TBA1B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 55 15-UNIMOD:4,24-UNIMOD:1031,25-UNIMOD:4 ms_run[2]:scan=26691 77.154 3 3473.6166 3473.6166 K H 281 309 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 72 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 55 16-UNIMOD:4,17-UNIMOD:1031 ms_run[2]:scan=31030 89.319 3 2932.3331 2932.3331 M A 2 29 PSM DVDDGLQAAEEVGYPVMIKASEGGGGK 73 sp|Q13085|ACACA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 55 19-UNIMOD:1031 ms_run[2]:scan=32753 94.39 3 2887.391 2887.3910 K G 293 320 PSM DYLSHQVPISFHKHWNIDPVK 74 sp|Q6Y288|B3GLT_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 55 13-UNIMOD:1031 ms_run[2]:scan=25901 74.986 4 2755.4235 2755.4235 K V 452 473 PSM LIGDAAKNQVAMNPTNTVFDAK 75 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 55 7-UNIMOD:1031 ms_run[2]:scan=26599 76.865 2 2513.2948 2513.2948 R R 50 72 PSM LMELHGEGSSSGKATGDETGAK 76 sp|P61247|RS3A_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 55 13-UNIMOD:1031 ms_run[2]:scan=14007 43.362 3 2357.1169 2357.1169 K V 228 250 PSM VHHEPQLSDKVHNDAQSFDYDHDAFLGAEEAK 77 sp|O43852|CALU_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 55 10-UNIMOD:1031 ms_run[2]:scan=22316 65.3 4 3844.7717 3844.7717 R T 28 60 PSM VVCDENGSKGYAFVHFETQEAADK 78 sp|Q13310-2|PABP4_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 55 3-UNIMOD:4,9-UNIMOD:1031 ms_run[2]:scan=23753 69.121 3 2896.3338 2896.3338 K A 130 154 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 79 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 55 1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=32752 94.387635 3 2990.3359 2990.3381 M A 2 29 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 80 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 55 1-UNIMOD:1,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=33557 96.613607 3 2974.3456 2974.3432 M A 2 29 PSM DVDDGLQAAEEVGYPVMIKASEGGGGK 81 sp|Q13085|ACACA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 54 19-UNIMOD:1031 ms_run[2]:scan=32626 94.023 3 2887.391 2887.3910 K G 293 320 PSM DVDDGLQAAEEVGYPVMIKASEGGGGK 82 sp|Q13085|ACACA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 54 19-UNIMOD:1031 ms_run[2]:scan=32877 94.749 3 2887.391 2887.3910 K G 293 320 PSM EAGGGGVGGPGAKSAAQAAAQTNSNAAGK 83 sp|Q8NC51-3|PAIRB_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 54 13-UNIMOD:1031 ms_run[2]:scan=14881 45.647 3 2650.3059 2650.3059 K Q 40 69 PSM GAEAANVTGPGGVPVQGSKYAADR 84 sp|P67809|YBOX1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 54 19-UNIMOD:1031 ms_run[2]:scan=19266 57.192 3 2467.2456 2467.2456 K N 119 143 PSM GPPHSKSGGGTGEEPGSQGLNGEAGPEDSTR 85 sp|O15355|PPM1G_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 54 6-UNIMOD:1031 ms_run[2]:scan=11833 37.575 3 3144.4344 3144.4344 K E 167 198 PSM HTGPGILSMANAGPNTNGSQFFICTAK 86 sp|P62937|PPIA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 54 9-UNIMOD:35,24-UNIMOD:4,27-UNIMOD:259 ms_run[2]:scan=21688 63.629 3 2814.3309 2814.3309 K T 92 119 PSM KVTSVVFHPSQDLVFSASPDATIR 87 sp|Q9UMS4|PRP19_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 54 1-UNIMOD:1031 ms_run[2]:scan=28081 81.065 3 2796.481 2796.4810 K I 266 290 PSM LGIQTDDKGHIIVDEFQNTNVK 88 sp|P00390-2|GSHR_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 54 8-UNIMOD:1031 ms_run[2]:scan=27153 78.458 3 2679.3868 2679.3868 K G 304 326 PSM LVGDAAKSQAALNPHNTVFDAK 89 sp|P17066|HSP76_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 54 7-UNIMOD:1031 ms_run[2]:scan=21705 63.672 3 2462.2918 2462.2918 R R 52 74 PSM TSSAQVEGGVHSLHSYEKR 90 sp|P12268|IMDH2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 54 18-UNIMOD:1031 ms_run[2]:scan=13311 41.535 2 2267.1295 2267.1295 R L 494 513 PSM YASICQQNGIVPIVEPEILPDGDHDLKR 91 sp|P04075|ALDOA_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 54 5-UNIMOD:4,27-UNIMOD:1031 ms_run[2]:scan=30277 87.155 3 3371.7184 3371.7184 R C 174 202 PSM YTIHSQLEHLQSKYIGTGHADTTK 92 sp|Q9BWJ5|SF3B5_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 54 13-UNIMOD:1031 ms_run[2]:scan=20606 60.724 4 2923.4828 2923.4828 R W 5 29 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 93 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 54 1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=32992 95.088035 3 2990.3382 2990.3381 M A 2 29 PSM DVDDGLQAAEEVGYPVMIKASEGGGGK 94 sp|Q13085|ACACA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 54 17-UNIMOD:35,19-UNIMOD:1031 ms_run[1]:scan=28618 82.540767 3 2903.381229 2903.385869 K G 293 320 PSM ALVDHENVISCPHLGASTKEAQSR 95 sp|O43175|SERA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 53 11-UNIMOD:4,19-UNIMOD:1031 ms_run[2]:scan=17947 53.724 3 2814.4083 2814.4083 R C 271 295 PSM DVDDGLQAAEEVGYPVMIKASEGGGGK 96 sp|Q13085|ACACA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 53 19-UNIMOD:1031 ms_run[2]:scan=32784 94.479 2 2887.391 2887.3910 K G 293 320 PSM DVDDGLQAAEEVGYPVMIKASEGGGGK 97 sp|Q13085|ACACA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 53 19-UNIMOD:1031 ms_run[2]:scan=32993 95.091 3 2887.391 2887.3910 K G 293 320 PSM GMLFLHNGAICSHGNLKSSNCVVDGR 98 sp|P16066|ANPRA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 53 11-UNIMOD:4,17-UNIMOD:1031,21-UNIMOD:4 ms_run[2]:scan=21989 64.42 4 3038.4637 3038.4637 K F 646 672 PSM HLNEIDLFHCIDPNDSKHK 99 sp|Q15185-3|TEBP_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 53 10-UNIMOD:4,17-UNIMOD:1031 ms_run[2]:scan=22559 65.941 4 2527.2278 2527.2278 K R 49 68 PSM IASHSHVKGLGLDESGLAK 100 sp|Q9Y265|RUVB1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 53 8-UNIMOD:1031 ms_run[2]:scan=17527 52.619 3 2114.1484 2114.1484 R Q 15 34 PSM IITITGTQDQIQNAQYLLQNSVKQYSGK 101 sp|P61978|HNRPK_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 53 23-UNIMOD:1031 ms_run[2]:scan=33094 95.393 3 3347.7725 3347.7725 R F 434 462 PSM KEGTGSTATSSSSTAGAAGK 102 sp|O15372|EIF3H_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 53 1-UNIMOD:1031 ms_run[2]:scan=7202 25.222 2 1950.9494 1950.9494 R G 5 25 PSM KYTLPPGVDPTQVSSSLSPEGTLTVEAPMPK 103 sp|P04792|HSPB1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 53 1-UNIMOD:1031 ms_run[2]:scan=31654 91.08 3 3421.7691 3421.7691 R L 141 172 PSM SIYYITGESKEQVANSAFVER 104 sp|P08238|HS90B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 53 10-UNIMOD:1031 ms_run[2]:scan=27941 80.68 2 2586.2966 2586.2966 K V 482 503 PSM TIGGGDDSFTTFFCETGAGKHVPR 105 sp|P68366-2|TBA4A_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 53 14-UNIMOD:4,20-UNIMOD:1031 ms_run[2]:scan=28163 81.287 3 2752.2915 2752.2915 K A 26 50 PSM TQETLSQAGQKTSAALSTVGSAISR 106 sp|O43399-6|TPD54_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 53 11-UNIMOD:1031 ms_run[2]:scan=29656 85.43 3 2687.409 2687.4090 K K 86 111 PSM WNGFGGKVQEGETIEDGAR 107 sp|P36639-4|8ODP_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 53 7-UNIMOD:1031 ms_run[2]:scan=24174 70.25 2 2245.0764 2245.0764 R R 32 51 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 108 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 53 1-UNIMOD:1,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=33698 96.98737 3 2974.3456 2974.3432 M A 2 29 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 109 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 53 1-UNIMOD:1,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=33837 97.356745 3 2974.3456 2974.3432 M A 2 29 PSM EIAEAYLGKTVTNAVVTVPAYFNDSQR 110 sp|P11142|HSP7C_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 53 9-UNIMOD:1031 ms_run[1]:scan=33336 96.042815 3 3150.621117 3151.618980 K Q 129 156 PSM ALSVGNIDDALQCYSEAIKLDPHNHVLYSNR 111 sp|P31948|STIP1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 52 13-UNIMOD:4,19-UNIMOD:1031 ms_run[2]:scan=32529 93.726 4 3707.8366 3707.8366 K S 14 45 PSM ALVDHENVISCPHLGASTKEAQSR 112 sp|O43175|SERA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 52 11-UNIMOD:4,19-UNIMOD:1031 ms_run[2]:scan=17944 53.717 4 2814.4083 2814.4083 R C 271 295 PSM AQGPAASAEEPKPVEAPAANSDQTVTVK 113 sp|P80723|BASP1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 52 12-UNIMOD:1031 ms_run[2]:scan=18950 56.363 3 2958.4934 2958.4934 K E 199 227 PSM DVDDGLQAAEEVGYPVMIKASEGGGGK 114 sp|Q13085|ACACA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 52 19-UNIMOD:1031 ms_run[2]:scan=33109 95.437 3 2887.391 2887.3910 K G 293 320 PSM GMLFLHNGAICSHGNLKSSNCVVDGR 115 sp|P16066|ANPRA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 52 2-UNIMOD:35,11-UNIMOD:4,17-UNIMOD:1031,21-UNIMOD:4 ms_run[2]:scan=19687 58.3 4 3054.4586 3054.4586 K F 646 672 PSM GNDISSGTVLSDYVGSGPPKGTGLHR 116 sp|P30086|PEBP1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 52 20-UNIMOD:1031 ms_run[2]:scan=24028 69.862 3 2766.3937 2766.3937 K Y 94 120 PSM HLNEIDLFHCIDPNDSKHK 117 sp|Q15185-3|TEBP_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 52 10-UNIMOD:4,17-UNIMOD:1031 ms_run[2]:scan=22574 65.98 3 2527.2278 2527.2278 K R 49 68 PSM HQKIIEEAPATIATPAVFEHMEQCAVK 118 sp|Q13085|ACACA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 52 3-UNIMOD:1031,24-UNIMOD:4 ms_run[2]:scan=27806 80.308 4 3243.642 3243.6420 R L 384 411 PSM ILPGNMKDNFWEMGDTGPCGPCSEIHYDR 119 sp|P49588|SYAC_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 52 7-UNIMOD:1031,19-UNIMOD:4,22-UNIMOD:4 ms_run[2]:scan=29869 86.021 3 3591.568 3591.5680 K I 166 195 PSM LKGEMMDLQHGSLFLQTPK 120 sp|P07195|LDHB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 52 2-UNIMOD:1031 ms_run[2]:scan=28075 81.05 3 2368.2283 2368.2283 K I 59 78 PSM NIVHCDLKPENVLLASAEPFPQVK 121 sp|O94806|KPCD3_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 52 5-UNIMOD:4,8-UNIMOD:1031 ms_run[2]:scan=30378 87.478 3 2913.5422 2913.5423 K L 694 718 PSM VPKTASTSFTNIAYDLCAK 122 sp|Q7LGA3-3|HS2ST_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 52 3-UNIMOD:1031,17-UNIMOD:4 ms_run[2]:scan=28353 81.813 2 2282.1617 2282.1617 R N 81 100 PSM SKPHSEAGTAFIQTQQLHAAMADTFLEHMCR 123 sp|P14618|KPYM_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 52 1-UNIMOD:1,2-UNIMOD:1031,29-UNIMOD:35,30-UNIMOD:4 ms_run[1]:scan=27460 79.346707 4 3766.7694 3766.7649 M L 2 33 PSM DSSGNLHGYVAEGGAKDIR 124 sp|Q8IZ83-3|A16A1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 51 16-UNIMOD:1031 ms_run[2]:scan=17760 53.233 2 2141.0501 2141.0501 R G 498 517 PSM ETAENYLGHTAKNAVITVPAYFNDSQR 125 sp|P38646|GRP75_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 51 12-UNIMOD:1031 ms_run[2]:scan=29054 83.75 3 3204.584 3204.5840 K Q 176 203 PSM FLEENSSDPTYTSSLGGKIPIR 126 sp|P54760|EPHB4_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 51 18-UNIMOD:1031 ms_run[2]:scan=28527 82.291 2 2606.3228 2606.3228 R W 764 786 PSM KLNCQVIGASVDSHFCHLAWVNTPK 127 sp|Q06830|PRDX1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 51 1-UNIMOD:1031,4-UNIMOD:4,16-UNIMOD:4 ms_run[2]:scan=26081 75.469 4 3076.5375 3076.5375 K K 68 93 PSM LIGDAAKNQVALNPQNTVFDAK 128 sp|P0DMV9|HS71B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 51 7-UNIMOD:1031 ms_run[2]:scan=26944 77.885 2 2522.3493 2522.3493 R R 50 72 PSM LIGDAAKNQVAMNPTNTVFDAK 129 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 51 7-UNIMOD:1031,12-UNIMOD:35 ms_run[2]:scan=24500 71.127 2 2529.2897 2529.2897 R R 50 72 PSM LPHLLLYGPPGTGKTSTILACAK 130 sp|P40937|RFC5_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 51 14-UNIMOD:1031,21-UNIMOD:4 ms_run[2]:scan=29696 85.54 3 2603.4509 2603.4509 R Q 53 76 PSM NAESNAELKGLDVDSLVIEHIQVNK 131 sp|P18621|RL17_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 51 9-UNIMOD:1031 ms_run[2]:scan=31614 90.964 3 2930.5349 2930.5349 K A 97 122 PSM QKGADFLVTEVENGGSLGSK 132 sp|P14618|KPYM_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 51 2-UNIMOD:1031 ms_run[2]:scan=27961 80.733 2 2231.1434 2231.1434 K K 187 207 PSM SAGVQCFGPTAEAAQLESSKR 133 sp|P22102|PUR2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 51 6-UNIMOD:4,20-UNIMOD:1031 ms_run[2]:scan=23674 68.909 2 2389.1696 2389.1696 R F 88 109 PSM SLENYHFVDEHGKDQGINIR 134 sp|Q14677-2|EPN4_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 51 13-UNIMOD:1031 ms_run[2]:scan=20546 60.568 3 2566.2564 2566.2564 R Q 92 112 PSM TTGIVMDSGDGVTHTVPIYEGYALPHAILR 135 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 51 6-UNIMOD:35,30-UNIMOD:267 ms_run[2]:scan=25934 75.072 4 3208.6102 3208.6102 R L 148 178 PSM VIVVGNPANTNCLTASKSAPSIPK 136 sp|P40925|MDHC_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 51 12-UNIMOD:4,17-UNIMOD:1031 ms_run[2]:scan=24927 72.278 3 2633.4211 2633.4211 K E 126 150 PSM TAVDSGIPLLTNFQVTKLFAEAVQK 137 sp|P31327|CPSM_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 51 17-UNIMOD:1031 ms_run[1]:scan=33725 97.059986 3 2887.583451 2885.590246 R S 1455 1480 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 138 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 51 1-UNIMOD:1,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=33356 96.092432 2 2974.3349 2974.3432 M A 2 29 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 139 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 51 1-UNIMOD:1,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=33969 97.723824 3 2974.3456 2974.3432 M A 2 29 PSM QPQGHLLLIGVSGAGKTTLSR 140 sp|Q14204|DYHC1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 51 1-UNIMOD:28,16-UNIMOD:1031 ms_run[1]:scan=29632 85.359839 2 2311.2951 2311.3007 R F 2928 2949 PSM VVVCDNGTGFVKCGYAGSNFPEHIFPALVGR 141 sp|P61160|ARP2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 51 4-UNIMOD:4,12-UNIMOD:1031,13-UNIMOD:4 ms_run[1]:scan=33009 95.13546 4 3563.724743 3562.748966 K P 8 39 PSM ADEASELACPTPKEDGLAQQQTQLNLR 142 sp|P49327|FAS_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 50 9-UNIMOD:4,13-UNIMOD:1031 ms_run[2]:scan=24550 71.261 3 3178.5565 3178.5565 K S 2194 2221 PSM AVIKNADMSEEMQQDSVECATQALEK 143 sp|P63167|DYL1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 50 4-UNIMOD:1031,19-UNIMOD:4 ms_run[2]:scan=26502 76.607 3 3120.4414 3120.4414 K Y 6 32 PSM DSSGNLHGYVAEGGAKDIR 144 sp|Q8IZ83-3|A16A1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 50 16-UNIMOD:1031 ms_run[2]:scan=17900 53.604 2 2141.0501 2141.0501 R G 498 517 PSM EFHLNESGDPSSKSTEIK 145 sp|Q01105-2|SET_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 50 13-UNIMOD:1031 ms_run[2]:scan=18176 54.327 2 2200.0648 2200.0648 K W 142 160 PSM FFIGFGGKGANQCVQAAR 146 sp|Q9H477-2|RBSK_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 50 8-UNIMOD:1031,13-UNIMOD:4 ms_run[2]:scan=27401 79.178 2 2123.0735 2123.0735 K L 47 65 PSM HIADLAGNSEVILPVPAFNVINGGSHAGNK 147 sp|P06733|ENOA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 50 30-UNIMOD:259 ms_run[2]:scan=28781 82.986 4 3018.5767 3018.5767 R L 133 163 PSM HPGSFDVVHVKDANGNSFATR 148 sp|P62701|RS4X_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 50 11-UNIMOD:1031 ms_run[2]:scan=20353 60.059 3 2450.2091 2450.2091 R L 201 222 PSM HQGVMVGMGQKDSYVGDEAQSK 149 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 50 11-UNIMOD:1031 ms_run[2]:scan=19047 56.618 3 2546.1894 2546.1894 R R 40 62 PSM HTGPGILSMANAGPNTNGSQFFICTAK 150 sp|P62937|PPIA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 50 9-UNIMOD:35,24-UNIMOD:4 ms_run[2]:scan=21687 63.626 3 2806.3167 2806.3167 K T 92 119 PSM IQAKYLDQMEDLYEDFHIVK 151 sp|O43681|ASNA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 50 4-UNIMOD:1031 ms_run[2]:scan=33258 95.841 3 2693.3411 2693.3411 K L 298 318 PSM IVAPGKGILAADESTGSIAK 152 sp|P04075|ALDOA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 50 6-UNIMOD:1031 ms_run[2]:scan=25787 74.669 2 2093.1732 2093.1732 R R 23 43 PSM LAPITSDPTEATAVGAVEASFK 153 sp|P14618|KPYM_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 50 ms_run[2]:scan=27508 79.482 2 2174.1107 2174.1107 R C 401 423 PSM LIGDAAKNQLTSNPENTVFDAK 154 sp|P11021|BIP_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 50 7-UNIMOD:1031 ms_run[2]:scan=26217 75.836 2 2541.3075 2541.3075 R R 75 97 PSM LKTNHIGHTGYLNTVTVSPDGSLCASGGK 155 sp|P63244|RACK1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 50 2-UNIMOD:1031,24-UNIMOD:4 ms_run[2]:scan=19603 58.081 3 3179.6033 3179.6033 K D 184 213 PSM NIVHCDLKPENVLLASADPFPQVK 156 sp|Q9BZL6-2|KPCD2_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 50 5-UNIMOD:4,8-UNIMOD:1031 ms_run[2]:scan=31322 90.141 3 2899.5266 2899.5266 K L 512 536 PSM PAVLGFEGSANKIGVGVVR 157 sp|Q9NPF4|OSGEP_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 50 12-UNIMOD:1031 ms_run[2]:scan=29253 84.299 2 2065.1684 2065.1684 M D 2 21 PSM SDGAPASDSKPGSSEAAPSSK 158 sp|P80723|BASP1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 50 10-UNIMOD:1031 ms_run[2]:scan=11069 35.532 2 2127.992 2127.9920 K E 164 185 PSM SNNVEMDWVLKHTGPNSPDTANDGFVR 159 sp|P31943|HNRH1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 50 11-UNIMOD:1031 ms_run[2]:scan=26919 77.814 3 3195.5044 3195.5044 K L 88 115 PSM TIGGGDDSFNTFFSETGAGK 160 sp|P68363|TBA1B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 50 20-UNIMOD:259 ms_run[2]:scan=24801 71.932 2 2014.9 2014.9000 K H 41 61 PSM TIGGGDDSFNTFFSETGAGKHVPR 161 sp|P68363|TBA1B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 50 20-UNIMOD:1031 ms_run[2]:scan=26899 77.759 3 2692.2881 2692.2881 K A 41 65 PSM VAPEEHPVLLTEAPLNPKANR 162 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 50 18-UNIMOD:1031 ms_run[2]:scan=24278 70.526 2 2490.3595 2490.3595 R E 96 117 PSM VCYYYDGDIGNYYYGQGHPMKPHR 163 sp|Q92769|HDAC2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 50 2-UNIMOD:4,21-UNIMOD:1031 ms_run[2]:scan=21294 62.585 4 3148.396 3148.3960 K I 12 36 PSM VCYYYDGDIGNYYYGQGHPMKPHR 164 sp|Q92769|HDAC2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 50 2-UNIMOD:4,21-UNIMOD:1031 ms_run[2]:scan=21298 62.595 3 3148.396 3148.3960 K I 12 36 PSM VIISAPSADAPMFVMGVNHEKYDNSLK 165 sp|P04406|G3P_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 50 21-UNIMOD:1031 ms_run[2]:scan=29725 85.619 4 3128.5675 3128.5675 R I 119 146 PSM VSDFGLTKEASSTQDTGK 166 sp|P41240|CSK_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 50 8-UNIMOD:1031 ms_run[2]:scan=20583 60.663 2 2066.0168 2066.0168 K L 330 348 PSM YGKDATNVGDEGGFAPNILENK 167 sp|P06733|ENOA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 50 3-UNIMOD:1031 ms_run[2]:scan=25789 74.674 2 2504.2183 2504.2183 K E 200 222 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 168 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 50 1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=33152 95.5606 2 2991.3542 2990.3382 M A 2 29 PSM EEEIAALVIDNGSGMCKAGFAGDDAPR 169 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 50 16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=30723 88.44668 3 2988.3890 2988.3952 M A 2 29 PSM EEEIAALVIDNGSGMCKAGFAGDDAPR 170 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 50 1-UNIMOD:1,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=33762 97.158047 3 3030.4053 3030.4058 M A 2 29 PSM EEEIAALVIDNGSGMCKAGFAGDDAPR 171 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 50 1-UNIMOD:1,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=33887 97.498268 3 3030.4053 3030.4058 M A 2 29 PSM EEEIAALVIDNGSGMCKAGFAGDDAPR 172 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 50 1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=33379 96.152503 3 3047.3962 3046.4002 M A 2 29 PSM AIIPCIKGYDVIAQAQSGTGK 173 sp|Q14240|IF4A2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 50 5-UNIMOD:4,7-UNIMOD:1031 ms_run[1]:scan=30630 88.191246 2 2385.278897 2385.272617 R T 63 84 PSM MGPGFTKALGHGVDLGHIYGDNLER 174 sp|P23219|PGH1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 50 7-UNIMOD:1031 ms_run[1]:scan=27180 78.530106 4 2848.430435 2849.428283 K Q 215 240 PSM AYHEQLTVAEITNACFEPANQMVKCDPR 175 sp|Q9BQE3|TBA1C_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 49 15-UNIMOD:4,24-UNIMOD:1031,25-UNIMOD:4 ms_run[2]:scan=26878 77.701 3 3487.6323 3487.6323 K H 281 309 PSM EANFTVSSMHGDMPQKER 176 sp|P38919|IF4A3_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 49 16-UNIMOD:1031 ms_run[2]:scan=19021 56.55 2 2259.0412 2259.0412 R E 299 317 PSM FPSLLTHNENMVAKVDEVK 177 sp|P62906|RL10A_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 49 14-UNIMOD:1031 ms_run[2]:scan=27437 79.281 3 2366.2304 2366.2304 K S 134 153 PSM GDLSGHFEHLMVALVTPPAVFDAKQLK 178 sp|P12429|ANXA3_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 49 24-UNIMOD:1031 ms_run[2]:scan=33371 96.131 4 3115.6529 3115.6529 K K 74 101 PSM GGPGSAVSPYPTFNPSSDVAALHKAIMVK 179 sp|P04083|ANXA1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 49 24-UNIMOD:1031 ms_run[2]:scan=30472 87.751 3 3093.5957 3093.5957 K G 30 59 PSM HIADLAGNSEVILPVPAFNVINGGSHAGNK 180 sp|P06733|ENOA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 49 ms_run[2]:scan=28792 83.016 4 3010.5625 3010.5625 R L 133 163 PSM HQGVMVGMGQKDSYVGDEAQSK 181 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 49 5-UNIMOD:35,11-UNIMOD:1031 ms_run[2]:scan=17177 51.702 3 2562.1843 2562.1843 R R 40 62 PSM HQKIIEEAPATIATPAVFEHMEQCAVK 182 sp|Q13085|ACACA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 49 3-UNIMOD:1031,21-UNIMOD:35,24-UNIMOD:4 ms_run[2]:scan=24207 70.337 4 3259.637 3259.6370 R L 384 411 PSM IAVAAQNCYKVTNGAFTGEISPGMIK 183 sp|P60174-1|TPIS_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 49 8-UNIMOD:4,10-UNIMOD:1031 ms_run[2]:scan=28130 81.199 3 2935.4936 2935.4936 K D 60 86 PSM KAGHHQTAYNALLNAGESR 184 sp|Q13535-2|ATR_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 49 1-UNIMOD:1031 ms_run[2]:scan=14191 43.847 3 2233.1352 2233.1352 R L 1869 1888 PSM LGGSPFGPAGTGKTESVK 185 sp|Q14204|DYHC1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 49 13-UNIMOD:1031 ms_run[2]:scan=20481 60.396 2 1884.9945 1884.9945 R A 1900 1918 PSM LIGDAAKNQVAMNPTNTVFDAK 186 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 49 7-UNIMOD:1031,12-UNIMOD:35 ms_run[2]:scan=24360 70.752 2 2529.2897 2529.2897 R R 50 72 PSM LMTGDTYTAHAGAKFPIK 187 sp|P42684-4|ABL2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 49 14-UNIMOD:1031 ms_run[2]:scan=22308 65.28 2 2117.0979 2117.0979 R W 397 415 PSM LPLQDVYKIGGIGTVPVGR 188 sp|Q5VTE0|EF1A3_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 49 8-UNIMOD:1031 ms_run[2]:scan=31672 91.13 2 2177.2572 2177.2572 R V 248 267 PSM MGPGFTKALGHGVDLGHIYGDNLER 189 sp|P23219-4|PGH1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 49 1-UNIMOD:35,7-UNIMOD:1031 ms_run[2]:scan=26101 75.521 4 2865.4232 2865.4232 K Q 106 131 PSM NMSVIAHVDHGKSTLTDSLVCK 190 sp|P13639|EF2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 49 2-UNIMOD:35,12-UNIMOD:1031,21-UNIMOD:4 ms_run[2]:scan=21230 62.411 3 2623.3098 2623.3098 R A 21 43 PSM NVTGHYISPFHDIPLKVNSK 191 sp|Q9H2U2-6|IPYR2_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 49 16-UNIMOD:1031 ms_run[2]:scan=24465 71.031 3 2461.3118 2461.3118 K E 54 74 PSM PKFSVCVLGDQQHCDEAK 192 sp|P62906|RL10A_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 49 2-UNIMOD:1031,6-UNIMOD:4,14-UNIMOD:4 ms_run[2]:scan=21956 64.335 3 2313.0882 2313.0882 R A 61 79 PSM SGDAAIVDMVPGKPMCVESFSDYPPLGR 193 sp|Q5VTE0|EF1A3_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 49 9-UNIMOD:35,13-UNIMOD:1031,15-UNIMOD:35,16-UNIMOD:4 ms_run[2]:scan=29937 86.21 3 3222.5036 3222.5036 K F 396 424 PSM SIVDNWPENHVKAVVVTDGER 194 sp|P23368-2|MAOM_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 49 12-UNIMOD:1031 ms_run[2]:scan=25668 74.35 2 2559.3082 2559.3082 R I 145 166 PSM TFSHELSDFGLESTAGEIPVVAIR 195 sp|P30101|PDIA3_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 49 24-UNIMOD:267 ms_run[2]:scan=29977 86.322 3 2584.3049 2584.3049 K T 306 330 PSM THFGGGKTTGFGMIYDSLDYAK 196 sp|P62847-2|RS24_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 49 7-UNIMOD:1031 ms_run[2]:scan=29138 83.976 2 2561.2261 2561.2261 R K 62 84 PSM TIGVAAKNQQITHANNTVSNFK 197 sp|Q92598-2|HS105_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 49 7-UNIMOD:1031 ms_run[2]:scan=19412 57.574 3 2551.3507 2551.3507 R R 47 69 PSM TTGIVMDSGDGVTHTVPIYEGYALPHAILR 198 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 49 ms_run[2]:scan=27431 79.263 4 3182.607 3182.6070 R L 148 178 PSM TVATPLNQVANPNSAIFGGAR 199 sp|Q15056-2|IF4H_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 49 21-UNIMOD:267 ms_run[2]:scan=24194 70.303 2 2107.105 2107.1050 R P 197 218 PSM VAPEEHPVLLTEAPLNPK 200 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 49 ms_run[2]:scan=19286 57.242 2 1953.0571 1953.0571 R A 96 114 PSM VIISAPSADAPMFVMGVNHEKYDNSLK 201 sp|P04406|G3P_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 49 12-UNIMOD:35,21-UNIMOD:1031 ms_run[2]:scan=27419 79.23 3 3144.5624 3144.5624 R I 119 146 PSM VISHAISEHVEDAGVHSGDATLMLPTQTISQGAIEKVK 202 sp|P31327|CPSM_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 49 36-UNIMOD:1031 ms_run[2]:scan=25916 75.025 4 4164.1525 4164.1525 R D 1187 1225 PSM YDNSLKIISNASCTTNCLAPLAK 203 sp|P04406|G3P_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 49 6-UNIMOD:1031,13-UNIMOD:4,17-UNIMOD:4 ms_run[2]:scan=28605 82.505 3 2749.3779 2749.3779 K V 140 163 PSM YTPSGQAGAAASESLFVSNHAY 204 sp|P04075|ALDOA_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 49 ms_run[2]:scan=20638 60.809 2 2227.0182 2227.0182 K - 343 365 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 205 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 49 1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=32232 92.729847 4 2990.3323 2990.3381 M A 2 29 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 206 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 49 1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=31608 90.948742 3 2990.3350 2990.3381 M A 2 29 PSM EEEIAALVIDNGSGMCKAGFAGDDAPR 207 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 49 1-UNIMOD:1,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=33632 96.812205 3 3030.4053 3030.4058 M A 2 29 PSM DVDDGLQAAEEVGYPVMIKASEGGGGK 208 sp|Q13085|ACACA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 49 17-UNIMOD:35,19-UNIMOD:1031 ms_run[1]:scan=28815 83.077988 3 2903.381229 2903.385869 K G 293 320 PSM VCYYYDGDIGNYYYGQGHPMKPHR 209 sp|Q92769|HDAC2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 49 2-UNIMOD:4 ms_run[1]:scan=16159 49.021711 4 2953.282412 2952.274819 K I 12 36 PSM AAEAAAAPAESAAPAAGEEPSKEEGEPK 210 sp|P80723|BASP1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 48 22-UNIMOD:1031 ms_run[2]:scan=15402 47.007 3 2831.3461 2831.3461 K K 122 150 PSM ANPFGGASHAKGIVLEK 211 sp|P62266|RS23_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 48 11-UNIMOD:1031 ms_run[2]:scan=21768 63.838 2 1891.0316 1891.0316 K V 38 55 PSM CLAFHDISPQAPTHFLVIPKK 212 sp|P49773|HINT1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 48 1-UNIMOD:4,20-UNIMOD:1031 ms_run[2]:scan=27779 80.231 3 2614.4094 2614.4094 R H 38 59 PSM EEEIAALVIDNGSGMCKAGFAGDDAPR 213 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 48 15-UNIMOD:35,16-UNIMOD:4,17-UNIMOD:1031 ms_run[2]:scan=28390 81.912 3 3004.3906 3004.3906 M A 2 29 PSM GFCFLEYEDHKTAAQAR 214 sp|O60506|HNRPQ_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 48 3-UNIMOD:4,11-UNIMOD:1031 ms_run[2]:scan=24058 69.941 2 2238.0528 2238.0528 R R 287 304 PSM HIADLAGNSEVILPVPAFNVINGGSHAGNK 215 sp|P06733|ENOA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 48 ms_run[2]:scan=28817 83.083 3 3010.5625 3010.5625 R L 133 163 PSM IQAKYLDQMEDLYEDFHIVK 216 sp|O43681|ASNA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 48 4-UNIMOD:1031,9-UNIMOD:35 ms_run[2]:scan=28632 82.578 3 2709.336 2709.3360 K L 298 318 PSM KGVNLPGAAVDLPAVSEK 217 sp|P14618|KPYM_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 48 1-UNIMOD:1031 ms_run[2]:scan=27116 78.357 2 1960.0993 1960.0993 K D 207 225 PSM KLAQQYYLVYQEPIPTAQLVQR 218 sp|P25787|PSA2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 48 1-UNIMOD:1031 ms_run[2]:scan=30349 87.359 2 2844.5538 2844.5538 R V 92 114 PSM KSQIFSTASDNQPTVTIK 219 sp|P11021|BIP_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 48 1-UNIMOD:1031 ms_run[2]:scan=22327 65.33 2 2160.1426 2160.1426 K V 447 465 PSM KYEDICPSTHNMDVPNIK 220 sp|P63241|IF5A1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 48 1-UNIMOD:1031,6-UNIMOD:4 ms_run[2]:scan=20381 60.135 3 2356.1192 2356.1192 K R 68 86 PSM KYTELPHGAISEDQAVGPADIPCDSTGQTST 221 sp|Q9H773|DCTP1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 48 1-UNIMOD:1031,23-UNIMOD:4 ms_run[2]:scan=23664 68.881 3 3440.6042 3440.6042 R - 140 171 PSM LASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEKK 222 sp|P05387|RLA2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 48 33-UNIMOD:1031 ms_run[2]:scan=21219 62.382 4 3097.6408 3097.6408 K D 62 96 PSM LPVIDPESGNTLYILTHKR 223 sp|P54619-2|AAKG1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 48 18-UNIMOD:1031 ms_run[2]:scan=31157 89.68 3 2361.3056 2361.3056 R I 121 140 PSM LTKDGNVLLHEMQIQHPTASLIAK 224 sp|P40227|TCPZ_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 48 3-UNIMOD:1031 ms_run[2]:scan=26713 77.227 4 2852.5582 2852.5582 K V 56 80 PSM LVQDVANNTNEEAGDGTTTATVLAR 225 sp|P10809|CH60_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 48 ms_run[2]:scan=16105 48.881 3 2559.2413 2559.2413 K S 97 122 PSM PGEVLGLVGTNGIGKSTALK 226 sp|P61221|ABCE1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 48 15-UNIMOD:1031 ms_run[2]:scan=28110 81.143 2 2106.2049 2106.2049 R I 102 122 PSM PLVVFVLGGPGAGKGTQCAR 227 sp|P30085-3|KCY_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 48 14-UNIMOD:1031,18-UNIMOD:4 ms_run[2]:scan=30447 87.682 2 2179.1936 2179.1936 K I 35 55 PSM SINPDEAVAYGAAVQAAILSGDK 228 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 48 ms_run[2]:scan=32646 94.082 2 2259.1383 2259.1383 K S 362 385 PSM TALLDAAGVASLLTTAEVVVTEIPK 229 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 48 ms_run[2]:scan=34124 98.169 3 2481.3942 2481.3942 R E 527 552 PSM TALLDAAGVASLLTTAEVVVTEIPK 230 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 48 25-UNIMOD:259 ms_run[2]:scan=34125 98.172 3 2489.4084 2489.4084 R E 527 552 PSM THFGGGKTTGFGMIYDSLDYAK 231 sp|P62847-2|RS24_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 48 7-UNIMOD:1031 ms_run[2]:scan=29120 83.928 3 2561.2261 2561.2261 R K 62 84 PSM VADPDHDHTGFLTEYVATR 232 sp|P28482-2|MK01_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 48 ms_run[2]:scan=17570 52.73 3 2142.997 2142.9970 R W 173 192 PSM VAPEEHPVLLTEAPLNPK 233 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 48 18-UNIMOD:259 ms_run[2]:scan=19288 57.247 2 1961.0713 1961.0713 R A 96 114 PSM VCYYYDGDVGNYYYGQGHPMKPHR 234 sp|Q13547|HDAC1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 48 2-UNIMOD:4,21-UNIMOD:1031 ms_run[2]:scan=20101 59.389 4 3134.3803 3134.3803 K I 11 35 PSM VCYYYDGDVGNYYYGQGHPMKPHR 235 sp|Q13547|HDAC1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 48 2-UNIMOD:4,21-UNIMOD:1031 ms_run[2]:scan=20111 59.416 3 3134.3803 3134.3803 K I 11 35 PSM VDKGVVPLAGTNGETTTQGLDGLSER 236 sp|P04075|ALDOA_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 48 3-UNIMOD:1031 ms_run[2]:scan=26408 76.352 2 2809.4458 2809.4458 K C 109 135 PSM VLLDAPCSGTGVISKDPAVK 237 sp|P46087-3|NOP2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 48 7-UNIMOD:4,15-UNIMOD:1031 ms_run[2]:scan=25358 73.514 2 2222.1981 2222.1981 R T 453 473 PSM VSGGLEVLAEKCPNLTHLNLSGNK 238 sp|P39687|AN32A_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 48 11-UNIMOD:1031,12-UNIMOD:4 ms_run[2]:scan=30112 86.702 3 2745.4483 2745.4483 R I 76 100 PSM VVVCDNGTGFVKCGYAGSNFPEHIFPALVGR 239 sp|P61160|ARP2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 48 4-UNIMOD:4,12-UNIMOD:1031,13-UNIMOD:4 ms_run[2]:scan=32837 94.636 3 3562.749 3562.7490 K P 8 39 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 240 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 48 1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=32525 93.713393 2 2991.3352 2990.3382 M A 2 29 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 241 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 48 1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=31907 91.803357 3 2991.3302 2990.3382 M A 2 29 PSM EEEIAALVIDNGSGMCKAGFAGDDAPR 242 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 48 1-UNIMOD:1,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=34020 97.86496 3 3030.4053 3030.4058 M A 2 29 PSM EEIAALVIDNGSGMCKAGFAGDDAPR 243 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 48 1-UNIMOD:1,15-UNIMOD:4,16-UNIMOD:1031 ms_run[1]:scan=33676 96.92823 3 2901.3675 2901.3632 E A 3 29 PSM IQAKYLDQMEDLYEDFHIVK 244 sp|O43681|ASNA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 48 4-UNIMOD:1031 ms_run[1]:scan=33254 95.828469 3 2693.342708 2693.341091 K L 298 318 PSM AAEAAAAPAESAAPAAGEEPSKEEGEPK 245 sp|P80723|BASP1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 47 ms_run[2]:scan=8154 27.753 3 2635.2249 2635.2249 K K 122 150 PSM AIGSASEGAQSSLQEVYHKSMTLK 246 sp|P28066-2|PSA5_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 47 19-UNIMOD:1031 ms_run[2]:scan=25848 74.836 3 2717.3694 2717.3694 R E 111 135 PSM ALANSLACQGKYTPSGQAGAAASESLFVSNHAY 247 sp|P04075|ALDOA_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 47 8-UNIMOD:4,11-UNIMOD:1031 ms_run[2]:scan=27850 80.429 3 3536.6994 3536.6994 R - 332 365 PSM ANGTTVHVGIHPSKVVITR 248 sp|P61254|RL26_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 47 14-UNIMOD:1031 ms_run[2]:scan=18360 54.812 3 2181.2382 2181.2382 K L 90 109 PSM AVLLGPPGAGKGTQAPR 249 sp|P54819-3|KAD2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 47 11-UNIMOD:1031 ms_run[2]:scan=20949 61.625 2 1785.0261 1785.0261 R L 18 35 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 250 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 47 16-UNIMOD:4,17-UNIMOD:1031 ms_run[2]:scan=31071 89.435 2 2932.3331 2932.3331 M A 2 29 PSM DLKPSNILYVDESGNPECLR 251 sp|Q15418-4|KS6A1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 47 3-UNIMOD:1031,18-UNIMOD:4 ms_run[2]:scan=28647 82.617 2 2514.2424 2514.2424 R I 519 539 PSM DSSGNLHGYVAEGGAKDIR 252 sp|Q8IZ83-3|A16A1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 47 16-UNIMOD:1031 ms_run[2]:scan=17748 53.201 3 2141.0501 2141.0501 R G 498 517 PSM DYHFKVDNDENEHQLSLR 253 sp|P06748|NPM_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 47 5-UNIMOD:1031 ms_run[2]:scan=19992 59.105 3 2454.1564 2454.1564 K T 28 46 PSM EGSTHNWQHITDQIGMFCFTGLKPEQVER 254 sp|P00505|AATM_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 47 18-UNIMOD:4,23-UNIMOD:1031 ms_run[2]:scan=30941 89.064 4 3640.7191 3640.7191 K L 365 394 PSM ESGQVVAIKQVPVESDLQEIIK 255 sp|Q13188|STK3_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 47 9-UNIMOD:1031 ms_run[2]:scan=33208 95.711 2 2604.4374 2604.4374 K E 48 70 PSM ESIFFNSHNVSKPESSSVLTELDK 256 sp|Q13572-2|ITPK1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 47 12-UNIMOD:1031 ms_run[2]:scan=27984 80.796 3 2889.4396 2889.4396 R I 226 250 PSM FLDDLGNAKSHLMSLYSACSSEVPHGPVDQK 257 sp|O95816|BAG2_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 47 9-UNIMOD:1031,19-UNIMOD:4 ms_run[2]:scan=32721 94.3 4 3597.7232 3597.7232 K F 124 155 PSM FPSLLTHNENMVAKVDEVK 258 sp|P62906|RL10A_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 47 11-UNIMOD:35,14-UNIMOD:1031 ms_run[2]:scan=23584 68.672 3 2382.2253 2382.2253 K S 134 153 PSM GKLPIVNEDDELVAIIAR 259 sp|P12268|IMDH2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 47 2-UNIMOD:1031 ms_run[2]:scan=33404 96.218 2 2160.2154 2160.2154 K T 207 225 PSM GMGSLDAMDKHLSSQNR 260 sp|P12268|IMDH2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 47 10-UNIMOD:1031 ms_run[2]:scan=19385 57.502 2 2041.9673 2041.9673 R Y 413 430 PSM GVVPLAGTNGETTTQGLDGLSER 261 sp|P04075|ALDOA_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 47 ms_run[2]:scan=21524 63.192 2 2271.1343 2271.1343 K C 112 135 PSM HQGVMVGMGQKDSYVGDEAQSK 262 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 47 8-UNIMOD:35,11-UNIMOD:1031 ms_run[2]:scan=15762 47.946 3 2562.1843 2562.1843 R R 40 62 PSM IAVAAQNCYKVTNGAFTGEISPGMIK 263 sp|P60174-1|TPIS_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 47 8-UNIMOD:4,10-UNIMOD:1031,24-UNIMOD:35 ms_run[2]:scan=26269 75.973 3 2951.4885 2951.4885 K D 60 86 PSM IICQGFTGKQGTFHSQQALEYGTK 264 sp|P53597|SUCA_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 47 3-UNIMOD:4,9-UNIMOD:1031 ms_run[2]:scan=21263 62.5 3 2894.4385 2894.4385 K L 58 82 PSM ITAAQHSVTGSAVSKTVCK 265 sp|Q13492-3|PICAL_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 47 15-UNIMOD:1031,18-UNIMOD:4 ms_run[2]:scan=14081 43.558 3 2140.131 2140.1310 R A 10 29 PSM IWNSSLQTNKEPVGILTSNHR 266 sp|P43155-3|CACP_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 47 10-UNIMOD:1031 ms_run[2]:scan=25220 73.137 3 2589.3663 2589.3663 K N 236 257 PSM KDPEGTPYINHPIGVAR 267 sp|Q8N4P3-2|MESH1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 47 1-UNIMOD:1031 ms_run[2]:scan=18437 55.012 2 2059.0851 2059.0851 R I 25 42 PSM KPANDITSQLEINFGDLGR 268 sp|Q8NC51-3|PAIRB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 47 1-UNIMOD:1031 ms_run[2]:scan=32009 92.102 2 2283.1859 2283.1859 R P 331 350 PSM LIGDAAKNQVAMNPTNTVFDAK 269 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 47 7-UNIMOD:1031,12-UNIMOD:35 ms_run[2]:scan=24633 71.481 2 2529.2897 2529.2897 R R 50 72 PSM LIGDAAKNQVAMNPTNTVFDAK 270 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 47 7-UNIMOD:1031,12-UNIMOD:35 ms_run[2]:scan=25811 74.736 2 2529.2897 2529.2897 R R 50 72 PSM LIGDAAKNQVAMNPTNTVFDAK 271 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 47 7-UNIMOD:1031,12-UNIMOD:35 ms_run[2]:scan=25937 75.083 2 2529.2897 2529.2897 R R 50 72 PSM LIGDAAKNQVAMNPTNTVFDAK 272 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 47 7-UNIMOD:1031 ms_run[2]:scan=26592 76.847 3 2513.2948 2513.2948 R R 50 72 PSM LLLPGELAKHAVSEGTK 273 sp|P62807|H2B1C_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 47 9-UNIMOD:1031 ms_run[2]:scan=25926 75.053 2 1958.1201 1958.1201 R A 101 118 PSM QEDGGVYSSSGLKQIPIK 274 sp|P16591-3|FER_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 47 13-UNIMOD:1031 ms_run[2]:scan=24571 71.317 2 2101.1055 2101.1055 R W 339 357 PSM QGNGPVLVCAPSNIAVDQLTEKIHQTGLK 275 sp|Q92900-2|RENT1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 47 9-UNIMOD:4,22-UNIMOD:1031 ms_run[2]:scan=32728 94.32 4 3282.7394 3282.7394 R V 512 541 PSM QIESKTAFQEALDAAGDK 276 sp|P10599|THIO_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 47 5-UNIMOD:1031 ms_run[2]:scan=27065 78.22 2 2117.0641 2117.0641 K L 4 22 PSM SAGVQCFGPTAEAAQLESSKR 277 sp|P22102|PUR2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 47 6-UNIMOD:4,20-UNIMOD:1031 ms_run[2]:scan=23659 68.869 3 2389.1696 2389.1696 R F 88 109 PSM SDKNNEFIVIHNGIITNYK 278 sp|Q06210-2|GFPT1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 47 3-UNIMOD:1031 ms_run[2]:scan=25450 73.761 3 2414.2594 2414.2594 R D 112 131 PSM SQGKVLQATVVAVGSGSK 279 sp|P61604|CH10_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 47 4-UNIMOD:1031 ms_run[2]:scan=22753 66.457 2 1911.0789 1911.0789 K G 37 55 PSM TATESFASDPILYRPVAVALDTK 280 sp|P14618|KPYM_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 47 ms_run[2]:scan=27705 80.029 2 2464.285 2464.2850 R G 93 116 PSM TDEEGKDVPDHAVLEMK 281 sp|Q9BUJ2-3|HNRL1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 47 6-UNIMOD:1031 ms_run[2]:scan=20042 59.237 2 2108.0096 2108.0096 R A 432 449 PSM TFSHELSDFGLESTAGEIPVVAIR 282 sp|P30101|PDIA3_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 47 ms_run[2]:scan=29978 86.324 3 2574.2966 2574.2966 K T 306 330 PSM TIGGGDDSFNTFFSETGAGKHVPR 283 sp|P68363|TBA1B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 47 20-UNIMOD:1031 ms_run[2]:scan=27029 78.123 3 2692.2881 2692.2881 K A 41 65 PSM TSSAQVEGGVHSLHSYEKR 284 sp|P12268|IMDH2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 47 18-UNIMOD:1031 ms_run[2]:scan=13300 41.506 3 2267.1295 2267.1295 R L 494 513 PSM TVATPLNQVANPNSAIFGGAR 285 sp|Q15056-2|IF4H_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 47 ms_run[2]:scan=24192 70.296 2 2097.0967 2097.0967 R P 197 218 PSM VETGVLKPGMVVTFAPVNVTTEVK 286 sp|Q5VTE0|EF1A3_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 47 7-UNIMOD:1031 ms_run[2]:scan=33273 95.879 3 2710.4979 2710.4979 R S 267 291 PSM VLEDDPEATYTTSGGKIPIR 287 sp|P29317|EPHA2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 47 16-UNIMOD:1031 ms_run[2]:scan=24252 70.456 2 2357.2115 2357.2115 R W 763 783 PSM VVLAYEPVWAIGTGKTATPQQAQEVHEK 288 sp|P60174-1|TPIS_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 47 15-UNIMOD:1031 ms_run[2]:scan=28537 82.319 4 3245.7085 3245.7085 K L 161 189 PSM YVASYLLAALGGNSSPSAKDIK 289 sp|P05387|RLA2_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 47 19-UNIMOD:1031 ms_run[2]:scan=32487 93.595 3 2420.2951 2420.2951 R K 3 25 PSM SFSKESDDPMAYIHFTAEGEVTFK 290 sp|P14625|ENPL_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 47 4-UNIMOD:1031 ms_run[1]:scan=33090 95.380648 3 2930.358969 2931.363677 K S 361 385 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 291 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 47 1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=31339 90.187125 3 2990.3395 2990.3381 M A 2 29 PSM DDIAALVVDNGSGMCKAGFAGDDAPR 292 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 47 15-UNIMOD:4,16-UNIMOD:1031 ms_run[1]:scan=30025 86.459258 3 2817.3054 2817.3057 D A 3 29 PSM EEEIAALVIDNGSGMCKAGFAGDDAPR 293 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 47 1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=33660 96.885924 3 3048.4242 3046.4002 M A 2 29 PSM LPLQDVYKIGGIGTVPVGR 294 sp|P68104|EF1A1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 47 8-UNIMOD:1031 ms_run[1]:scan=31768 91.411838 2 2177.254833 2177.257225 R V 248 267 PSM DVDDGLQAAEEVGYPVMIKASEGGGGK 295 sp|Q13085|ACACA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 47 19-UNIMOD:1031 ms_run[1]:scan=32920 94.876429 2 2888.395993 2887.390954 K G 293 320 PSM LELLHPIIPEQSTFKVLSTK 296 sp|Q9Y2Z0|SGT1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 47 15-UNIMOD:1031 ms_run[1]:scan=31758 91.383515 3 2489.440241 2488.430498 K I 222 242 PSM KEAESCDCLQGFQLTHSLGGGTGSGMGTLLISK 297 sp|P04350|TBB4A_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 47 1-UNIMOD:259,6-UNIMOD:4,8-UNIMOD:4,33-UNIMOD:259 ms_run[1]:scan=32296 92.982253 3 3457.636196 3454.650174 R I 122 155 PSM AEGSDVANAVLDGADCIMLSGETAKGDYPLEAVR 298 sp|P14618|KPYM_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 46 16-UNIMOD:4,18-UNIMOD:35,25-UNIMOD:1031 ms_run[2]:scan=32900 94.819 3 3705.7502 3705.7502 R M 343 377 PSM AEVQKLQMEAPHIIVGTPGR 299 sp|P60842|IF4A1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 46 5-UNIMOD:1031 ms_run[2]:scan=25601 74.17 3 2369.2889 2369.2889 R V 142 162 PSM ALGKYGPADVEDTTGSGATDSK 300 sp|P24534|EF1B_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 46 4-UNIMOD:1031 ms_run[2]:scan=19653 58.211 2 2335.1179 2335.1179 K D 75 97 PSM AQGPAASAEEPKPVEAPAANSDQTVTVK 301 sp|P80723|BASP1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 46 ms_run[2]:scan=11832 37.572 3 2762.3723 2762.3723 K E 199 227 PSM AQVEEFLAQHGSEYQSVKLVGPEVR 302 sp|Q02809|PLOD1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 46 18-UNIMOD:1031 ms_run[2]:scan=26850 77.621 3 2995.5403 2995.5403 K M 331 356 PSM DATNVGDEGGFAPNILENK 303 sp|P06733|ENOA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 46 ms_run[2]:scan=22059 64.605 2 1959.9174 1959.9174 K E 203 222 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 304 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 46 16-UNIMOD:4,17-UNIMOD:1031 ms_run[2]:scan=31152 89.664 3 2932.3331 2932.3331 M A 2 29 PSM DKPHVNVGTIGHVDHGK 305 sp|P49411|EFTU_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 46 2-UNIMOD:1031 ms_run[2]:scan=15297 46.734 3 2005.0494 2005.0494 R T 54 71 PSM EAAENSLVAYKAASDIAMTELPPTHPIR 306 sp|P62258|1433E_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 46 11-UNIMOD:1031 ms_run[2]:scan=31839 91.611 3 3190.6332 3190.6332 K L 143 171 PSM EILVGDVGQTVDDPYATFVK 307 sp|P23528|COF1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 46 20-UNIMOD:259 ms_run[2]:scan=28079 81.059 2 2173.1034 2173.1034 K M 54 74 PSM FSKVEDMAELTCLNEASVLHNLK 308 sp|P35579|MYH9_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 46 3-UNIMOD:1031,12-UNIMOD:4 ms_run[2]:scan=33132 95.501 3 2843.4198 2843.4198 K E 80 103 PSM GAQVNAVNQNGCTPLHYAASKNR 309 sp|O75832-2|PSD10_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 46 12-UNIMOD:4,21-UNIMOD:1031 ms_run[2]:scan=17117 51.543 3 2665.3143 2665.3143 K H 96 119 PSM GLSEDTTEETLKESFDGSVR 310 sp|P19338|NUCL_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 46 12-UNIMOD:1031 ms_run[2]:scan=27597 79.727 2 2395.1391 2395.1391 K A 578 598 PSM HLPNCSVISQDDFFKPESEIETDK 311 sp|Q9NWW6-2|NRK1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 46 5-UNIMOD:4,15-UNIMOD:1031 ms_run[2]:scan=26580 76.815 3 3030.4281 3030.4281 K N 26 50 PSM HQGVMVGMGQKDSYVGDEAQSK 312 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 46 5-UNIMOD:35,8-UNIMOD:35,11-UNIMOD:1031 ms_run[2]:scan=14212 43.903 3 2578.1792 2578.1792 R R 40 62 PSM IQVTPPGFQLVFLPFADDKR 313 sp|P12956|XRCC6_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 46 19-UNIMOD:1031 ms_run[2]:scan=33688 96.959 2 2483.3577 2483.3577 K K 425 445 PSM KPTDGASSSNCVTDISHLVR 314 sp|P49321-2|NASP_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 46 1-UNIMOD:1031,11-UNIMOD:4 ms_run[2]:scan=21066 61.954 3 2339.154 2339.1540 R K 359 379 PSM KTFSHELSDFGLESTAGEIPVVAIR 315 sp|P30101|PDIA3_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 46 1-UNIMOD:1031 ms_run[2]:scan=31938 91.896 3 2898.5127 2898.5127 R T 305 330 PSM LAELQAKHGDPGDAAQQEAK 316 sp|O14737|PDCD5_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 46 7-UNIMOD:1031 ms_run[2]:scan=14887 45.664 3 2272.1448 2272.1448 R H 14 34 PSM LCDFGISGQLVDSIAKTR 317 sp|P45985|MP2K4_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 46 2-UNIMOD:4,16-UNIMOD:1031 ms_run[2]:scan=31768 91.412 2 2175.1358 2175.1358 K D 245 263 PSM LDSPAGTALSPSGHTKLLPR 318 sp|P32322|P5CR1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 46 16-UNIMOD:1031 ms_run[2]:scan=22135 64.814 3 2213.2168 2213.2168 K S 292 312 PSM LIGDAAKNQVAMNPTNTVFDAK 319 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 46 7-UNIMOD:1031,12-UNIMOD:35 ms_run[2]:scan=24886 72.168 3 2529.2897 2529.2897 R R 50 72 PSM LIGDAAKNQVAMNPTNTVFDAK 320 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 46 7-UNIMOD:1031 ms_run[2]:scan=26707 77.209 2 2513.2948 2513.2948 R R 50 72 PSM LKDPANFQYPAESVLAYK 321 sp|P15559-3|NQO1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 46 2-UNIMOD:1031 ms_run[2]:scan=28987 83.56 2 2249.1732 2249.1732 K E 60 78 PSM LMTGDTYTAHAGAKFPIK 322 sp|P42684-4|ABL2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 46 2-UNIMOD:35,14-UNIMOD:1031 ms_run[2]:scan=20742 61.082 2 2133.0929 2133.0929 R W 397 415 PSM LTFSCLGGSDNFKHLNEIDLFHCIDPNDSK 323 sp|Q15185-3|TEBP_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 46 5-UNIMOD:4,13-UNIMOD:1031,23-UNIMOD:4 ms_run[2]:scan=32814 94.569 4 3688.729 3688.7290 K H 36 66 PSM SAAQAAAQTNSNAAGKQLR 324 sp|Q8NC51-3|PAIRB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 46 16-UNIMOD:1031 ms_run[2]:scan=12886 40.405 2 2053.0665 2053.0665 K K 53 72 PSM SDGAPASDSKPGSSEAAPSSK 325 sp|P80723|BASP1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 46 10-UNIMOD:259,21-UNIMOD:259 ms_run[2]:scan=2861 13.237 2 1947.8992 1947.8992 K E 164 185 PSM SGANVLICGPNGCGKSSLFR 326 sp|P28288-2|ABCD3_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 46 8-UNIMOD:4,13-UNIMOD:4,15-UNIMOD:1031 ms_run[2]:scan=26997 78.036 2 2289.1358 2289.1358 R V 355 375 PSM TDEEGKDVPDHAVLEMK 327 sp|Q9BUJ2-3|HNRL1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 46 6-UNIMOD:1031,16-UNIMOD:35 ms_run[2]:scan=16702 50.45 2 2124.0045 2124.0045 R A 432 449 PSM TGQLAAIKVMDVTEDEEEEIK 328 sp|O95819-4|M4K4_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 46 8-UNIMOD:1031 ms_run[2]:scan=30790 88.643 2 2543.2677 2543.2677 K L 47 68 PSM TIGGGDDSFNTFFSETGAGK 329 sp|P68363|TBA1B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 46 ms_run[2]:scan=24842 72.046 2 2006.8858 2006.8858 K H 41 61 PSM TLLAKAIANECQANFISIK 330 sp|P55072|TERA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 46 5-UNIMOD:1031,11-UNIMOD:4 ms_run[2]:scan=31669 91.122 3 2300.2562 2300.2562 K G 525 544 PSM TLLAKAIANECQANFISIK 331 sp|P55072|TERA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 46 5-UNIMOD:1031,11-UNIMOD:4 ms_run[2]:scan=31679 91.15 2 2300.2562 2300.2562 K G 525 544 PSM TLVSVTKEGLELPEDEEEK 332 sp|P07900|HS90A_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 46 7-UNIMOD:1031 ms_run[2]:scan=27844 80.411 2 2340.1948 2340.1948 K K 540 559 PSM TMEQIVFPVPSICEFLTKESK 333 sp|Q14643-4|ITPR1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 46 2-UNIMOD:35,13-UNIMOD:4,18-UNIMOD:1031 ms_run[2]:scan=33544 96.58 3 2694.3649 2694.3649 R L 2149 2170 PSM TYEEGLKHEANNPQLK 334 sp|P31948|STIP1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 46 7-UNIMOD:1031 ms_run[2]:scan=15943 48.446 2 2066.0433 2066.0433 R E 94 110 PSM VCYYYDGDIGNYYYGQGHPMKPHR 335 sp|Q92769|HDAC2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 46 2-UNIMOD:4,20-UNIMOD:35,21-UNIMOD:1031 ms_run[2]:scan=20173 59.579 4 3164.3909 3164.3909 K I 12 36 PSM VDVAVNCAGIAVASKTYNLK 336 sp|Q99714-2|HCD2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 46 7-UNIMOD:4,15-UNIMOD:1031 ms_run[2]:scan=27142 78.427 2 2288.2199 2288.2199 R K 85 105 PSM VIISAPSADAPMFVMGVNHEKYDNSLK 337 sp|P04406|G3P_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 46 21-UNIMOD:1031 ms_run[2]:scan=29709 85.576 3 3128.5675 3128.5675 R I 119 146 PSM VLVKAAYNPGQAVPWNAVK 338 sp|Q8N163-2|CCAR2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 46 4-UNIMOD:1031 ms_run[2]:scan=28107 81.135 2 2220.2419 2220.2419 K V 94 113 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 339 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 46 1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=32916 94.866052 2 2990.3325 2990.3381 M A 2 29 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 340 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 46 1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=33465 96.375752 2 2991.3542 2990.3382 M A 2 29 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 341 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 46 1-UNIMOD:1,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=34381 99.100093 3 2974.3456 2974.3432 M A 2 29 PSM EEEIAALVIDNGSGMCKAGFAGDDAPR 342 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 46 1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=33443 96.318625 4 3046.3955 3046.4007 M A 2 29 PSM CLAFHDISPQAPTHFLVIPKK 343 sp|P49773|HINT1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 46 1-UNIMOD:385,1-UNIMOD:4,20-UNIMOD:1031 ms_run[1]:scan=32825 94.600502 3 2597.3870 2597.3823 R H 38 59 PSM HVFLTGPPGVGKTTLIHK 344 sp|Q9BSD7|NTPCR_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 46 12-UNIMOD:1031 ms_run[1]:scan=22842 66.690368 3 2098.207287 2097.209881 R A 4 22 PSM ATAVMPDGQFKDISLSDYK 345 sp|Q06830|PRDX1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45 11-UNIMOD:1031 ms_run[2]:scan=28049 80.976 2 2281.13 2281.1300 K G 17 36 PSM CIGEGQFGDVHQGIYMSPENPALAVAIKTCK 346 sp|Q05397-7|FAK1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45 1-UNIMOD:4,16-UNIMOD:35,28-UNIMOD:1031,30-UNIMOD:4 ms_run[2]:scan=27992 80.819 3 3601.7367 3601.7367 R N 427 458 PSM CLAFHDISPQAPTHFLVIPKK 347 sp|P49773|HINT1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45 1-UNIMOD:4,21-UNIMOD:1031 ms_run[2]:scan=27764 80.19 4 2614.4094 2614.4094 R H 38 59 PSM DATNVGDEGGFAPNILENK 348 sp|P06733|ENOA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45 19-UNIMOD:259 ms_run[2]:scan=22058 64.602 2 1967.9316 1967.9316 K E 203 222 PSM DDKHGSYEDAVHSGALND 349 sp|P17987|TCPA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45 3-UNIMOD:1031 ms_run[2]:scan=15826 48.129 2 2124.9348 2124.9348 K - 539 557 PSM DLKSNNILLLQPIESDDMEHK 350 sp|Q16584|M3K11_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45 3-UNIMOD:1031,18-UNIMOD:35 ms_run[2]:scan=29759 85.716 3 2663.3476 2663.3476 R T 241 262 PSM DVDDGLQAAEEVGYPVMIKASEGGGGK 351 sp|Q13085|ACACA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45 17-UNIMOD:35,19-UNIMOD:1031 ms_run[2]:scan=28938 83.426 3 2903.3859 2903.3859 K G 293 320 PSM EDKQPEQATTSAQVACLYR 352 sp|P18858-3|DNLI1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45 3-UNIMOD:1031,16-UNIMOD:4 ms_run[2]:scan=19794 58.58 2 2390.1536 2390.1536 R K 849 868 PSM ETVSEESNVLCLSKSPNK 353 sp|P13639|EF2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45 11-UNIMOD:4,14-UNIMOD:1031 ms_run[2]:scan=22642 66.16 2 2216.0995 2216.0995 R H 581 599 PSM FELGKLMELHGEGSSSGK 354 sp|P61247|RS3A_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45 5-UNIMOD:1031 ms_run[2]:scan=26526 76.672 3 2101.0514 2101.0514 K A 223 241 PSM FGLSVGHHLGKSIPTDNQIK 355 sp|P15559-3|NQO1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45 11-UNIMOD:1031 ms_run[2]:scan=21272 62.526 3 2343.2699 2343.2699 K A 214 234 PSM FSAYIKNSNPALNDNLEK 356 sp|O00299|CLIC1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45 6-UNIMOD:1031 ms_run[2]:scan=23570 68.635 2 2233.1379 2233.1379 K G 114 132 PSM GFCFLEYEDHKSAAQAR 357 sp|O43390-4|HNRPR_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45 3-UNIMOD:4,11-UNIMOD:1031 ms_run[2]:scan=23716 69.019 2 2224.0371 2224.0371 R R 192 209 PSM GGHGAASPSEKGAHPSGGADDVAK 358 sp|Q07065|CKAP4_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45 11-UNIMOD:1031 ms_run[2]:scan=7876 27.015 3 2355.1203 2355.1203 K K 11 35 PSM GGVGKTTCSCSLAVQLSK 359 sp|O43681|ASNA_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45 5-UNIMOD:1031,8-UNIMOD:4,10-UNIMOD:4 ms_run[2]:scan=21007 61.777 2 2048.0394 2048.0394 K G 46 64 PSM GVNLPGAAVDLPAVSEKDIQDLK 360 sp|P14618|KPYM_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45 17-UNIMOD:1031 ms_run[2]:scan=31840 91.614 2 2544.3799 2544.3799 K F 208 231 PSM HQKVVEIAPAAHLDPQLR 361 sp|P11498-2|PYC_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45 3-UNIMOD:1031 ms_run[2]:scan=21464 63.034 3 2217.2382 2217.2382 R T 271 289 PSM IAESNHIKLSGSNPYTTVTPQIINSK 362 sp|O43707-2|ACTN4_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45 8-UNIMOD:1031 ms_run[2]:scan=23490 68.422 3 3007.5978 3007.5979 R W 378 404 PSM KTTTLSGTAPAAGVVPSR 363 sp|P27816-6|MAP4_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45 1-UNIMOD:1031 ms_run[2]:scan=19185 56.978 2 1909.0633 1909.0633 K V 871 889 PSM LIGDAAKNQLTSNPENTVFDAK 364 sp|P11021|BIP_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45 7-UNIMOD:1031 ms_run[2]:scan=26226 75.86 3 2541.3075 2541.3075 R R 75 97 PSM LIGDAAKNQVALNPQNTVFDAK 365 sp|P0DMV9|HS71B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45 7-UNIMOD:1031 ms_run[2]:scan=26942 77.88 3 2522.3493 2522.3493 R R 50 72 PSM LIGDAAKNQVAMNPTNTVFDAK 366 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45 7-UNIMOD:1031,12-UNIMOD:35 ms_run[2]:scan=24357 70.745 3 2529.2897 2529.2897 R R 50 72 PSM LIGDAAKNQVAMNPTNTVFDAK 367 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45 7-UNIMOD:1031,12-UNIMOD:35 ms_run[2]:scan=26458 76.491 2 2529.2897 2529.2897 R R 50 72 PSM LLLQVQHASKQITADK 368 sp|P05141|ADT2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45 10-UNIMOD:1031 ms_run[2]:scan=20424 60.245 2 1988.1419 1988.1419 K Q 34 50 PSM LLQKGIHPTIISESFQK 369 sp|P50991|TCPD_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45 4-UNIMOD:1031 ms_run[2]:scan=24625 71.459 3 2134.215 2134.2150 K A 123 140 PSM LVVPASQCGSLIGKGGCK 370 sp|Q15366-7|PCBP2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45 8-UNIMOD:4,14-UNIMOD:1031,17-UNIMOD:4 ms_run[2]:scan=22632 66.133 2 2026.0704 2026.0704 R I 102 120 PSM PKGLAYVEYENESQASQAVMK 371 sp|Q15020-4|SART3_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45 2-UNIMOD:1031 ms_run[2]:scan=24122 70.112 3 2537.2472 2537.2472 K M 804 825 PSM PLVVFVLGGPGAGKGTQCAR 372 sp|P30085-3|KCY_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45 14-UNIMOD:1031,18-UNIMOD:4 ms_run[2]:scan=30444 87.674 3 2179.1936 2179.1936 K I 35 55 PSM QNEINNPKFNFLNPNDPYHAYYR 373 sp|Q15459|SF3A1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45 8-UNIMOD:1031 ms_run[2]:scan=28721 82.819 3 3063.4628 3063.4628 R H 73 96 PSM SFSKESDDPMAYIHFTAEGEVTFK 374 sp|P14625|ENPL_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45 4-UNIMOD:1031,10-UNIMOD:35 ms_run[2]:scan=27972 80.763 3 2947.3586 2947.3586 K S 361 385 PSM SGDAAIVDMVPGKPMCVESFSDYPPLGR 375 sp|Q5VTE0|EF1A3_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45 16-UNIMOD:4 ms_run[2]:scan=28795 83.023 3 2994.3925 2994.3926 K F 396 424 PSM SGVKIHVSDQELQSANASVDDSR 376 sp|P22314-2|UBA1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45 4-UNIMOD:1031 ms_run[2]:scan=19198 57.012 3 2637.2994 2637.2994 K L 763 786 PSM SINPDEAVAYGAAVQAAILSGDK 377 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45 23-UNIMOD:259 ms_run[2]:scan=32647 94.084 2 2267.1525 2267.1525 K S 362 385 PSM SKGFGFVCFSSPEEATK 378 sp|Q13310-2|PABP4_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45 2-UNIMOD:1031,8-UNIMOD:4 ms_run[2]:scan=28511 82.247 2 2072.9877 2072.9877 R A 332 349 PSM SKSEEAHAEDSVMDHHFR 379 sp|Q8NC51-3|PAIRB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45 2-UNIMOD:1031 ms_run[2]:scan=13077 40.917 4 2307.0338 2307.0338 K K 313 331 PSM TKAIEHADGGVAAGVAVLDNPYPV 380 sp|P48637-2|GSHB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45 2-UNIMOD:1031 ms_run[2]:scan=28823 83.101 3 2559.3333 2559.3333 R - 340 364 PSM TKENVNATENCISAVGK 381 sp|O00410-2|IPO5_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45 2-UNIMOD:1031,11-UNIMOD:4 ms_run[2]:scan=16884 50.93 2 2030.0103 2030.0103 K I 902 919 PSM TVALDGTLFQKSGVISGGASDLK 382 sp|Q14683|SMC1A_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45 11-UNIMOD:1031 ms_run[2]:scan=31381 90.304 3 2459.3272 2459.3272 K A 638 661 PSM VAQGVSGAVQDKGSIHK 383 sp|P12268|IMDH2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45 12-UNIMOD:1031 ms_run[2]:scan=14322 44.188 2 1876.0167 1876.0167 K F 439 456 PSM VEEGMHLLITGPNGCGKSSLFR 384 sp|P33897|ABCD1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45 15-UNIMOD:4,17-UNIMOD:1031 ms_run[2]:scan=28378 81.88 3 2597.3094 2597.3094 R I 497 519 PSM VFGALKGAVDGGLSIPHSTK 385 sp|P46777|RL5_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45 6-UNIMOD:1031 ms_run[2]:scan=26891 77.736 3 2149.1895 2149.1895 K R 159 179 PSM VGNPFELDTQQGPQVDKEQFER 386 sp|P30837|AL1B1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45 17-UNIMOD:1031 ms_run[2]:scan=27432 79.266 3 2756.3406 2756.3406 K V 348 370 PSM VIHDNFGIVEGLMTTVHAITATQKTVDGPSGK 387 sp|P04406|G3P_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45 13-UNIMOD:35,24-UNIMOD:1031 ms_run[2]:scan=32929 94.902 4 3547.8345 3547.8345 K L 163 195 PSM VILHLKEDQTEYLEER 388 sp|P07900|HS90A_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45 6-UNIMOD:1031 ms_run[2]:scan=23412 68.212 2 2210.1583 2210.1583 K R 186 202 PSM VMIGENVDEKHLPTLDHPIIPADYVAIK 389 sp|P31327|CPSM_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45 10-UNIMOD:1031 ms_run[2]:scan=30633 88.199 4 3322.7635 3322.7635 K A 1282 1310 PSM VMLGETNPADSKPGTIR 390 sp|P22392|NDKB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45 2-UNIMOD:35,12-UNIMOD:1031 ms_run[2]:scan=19585 58.035 2 1997.0252 1997.0252 R G 89 106 PSM VNGKAGNLGGGVVTIER 391 sp|P35268|RL22_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45 4-UNIMOD:1031 ms_run[2]:scan=21320 62.655 2 1836.0217 1836.0217 K S 49 66 PSM VQELGHGCAALVTKAGALQCSPSDAYTK 392 sp|Q9Y490|TLN1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45 8-UNIMOD:4,14-UNIMOD:1031,20-UNIMOD:4 ms_run[2]:scan=23799 69.242 3 3127.5431 3127.5431 R K 1920 1948 PSM VSDFGLTKEASSTQDTGK 393 sp|P41240|CSK_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45 8-UNIMOD:1031,18-UNIMOD:1031 ms_run[2]:scan=20604 60.718 2 2074.031 2074.0310 K L 330 348 PSM VSLDVNHFAPDELTVKTK 394 sp|P04792|HSPB1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45 16-UNIMOD:1031 ms_run[2]:scan=26095 75.506 3 2208.179 2208.1790 R D 97 115 PSM VSLDVNHFAPDELTVKTK 395 sp|P04792|HSPB1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45 16-UNIMOD:1031 ms_run[2]:scan=26114 75.555 2 2208.179 2208.1790 R D 97 115 PSM VVLAYEPVWAIGTGKTATPQQAQEVHEK 396 sp|P60174-1|TPIS_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45 15-UNIMOD:1031 ms_run[2]:scan=28515 82.257 3 3245.7085 3245.7085 K L 161 189 PSM WGEDNHWICKPWNLAR 397 sp|Q14166|TTL12_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45 9-UNIMOD:4,10-UNIMOD:1031 ms_run[2]:scan=29290 84.398 2 2277.0902 2277.0902 R S 410 426 PSM YDNSLKIISNASCTTNCLAPLAK 398 sp|P04406|G3P_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45 6-UNIMOD:1031,13-UNIMOD:4,17-UNIMOD:4 ms_run[2]:scan=28619 82.543 2 2749.3779 2749.3779 K V 140 163 PSM YGKDATNVGDEGGFAPNILENK 399 sp|P06733|ENOA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 45 3-UNIMOD:1031 ms_run[2]:scan=25794 74.689 3 2504.2183 2504.2183 K E 200 222 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 400 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 45 1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=33642 96.835961 3 2991.3552 2990.3382 M A 2 29 PSM EEEIAALVIDNGSGMCKAGFAGDDAPR 401 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 45 1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=33845 97.379136 3 3048.4242 3046.4002 M A 2 29 PSM AENDVDNELLDYEDDEVETAAGGDGAEAPAKK 402 sp|Q13838|DX39B_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 45 1-UNIMOD:1,31-UNIMOD:1031 ms_run[1]:scan=29299 84.420065 3 3587.5924 3587.5906 M D 2 34 PSM KEGICALGGTSELSSEGTQHSYSEEEK 403 sp|P13797|PLST_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 45 1-UNIMOD:259,5-UNIMOD:4,27-UNIMOD:259 ms_run[1]:scan=22728 66.390978 3 2931.316984 2928.326574 R Y 100 127 PSM AGGKILTFDQLALDSPK 404 sp|Q07020|RL18_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44 4-UNIMOD:1031 ms_run[2]:scan=31054 89.389 2 1969.0884 1969.0884 R G 116 133 PSM ALKVLDNYLTSPLPEEVDETSAEDEGVSQR 405 sp|O00299|CLIC1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44 3-UNIMOD:1031 ms_run[2]:scan=32152 92.502 3 3499.7206 3499.7206 K K 136 166 PSM ALYEQNQSDVNEAKSGGR 406 sp|Q14691|PSF1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44 14-UNIMOD:1031 ms_run[2]:scan=15022 46.015 2 2161.04 2161.0400 K S 38 56 PSM AQAYQTGKDISTNYYASQK 407 sp|P14625|ENPL_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44 8-UNIMOD:1031 ms_run[2]:scan=18574 55.373 2 2332.1335 2332.1335 K K 664 683 PSM ASSHSSQTQGGGSVTKK 408 sp|P02545-6|LMNA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44 16-UNIMOD:1031 ms_run[2]:scan=5857 21.574 2 1841.9232 1841.9232 R R 402 419 PSM AVEHINKTIAPALVSK 409 sp|P06733|ENOA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44 7-UNIMOD:1031 ms_run[2]:scan=21360 62.763 2 1886.0989 1886.0989 K K 65 81 PSM DLKSNNILLLQPIESDDMEHK 410 sp|Q16584|M3K11_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44 3-UNIMOD:1031 ms_run[2]:scan=30825 88.742 3 2647.3527 2647.3527 R T 241 262 PSM DLYANTVLSGGTTMYPGIADR 411 sp|P60709|ACTB_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44 14-UNIMOD:35 ms_run[2]:scan=23991 69.76 2 2230.0576 2230.0576 K M 292 313 PSM ETGSSKGFGFVDFNSEEDAK 412 sp|P19338|NUCL_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44 6-UNIMOD:1031 ms_run[2]:scan=27275 78.788 2 2346.0652 2346.0652 R A 605 625 PSM EYHLAINKEPNSLHGGVR 413 sp|Q96C23|GALM_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44 8-UNIMOD:1031 ms_run[2]:scan=18841 56.075 2 2229.1654 2229.1654 K G 94 112 PSM GALQNIIPASTGAAKAVGK 414 sp|P04406|G3P_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44 15-UNIMOD:1031 ms_run[2]:scan=25321 73.415 2 1962.1262 1962.1262 R V 201 220 PSM IAAKFITHAPPGEFNEVFNDVR 415 sp|P52907|CAZA1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44 4-UNIMOD:1031 ms_run[2]:scan=29072 83.797 3 2667.3809 2667.3809 R L 16 38 PSM IGSSMKSVGEVMAIGR 416 sp|P31327|CPSM_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44 5-UNIMOD:35,6-UNIMOD:1031,12-UNIMOD:35 ms_run[2]:scan=19171 56.941 2 1848.9438 1848.9438 R T 788 804 PSM IGSSMKSVGEVMAIGR 417 sp|P31327|CPSM_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44 6-UNIMOD:1031 ms_run[2]:scan=26525 76.669 2 1816.9539 1816.9539 R T 788 804 PSM IIGAKDHASIQMNVAEVDK 418 sp|P63220|RS21_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44 5-UNIMOD:1031 ms_run[2]:scan=21384 62.826 3 2234.1729 2234.1729 R V 23 42 PSM IISNASCTTNCLAPLAK 419 sp|P04406|G3P_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44 7-UNIMOD:4,11-UNIMOD:4,17-UNIMOD:259 ms_run[2]:scan=16607 50.2 2 1840.9267 1840.9267 K V 146 163 PSM ILQDGGLQVVEKQNLSK 420 sp|O43175|SERA_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44 12-UNIMOD:1031 ms_run[2]:scan=24296 70.574 2 2064.1579 2064.1579 K E 22 39 PSM ISGASEKDIVHSGLAYTMER 421 sp|P00367-2|DHE3_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44 7-UNIMOD:1031 ms_run[2]:scan=24518 71.174 3 2359.1842 2359.1842 R S 330 350 PSM KELNSNHDGADETSEK 422 sp|Q01105-2|SET_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44 1-UNIMOD:1031 ms_run[2]:scan=8375 28.341 2 1968.9025 1968.9025 K E 11 27 PSM KGDILLDENCCVESLPDK 423 sp|Q9UH65|SWP70_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44 1-UNIMOD:1031,10-UNIMOD:4,11-UNIMOD:4 ms_run[2]:scan=24921 72.26 2 2300.1028 2300.1028 K D 251 269 PSM KQGGLGPMNIPLVSDPK 424 sp|Q06830|PRDX1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44 1-UNIMOD:1031 ms_run[2]:scan=28363 81.84 2 1946.0659 1946.0659 K R 93 110 PSM KSEYTQPTPIQCQGVPVALSGR 425 sp|Q86XP3-2|DDX42_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44 1-UNIMOD:1031,12-UNIMOD:4 ms_run[2]:scan=23000 67.115 3 2611.3428 2611.3428 R D 151 173 PSM KTPQGPPEIYSDTQFPSLQSTAK 426 sp|Q9UKY7-2|CDV3_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44 1-UNIMOD:1031 ms_run[2]:scan=25536 73.996 3 2715.3756 2715.3756 R H 181 204 PSM LAGANPAVITCDELLLGHEKAPAFR 427 sp|P78527-2|PRKDC_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44 11-UNIMOD:4,20-UNIMOD:1031 ms_run[2]:scan=30093 86.652 3 2858.5113 2858.5113 K D 4020 4045 PSM LGPKSSVLIAQQTDTSDPEK 428 sp|P46060|RAGP1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44 4-UNIMOD:1031 ms_run[2]:scan=22474 65.718 2 2309.2115 2309.2115 R V 449 469 PSM LIGDAAKNQVAMNPTNTVFDAK 429 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44 7-UNIMOD:1031,12-UNIMOD:35 ms_run[2]:scan=24487 71.092 3 2529.2897 2529.2897 R R 50 72 PSM LIGDAAKNQVAMNPTNTVFDAK 430 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44 7-UNIMOD:1031,12-UNIMOD:35 ms_run[2]:scan=25031 72.568 3 2529.2897 2529.2897 R R 50 72 PSM LIGDAAKNQVAMNPTNTVFDAK 431 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44 7-UNIMOD:1031,12-UNIMOD:35 ms_run[2]:scan=25149 72.935 3 2529.2897 2529.2897 R R 50 72 PSM LIGDAAKNQVAMNPTNTVFDAK 432 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44 7-UNIMOD:1031,12-UNIMOD:35 ms_run[2]:scan=26069 75.437 3 2529.2897 2529.2897 R R 50 72 PSM LIGDAAKNQVAMNPTNTVFDAK 433 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44 7-UNIMOD:1031,12-UNIMOD:35 ms_run[2]:scan=26252 75.928 3 2529.2897 2529.2897 R R 50 72 PSM LIGDAAKNQVAMNPTNTVFDAK 434 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44 7-UNIMOD:1031,12-UNIMOD:35 ms_run[2]:scan=26510 76.629 3 2529.2897 2529.2897 R R 50 72 PSM LIGDAAKNQVAMNPTNTVFDAK 435 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44 7-UNIMOD:1031,22-UNIMOD:1031 ms_run[2]:scan=26621 76.922 2 2521.309 2521.3090 R R 50 72 PSM LNFSHGTHEYHAETIKNVR 436 sp|P14618|KPYM_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44 16-UNIMOD:1031 ms_run[2]:scan=14848 45.562 4 2448.2298 2448.2298 R T 74 93 PSM LSGPLKEQYAQEHGLNFQR 437 sp|Q15126|PMVK_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44 6-UNIMOD:1031 ms_run[2]:scan=22403 65.529 3 2410.2393 2410.2393 R L 43 62 PSM LTGIKHELQANCYEEVK 438 sp|P23528|COF1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44 5-UNIMOD:1031,12-UNIMOD:4 ms_run[2]:scan=20357 60.069 2 2227.1307 2227.1307 K D 128 145 PSM MDSTANEVEAVKVHSFPTLK 439 sp|P07237|PDIA1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44 1-UNIMOD:35,12-UNIMOD:1031 ms_run[2]:scan=26840 77.591 3 2414.2152 2414.2152 K F 425 445 PSM NAKISSLLEEQFQQGK 440 sp|P62241|RS8_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44 3-UNIMOD:1031 ms_run[2]:scan=28356 81.82 2 2015.0688 2015.0688 K L 155 171 PSM NALIHKSSVNCPFSSQDMK 441 sp|Q08211|DHX9_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44 6-UNIMOD:1031,11-UNIMOD:4 ms_run[2]:scan=20643 60.82 3 2358.146 2358.1460 R Y 1019 1038 PSM PATAGKAGGAAVVITEPEHTK 442 sp|Q9P258|RCC2_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44 6-UNIMOD:1031 ms_run[2]:scan=17711 53.1 3 2200.1852 2200.1852 R E 72 93 PSM QAQYLGMSCDGPFKPDHYR 443 sp|P23526-2|SAHH_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44 9-UNIMOD:4,14-UNIMOD:1031 ms_run[2]:scan=22618 66.096 3 2465.1256 2465.1256 K Y 385 404 PSM QLQQAQAAGAEQEVEKFTK 444 sp|P39748-2|FEN1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44 16-UNIMOD:1031 ms_run[2]:scan=23450 68.315 3 2299.1808 2299.1808 K R 46 65 PSM SGDAAIVDMVPGKPMCVESFSDYPPLGR 445 sp|Q5VTE0|EF1A3_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44 13-UNIMOD:1031,16-UNIMOD:4 ms_run[2]:scan=33311 95.978 3 3190.5137 3190.5137 K F 396 424 PSM SGSKAFLDALQNQAEASSK 446 sp|Q12931-2|TRAP1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44 4-UNIMOD:1031 ms_run[2]:scan=26844 77.603 2 2147.0859 2147.0859 R I 125 144 PSM SKSEEAHAEDSVMDHHFR 447 sp|Q8NC51-3|PAIRB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44 2-UNIMOD:1031,13-UNIMOD:35 ms_run[2]:scan=10066 32.834 3 2323.0288 2323.0288 K K 313 331 PSM SKSEEAHAEDSVMDHHFR 448 sp|Q8NC51-3|PAIRB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44 2-UNIMOD:1031 ms_run[2]:scan=13074 40.91 3 2307.0338 2307.0338 K K 313 331 PSM SLVSVTKEGLELPEDEEEK 449 sp|P08238|HS90B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44 7-UNIMOD:1031 ms_run[2]:scan=28310 81.693 2 2326.1792 2326.1792 K K 532 551 PSM STAGDTHLGGEDFDNR 450 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44 ms_run[2]:scan=8218 27.923 2 1690.7183 1690.7183 K M 221 237 PSM STPKEDDSSASTSQSTR 451 sp|P23588-2|IF4B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44 4-UNIMOD:1031 ms_run[2]:scan=8198 27.873 2 1978.908 1978.9080 R A 301 318 PSM TAFDDAIAELDTLNEDSYK 452 sp|P61981|1433G_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44 ms_run[2]:scan=31494 90.627 2 2129.9641 2129.9641 K D 199 218 PSM TFIIGISGVTNSGKTTLAK 453 sp|Q9NWW6-2|NRK1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44 14-UNIMOD:1031 ms_run[2]:scan=29047 83.729 2 2103.194 2103.1940 K N 3 22 PSM TFIIGISGVTNSGKTTLAK 454 sp|Q9NWW6-2|NRK1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44 14-UNIMOD:1031,19-UNIMOD:1031 ms_run[2]:scan=29082 83.825 2 2111.2082 2111.2082 K N 3 22 PSM TKAIEHADGGVAAGVAVLDNPYPV 455 sp|P48637-2|GSHB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44 2-UNIMOD:1031 ms_run[2]:scan=28827 83.111 2 2559.3333 2559.3333 R - 340 364 PSM TKSTGGAPTFNVTVTK 456 sp|P07737|PROF1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44 2-UNIMOD:1031 ms_run[2]:scan=19981 59.076 2 1803.9731 1803.9731 R T 90 106 PSM TYDATTHFETTCDDIK 457 sp|P50395-2|GDIB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44 12-UNIMOD:4,16-UNIMOD:259 ms_run[2]:scan=11963 37.924 2 1924.824 1924.8240 R N 358 374 PSM VAPEEHPVLLTEAPLNPKANR 458 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44 18-UNIMOD:1031 ms_run[2]:scan=24311 70.616 3 2490.3595 2490.3595 R E 96 117 PSM VDEAVAVLQAHQAKEAAQK 459 sp|P11940|PABP1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44 14-UNIMOD:1031 ms_run[2]:scan=19883 58.814 3 2201.1804 2201.1804 K A 607 626 PSM VEEGMHLLITGPNGCGKSSLFR 460 sp|P33897|ABCD1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44 5-UNIMOD:35,15-UNIMOD:4,17-UNIMOD:1031 ms_run[2]:scan=25459 73.786 3 2613.3043 2613.3043 R I 497 519 PSM VIISAPSADAPMFVMGVNHEKYDNSLK 461 sp|P04406|G3P_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44 15-UNIMOD:35,21-UNIMOD:1031 ms_run[2]:scan=27305 78.886 3 3144.5624 3144.5624 R I 119 146 PSM VLISSLQDCLHGIESKSYGSGSR 462 sp|Q16630-3|CPSF6_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 44 9-UNIMOD:4,16-UNIMOD:1031 ms_run[2]:scan=28278 81.603 3 2688.3541 2688.3541 K R 395 418 PSM QSKPVTTPEEIAQVATISANGDK 463 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 44 3-UNIMOD:1031 ms_run[1]:scan=27331 78.967871 3 2579.335084 2579.344262 K E 158 181 PSM EEEIAALVIDNGSGMCKAGFAGDDAPR 464 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 44 1-UNIMOD:1,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=34137 98.208839 3 3030.4053 3030.4058 M A 2 29 PSM SGDAAIVDMVPGKPMCVESFSDYPPLGR 465 sp|P68104|EF1A1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 44 9-UNIMOD:35,13-UNIMOD:1031,15-UNIMOD:35,16-UNIMOD:4 ms_run[1]:scan=32659 94.118504 3 3223.534200 3222.503559 K F 396 424 PSM VNVPVIGGHAGKTIIPLISQCTPK 466 sp|P40926|MDHM_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 44 12-UNIMOD:1031,21-UNIMOD:4 ms_run[1]:scan=30109 86.694535 3 2695.538568 2694.525478 R V 192 216 PSM LGNNCVFAPADVTSEKDVQTALALAK 467 sp|Q99714|HCD2_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 44 5-UNIMOD:4,16-UNIMOD:1031 ms_run[1]:scan=32302 93.000066 3 2926.503650 2927.506259 K G 54 80 PSM KLAQQYYLVYQEPIPTAQLVQR 468 sp|P25787|PSA2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 44 1-UNIMOD:1031 ms_run[1]:scan=30335 87.313763 3 2844.545531 2844.553801 R V 92 114 PSM KEGICALGGTSELSSEGTQHSYSEEEK 469 sp|P13797|PLST_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 44 1-UNIMOD:259,5-UNIMOD:4 ms_run[1]:scan=22716 66.359369 3 2923.305812 2920.312375 R Y 100 127 PSM AAAPAPEEEMDECEQALAAEPKAK 470 sp|P26641|EF1G_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43 13-UNIMOD:4,24-UNIMOD:1031 ms_run[2]:scan=22451 65.656 3 2751.2731 2751.2731 K D 254 278 PSM ATGHEFAVKIMEVTAER 471 sp|P15735|PHKG2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43 9-UNIMOD:1031 ms_run[2]:scan=27950 80.703 2 2084.0725 2084.0725 R L 45 62 PSM AVYTQDCPLAAAKAIQGLR 472 sp|P49588|SYAC_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43 7-UNIMOD:4,13-UNIMOD:1031 ms_run[2]:scan=29086 83.834 3 2241.194 2241.1940 K A 665 684 PSM DIKAANVLLSEHGEVK 473 sp|Q9Y6E0-2|STK24_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43 3-UNIMOD:1031 ms_run[2]:scan=23361 68.075 2 1918.0524 1918.0524 R L 144 160 PSM DIKGANILLTDHGDVK 474 sp|Q9Y4K4|M4K5_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43 3-UNIMOD:1031 ms_run[2]:scan=24198 70.313 2 1904.0367 1904.0367 R L 140 156 PSM DKPHVNVGTIGHVDHGK 475 sp|P49411|EFTU_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43 2-UNIMOD:1031 ms_run[2]:scan=15291 46.719 4 2005.0494 2005.0494 R T 54 71 PSM DSVVAGFQWATKEGALCEENMR 476 sp|P13639|EF2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43 12-UNIMOD:1031,17-UNIMOD:4 ms_run[2]:scan=31509 90.669 3 2693.2578 2693.2578 K G 677 699 PSM EEAPDILCLQETKCSENK 477 sp|P27695|APEX1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43 8-UNIMOD:4,13-UNIMOD:1031,14-UNIMOD:4 ms_run[2]:scan=25019 72.537 2 2359.1036 2359.1036 K L 86 104 PSM ELAVKQVQFDPDSPETSK 478 sp|Q9Y2U5|M3K2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43 5-UNIMOD:1031 ms_run[2]:scan=24702 71.666 2 2213.1216 2213.1216 R E 381 399 PSM ENQCVIISGESGAGKTVAAK 479 sp|Q12965|MYO1E_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43 4-UNIMOD:4,15-UNIMOD:1031 ms_run[2]:scan=18808 55.989 2 2214.1314 2214.1314 R Y 104 124 PSM EQQAQVEKEDFSDMVAEHAAK 480 sp|Q13435|SF3B2_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43 8-UNIMOD:1031 ms_run[2]:scan=23903 69.519 3 2585.2068 2585.2068 R Q 850 871 PSM ESGQVVAIKQVPVESDLQEIIK 481 sp|Q13188|STK3_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43 9-UNIMOD:1031 ms_run[2]:scan=33206 95.707 3 2604.4374 2604.4374 K E 48 70 PSM EVDEQMLNVQNKNSSYFVEWIPNNVK 482 sp|P07437|TBB5_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43 6-UNIMOD:35,12-UNIMOD:1031 ms_run[2]:scan=31860 91.67 3 3335.6132 3335.6132 K T 325 351 PSM GADFLVTEVENGGSLGSKK 483 sp|P14618|KPYM_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43 18-UNIMOD:1031 ms_run[2]:scan=27289 78.834 2 2103.0848 2103.0848 K G 189 208 PSM GDGPVQGIINFEQKESNGPVK 484 sp|P00441|SODC_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43 14-UNIMOD:1031 ms_run[2]:scan=27988 80.806 2 2408.2336 2408.2336 K V 11 32 PSM GILLYGPPGCGKTLLAR 485 sp|P46459-2|NSF_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43 10-UNIMOD:4,12-UNIMOD:1031 ms_run[2]:scan=30119 86.722 2 1981.1183 1981.1183 K Q 161 178 PSM GKLQGHDVDFLITHPK 486 sp|Q9NP87|DPOLM_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43 2-UNIMOD:1031 ms_run[2]:scan=21411 62.896 3 2000.0843 2000.0843 R E 324 340 PSM GMGSLDAMDKHLSSQNR 487 sp|P12268|IMDH2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43 2-UNIMOD:35,10-UNIMOD:1031 ms_run[2]:scan=16583 50.137 2 2057.9623 2057.9623 R Y 413 430 PSM GTEAGQVGEPGIPTGEAGPSCSSASDKLPR 488 sp|O15355|PPM1G_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43 21-UNIMOD:4,27-UNIMOD:1031 ms_run[2]:scan=21771 63.846 3 3107.483 3107.4830 R V 221 251 PSM GVLMYGPPGTGKTLLAR 489 sp|P17980|PRS6A_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43 4-UNIMOD:35,12-UNIMOD:1031 ms_run[2]:scan=26447 76.46 2 1942.071 1942.0710 K A 222 239 PSM GVLMYGPPGTGKTLLAR 490 sp|P17980|PRS6A_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43 4-UNIMOD:35,12-UNIMOD:1031 ms_run[2]:scan=27640 79.848 2 1942.071 1942.0710 K A 222 239 PSM HIYYITGETKDQVANSAFVER 491 sp|P07900|HS90A_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43 10-UNIMOD:1031 ms_run[2]:scan=24506 71.141 3 2636.3235 2636.3235 K L 490 511 PSM HNIICLQNDHKAVMK 492 sp|O00233-2|PSMD9_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43 5-UNIMOD:4,11-UNIMOD:1031,14-UNIMOD:35 ms_run[2]:scan=14835 45.528 3 2032.0346 2032.0346 R Q 77 92 PSM HNIICLQNDHKAVMK 493 sp|O00233-2|PSMD9_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43 5-UNIMOD:4,11-UNIMOD:1031 ms_run[2]:scan=17204 51.771 3 2016.0397 2016.0397 R Q 77 92 PSM HNIICLQNDHKAVMK 494 sp|O00233-2|PSMD9_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43 5-UNIMOD:4,11-UNIMOD:1031 ms_run[2]:scan=17217 51.805 2 2016.0397 2016.0397 R Q 77 92 PSM IEWLESHQDADIEDFKAK 495 sp|P11021|BIP_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43 16-UNIMOD:1031 ms_run[2]:scan=26084 75.477 3 2369.1539 2369.1539 K K 602 620 PSM IGSSMKSVGEVMAIGR 496 sp|P31327|CPSM_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43 6-UNIMOD:1031,12-UNIMOD:35 ms_run[2]:scan=21931 64.27 2 1832.9488 1832.9488 R T 788 804 PSM IKVDEFVTHNLSFDEINK 497 sp|P11766|ADHX_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43 2-UNIMOD:1031 ms_run[2]:scan=28096 81.105 3 2343.2111 2343.2111 K A 340 358 PSM ILCFYGPPGVGKTSIAR 498 sp|P36776-3|LONM_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43 3-UNIMOD:4,12-UNIMOD:1031 ms_run[2]:scan=28284 81.621 2 2031.0976 2031.0976 K S 322 339 PSM IQVTPPGFQLVFLPFADDKR 499 sp|P12956|XRCC6_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43 19-UNIMOD:1031 ms_run[2]:scan=33686 96.955 3 2483.3577 2483.3577 K K 425 445 PSM ISGASEKDIVHSGLAYTMER 500 sp|P00367-2|DHE3_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43 7-UNIMOD:1031,18-UNIMOD:35 ms_run[2]:scan=22178 64.933 3 2375.1791 2375.1791 R S 330 350 PSM KELNSNHDGADETSEK 501 sp|Q01105-2|SET_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43 1-UNIMOD:1031 ms_run[2]:scan=8368 28.324 3 1968.9025 1968.9025 K E 11 27 PSM KHSQFIGYPITLYLEK 502 sp|P08238|HS90B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43 1-UNIMOD:1031 ms_run[2]:scan=29417 84.748 2 2132.167 2132.1670 K E 204 220 PSM KHYFYADLPAGYQITQQR 503 sp|O75879|GATB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43 1-UNIMOD:1031 ms_run[2]:scan=24623 71.454 2 2394.2121 2394.2121 R L 139 157 PSM LAPITSDPTEATAVGAVEASFK 504 sp|P14618|KPYM_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43 22-UNIMOD:259 ms_run[2]:scan=27495 79.444 2 2182.1249 2182.1249 R C 401 423 PSM LAQSHHVKQVLVAPGNAGTACSEK 505 sp|P22102|PUR2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43 8-UNIMOD:1031,21-UNIMOD:4 ms_run[2]:scan=15415 47.041 3 2697.4021 2697.4021 K I 21 45 PSM LCVPAMNVNDSVTKQK 506 sp|O43865|SAHH2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43 2-UNIMOD:4,6-UNIMOD:35,14-UNIMOD:1031 ms_run[2]:scan=18071 54.052 2 2015.018 2015.0180 K F 271 287 PSM LDINTNTYTSQDLKSALAK 507 sp|Q9H173|SIL1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43 14-UNIMOD:1031 ms_run[2]:scan=27484 79.413 2 2291.2009 2291.2009 R F 119 138 PSM LDKSQIHDIVLVGGSTR 508 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43 3-UNIMOD:1031 ms_run[2]:scan=25834 74.799 2 2033.1269 2033.1269 K I 326 343 PSM LIGDAAKNQVAMNPTNTVFDAK 509 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43 7-UNIMOD:1031,12-UNIMOD:35 ms_run[2]:scan=25273 73.285 2 2529.2897 2529.2897 R R 50 72 PSM LIGDAAKNQVAMNPTNTVFDAK 510 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43 7-UNIMOD:1031 ms_run[2]:scan=26824 77.546 2 2513.2948 2513.2948 R R 50 72 PSM LITEDVQGKNCLTNFHGMDLTR 511 sp|P61247|RS3A_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43 9-UNIMOD:1031,11-UNIMOD:4,18-UNIMOD:35 ms_run[2]:scan=23516 68.492 3 2773.3527 2773.3527 K D 86 108 PSM LTGIKHELQANCYEEVK 512 sp|P23528|COF1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43 5-UNIMOD:1031,12-UNIMOD:4 ms_run[2]:scan=20328 59.99 3 2227.1307 2227.1307 K D 128 145 PSM NKHSSGQQNLNTITYETLK 513 sp|O75575|RPC9_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43 2-UNIMOD:1031 ms_run[2]:scan=18035 53.958 3 2371.2132 2371.2132 K Y 33 52 PSM NLGTIAKSGTSEFLNK 514 sp|P14625|ENPL_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43 7-UNIMOD:1031 ms_run[2]:scan=24967 72.386 2 1875.0102 1875.0102 K M 162 178 PSM QATYGYYLGNPAEFHDSSDHHTFKK 515 sp|Q15293|RCN1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43 24-UNIMOD:1031 ms_run[2]:scan=19771 58.518 4 3108.4366 3108.4366 K M 142 167 PSM QDLPNAMNAAEITDKLGLHSLR 516 sp|P84077|ARF1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43 15-UNIMOD:1031 ms_run[2]:scan=31871 91.7 3 2602.3537 2602.3537 K H 128 150 PSM QFTSSSSIKGSSGLGGGSSR 517 sp|Q04695|K1C17_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43 9-UNIMOD:1031 ms_run[2]:scan=18322 54.712 2 2082.0342 2082.0342 R T 7 27 PSM SSFYVNGLTLGGQKCSVIR 518 sp|P07737|PROF1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43 14-UNIMOD:1031,15-UNIMOD:4 ms_run[2]:scan=28684 82.716 2 2281.1889 2281.1889 R D 57 76 PSM SVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSK 519 sp|P67809|YBOX1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43 17-UNIMOD:1031 ms_run[2]:scan=27843 80.408 3 3667.7853 3667.7853 R Y 102 138 PSM TALLDAAGVASLLTTAEVVVTEIPK 520 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43 ms_run[2]:scan=34128 98.18 2 2481.3942 2481.3942 R E 527 552 PSM TATESFASDPILYRPVAVALDTK 521 sp|P14618|KPYM_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43 ms_run[2]:scan=27670 79.933 3 2464.285 2464.2850 R G 93 116 PSM TKGVDEVTIVNILTNR 522 sp|P07355|ANXA2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43 2-UNIMOD:1031 ms_run[2]:scan=32928 94.899 2 1967.1051 1967.1051 K S 48 64 PSM TLFVKGLSEDTTEETLK 523 sp|P19338|NUCL_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43 5-UNIMOD:1031 ms_run[2]:scan=27813 80.325 2 2106.1096 2106.1096 K E 573 590 PSM TLKLTTPTYGDLNHLVSATMSGVTTCLR 524 sp|P07437|TBB5_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43 3-UNIMOD:1031,20-UNIMOD:35,26-UNIMOD:4 ms_run[2]:scan=31314 90.118 3 3261.6737 3261.6737 R F 214 242 PSM VLISSLKDCLHGIEAK 525 sp|Q8N684-2|CPSF7_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43 7-UNIMOD:1031,9-UNIMOD:4 ms_run[2]:scan=28426 82.011 2 1978.0921 1978.0921 R S 382 398 PSM VSQEHPVVLTKFVEGAR 526 sp|P31327|CPSM_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43 11-UNIMOD:1031 ms_run[2]:scan=24958 72.361 2 2091.1477 2091.1477 R E 1158 1175 PSM WGLGGTCVNVGCIPKK 527 sp|Q16881-4|TRXR1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43 7-UNIMOD:4,12-UNIMOD:4,15-UNIMOD:1031 ms_run[2]:scan=26100 75.518 2 1940.9965 1940.9965 R L 105 121 PSM YDCSSADINPIGGISKTDLR 528 sp|Q6IA69-2|NADE_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 43 3-UNIMOD:4,16-UNIMOD:1031 ms_run[2]:scan=27010 78.071 2 2377.1584 2377.1584 K A 269 289 PSM NLGTIAKSGTSEFLNK 529 sp|P14625|ENPL_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 43 7-UNIMOD:1031 ms_run[1]:scan=25378 73.568627 2 1875.006534 1875.010178 K M 162 178 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 530 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 43 1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=31477 90.580164 3 2990.3350 2990.3381 M A 2 29 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 531 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 43 1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=33453 96.344988 3 2991.3552 2990.3382 M A 2 29 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 532 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 43 1-UNIMOD:1,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=34198 98.408297 3 2974.3456 2974.3432 M A 2 29 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 533 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 43 1-UNIMOD:1,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=32459 93.500162 3 2976.3842 2974.3432 M A 2 29 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 534 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 43 1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=33877 97.470026 3 2991.3592 2990.3382 M A 2 29 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 535 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 43 1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=34131 98.190881 3 2991.3552 2990.3382 M A 2 29 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 536 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 43 1-UNIMOD:1,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=34089 98.068118 3 2974.3456 2974.3432 M A 2 29 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 537 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 43 1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=31782 91.451327 3 2991.3302 2990.3382 M A 2 29 PSM EEEIAALVIDNGSGMCKAGFAGDDAPR 538 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 43 1-UNIMOD:1,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=34583 100.02166 3 3030.4053 3030.4058 M A 2 29 PSM EEEIAALVIDNGSGMCKAGFAGDDAPR 539 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 43 1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=33601 96.727795 2 3047.4162 3046.4002 M A 2 29 PSM EEEIAALVIDNGSGMCKAGFAGDDAPR 540 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 43 1-UNIMOD:1,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=34251 98.581435 3 3030.4053 3030.4058 M A 2 29 PSM EEEIAALVIDNGSGMCKAGFAGDDAPR 541 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 43 1-UNIMOD:1,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=33496 96.454659 3 3030.4053 3030.4058 M A 2 29 PSM QLFHPEQLITGKEDAANNYAR 542 sp|P68363|TBA1B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 43 1-UNIMOD:28,12-UNIMOD:1031 ms_run[1]:scan=31737 91.322142 2 2593.2939 2593.2920 R G 85 106 PSM ASGVAVSDGVIKVFNDMK 543 sp|P23528|COF1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 43 1-UNIMOD:1,12-UNIMOD:1031 ms_run[1]:scan=33622 96.784534 2 2075.0802 2074.0762 M V 2 20 PSM TDAAVSFAKDFLAGGVAAAISK 544 sp|P05141|ADT2_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 43 1-UNIMOD:1,9-UNIMOD:1031 ms_run[1]:scan=34181 98.349789 3 2347.2462 2347.2418 M T 2 24 PSM LPAAGVGDMVMATVKK 545 sp|P62829|RL23_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 43 15-UNIMOD:1031 ms_run[1]:scan=28741 82.874352 2 1783.977475 1782.973598 R G 52 68 PSM MKPGATGESDLAEVLPQHK 546 sp|Q709F0|ACD11_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 43 1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:1031 ms_run[1]:scan=24588 71.361134 3 2261.1338 2261.1357 - F 1 20 PSM DLKSNNIFLHEDLTVK 547 sp|P15056|BRAF_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 43 3-UNIMOD:1031 ms_run[1]:scan=27205 78.598444 2 2082.125333 2081.115706 R I 576 592 PSM AAQASDLEKIHLDEK 548 sp|P37837|TALDO_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 9-UNIMOD:1031 ms_run[2]:scan=19626 58.14 2 1862.9738 1862.9738 K S 278 293 PSM AELIKTHHNDTELIR 549 sp|P49915-2|GUAA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 5-UNIMOD:1031 ms_run[2]:scan=16240 49.231 2 1985.0694 1985.0694 K K 286 301 PSM AITVFSPDGHLFQVEYAQEAVKK 550 sp|O14818|PSA7_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 22-UNIMOD:1031 ms_run[2]:scan=29526 85.066 3 2772.4487 2772.4487 R G 6 29 PSM AQLGGPEAAKSDETAAK 551 sp|P04792|HSPB1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 10-UNIMOD:1031 ms_run[2]:scan=14564 44.819 2 1838.9374 1838.9374 R - 189 206 PSM AVCVLKGDGPVQGIINFEQK 552 sp|P00441|SODC_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 3-UNIMOD:4,6-UNIMOD:1031 ms_run[2]:scan=30713 88.42 3 2367.2621 2367.2621 K E 5 25 PSM DLKAGNILFTLDGDIK 553 sp|Q9H2G2-2|SLK_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 3-UNIMOD:1031 ms_run[2]:scan=33464 96.373 2 1928.0619 1928.0619 R L 155 171 PSM DLKCDNIFITGPTGSVK 554 sp|Q9Y3S1-2|WNK2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 3-UNIMOD:1031,4-UNIMOD:4 ms_run[2]:scan=27985 80.799 2 2060.0612 2060.0612 R I 323 340 PSM DLKTSNLLLSHAGILK 555 sp|Q9UQ88-4|CD11A_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 3-UNIMOD:1031 ms_run[2]:scan=28874 83.243 2 1918.1251 1918.1251 R V 537 553 PSM DPFAHLPKSTFVLDEFK 556 sp|P26641|EF1G_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 8-UNIMOD:1031 ms_run[2]:scan=32727 94.318 3 2186.1412 2186.1412 K R 278 295 PSM EILVGDVGQTVDDPYATFVK 557 sp|P23528|COF1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 ms_run[2]:scan=28073 81.042 2 2165.0892 2165.0892 K M 54 74 PSM EVDEQMLNVQNKNSSYFVEWIPNNVK 558 sp|P07437|TBB5_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 12-UNIMOD:1031 ms_run[2]:scan=33195 95.677 3 3319.6183 3319.6183 K T 325 351 PSM EVSGIKAAYEAELGDAR 559 sp|P02545-6|LMNA_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 6-UNIMOD:1031 ms_run[2]:scan=26380 76.276 2 1974.0058 1974.0058 R K 73 90 PSM EVTLIHSQVALADKELLPSVR 560 sp|Q9BRQ8-2|FSP1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 14-UNIMOD:1031 ms_run[2]:scan=29646 85.4 3 2513.4217 2513.4217 K Q 129 150 PSM GATYGKPVHHGVNQLK 561 sp|P61313|RL15_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 6-UNIMOD:1031 ms_run[2]:scan=11293 36.119 2 1901.0272 1901.0272 K F 78 94 PSM GDGPVQGIINFEQKESNGPVK 562 sp|P00441|SODC_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 14-UNIMOD:1031 ms_run[2]:scan=27966 80.748 3 2408.2336 2408.2336 K V 11 32 PSM GDINVCIVGDPSTAKSQFLK 563 sp|Q14566|MCM6_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 6-UNIMOD:4,15-UNIMOD:1031 ms_run[2]:scan=30042 86.505 2 2344.2097 2344.2097 R H 388 408 PSM GIVDQSQQAYQEAFEISK 564 sp|P63104|1433Z_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 18-UNIMOD:259 ms_run[2]:scan=23471 68.371 2 2047.9942 2047.9942 K K 140 158 PSM GMITVTDPDLIEKSNLNR 565 sp|A0AVT1-2|UBA6_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 13-UNIMOD:1031 ms_run[2]:scan=28169 81.305 2 2211.1569 2211.1569 K Q 17 35 PSM GVLLFGPPGTGKTLCAR 566 sp|P35998|PRS7_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 12-UNIMOD:1031,15-UNIMOD:4 ms_run[2]:scan=29546 85.122 2 1939.0713 1939.0713 K A 211 228 PSM HHTSKIQEFADLTQVETFGFR 567 sp|P54278-4|PMS2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 5-UNIMOD:1031 ms_run[2]:scan=31922 91.844 3 2686.3503 2686.3503 K G 87 108 PSM HNIICLQNDHKAVMK 568 sp|O00233-2|PSMD9_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 5-UNIMOD:4,11-UNIMOD:1031,14-UNIMOD:35 ms_run[2]:scan=14857 45.584 2 2032.0346 2032.0346 R Q 77 92 PSM HYGGLTGLNKAETAAK 569 sp|P18669|PGAM1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 10-UNIMOD:1031 ms_run[2]:scan=17738 53.174 2 1825.9686 1825.9686 R H 91 107 PSM ICVVGENGAGKSTMLK 570 sp|Q9NUQ8-2|ABCF3_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 2-UNIMOD:4,11-UNIMOD:1031 ms_run[2]:scan=21620 63.449 2 1858.9645 1858.9645 R L 515 531 PSM IGSSMKSVGEVMAIGR 571 sp|P31327|CPSM_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 5-UNIMOD:35,6-UNIMOD:1031,12-UNIMOD:35 ms_run[2]:scan=19304 57.292 2 1848.9438 1848.9438 R T 788 804 PSM IPTGQEYAAKIINTK 572 sp|Q13557-8|KCC2D_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 10-UNIMOD:1031 ms_run[2]:scan=24145 70.175 2 1842.0251 1842.0251 K K 34 49 PSM KAFCEPGNVENNGVLSFIK 573 sp|P54577|SYYC_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 1-UNIMOD:1031,4-UNIMOD:4 ms_run[2]:scan=30089 86.639 2 2318.1729 2318.1729 K H 247 266 PSM KHLEINPDHPIVETLR 574 sp|P08238|HS90B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 1-UNIMOD:1031 ms_run[2]:scan=21700 63.66 3 2106.1586 2106.1586 K Q 624 640 PSM KIQALQQQADEAEDR 575 sp|P67936|TPM4_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 1-UNIMOD:1031 ms_run[2]:scan=16410 49.684 2 1937.9807 1937.9807 R A 13 28 PSM KIQVLQQQADDAEER 576 sp|P06753-2|TPM3_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 1-UNIMOD:1031 ms_run[2]:scan=18608 55.464 2 1966.012 1966.0120 R A 13 28 PSM KTSDFNTFLAQEGCTK 577 sp|Q9UHD1|CHRD1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 1-UNIMOD:1031,14-UNIMOD:4 ms_run[2]:scan=23823 69.306 2 2041.9779 2041.9779 R G 198 214 PSM KVWLDPNETNEIANANSR 578 sp|P84098|RL19_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 1-UNIMOD:1031 ms_run[2]:scan=24640 71.499 2 2266.1342 2266.1342 K Q 21 39 PSM LASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEK 579 sp|P05387|RLA2_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 ms_run[2]:scan=17842 53.451 3 2773.4246 2773.4246 K K 62 95 PSM LCCLEKGPNGYGFHLHGEK 580 sp|O14745|NHRF1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 2-UNIMOD:4,3-UNIMOD:4,6-UNIMOD:1031 ms_run[2]:scan=19663 58.238 3 2411.1515 2411.1515 R G 14 33 PSM LGGSPFGPAGTGKTESVK 581 sp|Q14204|DYHC1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 13-UNIMOD:1031 ms_run[2]:scan=20486 60.408 3 1884.9945 1884.9945 R A 1900 1918 PSM LHIIEVGTPPTGNQPFPKK 582 sp|Q00610-2|CLH1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 18-UNIMOD:1031 ms_run[2]:scan=23599 68.71 3 2268.263 2268.2630 K A 228 247 PSM LIGDAAKNQVAMNPTNTVFDAK 583 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 7-UNIMOD:1031,12-UNIMOD:35 ms_run[2]:scan=25531 73.984 3 2529.2897 2529.2897 R R 50 72 PSM LIGDAAKNQVAMNPTNTVFDAK 584 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 7-UNIMOD:1031,12-UNIMOD:35 ms_run[2]:scan=25147 72.93 2 2529.2897 2529.2897 R R 50 72 PSM LIGDAAKNQVAMNPTNTVFDAK 585 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 7-UNIMOD:1031,12-UNIMOD:35 ms_run[2]:scan=25679 74.381 2 2529.2897 2529.2897 R R 50 72 PSM LIGDAAKNQVAMNPTNTVFDAK 586 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 7-UNIMOD:1031,12-UNIMOD:35 ms_run[2]:scan=26324 76.126 2 2529.2897 2529.2897 R R 50 72 PSM LPAAGVGDMVMATVKK 587 sp|P62829|RL23_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 11-UNIMOD:35,15-UNIMOD:1031 ms_run[2]:scan=24418 70.905 2 1798.9685 1798.9685 R G 52 68 PSM LTDFGLSKEAIDHEK 588 sp|Q15418-4|KS6A1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 8-UNIMOD:1031 ms_run[2]:scan=23063 67.282 2 1897.9785 1897.9785 K K 187 202 PSM LTDFGLSKESIDHEK 589 sp|P51812|KS6A3_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 8-UNIMOD:1031 ms_run[2]:scan=22515 65.826 2 1913.9735 1913.9735 K K 209 224 PSM MKPGATGESDLAEVLPQHK 590 sp|Q709F0-2|ACD11_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 1-UNIMOD:35,2-UNIMOD:1031 ms_run[2]:scan=20874 61.431 3 2219.1256 2219.1256 - F 1 20 PSM NALIHKSSVNCPFSSQDMK 591 sp|Q08211|DHX9_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 6-UNIMOD:1031,11-UNIMOD:4,18-UNIMOD:35 ms_run[2]:scan=19112 56.788 3 2374.141 2374.1410 R Y 1019 1038 PSM NFGPKGFGFGQGAGALVHSE 592 sp|P21291|CSRP1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 5-UNIMOD:1031 ms_run[2]:scan=29073 83.799 2 2172.0752 2172.0752 K - 174 194 PSM NLGTIAKSGTSEFLNK 593 sp|P14625|ENPL_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 7-UNIMOD:1031 ms_run[2]:scan=24529 71.206 2 1875.0102 1875.0102 K M 162 178 PSM NLGTIAKSGTSEFLNK 594 sp|P14625|ENPL_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 7-UNIMOD:1031 ms_run[2]:scan=25453 73.772 2 1875.0102 1875.0102 K M 162 178 PSM NLGTIAKSGTSEFLNK 595 sp|P14625|ENPL_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 7-UNIMOD:1031 ms_run[2]:scan=26238 75.892 2 1875.0102 1875.0102 K M 162 178 PSM NLGTIAKSGTSEFLNK 596 sp|P14625|ENPL_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 7-UNIMOD:1031 ms_run[2]:scan=26817 77.525 2 1875.0102 1875.0102 K M 162 178 PSM PGVTVKDVNQQEFVR 597 sp|P39019|RS19_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 6-UNIMOD:1031 ms_run[2]:scan=21997 64.441 2 1911.0214 1911.0214 M A 2 17 PSM QLFHPEQLITGKEDAANNYAR 598 sp|P68363|TBA1B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 12-UNIMOD:1031 ms_run[2]:scan=26656 77.031 3 2610.319 2610.3190 R G 85 106 PSM QPQGHLLLIGVSGAGKTTLSR 599 sp|Q14204|DYHC1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 16-UNIMOD:1031 ms_run[2]:scan=25235 73.18 3 2328.3278 2328.3278 R F 2928 2949 PSM SGDAAIVDMVPGKPMCVESFSDYPPLGR 600 sp|Q5VTE0|EF1A3_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 13-UNIMOD:1031,15-UNIMOD:35,16-UNIMOD:4 ms_run[2]:scan=32637 94.054 3 3206.5086 3206.5086 K F 396 424 PSM SGSKAFLDALQNQAEASSK 601 sp|Q12931-2|TRAP1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 4-UNIMOD:1031 ms_run[2]:scan=26717 77.243 2 2147.0859 2147.0859 R I 125 144 PSM SIVDNWPENHVKAVVVTDGER 602 sp|P23368-2|MAOM_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 12-UNIMOD:1031 ms_run[2]:scan=25635 74.26 3 2559.3082 2559.3082 R I 145 166 PSM SIYYITGESKEQVANSAFVER 603 sp|P08238|HS90B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 10-UNIMOD:1031 ms_run[2]:scan=27926 80.639 3 2586.2966 2586.2966 K V 482 503 PSM SLAGSSGPGASSGTSGDHGELVVR 604 sp|P29692|EF1D_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 ms_run[2]:scan=10447 33.89 3 2184.0407 2184.0407 K I 60 84 PSM SLTYKESGVDIAAGNMLVK 605 sp|P22102|PUR2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 5-UNIMOD:1031 ms_run[2]:scan=28275 81.595 2 2191.1559 2191.1559 R K 434 453 PSM SSGPYGGGGQYFAKPR 606 sp|P09651-3|ROA1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 14-UNIMOD:1031 ms_run[2]:scan=20315 59.955 2 1823.8955 1823.8955 R N 232 248 PSM SVLGEADQKGSLVAPDR 607 sp|P49588|SYAC_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 9-UNIMOD:1031 ms_run[2]:scan=23154 67.524 2 1937.0218 1937.0218 R L 617 634 PSM TAFDDAIAELDTLNEDSYK 608 sp|P61981|1433G_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 19-UNIMOD:259 ms_run[2]:scan=31493 90.625 2 2137.9783 2137.9783 K D 199 218 PSM TAFDEAIAELDTLNEDSYK 609 sp|P27348|1433T_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 19-UNIMOD:259 ms_run[2]:scan=32212 92.674 2 2151.9939 2151.9939 K D 194 213 PSM TAFDEAIAELDTLNEESYK 610 sp|P31946-2|1433B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 19-UNIMOD:259 ms_run[2]:scan=32354 93.162 2 2166.0096 2166.0096 K D 194 213 PSM TAFDEAIAELDTLNEESYK 611 sp|P31946-2|1433B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 ms_run[2]:scan=32367 93.206 3 2157.9954 2157.9954 K D 194 213 PSM TDEEGKDVPDHAVLEMK 612 sp|Q9BUJ2-3|HNRL1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 6-UNIMOD:1031 ms_run[2]:scan=20028 59.201 3 2108.0096 2108.0096 R A 432 449 PSM TFKTVFAEHISDECK 613 sp|P39023|RL3_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 3-UNIMOD:1031,14-UNIMOD:4 ms_run[2]:scan=24114 70.09 2 2006.9772 2006.9772 R R 101 116 PSM TGQLAAIKVMDVTEDEEEEIK 614 sp|O95819-4|M4K4_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 8-UNIMOD:1031 ms_run[2]:scan=30803 88.681 3 2543.2677 2543.2677 K L 47 68 PSM TIAQDYGVLKADEGISFR 615 sp|Q06830|PRDX1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 10-UNIMOD:1031 ms_run[2]:scan=29066 83.782 2 2178.1321 2178.1321 R G 111 129 PSM TIGGGDDSFNTFFSETGAGKHVPR 616 sp|P68363|TBA1B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 20-UNIMOD:1031 ms_run[2]:scan=26934 77.857 2 2692.2881 2692.2881 K A 41 65 PSM TIGTGLVTNTLAMTEEEKNIK 617 sp|P49411|EFTU_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 18-UNIMOD:1031 ms_run[2]:scan=30881 88.896 3 2458.2989 2458.2989 R W 430 451 PSM TMSAQIEGGVHGLHSYEKR 618 sp|P20839-2|IMDH1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 18-UNIMOD:1031 ms_run[2]:scan=17042 51.345 3 2295.143 2295.1430 R L 469 488 PSM TSIMSKQYGNEVFLAK 619 sp|P50990-2|TCPQ_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 4-UNIMOD:35,6-UNIMOD:1031 ms_run[2]:scan=23475 68.384 2 2027.0398 2027.0398 R L 147 163 PSM TSRPENAIIYNNNEDFQVGQAK 620 sp|P29401|TKT_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 ms_run[2]:scan=15751 47.917 3 2507.2041 2507.2041 R V 472 494 PSM VAPEEHPVLLTEAPLNPK 621 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 18-UNIMOD:259 ms_run[2]:scan=19268 57.196 3 1961.0713 1961.0713 R A 96 114 PSM VKGHFGPINSVAFHPDGK 622 sp|Q13347|EIF3I_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 2-UNIMOD:1031 ms_run[2]:scan=19900 58.858 4 2102.1061 2102.1061 R S 281 299 PSM VLLQSKDQITAGNAAR 623 sp|P22234|PUR6_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 6-UNIMOD:1031 ms_run[2]:scan=21067 61.957 2 1880.048 1880.0480 K K 31 47 PSM WGDAGAEYVVESTGVFTTMEK 624 sp|P04406|G3P_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 ms_run[2]:scan=29453 84.861 2 2276.0307 2276.0307 K A 87 108 PSM WGLGGTCVNVGCIPKK 625 sp|Q16881-4|TRXR1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 7-UNIMOD:4,12-UNIMOD:4,15-UNIMOD:1031,16-UNIMOD:1031 ms_run[2]:scan=26089 75.489 2 1949.0107 1949.0107 R L 105 121 PSM YADLTEDQLPSCESLKDTIAR 626 sp|P18669|PGAM1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 12-UNIMOD:4,16-UNIMOD:1031 ms_run[2]:scan=28112 81.148 2 2620.269 2620.2690 R A 142 163 PSM YDYNSGEELESYKGHFGPIHCVR 627 sp|Q9Y3F4|STRAP_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 13-UNIMOD:1031,21-UNIMOD:4 ms_run[2]:scan=23702 68.982 4 2952.3501 2952.3501 K F 250 273 PSM YSGSEGSTQTLTKGELK 628 sp|P25815|S100P_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 42 13-UNIMOD:1031 ms_run[2]:scan=18218 54.437 2 1981.0004 1981.0004 R V 18 35 PSM NLGTIAKSGTSEFLNK 629 sp|P14625|ENPL_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 42 7-UNIMOD:1031 ms_run[1]:scan=27202 78.590715 2 1875.010183 1875.010178 K M 162 178 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 630 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 42 15-UNIMOD:35,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=31035 89.331557 3 2949.3642 2948.3272 M A 2 29 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 631 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 42 1-UNIMOD:1,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=34299 98.760868 3 2974.3456 2974.3432 M A 2 29 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 632 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 42 1-UNIMOD:1,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=34469 99.468925 3 2974.3456 2974.3432 M A 2 29 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 633 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 42 1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=32644 94.074147 2 2990.3272 2990.3382 M A 2 29 PSM EEEIAALVIDNGSGMCKAGFAGDDAPR 634 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 42 1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=33516 96.507319 3 3047.4052 3046.4002 M A 2 29 PSM EEEIAALVIDNGSGMCKAGFAGDDAPR 635 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 42 1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=33975 97.738505 3 3048.4242 3046.4002 M A 2 29 PSM LKGEMMDLQHGSLFLR 636 sp|P00338|LDHA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 42 2-UNIMOD:1031 ms_run[1]:scan=27982 80.791193 3 2071.083355 2070.075438 K T 58 74 PSM VETGVLKPGMVVTFAPVNVTTEVK 637 sp|P68104|EF1A1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 42 ms_run[1]:scan=27539 79.569753 3 2514.399208 2514.376748 R S 267 291 PSM GDVTITNDGATILKQMQVLHPAAR 638 sp|P50991|TCPD_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 42 14-UNIMOD:1031 ms_run[1]:scan=29660 85.439747 3 2745.472144 2744.464334 K M 66 90 PSM HGDPGDAAQQEAKHR 639 sp|O14737|PDCD5_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 42 13-UNIMOD:1031 ms_run[1]:scan=6875 24.336274 3 1811.858567 1811.866308 K E 21 36 PSM SDAAVDTSSEITTKDLK 640 sp|P06454|PTMA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 42 1-UNIMOD:1,14-UNIMOD:1031 ms_run[1]:scan=24027 69.859082 2 2018.0068 2018.0050 M E 2 19 PSM DVDDGLQAAEEVGYPVMIKASEGGGGK 641 sp|Q13085|ACACA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 42 17-UNIMOD:35,19-UNIMOD:1031 ms_run[1]:scan=33175 95.622446 3 2905.4262 2903.3852 K G 293 320 PSM AAYNPGQAVPWNAVKVQTLSNQPLLK 642 sp|Q8N163|CCAR2_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 42 15-UNIMOD:1031 ms_run[1]:scan=33180 95.637508 3 3002.652005 3002.634177 K S 98 124 PSM KEAESCDCLQGFQLTHSLGGGTGSGMGTLLISK 643 sp|P04350|TBB4A_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 42 1-UNIMOD:259,6-UNIMOD:4,8-UNIMOD:4 ms_run[1]:scan=31336 90.179379 3 3449.622824 3446.635975 R I 122 155 PSM AFGQAKHQPTAIIAK 644 sp|P29401|TKT_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 6-UNIMOD:1031 ms_run[2]:scan=17023 51.296 2 1776.0046 1776.0046 K T 227 242 PSM AGPESDAQYQFTGIKK 645 sp|Q96IX5|ATPMD_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 15-UNIMOD:1031 ms_run[2]:scan=21337 62.7 2 1934.9738 1934.9738 M Y 2 18 PSM ALAENSGVKANEVISK 646 sp|P50990-2|TCPQ_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 9-UNIMOD:1031 ms_run[2]:scan=18323 54.714 2 1824.9945 1824.9945 R L 432 448 PSM APPNATLEHFYLTSGKQPK 647 sp|Q96G23|CERS2_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 16-UNIMOD:1031 ms_run[2]:scan=22740 66.423 3 2294.2059 2294.2059 R Q 78 97 PSM AVLKFAAATGATPIAGR 648 sp|P08865|RSSA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 4-UNIMOD:1031 ms_run[2]:scan=26307 76.076 2 1810.0465 1810.0465 R F 86 103 PSM CTGGEVGATSALAPKIGPLGLSPK 649 sp|P30050|RL12_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 1-UNIMOD:4,15-UNIMOD:1031 ms_run[2]:scan=29570 85.188 3 2476.3359 2476.3359 R K 17 41 PSM DIHELFVPENKLDHVR 650 sp|O95340|PAPS2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 11-UNIMOD:1031 ms_run[2]:scan=26357 76.214 3 2156.1378 2156.1378 K A 223 239 PSM DIKGDNVLINTYSGVLK 651 sp|Q99683|M3K5_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 3-UNIMOD:1031 ms_run[2]:scan=30839 88.78 2 2044.1205 2044.1205 R I 803 820 PSM DIKSANILLDEAFTAK 652 sp|Q9NWZ3-2|IRAK4_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 3-UNIMOD:1031 ms_run[2]:scan=33279 95.893 2 1944.0568 1944.0568 R I 187 203 PSM DKVGILQHPDGTVLK 653 sp|Q8NFU5|IPMK_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 2-UNIMOD:1031 ms_run[2]:scan=22892 66.823 2 1815.0254 1815.0254 K Q 61 76 PSM DLKPENVLLSSQEEDCLIK 654 sp|O96017-13|CHK2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 3-UNIMOD:1031,16-UNIMOD:4 ms_run[2]:scan=30439 87.657 2 2425.241 2425.2410 R I 126 145 PSM DLKPSNILYVDESGNPESIR 655 sp|P51812|KS6A3_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 3-UNIMOD:1031 ms_run[2]:scan=28313 81.701 2 2441.2438 2441.2438 R I 539 559 PSM DQTKAQAAAPASVPAQAPK 656 sp|P47914|RL29_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 4-UNIMOD:1031 ms_run[2]:scan=15784 48.007 2 2045.0906 2045.0906 K R 131 150 PSM DVKAGNILLSEPGLVK 657 sp|Q9UL54-2|TAOK2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 3-UNIMOD:1031 ms_run[2]:scan=29157 84.028 2 1848.072 1848.0720 R L 151 167 PSM EKLIAPVAEEEATVPNNK 658 sp|P07195|LDHB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 2-UNIMOD:1031 ms_run[2]:scan=23367 68.09 2 2147.1474 2147.1474 K I 6 24 PSM EKTHINIVVIGHVDSGK 659 sp|Q5VTE0|EF1A3_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 2-UNIMOD:1031 ms_run[2]:scan=20891 61.476 3 2041.132 2041.1320 K S 4 21 PSM ETNLDSLPLVDTHSKR 660 sp|P08670|VIME_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 15-UNIMOD:1031 ms_run[2]:scan=22770 66.5 2 2020.0589 2020.0589 R T 425 441 PSM FGEVVDCTIKTDPVTGR 661 sp|O14979|HNRDL_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 7-UNIMOD:4,10-UNIMOD:1031 ms_run[2]:scan=24270 70.504 2 2089.0514 2089.0514 R S 171 188 PSM GALQNIIPASTGAAKAVGK 662 sp|P04406|G3P_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 15-UNIMOD:1031,19-UNIMOD:1031 ms_run[2]:scan=25354 73.505 2 1970.1404 1970.1404 R V 201 220 PSM GISEETTTGVHNLYKMMANGILK 663 sp|P23526-2|SAHH_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 15-UNIMOD:1031 ms_run[2]:scan=32123 92.419 3 2702.3772 2702.3772 R V 124 147 PSM GKGGVTGSPEASISGSK 664 sp|Q09666|AHNK_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 2-UNIMOD:1031 ms_run[2]:scan=14519 44.701 2 1713.8897 1713.8897 K G 5724 5741 PSM GLQKEEVVLLTHGDSVDK 665 sp|P49915-2|GUAA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 4-UNIMOD:1031 ms_run[2]:scan=24406 70.873 3 2162.1583 2162.1583 R V 43 61 PSM GMITVTDPDLIEKSNLNR 666 sp|A0AVT1-2|UBA6_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 2-UNIMOD:35,13-UNIMOD:1031 ms_run[2]:scan=25836 74.804 2 2227.1518 2227.1518 K Q 17 35 PSM GVILYGPPGTGKTLLAK 667 sp|P62191-2|PRS4_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 12-UNIMOD:1031 ms_run[2]:scan=28103 81.126 2 1880.1135 1880.1135 K A 148 165 PSM GVLMYGPPGCGKTMLAK 668 sp|P43686-2|PRS6B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 10-UNIMOD:4,12-UNIMOD:1031,14-UNIMOD:35 ms_run[2]:scan=23604 68.725 2 1991.0042 1991.0042 R A 170 187 PSM GVLMYGPPGCGKTMLAK 669 sp|P43686-2|PRS6B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 4-UNIMOD:35,10-UNIMOD:4,12-UNIMOD:1031 ms_run[2]:scan=24233 70.407 2 1991.0042 1991.0042 R A 170 187 PSM GVNLPGAAVDLPAVSEKDIQDLK 670 sp|P14618|KPYM_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 17-UNIMOD:1031 ms_run[2]:scan=31809 91.528 3 2544.3799 2544.3799 K F 208 231 PSM HAAENPGKYNILGTNTIMDK 671 sp|Q00839-2|HNRPU_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 8-UNIMOD:1031 ms_run[2]:scan=23990 69.757 3 2382.2002 2382.2002 K M 498 518 PSM HGSYEDAVHSGALND 672 sp|P17987|TCPA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 ms_run[2]:scan=8556 28.815 2 1570.6648 1570.6648 K - 542 557 PSM IDESSLTGESDHVKK 673 sp|P23634-5|AT2B4_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 14-UNIMOD:1031 ms_run[2]:scan=15041 46.067 2 1839.9214 1839.9214 K S 234 249 PSM IEDLSQQAQLAAAEKFK 674 sp|E9PAV3|NACAM_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 15-UNIMOD:1031 ms_run[2]:scan=27410 79.203 2 2085.1106 2085.1106 K V 1991 2008 PSM IINEPTAAAIAYGLDKK 675 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 16-UNIMOD:1031 ms_run[2]:scan=27794 80.274 2 1983.1041 1983.1041 R V 172 189 PSM INEELESQYQQSMDSKLSGR 676 sp|O00193|SMAP_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 16-UNIMOD:1031 ms_run[2]:scan=24772 71.854 3 2537.2068 2537.2068 K Y 76 96 PSM IPTGQEYAAKIINTK 677 sp|Q13557-8|KCC2D_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 10-UNIMOD:1031,15-UNIMOD:1031 ms_run[2]:scan=24186 70.281 2 1850.0393 1850.0393 K K 34 49 PSM IQAKYLDQMEDLYEDFHIVK 678 sp|O43681|ASNA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 4-UNIMOD:1031,9-UNIMOD:35 ms_run[2]:scan=28758 82.923 3 2709.336 2709.3360 K L 298 318 PSM KAEAGAGSATEFQFR 679 sp|P46783|RS10_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 1-UNIMOD:1031 ms_run[2]:scan=19700 58.334 2 1764.8795 1764.8795 K G 139 154 PSM KHGLEVIYMIEPIDEYCVQQLK 680 sp|P07900|HS90A_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 1-UNIMOD:1031,17-UNIMOD:4 ms_run[2]:scan=33024 95.178 3 2900.4816 2900.4816 R E 513 535 PSM KLAGANPAVITCDELLLGHEK 681 sp|P78527-2|PRKDC_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 1-UNIMOD:1031,12-UNIMOD:4 ms_run[2]:scan=26732 77.285 3 2444.3097 2444.3097 R A 4019 4040 PSM KYEQGFITDPVVLSPK 682 sp|P12268|IMDH2_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 1-UNIMOD:1031 ms_run[2]:scan=27634 79.83 2 2016.0932 2016.0932 K D 109 125 PSM KYTLPPGVDPTQVSSSLSPEGTLTVEAPMPK 683 sp|P04792|HSPB1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 1-UNIMOD:1031,29-UNIMOD:35 ms_run[2]:scan=30066 86.57 3 3437.764 3437.7640 R L 141 172 PSM LADFGVAGQLTDTMAKR 684 sp|Q13043-2|STK4_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 16-UNIMOD:1031 ms_run[2]:scan=27826 80.363 2 1989.0353 1989.0353 K N 165 182 PSM LDINTNTYTSQDLKSALAK 685 sp|Q9H173|SIL1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 14-UNIMOD:1031 ms_run[2]:scan=27509 79.485 3 2291.2009 2291.2009 R F 119 138 PSM LDKSQIHDIVLVGGSTR 686 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 3-UNIMOD:1031 ms_run[2]:scan=25810 74.733 3 2033.1269 2033.1269 K I 326 343 PSM LIGDAAKNQVALNPQNTVFDAK 687 sp|P0DMV9|HS71B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 7-UNIMOD:1031 ms_run[2]:scan=27076 78.25 3 2522.3493 2522.3493 R R 50 72 PSM LIGDAAKNQVAMNPTNTVFDAK 688 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 7-UNIMOD:1031,12-UNIMOD:35 ms_run[2]:scan=24880 72.15 2 2529.2897 2529.2897 R R 50 72 PSM LIGDAAKNQVAMNPTNTVFDAK 689 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 7-UNIMOD:1031,12-UNIMOD:35 ms_run[2]:scan=25274 73.288 3 2529.2897 2529.2897 R R 50 72 PSM LIGDAAKNQVAMNPTNTVFDAK 690 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 7-UNIMOD:1031,12-UNIMOD:35 ms_run[2]:scan=25401 73.63 3 2529.2897 2529.2897 R R 50 72 PSM LIGDAAKNQVAMNPTNTVFDAK 691 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 7-UNIMOD:1031,12-UNIMOD:35 ms_run[2]:scan=25804 74.716 3 2529.2897 2529.2897 R R 50 72 PSM LIGDAAKNQVAMNPTNTVFDAK 692 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 7-UNIMOD:1031,12-UNIMOD:35 ms_run[2]:scan=25936 75.08 3 2529.2897 2529.2897 R R 50 72 PSM LIGDAAKNQVAMNPTNTVFDAK 693 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 7-UNIMOD:1031,12-UNIMOD:35 ms_run[2]:scan=26196 75.779 2 2529.2897 2529.2897 R R 50 72 PSM LIGDAAKNQVAMNPTNTVFDAK 694 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 7-UNIMOD:1031,12-UNIMOD:35 ms_run[2]:scan=26378 76.271 3 2529.2897 2529.2897 R R 50 72 PSM LIGDAAKNQVAMNPTNTVFDAK 695 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 7-UNIMOD:1031 ms_run[2]:scan=26826 77.551 3 2513.2948 2513.2948 R R 50 72 PSM LKGEATVSFDDPPSAK 696 sp|P35637-2|FUS_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 2-UNIMOD:1031 ms_run[2]:scan=20251 59.785 2 1856.952 1856.9520 K A 332 348 PSM LVPVLSAKAAQASDLEK 697 sp|P37837|TALDO_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 8-UNIMOD:1031 ms_run[2]:scan=27621 79.794 2 1935.1041 1935.1041 K I 270 287 PSM NDTKEDVFVHQTAIK 698 sp|P67809|YBOX1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 4-UNIMOD:1031 ms_run[2]:scan=20438 60.282 2 1940.0003 1940.0003 R K 78 93 PSM NLGTIAKSGTSEFLNK 699 sp|P14625|ENPL_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 7-UNIMOD:1031 ms_run[2]:scan=25077 72.726 2 1875.0102 1875.0102 K M 162 178 PSM NQLTSNPENTVFDAKR 700 sp|P11021|BIP_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 15-UNIMOD:1031 ms_run[2]:scan=22101 64.717 2 2029.0229 2029.0229 K L 82 98 PSM NQVAMNPTNTVFDAKR 701 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 5-UNIMOD:35,15-UNIMOD:1031 ms_run[2]:scan=20516 60.486 2 2017.0051 2017.0051 K L 57 73 PSM PAVLGFEGSANKIGVGVVR 702 sp|Q9NPF4|OSGEP_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 12-UNIMOD:1031 ms_run[2]:scan=29251 84.294 3 2065.1684 2065.1684 M D 2 21 PSM PLAKDLLHPSPEEEK 703 sp|P42677|RS27_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 4-UNIMOD:1031 ms_run[2]:scan=21237 62.429 2 1898.0149 1898.0149 M R 2 17 PSM PLVVFVLGGPGAGKGTQCAR 704 sp|P30085-3|KCY_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 14-UNIMOD:1031,18-UNIMOD:4 ms_run[2]:scan=30570 88.023 3 2179.1936 2179.1936 K I 35 55 PSM QAQYLGMSCDGPFKPDHYR 705 sp|P23526-2|SAHH_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 7-UNIMOD:35,9-UNIMOD:4,14-UNIMOD:1031 ms_run[2]:scan=19833 58.682 3 2481.1205 2481.1206 K Y 385 404 PSM QDLTTLDVTKLTPLSHEVISR 706 sp|P41091|IF2G_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 10-UNIMOD:1031 ms_run[2]:scan=30795 88.658 3 2561.4065 2561.4065 R Q 18 39 PSM QPQGHLLLIGVSGAGKTTLSR 707 sp|Q14204|DYHC1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 16-UNIMOD:1031 ms_run[2]:scan=25260 73.247 2 2328.3278 2328.3278 R F 2928 2949 PSM QTTKSELLSQLQQHEEESR 708 sp|Q92665|RT31_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 4-UNIMOD:1031 ms_run[2]:scan=25356 73.509 3 2466.235 2466.2350 K A 171 190 PSM SGSKAFLDALQNQAEASSK 709 sp|Q12931-2|TRAP1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 4-UNIMOD:1031,19-UNIMOD:1031 ms_run[2]:scan=26779 77.415 2 2155.1001 2155.1001 R I 125 144 PSM SKSEEAHAEDSVMDHHFR 710 sp|Q8NC51-3|PAIRB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 2-UNIMOD:1031,13-UNIMOD:35 ms_run[2]:scan=10052 32.797 4 2323.0288 2323.0288 K K 313 331 PSM SPAGLQVLNDYLADK 711 sp|P24534|EF1B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 15-UNIMOD:259 ms_run[2]:scan=26571 76.789 2 1610.8395 1610.8395 K S 8 23 PSM STGGAPTFNVTVTKTDK 712 sp|P07737|PROF1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 14-UNIMOD:1031 ms_run[2]:scan=21872 64.112 2 1919 1919.0000 K T 92 109 PSM SYPYLFKGLEDLHLDER 713 sp|Q96Q15-4|SMG1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 7-UNIMOD:1031 ms_run[2]:scan=33026 95.183 2 2290.1634 2290.1634 K I 880 897 PSM TAFDEAIAELDTLNEDSYK 714 sp|P27348|1433T_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 ms_run[2]:scan=32216 92.684 3 2143.9797 2143.9797 K D 194 213 PSM TAFDEAIAELDTLNEESYK 715 sp|P31946-2|1433B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 19-UNIMOD:259 ms_run[2]:scan=32360 93.18 3 2166.0096 2166.0096 K D 194 213 PSM TAFDEAIAELDTLNEESYK 716 sp|P31946-2|1433B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 ms_run[2]:scan=32355 93.165 2 2157.9954 2157.9954 K D 194 213 PSM TDEAAFQKLMSNLDSNR 717 sp|P26447|S10A4_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 8-UNIMOD:1031 ms_run[2]:scan=30855 88.824 2 2135.0317 2135.0317 R D 50 67 PSM TFKTVFAEHISDECK 718 sp|P39023|RL3_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 3-UNIMOD:1031,14-UNIMOD:4 ms_run[2]:scan=24108 70.075 3 2006.9772 2006.9772 R R 101 116 PSM TGLIKGSGTAEVELK 719 sp|P14618|KPYM_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 5-UNIMOD:1031 ms_run[2]:scan=22439 65.624 2 1697.9564 1697.9564 R K 121 136 PSM TIGGGDDSFTTFFCETGAGK 720 sp|P68366-2|TBA4A_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 14-UNIMOD:4 ms_run[2]:scan=26576 76.805 2 2066.8891 2066.8891 K H 26 46 PSM TKAIEHADGGVAAGVAVLDNPYPV 721 sp|P48637-2|GSHB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 2-UNIMOD:1031 ms_run[2]:scan=28951 83.461 3 2559.3333 2559.3333 R - 340 364 PSM TLSDYNIQKESTLHLVLR 722 sp|P62979|RS27A_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 9-UNIMOD:1031 ms_run[2]:scan=28565 82.395 3 2325.2692 2325.2692 R L 55 73 PSM TLTGKTITLEVEPSDTIENVK 723 sp|P62979|RS27A_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 5-UNIMOD:1031 ms_run[2]:scan=28289 81.634 2 2483.3371 2483.3371 K A 7 28 PSM TPAVEGLTEAEEEELR 724 sp|O43399-6|TPD54_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 16-UNIMOD:267 ms_run[2]:scan=19886 58.821 2 1781.8559 1781.8559 R A 12 28 PSM TSIMSKQYGNEVFLAK 725 sp|P50990-2|TCPQ_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 4-UNIMOD:35,6-UNIMOD:1031 ms_run[2]:scan=23206 67.662 2 2027.0398 2027.0398 R L 147 163 PSM TSIMSKQYGNEVFLAK 726 sp|P50990-2|TCPQ_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 4-UNIMOD:35,6-UNIMOD:1031 ms_run[2]:scan=25427 73.701 2 2027.0398 2027.0398 R L 147 163 PSM TVAGGAWTYNTTSAVTVK 727 sp|P61513|RL37A_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 ms_run[2]:scan=18051 53.999 2 1825.921 1825.9210 K S 63 81 PSM TYDATTHFETTCDDIK 728 sp|P50395-2|GDIB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 12-UNIMOD:4 ms_run[2]:scan=11965 37.929 2 1916.8098 1916.8098 R N 358 374 PSM VAPEEHPVLLTEAPLNPK 729 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 ms_run[2]:scan=19269 57.199 3 1953.0571 1953.0571 R A 96 114 PSM VCYYYDGDVGNYYYGQGHPMKPHR 730 sp|Q13547|HDAC1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 2-UNIMOD:4,20-UNIMOD:35,21-UNIMOD:1031 ms_run[2]:scan=18948 56.358 4 3150.3753 3150.3753 K I 11 35 PSM VDCTANTNTCNKYGVSGYPTLK 731 sp|P30101|PDIA3_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 3-UNIMOD:4,10-UNIMOD:4,12-UNIMOD:1031 ms_run[2]:scan=21262 62.497 3 2658.2418 2658.2418 K I 83 105 PSM VDVAVNCAGIAVASKTYNLK 732 sp|Q99714-2|HCD2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 7-UNIMOD:4,15-UNIMOD:1031 ms_run[2]:scan=27118 78.362 3 2288.2199 2288.2199 R K 85 105 PSM VIHDNFGIVEGLMTTVHAITATQKTVDGPSGK 733 sp|P04406|G3P_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 13-UNIMOD:35,24-UNIMOD:1031 ms_run[2]:scan=32769 94.436 5 3547.8345 3547.8345 K L 163 195 PSM VISELNGKNIEDVIAQGIGK 734 sp|P05387|RLA2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 8-UNIMOD:1031 ms_run[2]:scan=32538 93.755 2 2292.2689 2292.2689 K L 42 62 PSM VIVDFSSPNIAKEMHVGHLR 735 sp|P54136-2|SYRC_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 12-UNIMOD:1031 ms_run[2]:scan=25382 73.578 3 2444.2998 2444.2998 K S 122 142 PSM VIVDFSSPNIAKEMHVGHLR 736 sp|P54136-2|SYRC_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 12-UNIMOD:1031 ms_run[2]:scan=25390 73.601 4 2444.2998 2444.2998 K S 122 142 PSM VMLGETNPADSKPGTIR 737 sp|P22392|NDKB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 12-UNIMOD:1031 ms_run[2]:scan=21204 62.342 2 1981.0303 1981.0303 R G 89 106 PSM VNQIGSVTESLQACKLAQANGWGVMVSHR 738 sp|P06733|ENOA_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 14-UNIMOD:4,15-UNIMOD:1031 ms_run[2]:scan=30981 89.178 3 3335.6867 3335.6867 K S 344 373 PSM VTVAGLAGKDPVQCSR 739 sp|Q99497|PARK7_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 9-UNIMOD:1031,14-UNIMOD:4 ms_run[2]:scan=22256 65.139 2 1852.9829 1852.9829 K D 33 49 PSM VTVIKAPHYPGIGPVDESGIPTAIR 740 sp|O94875-9|SRBS2_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 5-UNIMOD:1031 ms_run[2]:scan=27581 79.684 3 2782.5382 2782.5382 R T 150 175 PSM VVKSAEHYTETALDEIR 741 sp|Q96SB4-4|SRPK1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 3-UNIMOD:1031 ms_run[2]:scan=22374 65.453 3 2156.1113 2156.1113 K L 94 111 PSM YADLTEDQLPSCESLKDTIAR 742 sp|P18669|PGAM1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 12-UNIMOD:4,16-UNIMOD:1031 ms_run[2]:scan=28095 81.102 3 2620.269 2620.2690 R A 142 163 PSM YAICSALAASALPALVMSKGHR 743 sp|P36578|RL4_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 4-UNIMOD:4,17-UNIMOD:35,19-UNIMOD:1031 ms_run[2]:scan=31449 90.5 3 2498.3138 2498.3138 R I 122 144 PSM YAICSALAASALPALVMSKGHR 744 sp|P36578|RL4_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 4-UNIMOD:4,17-UNIMOD:35,19-UNIMOD:1031 ms_run[2]:scan=31573 90.852 3 2498.3138 2498.3138 R I 122 144 PSM YVSHGATGKGNDQVR 745 sp|P00966|ASSY_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 41 9-UNIMOD:1031 ms_run[2]:scan=8333 28.229 2 1783.8965 1783.8965 K F 113 128 PSM NVVSGKTSACFEPSLDYMVTK 746 sp|P31327|CPSM_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 41 6-UNIMOD:1031,10-UNIMOD:4 ms_run[1]:scan=27838 80.395782 3 2528.224912 2528.229098 K I 752 773 PSM NLGTIAKSGTSEFLNK 747 sp|P14625|ENPL_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 41 7-UNIMOD:1031 ms_run[1]:scan=25843 74.824059 2 1876.001170 1875.010178 K M 162 178 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 748 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 41 1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=34591 100.05777 3 2992.3582 2990.3382 M A 2 29 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 749 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 41 1-UNIMOD:1,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=34547 99.84264 3 2974.3418 2974.3432 M A 2 29 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 750 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 41 1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=34238 98.539481 3 2991.3552 2990.3382 M A 2 29 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 751 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 41 1-UNIMOD:1,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=32698 94.234743 3 2974.3338 2974.3432 M A 2 29 PSM KDLYANTVLSGGTTMYPGIADR 752 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 41 1-UNIMOD:1031,15-UNIMOD:35 ms_run[1]:scan=26515 76.641545 3 2555.278488 2554.273740 R M 291 313 PSM EEEIAALVIDNGSGMCKAGFAGDDAPR 753 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 41 1-UNIMOD:1,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=34338 98.92815 3 3030.4053 3030.4058 M A 2 29 PSM EEEIAALVIDNGSGMCKAGFAGDDAPR 754 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 41 1-UNIMOD:1,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=34513 99.678971 3 3030.4053 3030.4058 M A 2 29 PSM EEEIAALVIDNGSGMCKAGFAGDDAPR 755 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 41 1-UNIMOD:1,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=33547 96.586638 2 3032.3992 3030.4062 M A 2 29 PSM SGDAAIVDMVPGKPMCVESFSDYPPLGR 756 sp|P68104|EF1A1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 41 9-UNIMOD:35,13-UNIMOD:1031,15-UNIMOD:35,16-UNIMOD:4 ms_run[1]:scan=31873 91.705417 3 3223.530231 3222.503559 K F 396 424 PSM SSGNAKIGHPAPNFK 757 sp|Q06830|PRDX1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 41 1-UNIMOD:1,6-UNIMOD:1031 ms_run[1]:scan=17608 52.829279 2 1761.9140 1761.9157 M A 2 17 PSM QPQGHLLLIGVSGAGKTTLSR 758 sp|Q14204|DYHC1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 41 1-UNIMOD:28,16-UNIMOD:1031 ms_run[1]:scan=29614 85.307918 3 2311.2990 2311.3007 R F 2928 2949 PSM THEEHHAAKTLGIGK 759 sp|P08237|PFKAM_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 41 1-UNIMOD:1,9-UNIMOD:1031 ms_run[1]:scan=13070 40.897845 3 1865.9704 1865.9743 M A 2 17 PSM THEEHHAAKTLGIGK 760 sp|P08237|PFKAM_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 41 1-UNIMOD:1,9-UNIMOD:1031 ms_run[1]:scan=13083 40.931711 2 1865.9730 1865.9743 M A 2 17 PSM PLSLIQGPPGTGKTVTSATIVYHLAR 761 sp|Q92900|RENT1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 41 13-UNIMOD:1031 ms_run[1]:scan=30505 87.839736 3 2873.627254 2872.617464 R Q 497 523 PSM IVIGYQSHADTATKSGSTTK 762 sp|P06730|IF4E_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 41 14-UNIMOD:1031 ms_run[1]:scan=14883 45.652188 3 2261.172815 2260.169926 K N 193 213 PSM GAAVDGGKLDVGNAEVK 763 sp|P51572|BAP31_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 41 8-UNIMOD:1031 ms_run[1]:scan=20052 59.264224 2 1793.949469 1794.947578 K L 160 177 PSM GKLPIVNEDDELVAIIAR 764 sp|P12268|IMDH2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 41 2-UNIMOD:1031 ms_run[1]:scan=33408 96.227709 3 2161.197428 2160.215420 K T 207 225 PSM IVIQKYHTVNGHNCEVR 765 sp|P09651|ROA1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 41 5-UNIMOD:1031,14-UNIMOD:4 ms_run[1]:scan=14927 45.768874 3 2261.172815 2262.169155 K K 162 179 PSM KEAESCDCLQGFQLTHSLGGGTGSGMGTLLISK 766 sp|P04350|TBB4A_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 41 1-UNIMOD:259,6-UNIMOD:4,8-UNIMOD:4 ms_run[1]:scan=32310 93.027422 3 3449.619338 3446.635975 R I 122 155 PSM AAKEAMEDGEIDGNK 767 sp|P19338|NUCL_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 3-UNIMOD:1031 ms_run[2]:scan=15442 47.111 2 1772.8251 1772.8251 K V 625 640 PSM AAVKGYLGPEQLPDCLK 768 sp|P40926|MDHM_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 4-UNIMOD:1031,15-UNIMOD:4 ms_run[2]:scan=26422 76.392 2 2054.087 2054.0870 K G 75 92 PSM AELIKTHHNDTELIR 769 sp|P49915-2|GUAA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 5-UNIMOD:1031 ms_run[2]:scan=16235 49.22 3 1985.0694 1985.0694 K K 286 301 PSM AKELDPTNMTYITNQAAVYFEK 770 sp|P31948|STIP1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 2-UNIMOD:1031 ms_run[2]:scan=33103 95.419 3 2742.3575 2742.3575 K G 251 273 PSM ALDEGDIALLKTYGQSTYSR 771 sp|P35998|PRS7_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 11-UNIMOD:1031 ms_run[2]:scan=30098 86.664 3 2396.2224 2396.2224 R Q 24 44 PSM ASSHSSQTQGGGSVTK 772 sp|P02545-6|LMNA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 ms_run[2]:scan=1930 10.538 2 1517.707 1517.7070 R K 402 418 PSM AVLLGPPGAGKGTQAPR 773 sp|P54819-3|KAD2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 11-UNIMOD:1031 ms_run[2]:scan=21201 62.334 2 1785.0261 1785.0261 R L 18 35 PSM DDKHGSYEDAVHSGALND 774 sp|P17987|TCPA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 3-UNIMOD:1031 ms_run[2]:scan=15816 48.101 3 2124.9348 2124.9348 K - 539 557 PSM DGKTLNDELEIIEGMK 775 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 3-UNIMOD:1031 ms_run[2]:scan=32915 94.863 2 2000.0136 2000.0136 K F 203 219 PSM DIKAANVLLSEHGEVK 776 sp|Q9Y6E0-2|STK24_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 3-UNIMOD:1031 ms_run[2]:scan=23347 68.039 3 1918.0524 1918.0524 R L 144 160 PSM DIKAGNILLNTEGHAK 777 sp|Q13043-2|STK4_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 3-UNIMOD:1031 ms_run[2]:scan=22582 66.002 2 1889.0371 1889.0371 R L 149 165 PSM DIKAGNILLTEPGQVK 778 sp|Q7L7X3-3|TAOK1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 3-UNIMOD:1031 ms_run[2]:scan=27018 78.093 2 1891.0779 1891.0779 R L 151 167 PSM DLEHLSKFIEEHATK 779 sp|P13667|PDIA4_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 7-UNIMOD:1031 ms_run[2]:scan=25301 73.363 3 1992.0316 1992.0316 R L 623 638 PSM DLKPENILLDEEGHIK 780 sp|P51812|KS6A3_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 3-UNIMOD:1031 ms_run[2]:scan=27219 78.636 2 2058.0997 2058.0997 R L 193 209 PSM DLKPENVLLDAHMNAK 781 sp|Q13131|AAPK1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 3-UNIMOD:1031,13-UNIMOD:35 ms_run[2]:scan=23254 67.792 2 2019.0459 2019.0459 R I 150 166 PSM DNIKHVPGGGNVQIQNK 782 sp|P27816-6|MAP4_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 4-UNIMOD:1031 ms_run[2]:scan=16532 50.003 3 2013.0756 2013.0756 K K 1012 1029 PSM DQVTAQEIFQDNHEDGPTAKK 783 sp|P13010|XRCC5_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 20-UNIMOD:1031 ms_run[2]:scan=19882 58.811 3 2566.23 2566.2300 K L 546 567 PSM DSSGNLHGYVAEGGAKDIR 784 sp|Q8IZ83-3|A16A1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 16-UNIMOD:1031 ms_run[2]:scan=17887 53.571 3 2141.0501 2141.0501 R G 498 517 PSM DVKGSYVSIHSSGFR 785 sp|Q13838|DX39B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 3-UNIMOD:1031 ms_run[2]:scan=20006 59.141 2 1833.9373 1833.9373 K D 34 49 PSM EDGNEEDKENQGDETQGQQPPQR 786 sp|P67809|YBOX1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 8-UNIMOD:1031 ms_run[2]:scan=9382 31.006 3 2823.218 2823.2180 R R 257 280 PSM FGEVVDCTIKMDPNTGR 787 sp|Q99729-3|ROAA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 7-UNIMOD:4,10-UNIMOD:1031 ms_run[2]:scan=24064 69.959 2 2134.0187 2134.0187 K S 93 110 PSM FGEVVDCTLKLDPITGR 788 sp|Q14103-4|HNRPD_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 7-UNIMOD:4,10-UNIMOD:1031 ms_run[2]:scan=30156 86.823 2 2115.1034 2115.1034 K S 101 118 PSM FIMESGAKGCEVVVSGK 789 sp|P23396|RS3_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 8-UNIMOD:1031,10-UNIMOD:4 ms_run[2]:scan=22540 65.893 2 1993.0013 1993.0013 R L 125 142 PSM FKSDQNLQTALELTR 790 sp|O95373|IPO7_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 2-UNIMOD:1031 ms_run[2]:scan=26260 75.948 2 1959.0425 1959.0425 K R 488 503 PSM GAVDGGLSIPHSTKR 791 sp|P46777|RL5_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 14-UNIMOD:1031 ms_run[2]:scan=17372 52.209 2 1689.9162 1689.9162 K F 165 180 PSM GCLLYGPPGTGKTLLAR 792 sp|P62333|PRS10_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 2-UNIMOD:4,12-UNIMOD:1031 ms_run[2]:scan=27683 79.971 2 1969.0819 1969.0819 K A 169 186 PSM GFGFVTFDDHDPVDKIVLQK 793 sp|P22626-2|ROA2_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 15-UNIMOD:1031 ms_run[2]:scan=32504 93.65 3 2472.2689 2472.2689 R Y 142 162 PSM GGKSGAAFYATEDDR 794 sp|Q9Y2I7|FYV1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 3-UNIMOD:1031 ms_run[2]:scan=17347 52.143 2 1739.8115 1739.8115 R F 1859 1874 PSM GIVDQSQQAYQEAFEISK 795 sp|P63104|1433Z_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 ms_run[2]:scan=23488 68.418 2 2039.98 2039.9800 K K 140 158 PSM GKLGLVGVNLTLDGVK 796 sp|P53396-2|ACLY_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 2-UNIMOD:1031 ms_run[2]:scan=32049 92.214 2 1778.0666 1778.0666 R S 67 83 PSM GQAGGKLHIIEVGTPPTGNQPFPK 797 sp|Q00610-2|CLH1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 6-UNIMOD:1031 ms_run[2]:scan=25592 74.145 3 2638.4231 2638.4231 R K 222 246 PSM GQKCEFQDAYVLLSEK 798 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 3-UNIMOD:1031,4-UNIMOD:4 ms_run[2]:scan=28490 82.188 2 2110.0405 2110.0405 K K 234 250 PSM GVLLYGPPGTGKTLLAR 799 sp|P62195-2|PRS8_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 12-UNIMOD:1031 ms_run[2]:scan=29254 84.301 2 1908.1197 1908.1197 K A 177 194 PSM GVLMYGPPGTGKTLLAR 800 sp|P17980|PRS6A_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 4-UNIMOD:35,12-UNIMOD:1031 ms_run[2]:scan=26976 77.978 2 1942.071 1942.0710 K A 222 239 PSM GVLMYGPPGTGKTLLAR 801 sp|P17980|PRS6A_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 4-UNIMOD:35,12-UNIMOD:1031 ms_run[2]:scan=27956 80.72 2 1942.071 1942.0710 K A 222 239 PSM HELQANCYEEVKDR 802 sp|P23528|COF1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 7-UNIMOD:4,12-UNIMOD:1031 ms_run[2]:scan=15150 46.352 2 1985.9265 1985.9265 K C 133 147 PSM IGDFGLVTSLKNDGK 803 sp|P19525-2|E2AK2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 11-UNIMOD:1031 ms_run[2]:scan=29595 85.254 2 1758.9516 1758.9516 K R 389 404 PSM IGHPAPNFKATAVMPDGQFK 804 sp|Q06830|PRDX1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 9-UNIMOD:1031 ms_run[2]:scan=23426 68.25 3 2321.1991 2321.1991 K D 8 28 PSM IGSSMKSVGEVMAIGR 805 sp|P31327|CPSM_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 5-UNIMOD:35,6-UNIMOD:1031 ms_run[2]:scan=23645 68.833 2 1832.9488 1832.9488 R T 788 804 PSM IGSSMKSVGEVMAIGR 806 sp|P31327|CPSM_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 5-UNIMOD:35,6-UNIMOD:1031 ms_run[2]:scan=23775 69.18 2 1832.9488 1832.9488 R T 788 804 PSM IGSSMKSVGEVMAIGR 807 sp|P31327|CPSM_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 5-UNIMOD:35,6-UNIMOD:1031 ms_run[2]:scan=23905 69.527 2 1832.9488 1832.9488 R T 788 804 PSM IIFVVGGPGSGKGTQCEK 808 sp|P00568|KAD1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 12-UNIMOD:1031,16-UNIMOD:4 ms_run[2]:scan=23987 69.75 2 2029.0666 2029.0666 K I 10 28 PSM ILTGGADKNVVVFDK 809 sp|Q9UMS4|PRP19_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 8-UNIMOD:1031 ms_run[2]:scan=24954 72.351 2 1770.988 1770.9880 K S 237 252 PSM IMGLDLPDGGHLTHGYMSDVKR 810 sp|P34897-3|GLYM_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 21-UNIMOD:1031 ms_run[2]:scan=25908 75.003 4 2607.2938 2607.2938 R I 140 162 PSM INVYYNEATGGKYVPR 811 sp|P68371|TBB4B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 12-UNIMOD:1031 ms_run[2]:scan=22235 65.082 2 2039.0476 2039.0476 R A 47 63 PSM ISMADVKFSFQCPGR 812 sp|Q13418-3|ILK_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 3-UNIMOD:35,7-UNIMOD:1031,12-UNIMOD:4 ms_run[2]:scan=24795 71.918 2 1953.9441 1953.9441 R M 201 216 PSM KAAAPAPEEEMDECEQALAAEPK 813 sp|P26641|EF1G_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 1-UNIMOD:1031,11-UNIMOD:35,14-UNIMOD:4 ms_run[2]:scan=17836 53.436 3 2696.2309 2696.2309 K A 253 276 PSM KDPEGTPYINHPIGVAR 814 sp|Q8N4P3-2|MESH1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 1-UNIMOD:1031 ms_run[2]:scan=18427 54.985 3 2059.0851 2059.0851 R I 25 42 PSM KEICNAYTELNDPMR 815 sp|Q15046|SYK_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 1-UNIMOD:1031,4-UNIMOD:4,14-UNIMOD:35 ms_run[2]:scan=20430 60.262 2 2064.9609 2064.9609 K Q 493 508 PSM KEICNAYTELNDPMR 816 sp|Q15046|SYK_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 1-UNIMOD:1031,4-UNIMOD:4 ms_run[2]:scan=23080 67.326 2 2048.9659 2048.9659 K Q 493 508 PSM KGFSEGLWEIENNPTVK 817 sp|P51858|HDGF_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 1-UNIMOD:1031 ms_run[2]:scan=28358 81.825 2 2143.095 2143.0950 R A 80 97 PSM KHYFYADLPAGYQITQQR 818 sp|O75879|GATB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 1-UNIMOD:1031 ms_run[2]:scan=24622 71.452 3 2394.2121 2394.2121 R L 139 157 PSM KLFIGGLSFETTEESLR 819 sp|P22626-2|ROA2_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 1-UNIMOD:1031 ms_run[2]:scan=32812 94.564 2 2122.131 2122.1310 R N 10 27 PSM KNGGLGHMNIALLSDLTK 820 sp|P30048-2|PRDX3_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 1-UNIMOD:1031 ms_run[2]:scan=29331 84.508 3 2077.1354 2077.1354 R Q 131 149 PSM KQIWTLEQPPDEAGSAAVCLR 821 sp|Q16658|FSCN1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 1-UNIMOD:1031,19-UNIMOD:4 ms_run[2]:scan=28341 81.778 3 2564.3057 2564.3057 K S 43 64 PSM KVSQPIEGHAASFAQFK 822 sp|Q00610-2|CLH1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 1-UNIMOD:1031 ms_run[2]:scan=19456 57.689 3 2040.0793 2040.0793 R M 189 206 PSM KYEDICPSTHNMDVPNIK 823 sp|P63241|IF5A1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 1-UNIMOD:1031,6-UNIMOD:4,12-UNIMOD:35 ms_run[2]:scan=17597 52.8 3 2372.1141 2372.1141 K R 68 86 PSM LADFGVAGQLTDTQIKR 824 sp|Q9P289|STK26_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 16-UNIMOD:1031 ms_run[2]:scan=26518 76.649 2 2028.1004 2028.1004 K N 160 177 PSM LCCLEKGPNGYGFHLHGEK 825 sp|O14745|NHRF1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 2-UNIMOD:4,3-UNIMOD:4,6-UNIMOD:1031 ms_run[2]:scan=19661 58.233 4 2411.1515 2411.1515 R G 14 33 PSM LIGDAAKNQVAMNPTNTVFDAK 826 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 7-UNIMOD:1031,12-UNIMOD:35 ms_run[2]:scan=25667 74.348 3 2529.2897 2529.2897 R R 50 72 PSM LIGDAAKNQVAMNPTNTVFDAK 827 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 7-UNIMOD:1031 ms_run[2]:scan=26701 77.191 3 2513.2948 2513.2948 R R 50 72 PSM LLAEPVPGIKAEPDESNAR 828 sp|P61088|UBE2N_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 10-UNIMOD:1031 ms_run[2]:scan=24366 70.767 2 2201.1692 2201.1692 R Y 15 34 PSM LTDFGLSKEAIDHEK 829 sp|Q15418-4|KS6A1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 8-UNIMOD:1031,15-UNIMOD:1031 ms_run[2]:scan=23087 67.345 2 1905.9927 1905.9927 K K 187 202 PSM MKPGATGESDLAEVLPQHK 830 sp|Q709F0-2|ACD11_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 1-UNIMOD:35,2-UNIMOD:1031 ms_run[2]:scan=19598 58.069 3 2219.1256 2219.1256 - F 1 20 PSM MSNYDTDLFVPYFEAIQK 831 sp|P49588|SYAC_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 1-UNIMOD:35 ms_run[2]:scan=32432 93.415 2 2196.0085 2196.0085 K G 255 273 PSM MYPIDFEKDDDSNFHMDFIVAASNLR 832 sp|P22314-2|UBA1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 8-UNIMOD:1031,16-UNIMOD:35 ms_run[2]:scan=32899 94.816 3 3301.506 3301.5060 K A 804 830 PSM NKTSTTSSMVASAEQPR 833 sp|Q6NXS1|IPP2B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 2-UNIMOD:1031 ms_run[2]:scan=16139 48.968 2 1989.979 1989.9790 K R 17 34 PSM NLGTIAKSGTSEFLNK 834 sp|P14625|ENPL_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 7-UNIMOD:1031 ms_run[2]:scan=25583 74.123 2 1875.0102 1875.0102 K M 162 178 PSM NLGTIAKSGTSEFLNK 835 sp|P14625|ENPL_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 7-UNIMOD:1031 ms_run[2]:scan=25712 74.473 2 1875.0102 1875.0102 K M 162 178 PSM NLGTIAKSGTSEFLNK 836 sp|P14625|ENPL_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 7-UNIMOD:1031 ms_run[2]:scan=27070 78.233 2 1875.0102 1875.0102 K M 162 178 PSM NPDDITQEEYGEFYK 837 sp|P08238|HS90B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 15-UNIMOD:259 ms_run[2]:scan=18180 54.337 2 1854.8039 1854.8039 R S 292 307 PSM NQVAMNPTNTVFDAKR 838 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 15-UNIMOD:1031 ms_run[2]:scan=23127 67.451 2 2001.0102 2001.0102 K L 57 73 PSM NSLESYAFNMKATVEDEK 839 sp|P11142|HSP7C_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 11-UNIMOD:1031 ms_run[2]:scan=31098 89.509 2 2271.0729 2271.0729 K L 540 558 PSM NSNPALNDNLEKGLLK 840 sp|O00299|CLIC1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 12-UNIMOD:1031 ms_run[2]:scan=24624 71.457 2 1935.0425 1935.0425 K A 120 136 PSM NVVSGKTSACFEPSLDYMVTK 841 sp|P31327|CPSM_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 6-UNIMOD:1031,10-UNIMOD:4 ms_run[2]:scan=27836 80.391 2 2528.2291 2528.2291 K I 752 773 PSM QATKDAGTIAGLNVMR 842 sp|P11021|BIP_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 4-UNIMOD:1031,15-UNIMOD:35 ms_run[2]:scan=20547 60.57 2 1856.9778 1856.9778 R I 182 198 PSM QGLTKDAHNALLDIQSSGR 843 sp|Q99613-2|EIF3C_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 5-UNIMOD:1031 ms_run[2]:scan=22572 65.975 3 2219.1658 2219.1658 R A 613 632 PSM SAAETVTKGGIMLPEK 844 sp|P61604|CH10_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 8-UNIMOD:1031,12-UNIMOD:35 ms_run[2]:scan=21779 63.868 2 1842.9761 1842.9761 R S 21 37 PSM SAAETVTKGGIMLPEK 845 sp|P61604|CH10_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 8-UNIMOD:1031 ms_run[2]:scan=23394 68.162 2 1826.9812 1826.9812 R S 21 37 PSM SPAGLQVLNDYLADK 846 sp|P24534|EF1B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 ms_run[2]:scan=26579 76.812 2 1602.8253 1602.8253 K S 8 23 PSM TAFDDAIAELDTLNEDSYK 847 sp|P61981|1433G_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 19-UNIMOD:259 ms_run[2]:scan=31512 90.676 3 2137.9783 2137.9783 K D 199 218 PSM TAYGPNGMNKMVINHLEK 848 sp|P50990-2|TCPQ_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 10-UNIMOD:1031,11-UNIMOD:35 ms_run[2]:scan=20120 59.44 3 2228.1082 2228.1082 R L 26 44 PSM TCTTVAFTQVNSEDKGALAK 849 sp|P62424|RL7A_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 2-UNIMOD:4,15-UNIMOD:1031 ms_run[2]:scan=22542 65.897 3 2336.1682 2336.1682 K L 198 218 PSM TETVQKLCPGGQLPFLLYGTEVHTDTNK 850 sp|O00299|CLIC1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 6-UNIMOD:1031,8-UNIMOD:4 ms_run[2]:scan=31978 92.015 3 3341.6966 3341.6966 R I 52 80 PSM TFIIGISGVTNSGKTTLAK 851 sp|Q9NWW6-2|NRK1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 14-UNIMOD:1031 ms_run[2]:scan=29175 84.077 2 2103.194 2103.1940 K N 3 22 PSM TFIIGISGVTNSGKTTLAK 852 sp|Q9NWW6-2|NRK1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 14-UNIMOD:1031 ms_run[2]:scan=29057 83.757 3 2103.194 2103.1940 K N 3 22 PSM TGAEGAVLDEAKNINK 853 sp|O60282|KIF5C_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 12-UNIMOD:1031 ms_run[2]:scan=21423 62.928 2 1824.9581 1824.9581 K S 242 258 PSM TIAQDYGVLKADEGISFR 854 sp|Q06830|PRDX1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 10-UNIMOD:1031 ms_run[2]:scan=29055 83.752 3 2178.1321 2178.1321 R G 111 129 PSM TSIMSKQYGNEVFLAK 855 sp|P50990-2|TCPQ_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 4-UNIMOD:35,6-UNIMOD:1031 ms_run[2]:scan=23345 68.034 2 2027.0398 2027.0398 R L 147 163 PSM TSIMSKQYGNEVFLAK 856 sp|P50990-2|TCPQ_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 4-UNIMOD:35,6-UNIMOD:1031 ms_run[2]:scan=25298 73.355 2 2027.0398 2027.0398 R L 147 163 PSM TSIMSKQYGNEVFLAK 857 sp|P50990-2|TCPQ_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 6-UNIMOD:1031 ms_run[2]:scan=26200 75.791 2 2011.0448 2011.0448 R L 147 163 PSM TSIMSKQYGNEVFLAK 858 sp|P50990-2|TCPQ_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 6-UNIMOD:1031,16-UNIMOD:1031 ms_run[2]:scan=26219 75.841 2 2019.059 2019.0590 R L 147 163 PSM TSLGPNGLDKMMVDK 859 sp|P48643|TCPE_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 10-UNIMOD:1031,11-UNIMOD:35 ms_run[2]:scan=21554 63.275 2 1816.9063 1816.9063 R D 50 65 PSM TVDFTQDSNYLLTGGQDK 860 sp|Q9Y3F4|STRAP_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 ms_run[2]:scan=22340 65.364 2 2000.9327 2000.9327 K L 105 123 PSM TVDNFVALATGEKGFGYK 861 sp|P23284|PPIB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 13-UNIMOD:1031 ms_run[2]:scan=31094 89.499 2 2112.0892 2112.0892 K N 72 90 PSM TVKHGAGAEISTVNPEQYSK 862 sp|P48426-2|PI42A_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 3-UNIMOD:1031 ms_run[2]:scan=16488 49.887 3 2311.1808 2311.1808 K R 317 337 PSM TVYGGGCSEMLMAHAVTQLANR 863 sp|P78371|TCPB_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 7-UNIMOD:4 ms_run[2]:scan=24117 70.1 3 2365.0977 2365.0977 R T 406 428 PSM VAIVGGSGSGKSTIVR 864 sp|O75027-3|ABCB7_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 11-UNIMOD:1031 ms_run[2]:scan=20016 59.169 2 1682.9679 1682.9679 K L 461 477 PSM VAVVAGYGDVGKGCAQALR 865 sp|P23526-2|SAHH_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 12-UNIMOD:1031,14-UNIMOD:4 ms_run[2]:scan=22332 65.345 2 2086.0993 2086.0993 K G 187 206 PSM VFGEDSVGVIFKNGDDLR 866 sp|P42338|PK3CB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 12-UNIMOD:1031 ms_run[2]:scan=30684 88.339 2 2162.1008 2162.1008 K Q 794 812 PSM VISHAISEHVEDAGVHSGDATLMLPTQTISQGAIEK 867 sp|P31327|CPSM_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 36-UNIMOD:259 ms_run[2]:scan=21495 63.114 5 3748.8822 3748.8822 R V 1187 1223 PSM VISHAISEHVEDAGVHSGDATLMLPTQTISQGAIEKVK 868 sp|P31327|CPSM_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 36-UNIMOD:1031 ms_run[2]:scan=25903 74.99 5 4164.1525 4164.1525 R D 1187 1225 PSM VISSIEQKTSADGNEK 869 sp|P61981|1433G_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 8-UNIMOD:1031 ms_run[2]:scan=17106 51.513 2 1900.9742 1900.9742 R K 62 78 PSM VKAFGPGLQGGSAGSPAR 870 sp|P21333-2|FLNA_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 2-UNIMOD:1031 ms_run[2]:scan=19967 59.039 2 1851.9955 1851.9955 K F 1070 1088 PSM VLVGKNFEDVAFDEK 871 sp|P07237|PDIA1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 5-UNIMOD:1031 ms_run[2]:scan=27944 80.687 2 1904.9884 1904.9884 K K 371 386 PSM VPKTASTSFTNIAYDLCAK 872 sp|Q7LGA3-3|HS2ST_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 3-UNIMOD:1031,17-UNIMOD:4 ms_run[2]:scan=28364 81.842 3 2282.1617 2282.1617 R N 81 100 PSM VSDFGLTKEASSTQDTGK 873 sp|P41240|CSK_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 8-UNIMOD:1031 ms_run[2]:scan=20587 60.676 3 2066.0168 2066.0168 K L 330 348 PSM VSKTGAEGAVLDEAK 874 sp|O60282|KIF5C_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 3-UNIMOD:1031 ms_run[2]:scan=19289 57.25 2 1669.8887 1669.8887 K N 239 254 PSM WGEDNHWICKPWNLAR 875 sp|Q14166|TTL12_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 9-UNIMOD:4,10-UNIMOD:1031 ms_run[2]:scan=29278 84.365 3 2277.0902 2277.0902 R S 410 426 PSM YLKSEPIPESNDGPVK 876 sp|P30101|PDIA3_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 3-UNIMOD:1031 ms_run[2]:scan=20127 59.457 2 1968.0204 1968.0204 R V 364 380 PSM YQGVNLYVKNLDDGIDDER 877 sp|P11940|PABP1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 40 9-UNIMOD:1031 ms_run[2]:scan=27923 80.629 2 2421.1812 2421.1812 R L 291 310 PSM NLGTIAKSGTSEFLNK 878 sp|P14625|ENPL_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 40 7-UNIMOD:1031 ms_run[1]:scan=25975 75.185805 2 1876.001170 1875.010178 K M 162 178 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 879 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 40 1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=33675 96.925907 3 2991.3592 2990.3382 M A 2 29 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 880 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 40 1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=34428 99.291729 3 2991.3592 2990.3382 M A 2 29 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 881 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 40 1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=34340 98.933312 3 2991.3592 2990.3382 M A 2 29 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 882 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 40 1-UNIMOD:1,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=34617 100.18382 3 2974.3418 2974.3432 M A 2 29 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 883 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 40 1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=34007 97.828199 3 2991.3552 2990.3382 M A 2 29 PSM EEEIAALVIDNGSGMCKAGFAGDDAPR 884 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 40 1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=34232 98.517964 3 3048.4242 3046.4002 M A 2 29 PSM EEEIAALVIDNGSGMCKAGFAGDDAPR 885 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 40 1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=34414 99.244667 3 3046.4142 3046.4002 M A 2 29 PSM EEEIAALVIDNGSGMCKAGFAGDDAPR 886 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 40 1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=34327 98.88411 3 3046.4142 3046.4002 M A 2 29 PSM EEEIAALVIDNGSGMCKAGFAGDDAPR 887 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 40 1-UNIMOD:1,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=34437 99.324487 3 3030.4053 3030.4058 M A 2 29 PSM AAVATFLQSVQVPEFTPKSGVK 888 sp|P22314|UBA1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 40 18-UNIMOD:1031 ms_run[1]:scan=33194 95.674838 3 2500.386218 2499.373711 R I 785 807 PSM KQGGLGPMNIPLVSDPK 889 sp|Q06830|PRDX1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 40 1-UNIMOD:1031,8-UNIMOD:35 ms_run[1]:scan=24293 70.566442 2 1962.052240 1962.060834 K R 93 110 PSM TAFDEAIAELDTLNEDSYK 890 sp|P27348|1433T_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 40 ms_run[1]:scan=32214 92.679166 2 2143.968386 2143.979725 K D 194 213 PSM DVDDGLQAAEEVGYPVMIKASEGGGGK 891 sp|Q13085|ACACA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 40 19-UNIMOD:1031 ms_run[1]:scan=33126 95.485663 3 2887.397164 2887.390954 K G 293 320 PSM SAVADKHELLSLASSNHLGK 892 sp|O15372|EIF3H_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 40 6-UNIMOD:1031 ms_run[1]:scan=25393 73.607794 3 2273.224648 2272.217545 K N 222 242 PSM HSDGNLCVKVTDDLVCLVYK 893 sp|P49458|SRP09_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 40 7-UNIMOD:4,9-UNIMOD:1031,16-UNIMOD:4 ms_run[1]:scan=33302 95.953005 3 2531.259322 2530.255981 R T 33 53 PSM VIVDFSSPNIAKEMHVGHLR 894 sp|P54136|SYRC_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 40 12-UNIMOD:1031,14-UNIMOD:35 ms_run[1]:scan=22248 65.116492 3 2461.303405 2460.294750 K S 194 214 PSM MESGFTSKDTYLSHFNPR 895 sp|P40261|NNMT_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 40 1-UNIMOD:1,8-UNIMOD:1031 ms_run[1]:scan=30161 86.835106 3 2354.1064 2354.0996 - D 1 19 PSM TKLDTLATGHLFQEVR 896 sp|Q9NRH2|SNRK_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 40 2-UNIMOD:1031 ms_run[1]:scan=27576 79.671986 3 2025.111044 2024.105475 K C 50 66 PSM KLNCQVIGASVDSHFCHLAWVNTPK 897 sp|Q06830|PRDX1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 40 1-UNIMOD:259,4-UNIMOD:4,16-UNIMOD:4,25-UNIMOD:259 ms_run[1]:scan=29481 84.941335 4 2899.442641 2896.444737 K K 68 93 PSM WGDAGAEYVVESTGVFTTMEK 898 sp|P04406|G3P_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 40 21-UNIMOD:259 ms_run[1]:scan=29494 84.977422 2 2284.045126 2284.044914 K A 87 108 PSM ADLINNLGTIAKSGTK 899 sp|P07900|HS90A_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 12-UNIMOD:1031 ms_run[2]:scan=26604 76.879 2 1811.0153 1811.0153 K A 101 117 PSM AEVQKLQMEAPHIIVGTPGR 900 sp|P60842|IF4A1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 5-UNIMOD:1031,8-UNIMOD:35 ms_run[2]:scan=23133 67.466 3 2385.2838 2385.2839 R V 142 162 PSM AFGQAKHQPTAIIAK 901 sp|P29401|TKT_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 6-UNIMOD:1031 ms_run[2]:scan=17021 51.291 3 1776.0046 1776.0046 K T 227 242 PSM ANGTTVHVGIHPSKVVITR 902 sp|P61254|RL26_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 14-UNIMOD:1031 ms_run[2]:scan=18361 54.814 4 2181.2382 2181.2382 K L 90 109 PSM ASGNYATVISHNPETKK 903 sp|P62917|RL8_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 16-UNIMOD:1031 ms_run[2]:scan=14972 45.884 2 2012.0327 2012.0327 R T 129 146 PSM AVAISLPKGVVEVTHDLQK 904 sp|P50454|SERPH_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 8-UNIMOD:1031 ms_run[2]:scan=29783 85.78 3 2199.2627 2199.2627 K H 301 320 PSM AVGFSSGTENPHGVKAVTR 905 sp|Q32P28-4|P3H1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 15-UNIMOD:1031 ms_run[2]:scan=16346 49.515 3 2109.0967 2109.0967 R G 648 667 PSM AVILGPPGSGKGTVCQR 906 sp|P27144|KAD4_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 11-UNIMOD:1031,15-UNIMOD:4 ms_run[2]:scan=20696 60.958 2 1892.0302 1892.0302 R I 8 25 PSM AVLLGPPGAGKGTQAPR 907 sp|P54819-3|KAD2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 11-UNIMOD:1031 ms_run[2]:scan=21069 61.964 2 1785.0261 1785.0261 R L 18 35 PSM AVLLGPPGAGKGTQAPR 908 sp|P54819-3|KAD2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 11-UNIMOD:1031 ms_run[2]:scan=21331 62.686 2 1785.0261 1785.0261 R L 18 35 PSM AVLLGPPGAGKGTQAPR 909 sp|P54819-3|KAD2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 11-UNIMOD:1031 ms_run[2]:scan=21461 63.026 2 1785.0261 1785.0261 R L 18 35 PSM CNILHADIKPDNILVNESK 910 sp|Q13523|PRP4B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 1-UNIMOD:4,9-UNIMOD:1031 ms_run[2]:scan=25669 74.353 3 2388.2471 2388.2471 R T 809 828 PSM DGDFENPVPYTGAVKVGAIQR 911 sp|P30040|ERP29_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 15-UNIMOD:1031 ms_run[2]:scan=27754 80.163 3 2428.2387 2428.2387 R W 123 144 PSM DIATIVADKCVNPETK 912 sp|Q9Y3A5|SBDS_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 9-UNIMOD:1031,10-UNIMOD:4 ms_run[2]:scan=26590 76.842 2 1969.019 1969.0190 R R 110 126 PSM DIKAANVLLSEQGDVK 913 sp|Q9P289|STK26_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 3-UNIMOD:1031 ms_run[2]:scan=26359 76.219 2 1895.0364 1895.0364 R L 144 160 PSM DIKAANVLLSEQGDVK 914 sp|Q9P289|STK26_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 3-UNIMOD:1031,16-UNIMOD:1031 ms_run[2]:scan=26109 75.543 2 1903.0506 1903.0506 R L 144 160 PSM DIKGANILLTDNGHVK 915 sp|Q8IVH8-3|M4K3_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 3-UNIMOD:1031 ms_run[2]:scan=23821 69.301 2 1903.0527 1903.0527 R L 136 152 PSM DKYMTETWDPSHAPDNFR 916 sp|Q9UP95-5|S12A4_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 2-UNIMOD:1031,4-UNIMOD:35 ms_run[2]:scan=21750 63.792 3 2421.0696 2421.0696 R E 956 974 PSM DLDPEQGHTVYAKK 917 sp|P16066|ANPRA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 13-UNIMOD:1031 ms_run[2]:scan=15609 47.549 2 1795.9105 1795.9105 R L 686 700 PSM DQLIYNLLKEEQTPQNK 918 sp|P00338|LDHA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 9-UNIMOD:1031 ms_run[2]:scan=29580 85.213 2 2269.1954 2269.1954 K I 6 23 PSM DYNVTANSKLVIITAGAR 919 sp|P00338|LDHA_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 9-UNIMOD:1031 ms_run[2]:scan=31003 89.244 2 2101.1532 2101.1532 K Q 82 100 PSM FGTKGLAITFVSDENDAK 920 sp|O00148|DX39A_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 4-UNIMOD:1031 ms_run[2]:scan=29322 84.482 2 2108.079 2108.0790 R I 380 398 PSM FKGFCYVEFDEVDSLK 921 sp|Q15056-2|IF4H_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 2-UNIMOD:1031,5-UNIMOD:4 ms_run[2]:scan=31984 92.033 2 2178.0343 2178.0343 K E 81 97 PSM GADFLVTEVENGGSLGSK 922 sp|P14618|KPYM_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 18-UNIMOD:259 ms_run[2]:scan=23692 68.956 2 1786.8829 1786.8829 K K 189 207 PSM GALQNIIPASTGAAKAVGK 923 sp|P04406|G3P_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 15-UNIMOD:1031,19-UNIMOD:1031 ms_run[2]:scan=25377 73.566 3 1970.1404 1970.1404 R V 201 220 PSM GDINVCIVGDPSTAKSQFLK 924 sp|Q14566|MCM6_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 6-UNIMOD:4,15-UNIMOD:1031 ms_run[2]:scan=30062 86.56 3 2344.2097 2344.2097 R H 388 408 PSM GFGFVDFNSEEDAKAAK 925 sp|P19338|NUCL_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 14-UNIMOD:1031 ms_run[2]:scan=27139 78.42 2 2026.9636 2026.9636 K E 611 628 PSM GILAADESTGSIAKR 926 sp|P04075|ALDOA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 14-UNIMOD:1031 ms_run[2]:scan=20074 59.32 2 1683.9155 1683.9155 K L 29 44 PSM GILLYGPPGTGKTLIAR 927 sp|P55072|TERA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 12-UNIMOD:1031 ms_run[2]:scan=29879 86.049 2 1922.1353 1922.1353 R A 240 257 PSM GMITVTDPDLIEKSNLNR 928 sp|A0AVT1-2|UBA6_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 2-UNIMOD:35,13-UNIMOD:1031 ms_run[2]:scan=25837 74.806 3 2227.1518 2227.1518 K Q 17 35 PSM GPILCFVGPPGVGKTSVGR 929 sp|Q86WA8-2|LONP2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 5-UNIMOD:4,14-UNIMOD:1031 ms_run[2]:scan=29496 84.983 3 2093.1456 2093.1456 K S 324 343 PSM GSYGDLGGPIITTQVTIPK 930 sp|P61978|HNRPK_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 ms_run[2]:scan=25555 74.047 2 1916.0255 1916.0255 R D 378 397 PSM GVLMYGPPGCGKTMLAK 931 sp|P43686-2|PRS6B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 4-UNIMOD:35,10-UNIMOD:4,12-UNIMOD:1031,14-UNIMOD:35 ms_run[2]:scan=21732 63.742 2 2006.9992 2006.9992 R A 170 187 PSM GVLMYGPPGCGKTMLAK 932 sp|P43686-2|PRS6B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 4-UNIMOD:35,10-UNIMOD:4,12-UNIMOD:1031,14-UNIMOD:35 ms_run[2]:scan=21863 64.09 2 2006.9992 2006.9992 R A 170 187 PSM GVLMYGPPGTGKTLLAR 933 sp|P17980|PRS6A_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 4-UNIMOD:35,12-UNIMOD:1031 ms_run[2]:scan=26575 76.802 2 1942.071 1942.0710 K A 222 239 PSM GVLMYGPPGTGKTLLAR 934 sp|P17980|PRS6A_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 4-UNIMOD:35,12-UNIMOD:1031 ms_run[2]:scan=26856 77.639 2 1942.071 1942.0710 K A 222 239 PSM GVLMYGPPGTGKTLLAR 935 sp|P17980|PRS6A_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 12-UNIMOD:1031 ms_run[2]:scan=28348 81.801 2 1926.0761 1926.0761 K A 222 239 PSM HLEINPDHPIVETLR 936 sp|P08238|HS90B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 15-UNIMOD:267 ms_run[2]:scan=17122 51.557 3 1791.9507 1791.9507 K Q 625 640 PSM HYGPGWVSMANAGK 937 sp|P23284|PPIB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 ms_run[2]:scan=13816 42.861 2 1473.6823 1473.6823 K D 132 146 PSM IGAEVYHNLKNVIK 938 sp|P06733|ENOA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 10-UNIMOD:1031 ms_run[2]:scan=24361 70.754 2 1793.02 1793.0200 R E 184 198 PSM IGSSMKSVGEVMAIGR 939 sp|P31327|CPSM_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 5-UNIMOD:35,6-UNIMOD:1031 ms_run[2]:scan=24039 69.892 2 1832.9488 1832.9488 R T 788 804 PSM IGSSMKSVGEVMAIGR 940 sp|P31327|CPSM_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 5-UNIMOD:35,6-UNIMOD:1031 ms_run[2]:scan=25414 73.665 2 1832.9488 1832.9488 R T 788 804 PSM IGSSMKSVGEVMAIGR 941 sp|P31327|CPSM_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 5-UNIMOD:35,6-UNIMOD:1031 ms_run[2]:scan=25544 74.02 2 1832.9488 1832.9488 R T 788 804 PSM IGSSMKSVGEVMAIGR 942 sp|P31327|CPSM_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 5-UNIMOD:35,6-UNIMOD:1031 ms_run[2]:scan=25685 74.398 2 1832.9488 1832.9488 R T 788 804 PSM IIHTDIKPENILMCVDDAYVR 943 sp|P78362|SRPK2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 7-UNIMOD:1031,14-UNIMOD:4 ms_run[2]:scan=31517 90.692 3 2710.3822 2710.3822 K R 210 231 PSM IKDLSTVEALQNLK 944 sp|Q9BTT0|AN32E_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 2-UNIMOD:1031 ms_run[2]:scan=27943 80.684 2 1767.0142 1767.0142 K N 100 114 PSM IKSTNPGISIGDVAK 945 sp|O15347|HMGB3_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 2-UNIMOD:1031 ms_run[2]:scan=21389 62.838 2 1694.9567 1694.9567 K K 111 126 PSM IKVAQGVSGAVQDK 946 sp|P12268|IMDH2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 2-UNIMOD:1031 ms_run[2]:scan=16198 49.124 2 1594.9043 1594.9043 K G 437 451 PSM ILLQSKNAGAVIGK 947 sp|P61978|HNRPK_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 6-UNIMOD:1031 ms_run[2]:scan=22949 66.975 2 1606.977 1606.9770 R G 47 61 PSM IQKSSNFGYITSCYK 948 sp|Q58A45-2|PAN3_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 3-UNIMOD:1031,13-UNIMOD:4 ms_run[2]:scan=22919 66.896 2 1990.9822 1990.9822 R A 182 197 PSM ISMADVKFSFQCPGR 949 sp|Q13418-3|ILK_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 7-UNIMOD:1031,12-UNIMOD:4 ms_run[2]:scan=29629 85.353 2 1937.9492 1937.9492 R M 201 216 PSM ISVYYNEATGGKYVPR 950 sp|P07437|TBB5_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 12-UNIMOD:1031 ms_run[2]:scan=22357 65.41 2 2012.0367 2012.0367 R A 47 63 PSM KGEGLPNFDNNNIK 951 sp|Q9UBS4|DJB11_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 1-UNIMOD:1031 ms_run[2]:scan=21093 62.032 2 1754.8951 1754.8951 K G 302 316 PSM KGGSWIQEINVAEK 952 sp|P78527-2|PRKDC_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 1-UNIMOD:1031 ms_run[2]:scan=25025 72.554 2 1753.9363 1753.9363 K N 3992 4006 PSM KGGSWIQEINVAEK 953 sp|P78527-2|PRKDC_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 1-UNIMOD:1031 ms_run[2]:scan=25402 73.632 2 1753.9363 1753.9363 K N 3992 4006 PSM KGVLFGVPGAFTPGCSK 954 sp|P30044|PRDX5_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 1-UNIMOD:1031,15-UNIMOD:4 ms_run[2]:scan=29923 86.171 2 1917.0182 1917.0182 K T 86 103 PSM KHPDASVNFSEFSK 955 sp|P09429|HMGB1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 1-UNIMOD:1031 ms_run[2]:scan=19192 56.997 2 1787.8842 1787.8842 K K 30 44 PSM KHPDSSVNFAEFSK 956 sp|P26583|HMGB2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 1-UNIMOD:1031 ms_run[2]:scan=18894 56.217 2 1787.8842 1787.8842 K K 30 44 PSM KIFVGGLSPDTPEEK 957 sp|Q14103-4|HNRPD_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 1-UNIMOD:1031 ms_run[2]:scan=24236 70.414 2 1811.9669 1811.9669 K I 164 179 PSM KLDPGSEETQTLVR 958 sp|P26641|EF1G_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 1-UNIMOD:1031 ms_run[2]:scan=19135 56.849 2 1767.9367 1767.9367 R E 401 415 PSM KLGEMWNNTAADDK 959 sp|P09429|HMGB1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 1-UNIMOD:1031,5-UNIMOD:35 ms_run[2]:scan=17452 52.422 2 1803.8461 1803.8461 K Q 128 142 PSM KPLFHGDSEIDQLFR 960 sp|P06493|CDK1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 1-UNIMOD:1031 ms_run[2]:scan=28366 81.847 3 1997.0371 1997.0371 K I 201 216 PSM KQTIDNSQGAYQEAFDISK 961 sp|P27348|1433T_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 1-UNIMOD:1031 ms_run[2]:scan=22471 65.708 2 2338.1441 2338.1441 R K 139 158 PSM KTLTTVQGIADDYDK 962 sp|P41567|EIF1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 1-UNIMOD:1031 ms_run[2]:scan=23050 67.247 2 1862.9626 1862.9626 R K 42 57 PSM KYEDICPSTHNMDVPNIK 963 sp|P63241|IF5A1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 1-UNIMOD:1031,6-UNIMOD:4 ms_run[2]:scan=20401 60.185 2 2356.1192 2356.1192 K R 68 86 PSM LATQSNEITIPVTFESR 964 sp|P04792|HSPB1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 ms_run[2]:scan=24328 70.663 2 1904.9844 1904.9844 K A 172 189 PSM LIDIFYPGDQQSVTFGTKSR 965 sp|P54886-2|P5CS_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 18-UNIMOD:1031 ms_run[2]:scan=31849 91.639 2 2467.2747 2467.2747 K V 281 301 PSM LQFHDVAGDIFHQQCKR 966 sp|P11413|G6PD_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 15-UNIMOD:4,16-UNIMOD:1031 ms_run[2]:scan=22545 65.905 4 2294.1379 2294.1379 R N 371 388 PSM MADCGGLPQISQPAKLAEAFK 967 sp|Q92597-3|NDRG1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 4-UNIMOD:4,15-UNIMOD:1031 ms_run[2]:scan=30797 88.663 3 2427.229 2427.2290 K Y 205 226 PSM MSNYDTDLFVPYFEAIQK 968 sp|P49588|SYAC_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 ms_run[2]:scan=33150 95.553 2 2180.0136 2180.0136 K G 255 273 PSM NADMSEEMQQDSVECATQALEKYNIEK 969 sp|P63167|DYL1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 15-UNIMOD:4,22-UNIMOD:1031 ms_run[2]:scan=30474 87.756 3 3356.4847 3356.4847 K D 10 37 PSM NAKSSGNSSSSGSGSGSTSAGSSSPGAR 970 sp|Q12797|ASPH_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 3-UNIMOD:1031 ms_run[2]:scan=6122 22.315 3 2611.1706 2611.1706 K R 6 34 PSM NEKDNALLSAIEESR 971 sp|Q8N1F7|NUP93_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 3-UNIMOD:1031 ms_run[2]:scan=28414 81.978 2 1883.9589 1883.9589 K K 104 119 PSM NIIHGSDSVKSAEK 972 sp|P22392|NDKB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 10-UNIMOD:1031 ms_run[2]:scan=12687 39.881 2 1679.8842 1679.8842 R E 115 129 PSM NLGTIAKSGTSEFLNK 973 sp|P14625|ENPL_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 7-UNIMOD:1031 ms_run[2]:scan=24305 70.598 2 1875.0102 1875.0102 K M 162 178 PSM NLGTIAKSGTSEFLNK 974 sp|P14625|ENPL_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 7-UNIMOD:1031 ms_run[2]:scan=25194 73.063 2 1875.0102 1875.0102 K M 162 178 PSM NLGTIAKSGTSEFLNK 975 sp|P14625|ENPL_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 7-UNIMOD:1031 ms_run[2]:scan=25324 73.426 2 1875.0102 1875.0102 K M 162 178 PSM NLGTIAKSGTSEFLNK 976 sp|P14625|ENPL_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 7-UNIMOD:1031 ms_run[2]:scan=28726 82.834 2 1875.0102 1875.0102 K M 162 178 PSM NLGTIAKSGTSEFLNK 977 sp|P14625|ENPL_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 7-UNIMOD:1031 ms_run[2]:scan=27829 80.37 2 1875.0102 1875.0102 K M 162 178 PSM NPDDITQEEYGEFYK 978 sp|P08238|HS90B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 ms_run[2]:scan=18177 54.329 2 1846.7897 1846.7897 R S 292 307 PSM NQKVVEEAPSIFLDAETR 979 sp|P05165-3|PCCA_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 3-UNIMOD:1031 ms_run[2]:scan=29095 83.859 2 2241.1641 2241.1641 R R 296 314 PSM NSSHAGAFVIVTEEAIAKGIR 980 sp|P49588|SYAC_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 18-UNIMOD:1031 ms_run[2]:scan=31436 90.463 3 2365.2754 2365.2754 R R 730 751 PSM NVHTGELAAVKIIK 981 sp|Q9Y4K4|M4K5_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 11-UNIMOD:1031 ms_run[2]:scan=21976 64.386 2 1687.9985 1687.9985 R L 39 53 PSM PKFYCDYCDTYLTHDSPSVR 982 sp|P09234|RU1C_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 2-UNIMOD:1031,5-UNIMOD:4,8-UNIMOD:4 ms_run[2]:scan=23003 67.122 3 2719.2047 2719.2047 M K 2 22 PSM QATKDAGTIAGLNVMR 983 sp|P11021|BIP_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 4-UNIMOD:1031 ms_run[2]:scan=24118 70.103 2 1840.9829 1840.9829 R I 182 198 PSM QDLMNIAGTTLSSKLLTHHK 984 sp|P78371|TCPB_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 14-UNIMOD:1031 ms_run[2]:scan=29722 85.612 4 2403.2944 2403.2944 R D 157 177 PSM QGQETAVAPSLVAPALNKPK 985 sp|Q15691|MARE1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 18-UNIMOD:1031 ms_run[2]:scan=26027 75.325 2 2214.2372 2214.2372 R K 131 151 PSM SAAQAAAQTNSNAAGKQLR 986 sp|Q8NC51-3|PAIRB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 16-UNIMOD:1031 ms_run[2]:scan=12917 40.488 3 2053.0665 2053.0665 K K 53 72 PSM SDDNSYDEKYLIATSEQPIAALHR 987 sp|P49591|SYSC_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 9-UNIMOD:1031 ms_run[2]:scan=28594 82.476 3 2931.425 2931.4250 K D 258 282 PSM SFSKESDDPMAYIHFTAEGEVTFK 988 sp|P14625|ENPL_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 4-UNIMOD:1031 ms_run[2]:scan=31353 90.225 3 2931.3637 2931.3637 K S 361 385 PSM SKLTFSCLGGSDNFK 989 sp|Q15185-3|TEBP_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 2-UNIMOD:1031,7-UNIMOD:4 ms_run[2]:scan=25828 74.781 2 1855.9138 1855.9138 K H 34 49 PSM SLYQSAGVAPESFEYIEAHGTGTK 990 sp|P49327|FAS_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 ms_run[2]:scan=22224 65.053 3 2541.2023 2541.2023 R V 275 299 PSM STGEAFVQFASQEIAEK 991 sp|P31943|HNRH1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 ms_run[2]:scan=25447 73.754 2 1840.8843 1840.8843 R A 151 168 PSM STNGDTFLGGEDFDQALLR 992 sp|P38646|GRP75_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 ms_run[2]:scan=27781 80.236 2 2054.9545 2054.9545 K H 266 285 PSM SYSMIVNNLLKPISVEGSSK 993 sp|Q9HB71|CYBP_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 11-UNIMOD:1031 ms_run[2]:scan=33061 95.297 2 2361.2614 2361.2614 K K 124 144 PSM TDEEGKDVPDHAVLEMK 994 sp|Q9BUJ2-3|HNRL1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 6-UNIMOD:1031,16-UNIMOD:35 ms_run[2]:scan=16685 50.407 3 2124.0045 2124.0045 R A 432 449 PSM TDKGVSAAGQVVSLK 995 sp|Q9Y606-2|TRUA_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 3-UNIMOD:1031 ms_run[2]:scan=20720 61.023 2 1654.9254 1654.9254 R V 117 132 PSM TGVHHYSGNNIELGTACGK 996 sp|P62888|RL30_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 17-UNIMOD:4,19-UNIMOD:259 ms_run[2]:scan=7433 25.838 3 2021.9469 2021.9469 K Y 69 88 PSM TGVHHYSGNNIELGTACGK 997 sp|P62888|RL30_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 17-UNIMOD:4,19-UNIMOD:259 ms_run[2]:scan=7451 25.884 4 2021.9469 2021.9469 K Y 69 88 PSM TGVHHYSGNNIELGTACGK 998 sp|P62888|RL30_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 17-UNIMOD:4 ms_run[2]:scan=7434 25.84 3 2013.9327 2013.9327 K Y 69 88 PSM TNGKGISCMNTTLSESPFK 999 sp|Q15181|IPYR_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 4-UNIMOD:1031,8-UNIMOD:4 ms_run[2]:scan=24947 72.331 2 2267.0926 2267.0926 K C 235 254 PSM TPGKEAVAMESYAK 1000 sp|P78371|TCPB_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 4-UNIMOD:1031 ms_run[2]:scan=19219 57.067 2 1676.8444 1676.8444 R A 428 442 PSM TPKGTQGVVTNFEIFR 1001 sp|P55884|EIF3B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 3-UNIMOD:1031 ms_run[2]:scan=28555 82.368 2 1989.0684 1989.0684 R M 533 549 PSM TVAGGAWTYNTTSAVTVK 1002 sp|P61513|RL37A_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 18-UNIMOD:259 ms_run[2]:scan=18040 53.97 2 1833.9352 1833.9352 K S 63 81 PSM VDFNVPMKNNQITNNQR 1003 sp|P00558|PGK1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 8-UNIMOD:1031 ms_run[2]:scan=24069 69.971 2 2227.1168 2227.1168 R I 23 40 PSM VEDLSTCNDLIAKHGTALQR 1004 sp|P22059|OSBP1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 7-UNIMOD:4,13-UNIMOD:1031 ms_run[2]:scan=21364 62.773 3 2436.2431 2436.2431 K S 218 238 PSM VEEEIQTLSQVLAAKEK 1005 sp|P55327-2|TPD52_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 15-UNIMOD:1031 ms_run[2]:scan=32050 92.217 2 2110.1522 2110.1522 K H 46 63 PSM VGAVDADKHHSLGGQYGVQGFPTIK 1006 sp|Q15084-5|PDIA6_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 8-UNIMOD:1031 ms_run[2]:scan=21945 64.307 4 2776.4297 2776.4297 K I 126 151 PSM VHLDKAQQNNVEHK 1007 sp|P62081|RS7_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 5-UNIMOD:1031 ms_run[2]:scan=9915 32.432 2 1854.97 1854.9700 K V 156 170 PSM VIATDINESKLQELEK 1008 sp|Q9BUT1-2|BDH2_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 10-UNIMOD:1031 ms_run[2]:scan=26598 76.862 2 2025.0994 2025.0994 K Y 33 49 PSM VIISAPSADAPMFVMGVNHEK 1009 sp|P04406|G3P_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 12-UNIMOD:35,15-UNIMOD:35 ms_run[2]:scan=19451 57.677 3 2244.0919 2244.0919 R Y 119 140 PSM VKIAQGVSGSIQDK 1010 sp|P20839-2|IMDH1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 2-UNIMOD:1031 ms_run[2]:scan=17193 51.743 2 1624.9148 1624.9148 K G 412 426 PSM VLDSGAPIKIPVGPETLGR 1011 sp|P06576|ATPB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 9-UNIMOD:1031 ms_run[2]:scan=29711 85.581 2 2114.2099 2114.2099 K I 125 144 PSM VPHTQAVVLNSKDK 1012 sp|Q9UBF8-3|PI4KB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 12-UNIMOD:1031 ms_run[2]:scan=14528 44.725 2 1730.9679 1730.9679 R A 49 63 PSM VQSGNINAAKTIADIIR 1013 sp|P49368|TCPG_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 10-UNIMOD:1031 ms_run[2]:scan=29862 85.997 2 1979.1164 1979.1164 K T 22 39 PSM VTLLDGTEYSCDLEKHAK 1014 sp|O43491-2|E41L2_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 39 11-UNIMOD:4,15-UNIMOD:1031 ms_run[2]:scan=22802 66.587 3 2274.1202 2274.1202 K G 222 240 PSM QKGADFLVTEVENGGSLGSK 1015 sp|P14618|KPYM_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 39 1-UNIMOD:28,2-UNIMOD:1031 ms_run[1]:scan=32988 95.07529099999999 2 2214.1216 2214.1163 K K 187 207 PSM LIGDAAKNQVALNPQNTVFDAK 1016 sp|P0DMV8|HS71A_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 39 7-UNIMOD:1031 ms_run[1]:scan=27698 80.011478 3 2523.339967 2522.349288 R R 50 72 PSM LIGDAAKNQVALNPQNTVFDAK 1017 sp|P0DMV8|HS71A_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 39 7-UNIMOD:1031 ms_run[1]:scan=27866 80.471797 3 2523.345898 2522.349288 R R 50 72 PSM IDSLSAQLSQLQKQLAAK 1018 sp|P02545|LMNA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 39 13-UNIMOD:1031 ms_run[1]:scan=30371 87.453682 2 2137.209316 2137.210669 R E 299 317 PSM TAGPIASAQKQPAGK 1019 sp|P27816|MAP4_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 39 10-UNIMOD:1031 ms_run[1]:scan=13617 42.336397 2 1619.895386 1619.899505 K V 977 992 PSM KGTDVNVFNTILTTR 1020 sp|P04083|ANXA1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 39 1-UNIMOD:1031 ms_run[1]:scan=30166 86.851092 2 1874.025814 1874.026162 R S 214 229 PSM AIIPCIKGYDVIAQAQSGTGK 1021 sp|Q14240|IF4A2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 39 5-UNIMOD:4,7-UNIMOD:1031 ms_run[1]:scan=30628 88.186067 3 2385.281046 2385.272617 R T 63 84 PSM HGDPGDAAQQEAKHR 1022 sp|O14737|PDCD5_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 39 13-UNIMOD:1031 ms_run[1]:scan=6884 24.361026 2 1811.860864 1811.866308 K E 21 36 PSM FKGFCYVEFDEVDSLK 1023 sp|Q15056|IF4H_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 39 2-UNIMOD:1031,5-UNIMOD:4 ms_run[1]:scan=32022 92.140246 2 2178.035359 2178.034344 K E 81 97 PSM KVLTGVAGEDAECHAAK 1024 sp|O95373|IPO7_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 39 1-UNIMOD:1031,13-UNIMOD:4 ms_run[1]:scan=14994 45.941203 3 1951.982025 1950.983312 K L 724 741 PSM VFDKEGNGTVMGAEIR 1025 sp|P60660|MYL6_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 39 4-UNIMOD:1031,11-UNIMOD:35 ms_run[1]:scan=19633 58.159778 2 1933.957312 1933.956763 R H 95 111 PSM MKPGATGESDLAEVLPQHK 1026 sp|Q709F0|ACD11_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 39 1-UNIMOD:1,2-UNIMOD:1031 ms_run[1]:scan=27210 78.611098 2 2245.1419 2245.1407 - F 1 20 PSM ISMADVKFSFQCPGR 1027 sp|Q13418|ILK_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 39 3-UNIMOD:35,7-UNIMOD:1031,12-UNIMOD:4 ms_run[1]:scan=24929 72.283018 2 1954.943383 1953.944090 R M 335 350 PSM GFGDVGEAKGGSTTGSQFLEQFK 1028 sp|Q14157|UBP2L_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 39 9-UNIMOD:1031 ms_run[1]:scan=28712 82.793882 3 2543.248026 2542.233983 K T 345 368 PSM QEDGGVYSSSGLKQIPIK 1029 sp|P16591|FER_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 39 1-UNIMOD:28,13-UNIMOD:1031 ms_run[1]:scan=28180 81.334737 2 2084.0832 2084.0785 R W 708 726 PSM DLKSNNIFLHEDLTVK 1030 sp|P15056|BRAF_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 39 3-UNIMOD:1031 ms_run[1]:scan=27188 78.55248 3 2082.129186 2081.115706 R I 576 592 PSM GPILCFVGPPGVGKTSVGR 1031 sp|Q86WA8|LONP2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 39 5-UNIMOD:4,14-UNIMOD:1031 ms_run[1]:scan=29482 84.943899 3 2093.153452 2093.145566 K S 368 387 PSM KTQHGVLSQQFVELINK 1032 sp|Q12846|STX4_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 39 1-UNIMOD:1031 ms_run[1]:scan=24959 72.363158 3 2165.205832 2164.200438 R C 124 141 PSM HYGPGWVSMANAGK 1033 sp|P23284|PPIB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 39 14-UNIMOD:259 ms_run[1]:scan=13814 42.85606 2 1480.696430 1481.696517 K D 132 146 PSM FKQISQAYEVLSDAK 1034 sp|P31689|DNJA1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 39 2-UNIMOD:1031 ms_run[1]:scan=27169 78.4998 2 1925.005938 1922.014929 K K 45 60 PSM AAAPAPEEEMDECEQALAAEPKAK 1035 sp|P26641|EF1G_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 10-UNIMOD:35,13-UNIMOD:4,24-UNIMOD:1031 ms_run[2]:scan=18307 54.673 3 2767.2681 2767.2681 K D 254 278 PSM AAFQSQYKSHFVAASLSNQK 1036 sp|Q86XP3-2|DDX42_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 8-UNIMOD:1031 ms_run[2]:scan=22761 66.479 3 2407.2284 2407.2284 K A 582 602 PSM ACKAVGHPFVIQLGR 1037 sp|O14980|XPO1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 2-UNIMOD:4,3-UNIMOD:1031 ms_run[2]:scan=23630 68.793 3 1848.0192 1848.0192 R I 698 713 PSM ADLINNLGTIAKSGTK 1038 sp|P07900|HS90A_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 12-UNIMOD:1031 ms_run[2]:scan=27615 79.778 2 1811.0153 1811.0153 K A 101 117 PSM AEEYEFLTPVEEAPKGMLAR 1039 sp|P52565|GDIR1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 15-UNIMOD:1031 ms_run[2]:scan=31801 91.505 3 2475.2356 2475.2356 R G 153 173 PSM AENGKLVINGNPITIFQER 1040 sp|P04406|G3P_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 5-UNIMOD:1031 ms_run[2]:scan=31776 91.433 2 2308.2539 2308.2539 K D 62 81 PSM AGKLCVPAMNVNDSVTK 1041 sp|O43865|SAHH2_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 3-UNIMOD:1031,5-UNIMOD:4 ms_run[2]:scan=24052 69.926 2 1999.0231 1999.0231 K Q 268 285 PSM ALVFQPVAELKDQTDFEHR 1042 sp|P08237-2|PFKAM_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 11-UNIMOD:1031 ms_run[2]:scan=31144 89.641 3 2438.2594 2438.2594 R I 686 705 PSM APLKIFAQDGEGQR 1043 sp|O75369-7|FLNB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 4-UNIMOD:1031 ms_run[2]:scan=23663 68.879 2 1724.921 1724.9210 K I 509 523 PSM APQCLGKFIEIAAR 1044 sp|Q00839-2|HNRPU_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 4-UNIMOD:4,7-UNIMOD:1031 ms_run[2]:scan=29888 86.072 2 1768.9658 1768.9658 R K 540 554 PSM APQVDVDKAVAELK 1045 sp|P41250|GARS_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 8-UNIMOD:1031 ms_run[2]:scan=24547 71.253 2 1677.9301 1677.9301 K A 86 100 PSM ATGHSGGGCISQGR 1046 sp|Q9HA64|KT3K_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 9-UNIMOD:4,14-UNIMOD:267 ms_run[2]:scan=2245 11.47 2 1353.6083 1353.6083 R S 16 30 PSM ATVVESSEKAYSEAHEISK 1047 sp|P61981|1433G_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 9-UNIMOD:1031 ms_run[2]:scan=18210 54.415 3 2260.1223 2260.1223 R E 144 163 PSM AYHEQLSVAEITNACFEPANQMVK 1048 sp|P68363|TBA1B_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 15-UNIMOD:4,22-UNIMOD:35 ms_run[2]:scan=21587 63.361 3 2765.2789 2765.2789 K C 281 305 PSM DAIHFYNKSLAEHR 1049 sp|P31948|STIP1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 8-UNIMOD:1031 ms_run[2]:scan=19828 58.67 2 1895.9642 1895.9642 K T 318 332 PSM DIKAANVLLSEHGEVK 1050 sp|Q9Y6E0-2|STK24_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 3-UNIMOD:1031 ms_run[2]:scan=23474 68.381 3 1918.0524 1918.0524 R L 144 160 PSM DIKAANVLLSEHGEVK 1051 sp|Q9Y6E0-2|STK24_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 3-UNIMOD:1031 ms_run[2]:scan=23632 68.798 3 1918.0524 1918.0524 R L 144 160 PSM DIKAANVLLSEQGDVK 1052 sp|Q9P289|STK26_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 3-UNIMOD:1031 ms_run[2]:scan=26098 75.513 2 1895.0364 1895.0364 R L 144 160 PSM DIKAANVLLSEQGDVK 1053 sp|Q9P289|STK26_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 3-UNIMOD:1031 ms_run[2]:scan=26224 75.856 2 1895.0364 1895.0364 R L 144 160 PSM DIKAGNILLNTEGHAK 1054 sp|Q13043-2|STK4_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 3-UNIMOD:1031 ms_run[2]:scan=22722 66.377 2 1889.0371 1889.0371 R L 149 165 PSM DIKAGNILLNTEGHAK 1055 sp|Q13043-2|STK4_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 3-UNIMOD:1031,16-UNIMOD:1031 ms_run[2]:scan=22595 66.035 2 1897.0513 1897.0513 R L 149 165 PSM DLKPANILVMGEGPER 1056 sp|Q9BWU1-2|CDK19_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 3-UNIMOD:1031,10-UNIMOD:35 ms_run[2]:scan=26342 76.175 2 1950.0244 1950.0244 R G 91 107 PSM DLKPENVLLDAHMNAK 1057 sp|Q13131|AAPK1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 3-UNIMOD:1031 ms_run[2]:scan=25572 74.094 2 2003.051 2003.0510 R I 150 166 PSM DLKPHNILISMPNAHGK 1058 sp|O75460|ERN1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 3-UNIMOD:1031 ms_run[2]:scan=23007 67.135 3 2080.1252 2080.1252 R I 688 705 PSM DLKTSNLLLSHAGILK 1059 sp|Q9UQ88-4|CD11A_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 3-UNIMOD:1031 ms_run[2]:scan=28863 83.213 3 1918.1251 1918.1251 R V 537 553 PSM DPSAVAKHFVALSTNTTK 1060 sp|P06744|G6PI_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 7-UNIMOD:1031 ms_run[2]:scan=25511 73.929 3 2082.111 2082.1110 K V 235 253 PSM DYHFKVDNDENEHQLSLR 1061 sp|P06748|NPM_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 5-UNIMOD:1031 ms_run[2]:scan=19991 59.103 4 2454.1564 2454.1564 K T 28 46 PSM EAKNSDVLQSPLDSAAR 1062 sp|Q8NBJ5|GT251_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 3-UNIMOD:1031 ms_run[2]:scan=21845 64.041 2 1996.0225 1996.0225 R D 603 620 PSM EANFTVSSMHGDMPQKER 1063 sp|P38919|IF4A3_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 9-UNIMOD:35,13-UNIMOD:35,16-UNIMOD:1031 ms_run[2]:scan=12930 40.523 3 2291.0311 2291.0311 R E 299 317 PSM EEEIAALVIDNGSGMCKAGFAGDDAPR 1064 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 15-UNIMOD:35,16-UNIMOD:4,17-UNIMOD:1031 ms_run[2]:scan=28522 82.279 3 3004.3906 3004.3906 M A 2 29 PSM EGNDLYHEMIESGVINLKDATSK 1065 sp|P06576|ATPB_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 18-UNIMOD:1031 ms_run[2]:scan=33040 95.233 3 2758.3484 2758.3484 R V 242 265 PSM ELNSNHDGADETSEK 1066 sp|Q01105-2|SET_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 ms_run[2]:scan=2418 11.966 2 1644.6863 1644.6863 K E 12 27 PSM EMNPALGIDCLHKGTNDMK 1067 sp|P48643|TCPE_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 10-UNIMOD:4,13-UNIMOD:1031 ms_run[2]:scan=23169 67.564 3 2339.1072 2339.1072 K Q 484 503 PSM ENQCVIISGESGAGKTVAAK 1068 sp|Q12965|MYO1E_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 4-UNIMOD:4,15-UNIMOD:1031 ms_run[2]:scan=18801 55.971 3 2214.1314 2214.1314 R Y 104 124 PSM ESVELPLTHPEYYEEMGIKPPK 1069 sp|P62191-2|PRS4_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 19-UNIMOD:1031 ms_run[2]:scan=28247 81.518 3 2781.3935 2781.3935 K G 126 148 PSM FAIGSQVSEHSIIKDFTK 1070 sp|P33992|MCM5_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 14-UNIMOD:1031 ms_run[2]:scan=26736 77.299 3 2202.1685 2202.1685 R Q 683 701 PSM FVEKCSPIGVYTSGK 1071 sp|P33992|MCM5_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 4-UNIMOD:1031,5-UNIMOD:4 ms_run[2]:scan=23190 67.621 2 1866.955 1866.9550 K G 393 408 PSM GALQNIIPASTGAAKAVGK 1072 sp|P04406|G3P_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 15-UNIMOD:1031 ms_run[2]:scan=25416 73.67 3 1962.1262 1962.1262 R V 201 220 PSM GDLSGHFEHLMVALVTPPAVFDAKQLK 1073 sp|P12429|ANXA3_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 11-UNIMOD:35,27-UNIMOD:1031 ms_run[2]:scan=31797 91.495 3 3131.6478 3131.6478 K K 74 101 PSM GEMKGSAITGPVAK 1074 sp|P62829|RL23_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 4-UNIMOD:1031 ms_run[2]:scan=17648 52.932 2 1540.8283 1540.8283 K E 110 124 PSM GFAFVTFESPADAKDAAR 1075 sp|P38159|RBMX_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 14-UNIMOD:1031 ms_run[2]:scan=30011 86.417 2 2095.0375 2095.0375 R D 50 68 PSM GIVPLAKVDCTANTNTCNK 1076 sp|P30101|PDIA3_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 7-UNIMOD:1031,10-UNIMOD:4,17-UNIMOD:4 ms_run[2]:scan=24086 70.016 2 2271.1351 2271.1351 K Y 76 95 PSM GIYAYGFEKPSAIQQR 1077 sp|P60842|IF4A1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 9-UNIMOD:1031 ms_run[2]:scan=25820 74.761 2 2023.0527 2023.0527 R A 46 62 PSM GKATISNDGATILK 1078 sp|Q99832|TCPH_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 2-UNIMOD:1031 ms_run[2]:scan=20059 59.28 2 1583.8883 1583.8883 R L 54 68 PSM GLGKGFVPSPTSQPGGHESLVDR 1079 sp|P26640|SYVC_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 4-UNIMOD:1031 ms_run[2]:scan=22401 65.524 3 2517.2976 2517.2976 R W 963 986 PSM GMGSLDAMDKHLSSQNR 1080 sp|P12268|IMDH2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 2-UNIMOD:35,8-UNIMOD:35,10-UNIMOD:1031 ms_run[2]:scan=12726 39.982 3 2073.9572 2073.9572 R Y 413 430 PSM GMGSLDAMDKHLSSQNR 1081 sp|P12268|IMDH2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 2-UNIMOD:35,10-UNIMOD:1031 ms_run[2]:scan=16577 50.122 3 2057.9623 2057.9623 R Y 413 430 PSM GMITVTDPDLIEKSNLNR 1082 sp|A0AVT1-2|UBA6_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 13-UNIMOD:1031 ms_run[2]:scan=28174 81.317 3 2211.1569 2211.1569 K Q 17 35 PSM GPAKNSEPEEVIPSR 1083 sp|P54577|SYYC_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 4-UNIMOD:1031 ms_run[2]:scan=17097 51.492 2 1804.9319 1804.9319 K L 353 368 PSM GPILCFVGPPGVGKTSVGR 1084 sp|Q86WA8-2|LONP2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 5-UNIMOD:4,14-UNIMOD:1031 ms_run[2]:scan=29486 84.954 2 2093.1456 2093.1456 K S 324 343 PSM GVLMYGPPGCGKTMLAK 1085 sp|P43686-2|PRS6B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 10-UNIMOD:4,12-UNIMOD:1031 ms_run[2]:scan=26056 75.402 2 1975.0093 1975.0093 R A 170 187 PSM GVLMYGPPGTGKTLLAR 1086 sp|P17980|PRS6A_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 4-UNIMOD:35,12-UNIMOD:1031 ms_run[2]:scan=27105 78.327 2 1942.071 1942.0710 K A 222 239 PSM HGLEVIYMIEPIDEYCVQQLK 1087 sp|P07900|HS90A_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 16-UNIMOD:4 ms_run[2]:scan=31174 89.726 3 2576.2655 2576.2655 K E 514 535 PSM HLEINPDHPIVETLR 1088 sp|P08238|HS90B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 ms_run[2]:scan=17119 51.548 2 1781.9424 1781.9424 K Q 625 640 PSM HQKIIEEAPAPGIK 1089 sp|Q96RQ3|MCCA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 3-UNIMOD:1031 ms_run[2]:scan=17683 53.026 2 1725.9778 1725.9778 R S 282 296 PSM IFVGTKGIPHLVTHDAR 1090 sp|P62701|RS4X_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 6-UNIMOD:1031 ms_run[2]:scan=22212 65.021 3 2056.1582 2056.1582 K T 129 146 PSM IGSSMKSVGEVMAIGR 1091 sp|P31327|CPSM_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 5-UNIMOD:35,6-UNIMOD:1031 ms_run[2]:scan=24436 70.955 2 1832.9488 1832.9488 R T 788 804 PSM IITITGTQDQIQNAQYLLQNSVK 1092 sp|P61978|HNRPK_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 ms_run[2]:scan=29565 85.173 3 2588.381 2588.3810 R Q 434 457 PSM IIVDELKQEVISTSSK 1093 sp|P63244|RACK1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 7-UNIMOD:1031 ms_run[2]:scan=31438 90.469 2 1984.1092 1984.1092 K A 265 281 PSM ISNYGWDQSDKFVK 1094 sp|Q9HB71|CYBP_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 11-UNIMOD:1031 ms_run[2]:scan=24109 70.077 2 1881.9261 1881.9261 K I 75 89 PSM KAEGAATEEEGTPK 1095 sp|P80723|BASP1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 1-UNIMOD:1031 ms_run[2]:scan=9016 30.035 2 1612.7944 1612.7944 K E 25 39 PSM KEAGGGGVGGPGAK 1096 sp|Q8NC51-3|PAIRB_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 1-UNIMOD:1031 ms_run[2]:scan=8704 29.206 2 1336.7099 1336.7099 K S 39 53 PSM KGGSWIQEINVAEK 1097 sp|P78527-2|PRKDC_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 1-UNIMOD:1031 ms_run[2]:scan=25143 72.918 2 1753.9363 1753.9363 K N 3992 4006 PSM KGGSWIQEINVAEK 1098 sp|P78527-2|PRKDC_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 1-UNIMOD:1031 ms_run[2]:scan=25269 73.273 2 1753.9363 1753.9363 K N 3992 4006 PSM KGIAFPTSISVNNCVCHFSPLK 1099 sp|Q9UQ80|PA2G4_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 1-UNIMOD:1031,14-UNIMOD:4,16-UNIMOD:4 ms_run[2]:scan=29072 83.797 3 2671.3614 2671.3614 K S 72 94 PSM KGSQITQQSTNQSR 1100 sp|P50750|CDK9_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 1-UNIMOD:1031 ms_run[2]:scan=8868 29.639 2 1757.902 1757.9020 R N 345 359 PSM KLMHQAALLGQALQDSR 1101 sp|Q16881-4|TRXR1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 1-UNIMOD:1031 ms_run[2]:scan=23689 68.948 3 2075.131 2075.1310 K N 120 137 PSM KLYGAQFHPEVGLTENGK 1102 sp|P49915-2|GUAA_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 1-UNIMOD:1031 ms_run[2]:scan=21494 63.111 3 2183.1375 2183.1375 K V 84 102 PSM KQGGLGPMNIPLVSDPK 1103 sp|Q06830|PRDX1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 1-UNIMOD:1031,8-UNIMOD:35 ms_run[2]:scan=24466 71.034 2 1962.0608 1962.0608 K R 93 110 PSM KTCTTVAFTQVNSEDK 1104 sp|P62424|RL7A_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 1-UNIMOD:1031,3-UNIMOD:4 ms_run[2]:scan=18431 54.995 2 2023.9885 2023.9885 R G 197 213 PSM KTEAPAAPAAQETK 1105 sp|P80723|BASP1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 1-UNIMOD:259,14-UNIMOD:259 ms_run[2]:scan=3465 14.9 2 1427.7591 1427.7591 K S 150 164 PSM KTTHFVEGGDAGNR 1106 sp|P18124|RL7_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 1-UNIMOD:1031 ms_run[2]:scan=11381 36.346 2 1683.8329 1683.8329 K E 223 237 PSM KYTLPPGVDPTQVSSSLSPEGTLTVEAPMPK 1107 sp|P04792|HSPB1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 1-UNIMOD:1031 ms_run[2]:scan=31532 90.733 3 3421.7691 3421.7691 R L 141 172 PSM LCVPAMNVNDSVTKQK 1108 sp|O43865|SAHH2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 2-UNIMOD:4,14-UNIMOD:1031 ms_run[2]:scan=22568 65.966 2 1999.0231 1999.0231 K F 271 287 PSM LDKAQIHDLVLVGGSTR 1109 sp|P0DMV9|HS71B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 3-UNIMOD:1031 ms_run[2]:scan=26658 77.035 3 2017.132 2017.1320 K I 326 343 PSM LDSGKELHINLIPNK 1110 sp|P07900|HS90A_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 5-UNIMOD:1031 ms_run[2]:scan=24940 72.313 3 1886.0625 1886.0625 K Q 70 85 PSM LIGDAAKNQVAMNPTNTVFDAK 1111 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 7-UNIMOD:1031,12-UNIMOD:35 ms_run[2]:scan=24750 71.793 3 2529.2897 2529.2897 R R 50 72 PSM LITQTFSHHNQLAQKTR 1112 sp|Q9Y266|NUDC_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 15-UNIMOD:1031 ms_run[2]:scan=15423 47.063 3 2218.1971 2218.1971 K R 54 71 PSM LKSYCNDQSTGDIK 1113 sp|P00492|HPRT_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 2-UNIMOD:1031,5-UNIMOD:4 ms_run[2]:scan=14358 44.282 2 1823.8724 1823.8724 R V 102 116 PSM LMITHIVNQNFKSYAGEK 1114 sp|Q9NTJ3|SMC4_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 2-UNIMOD:35,12-UNIMOD:1031 ms_run[2]:scan=23434 68.269 3 2304.1936 2304.1936 R I 82 100 PSM MFAKGTEITHAVVIK 1115 sp|Q99613-2|EIF3C_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 4-UNIMOD:1031 ms_run[2]:scan=23652 68.849 3 1840.0281 1840.0281 K K 307 322 PSM MPILGLGTWKSPPGQVTEAVK 1116 sp|P15121|ALDR_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 10-UNIMOD:1031 ms_run[2]:scan=32735 94.338 3 2404.3188 2404.3188 K V 13 34 PSM MYPIDFEKDDDSNFHMDFIVAASNLR 1117 sp|P22314-2|UBA1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 1-UNIMOD:35,8-UNIMOD:1031,16-UNIMOD:35 ms_run[2]:scan=31423 90.425 3 3317.5009 3317.5009 K A 804 830 PSM NLGTIAKSGTSEFLNK 1118 sp|P14625|ENPL_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 7-UNIMOD:1031 ms_run[2]:scan=26105 75.533 2 1875.0102 1875.0102 K M 162 178 PSM NLGTIAKSGTSEFLNK 1119 sp|P14625|ENPL_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 7-UNIMOD:1031 ms_run[2]:scan=28600 82.494 2 1875.0102 1875.0102 K M 162 178 PSM NPEKSFPVNSDVGVLK 1120 sp|P48444-2|COPD_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 4-UNIMOD:1031 ms_run[2]:scan=24902 72.209 2 1925.0258 1925.0258 K W 260 276 PSM PLISVYSEKGESSGK 1121 sp|P36578|RL4_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 9-UNIMOD:1031 ms_run[2]:scan=21480 63.075 2 1775.9305 1775.9305 R N 6 21 PSM QATKDAGQISGLNVLR 1122 sp|P38646|GRP75_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 4-UNIMOD:1031 ms_run[2]:scan=24016 69.829 2 1866.0323 1866.0323 R V 203 219 PSM QFVPIKVEQIEAGTPGR 1123 sp|Q16881-4|TRXR1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 6-UNIMOD:1031 ms_run[2]:scan=27881 80.513 2 2064.1368 2064.1368 R L 302 319 PSM QSKPVTTPEEIAQVATISANGDK 1124 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 3-UNIMOD:1031 ms_run[2]:scan=27319 78.933 2 2579.3443 2579.3443 K E 158 181 PSM SETSGPQIKELTDEEAER 1125 sp|Q9Y266|NUDC_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 9-UNIMOD:1031 ms_run[2]:scan=21289 62.571 2 2214.0652 2214.0652 K L 97 115 PSM SFSKESDDPMAYIHFTAEGEVTFK 1126 sp|P14625|ENPL_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 4-UNIMOD:1031,10-UNIMOD:35 ms_run[2]:scan=28101 81.121 3 2947.3586 2947.3586 K S 361 385 PSM SGDAAIVDMVPGKPMCVESFSDYPPLGR 1127 sp|Q5VTE0|EF1A3_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 9-UNIMOD:35,13-UNIMOD:1031,16-UNIMOD:4 ms_run[2]:scan=31862 91.675 3 3206.5086 3206.5086 K F 396 424 PSM SINPDEAVAYGAAVQAAILSGDK 1128 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 ms_run[2]:scan=32691 94.214 3 2259.1383 2259.1383 K S 362 385 PSM SKPGAAMVEMADGYAVDR 1129 sp|P14866-2|HNRPL_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 2-UNIMOD:1031 ms_run[2]:scan=26454 76.478 2 2062.9816 2062.9816 K A 284 302 PSM SLIGVEYKPVSATGAEDK 1130 sp|P07814|SYEP_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 8-UNIMOD:1031 ms_run[2]:scan=24548 71.256 2 2059.0837 2059.0837 K D 944 962 PSM SQETECTYFSTPLLLGKK 1131 sp|P40926|MDHM_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 6-UNIMOD:4,17-UNIMOD:1031 ms_run[2]:scan=30276 87.153 2 2297.1613 2297.1613 K G 280 298 PSM SQIFSTASDNQPTVTIK 1132 sp|P11021|BIP_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 ms_run[2]:scan=17680 53.019 2 1835.9265 1835.9265 K V 448 465 PSM SQNPPQSKGCCFVTFYTR 1133 sp|Q92879-5|CELF1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 8-UNIMOD:1031,10-UNIMOD:4,11-UNIMOD:4 ms_run[2]:scan=24883 72.158 2 2372.1042 2372.1042 R K 35 53 PSM SVPTSTVFYPSDGVATEK 1134 sp|P29401|TKT_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 ms_run[2]:scan=18613 55.476 2 1883.9153 1883.9153 R A 439 457 PSM SVPTSTVFYPSDGVATEK 1135 sp|P29401|TKT_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 18-UNIMOD:259 ms_run[2]:scan=18623 55.503 2 1891.9295 1891.9295 R A 439 457 PSM TAFDDAIAELDTLNEDSYK 1136 sp|P61981|1433G_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 ms_run[2]:scan=31511 90.674 3 2129.9641 2129.9641 K D 199 218 PSM TAFDEAIAELDTLNEDSYK 1137 sp|P27348|1433T_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 19-UNIMOD:259 ms_run[2]:scan=32246 92.783 3 2151.9939 2151.9939 K D 194 213 PSM TCHLTNHCIQKEYSK 1138 sp|Q8NG68|TTL_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 2-UNIMOD:4,8-UNIMOD:4,11-UNIMOD:1031 ms_run[2]:scan=10958 35.238 3 2114.0037 2114.0037 K N 237 252 PSM TFVNITPAEVGVLVGKDR 1139 sp|P07737|PROF1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 16-UNIMOD:1031 ms_run[2]:scan=33230 95.769 3 2110.1786 2110.1786 K S 39 57 PSM TLLAKAIANECQANFISIK 1140 sp|P55072|TERA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 5-UNIMOD:1031,11-UNIMOD:4 ms_run[2]:scan=31792 91.48 3 2300.2562 2300.2562 K G 525 544 PSM TPVTDPATGAVKEK 1141 sp|P49748-2|ACADV_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 12-UNIMOD:1031 ms_run[2]:scan=15270 46.663 2 1608.8723 1608.8723 K I 243 257 PSM TSGHVDKFADFMVK 1142 sp|P41250|GARS_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 7-UNIMOD:1031 ms_run[2]:scan=25014 72.523 2 1776.8869 1776.8869 K D 191 205 PSM TSGNVEDDLIIFPDDCEFKR 1143 sp|Q16186|ADRM1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 16-UNIMOD:4,19-UNIMOD:1031 ms_run[2]:scan=31641 91.04 2 2565.2057 2565.2057 R V 65 85 PSM TSIDAYDNFDNISLAQR 1144 sp|Q00610-2|CLH1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 ms_run[2]:scan=23172 67.572 2 1941.9068 1941.9068 R L 1482 1499 PSM TSIMSKQYGNEVFLAK 1145 sp|P50990-2|TCPQ_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 4-UNIMOD:35,6-UNIMOD:1031 ms_run[2]:scan=24264 70.488 2 2027.0398 2027.0398 R L 147 163 PSM TSIMSKQYGNEVFLAK 1146 sp|P50990-2|TCPQ_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 6-UNIMOD:1031 ms_run[2]:scan=26329 76.141 2 2011.0448 2011.0448 R L 147 163 PSM TSSAQVEGGVHSLHSYEK 1147 sp|P12268|IMDH2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 ms_run[2]:scan=7659 26.43 3 1914.9072 1914.9072 R R 494 512 PSM TVDNFVALATGEKGFGYK 1148 sp|P23284|PPIB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 13-UNIMOD:1031 ms_run[2]:scan=31080 89.461 3 2112.0892 2112.0892 K N 72 90 PSM TVQGSGHQEHINIHKLR 1149 sp|Q14247|SRC8_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 15-UNIMOD:1031 ms_run[2]:scan=12322 38.889 3 2149.1505 2149.1505 K E 43 60 PSM TYEEGLKHEANNPQLK 1150 sp|P31948|STIP1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 7-UNIMOD:1031 ms_run[2]:scan=15933 48.42 3 2066.0433 2066.0433 R E 94 110 PSM TYGADLASVDFQHASEDAR 1151 sp|P30740|ILEU_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 19-UNIMOD:267 ms_run[2]:scan=17785 53.3 3 2061.9267 2061.9267 K K 111 130 PSM VELCSFSGYKIYPGHGR 1152 sp|P83731|RL24_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 4-UNIMOD:4,10-UNIMOD:1031 ms_run[2]:scan=24205 70.33 3 2165.0728 2165.0728 K R 3 20 PSM VELCSFSGYKIYPGHGR 1153 sp|P83731|RL24_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 4-UNIMOD:4,10-UNIMOD:1031 ms_run[2]:scan=24256 70.466 2 2165.0728 2165.0728 K R 3 20 PSM VILHLKEDQTEYLEER 1154 sp|P07900|HS90A_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 6-UNIMOD:1031 ms_run[2]:scan=23401 68.182 3 2210.1583 2210.1583 K R 186 202 PSM VKVYETDNNIVVYK 1155 sp|Q03393|PTPS_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 2-UNIMOD:1031 ms_run[2]:scan=21585 63.356 2 1879.0091 1879.0091 K G 130 144 PSM VLEQLTGQTPVFSKAR 1156 sp|P62913-2|RL11_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 14-UNIMOD:1031 ms_run[2]:scan=25980 75.198 2 1969.0997 1969.0997 K Y 38 54 PSM VLSKEFHLNESGDPSSK 1157 sp|Q01105-2|SET_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 4-UNIMOD:1031 ms_run[2]:scan=19911 58.887 3 2069.0429 2069.0429 K S 138 155 PSM VNGKAGNLGGGVVTIER 1158 sp|P35268|RL22_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 4-UNIMOD:1031 ms_run[2]:scan=21333 62.691 3 1836.0217 1836.0217 K S 49 66 PSM VPAINVNDSVTKSK 1159 sp|P23526-2|SAHH_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 12-UNIMOD:1031 ms_run[2]:scan=19125 56.822 2 1666.9254 1666.9254 K F 147 161 PSM VPHTQAVVLNSKDK 1160 sp|Q9UBF8-3|PI4KB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 12-UNIMOD:1031,14-UNIMOD:1031 ms_run[2]:scan=14538 44.751 2 1738.9821 1738.9821 R A 49 63 PSM VPVDEFDGKVTYGQK 1161 sp|Q92499-3|DDX1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 9-UNIMOD:1031 ms_run[2]:scan=22263 65.156 2 1876.9571 1876.9571 K R 551 566 PSM YDCSSADINPIGGISKTDLR 1162 sp|Q6IA69-2|NADE_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 3-UNIMOD:4,16-UNIMOD:1031 ms_run[2]:scan=26983 77.998 3 2377.1584 2377.1584 K A 269 289 PSM YHTSQSGDEMTSLSEYVSR 1163 sp|P08238|HS90B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 10-UNIMOD:35 ms_run[2]:scan=12351 38.965 3 2191.9328 2191.9328 R M 457 476 PSM YVSHGATGKGNDQVR 1164 sp|P00966|ASSY_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 9-UNIMOD:1031 ms_run[2]:scan=8329 28.219 3 1783.8965 1783.8965 K F 113 128 PSM YYDPKTCGFDFTGAVEDISK 1165 sp|P00505|AATM_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 38 5-UNIMOD:1031,7-UNIMOD:4 ms_run[2]:scan=31817 91.549 2 2508.1519 2508.1519 R I 181 201 PSM NQTAEKEEFEHQQK 1166 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 38 ms_run[1]:scan=2915 13.382811 2 1744.808653 1744.801642 K E 584 598 PSM VDINAPDVDVQGPDWHLKMPK 1167 sp|Q09666|AHNK_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 38 18-UNIMOD:1031 ms_run[1]:scan=27919 80.618637 3 2570.315087 2569.299895 K I 3132 3153 PSM WGDAGAEYVVESTGVFTTMEKAGAHLQGGAK 1168 sp|P04406|G3P_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 38 19-UNIMOD:35,21-UNIMOD:1031 ms_run[1]:scan=28570 82.408383 3 3378.620292 3378.619057 K R 87 118 PSM NLGTIAKSGTSEFLNK 1169 sp|P14625|ENPL_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 38 7-UNIMOD:1031 ms_run[1]:scan=29431 84.790218 2 1877.016288 1875.010178 K M 162 178 PSM NLGTIAKSGTSEFLNK 1170 sp|P14625|ENPL_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 38 7-UNIMOD:1031 ms_run[1]:scan=26513 76.636639 2 1874.011714 1875.010178 K M 162 178 PSM NLGTIAKSGTSEFLNK 1171 sp|P14625|ENPL_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 38 7-UNIMOD:1031 ms_run[1]:scan=27446 79.30819 2 1876.003313 1875.010178 K M 162 178 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 1172 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 38 1-UNIMOD:1,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=33724 97.057663 3 2974.3456 2974.3432 M A 2 29 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 1173 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 38 1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=30297 87.21248 3 2990.3592 2990.3382 M A 2 29 PSM EEEIAALVIDNGSGMCKAGFAGDDAPR 1174 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 38 1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=33574 96.656478 4 3047.4172 3046.4002 M A 2 29 PSM GILTLKYPIEHGIITNWDDMEK 1175 sp|P62736|ACTA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 38 6-UNIMOD:1031 ms_run[1]:scan=33251 95.8215 3 2782.451256 2781.441139 R I 65 87 PSM KGTDVNVFNTILTTR 1176 sp|P04083|ANXA1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 38 1-UNIMOD:1031 ms_run[1]:scan=30172 86.865565 2 1874.025814 1874.026162 R S 214 229 PSM GVLFYGPPGCGKTLLAK 1177 sp|P55072|TERA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 38 10-UNIMOD:4,12-UNIMOD:1031 ms_run[1]:scan=29342 84.53818 2 1973.086842 1973.080841 K A 513 530 PSM GVLFYGPPGCGKTLLAK 1178 sp|P55072|TERA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 38 10-UNIMOD:4,12-UNIMOD:1031 ms_run[1]:scan=29316 84.467222 2 1973.086842 1973.080841 K A 513 530 PSM THFGGGKTTGFGMIYDSLDYAK 1179 sp|P62847|RS24_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 38 7-UNIMOD:1031,13-UNIMOD:35 ms_run[1]:scan=26396 76.319207 3 2577.215294 2577.220976 R K 62 84 PSM FETLQAQAGKHGDDLR 1180 sp|P08729|K2C7_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 38 10-UNIMOD:1031 ms_run[1]:scan=16831 50.789885 2 1981.001157 1981.001739 K N 287 303 PSM ACPLEKALDVMVSTFHK 1181 sp|P26447|S10A4_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 38 1-UNIMOD:1,2-UNIMOD:4,6-UNIMOD:1031 ms_run[1]:scan=33984 97.764433 3 2183.1164 2183.1114 M Y 2 19 PSM TGVIEHEHPVNKISFIAR 1182 sp|P98082|DAB2_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 38 12-UNIMOD:1031 ms_run[1]:scan=21886 64.148158 3 2243.240039 2242.222237 K D 109 127 PSM VVIIGAGKPAAVVLQTK 1183 sp|Q14697|GANAB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 38 8-UNIMOD:1031 ms_run[1]:scan=28679 82.703815 2 1860.160112 1859.160805 R G 892 909 PSM VDVAVNCAGIAVASKTYNLK 1184 sp|Q99714|HCD2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 38 7-UNIMOD:4,15-UNIMOD:1031 ms_run[1]:scan=27114 78.352082 3 2288.224630 2288.219854 R K 85 105 PSM CNILHADIKPDNILVNESK 1185 sp|Q13523|PRP4B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 38 1-UNIMOD:385,1-UNIMOD:4,9-UNIMOD:1031 ms_run[1]:scan=30950 89.087297 2 2371.2332 2371.2202 R T 809 828 PSM VVDIYSKFDVINLAAEK 1186 sp|P54619|AAKG1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 38 7-UNIMOD:1031 ms_run[1]:scan=33442 96.316301 2 2120.151707 2119.156508 R T 237 254 PSM ADKPDMGEIASFDK 1187 sp|P63313|TYB10_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 38 1-UNIMOD:1,6-UNIMOD:35 ms_run[1]:scan=13515 42.069451 2 1580.6999 1580.7023 M A 2 16 PSM TDEEGKDVPDHAVLEMK 1188 sp|Q9BUJ2|HNRL1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 38 6-UNIMOD:1031,16-UNIMOD:35 ms_run[1]:scan=16675 50.380835 3 2124.005871 2124.004501 R A 546 563 PSM ATGHSGGGCISQGR 1189 sp|Q9HA64|KT3K_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 38 9-UNIMOD:4 ms_run[1]:scan=2247 11.475486 2 1343.602806 1343.600046 R S 16 30 PSM ASGLAAGKGVIVAK 1190 sp|P22102|PUR2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 38 8-UNIMOD:259,14-UNIMOD:259 ms_run[1]:scan=20932 61.582246 2 1444.880093 1444.885699 K S 149 163 PSM ADWLSHYWMPKWINATDPSAR 1191 sp|P08243|ASNS_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 38 11-UNIMOD:1031 ms_run[1]:scan=33312 95.980167 3 2743.326106 2740.322027 R T 530 551 PSM AAKVLEQLTGQTPVFSK 1192 sp|P62913|RL11_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 38 3-UNIMOD:1031 ms_run[1]:scan=28245 81.512766 2 2011.123821 2012.130628 R A 36 53 PSM AAEDDEDDDVDTKK 1193 sp|P06454-2|PTMA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 13-UNIMOD:1031 ms_run[2]:scan=10733 34.644 2 1760.7588 1760.7588 R Q 90 104 PSM AFGQAKHQPTAIIAK 1194 sp|P29401|TKT_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 6-UNIMOD:1031,15-UNIMOD:1031 ms_run[2]:scan=17039 51.337 2 1784.0188 1784.0188 K T 227 242 PSM AKELDPTNMTYITNQAAVYFEK 1195 sp|P31948|STIP1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 2-UNIMOD:1031 ms_run[2]:scan=33105 95.424 2 2742.3575 2742.3575 K G 251 273 PSM ALADDDFLTVTGKTVR 1196 sp|P33991|MCM4_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 13-UNIMOD:1031 ms_run[2]:scan=28185 81.347 2 1917.0207 1917.0207 R L 846 862 PSM AMDVYQKALDLDSSCK 1197 sp|P31948|STIP1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 7-UNIMOD:1031,15-UNIMOD:4 ms_run[2]:scan=27458 79.342 2 2038.9704 2038.9704 K E 447 463 PSM ANEVISKLYAVHQEGNK 1198 sp|P50990-2|TCPQ_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 7-UNIMOD:1031 ms_run[2]:scan=23091 67.355 3 2095.1062 2095.1062 K N 441 458 PSM APNTPDILEIEFKK 1199 sp|P00966|ASSY_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 13-UNIMOD:1031 ms_run[2]:scan=29682 85.503 2 1809.9877 1809.9877 K G 216 230 PSM ASGNYATVISHNPETKK 1200 sp|P62917|RL8_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 16-UNIMOD:1031 ms_run[2]:scan=14944 45.812 3 2012.0327 2012.0327 R T 129 146 PSM ATAGDTHLGGEDFDNR 1201 sp|P0DMV9|HS71B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 16-UNIMOD:267 ms_run[2]:scan=8404 28.42 2 1684.7317 1684.7317 K L 221 237 PSM ATIAGGGVIPHIHKSLIGK 1202 sp|Q71UI9-3|H2AV_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 14-UNIMOD:1031 ms_run[2]:scan=22935 66.938 3 2064.2208 2064.2208 K K 65 84 PSM CPNLTHLNLSGNKIK 1203 sp|P39687|AN32A_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 1-UNIMOD:4,13-UNIMOD:1031 ms_run[2]:scan=21051 61.905 3 1904.0302 1904.0302 K D 87 102 PSM CWKFEHCNFNDVTTR 1204 sp|P13987|CD59_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 1-UNIMOD:4,3-UNIMOD:1031,7-UNIMOD:4 ms_run[2]:scan=21960 64.345 3 2208.9833 2208.9833 K L 64 79 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 1205 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 15-UNIMOD:35,16-UNIMOD:4,17-UNIMOD:1031 ms_run[2]:scan=28585 82.449 3 2948.328 2948.3280 M A 2 29 PSM DIKCSNILLNNSGQIK 1206 sp|Q9NYV4-2|CDK12_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 3-UNIMOD:1031,4-UNIMOD:4 ms_run[2]:scan=24875 72.137 2 2012.0725 2012.0725 R L 859 875 PSM DIKPANVFITATGVVK 1207 sp|Q8TDX7|NEK7_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 3-UNIMOD:1031 ms_run[2]:scan=31622 90.987 2 1868.0771 1868.0771 R L 161 177 PSM DLKPENILLDEEGHIK 1208 sp|P51812|KS6A3_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 3-UNIMOD:1031,16-UNIMOD:1031 ms_run[2]:scan=27262 78.747 2 2066.1139 2066.1139 R L 193 209 PSM DLKPENIMLNHQGHVK 1209 sp|P23443-4|KS6B1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 3-UNIMOD:1031 ms_run[2]:scan=19248 57.142 3 2068.0888 2068.0888 R L 218 234 PSM DLKPENVLLDAHMNAK 1210 sp|Q13131|AAPK1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 3-UNIMOD:1031,13-UNIMOD:35 ms_run[2]:scan=23231 67.729 3 2019.0459 2019.0459 R I 150 166 PSM DLKPENVLLDAHMNAK 1211 sp|Q13131|AAPK1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 3-UNIMOD:1031 ms_run[2]:scan=25559 74.06 3 2003.051 2003.0510 R I 150 166 PSM DLKPNNLLLDENGVLK 1212 sp|P50613|CDK7_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 3-UNIMOD:1031 ms_run[2]:scan=30169 86.858 2 1990.1099 1990.1099 R L 137 153 PSM DLQSNVEHLTEKMK 1213 sp|Q01813|PFKAP_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 12-UNIMOD:1031 ms_run[2]:scan=27196 78.573 2 1866.9509 1866.9509 R T 614 628 PSM DTEPLIQTAKTTLGSK 1214 sp|P48643|TCPE_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 10-UNIMOD:1031 ms_run[2]:scan=27861 80.459 2 1898.0361 1898.0361 K V 161 177 PSM DVDDGLQAAEEVGYPVMIKASEGGGGK 1215 sp|Q13085|ACACA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 19-UNIMOD:1031 ms_run[2]:scan=32663 94.129 2 2887.391 2887.3910 K G 293 320 PSM DVKPHNVMIDHEHR 1216 sp|Q8NEV1|CSK23_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 3-UNIMOD:1031,8-UNIMOD:35 ms_run[2]:scan=10620 34.349 3 1937.953 1937.9530 R K 156 170 PSM DVKPHNVMIDHQQK 1217 sp|P19784|CSK22_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 3-UNIMOD:1031,8-UNIMOD:35 ms_run[2]:scan=11523 36.719 2 1899.9625 1899.9625 R K 157 171 PSM DVKPHNVMIDHQQK 1218 sp|P19784|CSK22_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 3-UNIMOD:1031 ms_run[2]:scan=13628 42.367 2 1883.9676 1883.9676 R K 157 171 PSM DYSSGFGGKYGVQADR 1219 sp|Q14247|SRC8_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 9-UNIMOD:1031 ms_run[2]:scan=21241 62.442 2 1901.8908 1901.8908 K V 153 169 PSM EAFSDGITSVKNSWFK 1220 sp|P08243-3|ASNS_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 11-UNIMOD:1031 ms_run[2]:scan=32824 94.598 2 2011.0051 2011.0051 K I 385 401 PSM EANFTVSSMHGDMPQKER 1221 sp|P38919|IF4A3_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 13-UNIMOD:35,16-UNIMOD:1031 ms_run[2]:scan=15814 48.096 3 2275.0362 2275.0362 R E 299 317 PSM EDDVGTGAGLLEIKK 1222 sp|P49368|TCPG_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 14-UNIMOD:1031 ms_run[2]:scan=26103 75.526 2 1739.9305 1739.9305 R I 340 355 PSM EKLIAPVAEEEATVPNNK 1223 sp|P07195|LDHB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 2-UNIMOD:1031 ms_run[2]:scan=23368 68.093 3 2147.1474 2147.1474 K I 6 24 PSM ENQKHIYYITGETK 1224 sp|P07900|HS90A_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 4-UNIMOD:1031 ms_run[2]:scan=18173 54.319 2 1918.9789 1918.9789 K D 486 500 PSM FAAKGEGQLGPAER 1225 sp|P13639|EF2_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 4-UNIMOD:1031 ms_run[2]:scan=17437 52.383 2 1625.8526 1625.8526 K A 236 250 PSM FFSDCKIQNGAQGIR 1226 sp|P31943|HNRH1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 5-UNIMOD:4,6-UNIMOD:1031 ms_run[2]:scan=22221 65.045 2 1935.9625 1935.9625 R F 30 45 PSM FNGQFKTYAICGAIR 1227 sp|P63220|RS21_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 6-UNIMOD:1031,11-UNIMOD:4 ms_run[2]:scan=26887 77.726 2 1940.9931 1940.9931 R R 46 61 PSM FTASAGIQVVGDDLTVTNPKR 1228 sp|P06733|ENOA_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 20-UNIMOD:1031 ms_run[2]:scan=27569 79.652 3 2384.27 2384.2700 K I 307 328 PSM FTLGKCSTLIVTDLAAR 1229 sp|Q8TDD1|DDX54_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 5-UNIMOD:1031,6-UNIMOD:4 ms_run[2]:scan=32201 92.641 2 2061.1292 2061.1292 K G 384 401 PSM GEVAPDAKSFVLNLGK 1230 sp|P09382|LEG1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 8-UNIMOD:1031 ms_run[2]:scan=31435 90.461 2 1840.0094 1840.0094 R D 22 38 PSM GMGSLDAMDKHLSSQNR 1231 sp|P12268|IMDH2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 10-UNIMOD:1031 ms_run[2]:scan=19384 57.5 3 2041.9673 2041.9673 R Y 413 430 PSM GPIKFNVWDTAGQEK 1232 sp|P62826|RAN_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 4-UNIMOD:1031 ms_run[2]:scan=27156 78.465 2 1884.9734 1884.9734 R F 57 72 PSM GTLVQTKGTGASGSFK 1233 sp|P10412|H14_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 7-UNIMOD:1031 ms_run[2]:scan=18169 54.307 2 1733.9312 1733.9312 K L 91 107 PSM GVLMYGPPGTGKTLLAR 1234 sp|P17980|PRS6A_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 4-UNIMOD:35,12-UNIMOD:1031 ms_run[2]:scan=26460 76.496 3 1942.071 1942.0710 K A 222 239 PSM GVLMYGPPGTGKTLLAR 1235 sp|P17980|PRS6A_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 4-UNIMOD:35,12-UNIMOD:1031 ms_run[2]:scan=26729 77.278 2 1942.071 1942.0710 K A 222 239 PSM GVLMYGPPGTGKTLLAR 1236 sp|P17980|PRS6A_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 4-UNIMOD:35,12-UNIMOD:1031 ms_run[2]:scan=27511 79.49 2 1942.071 1942.0710 K A 222 239 PSM HFVALSTNTTKVK 1237 sp|P06744|G6PI_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 11-UNIMOD:1031 ms_run[2]:scan=17094 51.481 2 1640.925 1640.9250 K E 242 255 PSM HGLEVIYMIEPIDEYCVQQLK 1238 sp|P07900|HS90A_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 8-UNIMOD:35,16-UNIMOD:4,21-UNIMOD:259 ms_run[2]:scan=27921 80.624 3 2600.2746 2600.2746 K E 514 535 PSM HPGSFDVVHVKDANGNSFATR 1239 sp|P62701|RS4X_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 11-UNIMOD:1031 ms_run[2]:scan=20354 60.061 4 2450.2091 2450.2091 R L 201 222 PSM HSQFIGYPITLFVEK 1240 sp|P07900|HS90A_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 15-UNIMOD:259 ms_run[2]:scan=28889 83.284 2 1785.9545 1785.9545 K E 210 225 PSM HVFGESDELIGQK 1241 sp|P60174-1|TPIS_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 ms_run[2]:scan=13276 41.442 2 1457.7151 1457.7151 R V 101 114 PSM IAKEEIFGPVQPLFK 1242 sp|P30837|AL1B1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 3-UNIMOD:1031 ms_run[2]:scan=33188 95.657 2 1911.087 1911.0870 R F 412 427 PSM IEKIGEGTYGVVYK 1243 sp|P06493|CDK1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 3-UNIMOD:1031 ms_run[2]:scan=22803 66.589 2 1750.9505 1750.9505 K G 7 21 PSM IFVGTKGIPHLVTHDAR 1244 sp|P62701|RS4X_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 6-UNIMOD:1031 ms_run[2]:scan=22206 65.006 4 2056.1582 2056.1582 K T 129 146 PSM IIFVVGGPGSGKGTQCEK 1245 sp|P00568|KAD1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 12-UNIMOD:1031,16-UNIMOD:4 ms_run[2]:scan=24116 70.098 2 2029.0666 2029.0666 K I 10 28 PSM IKGEHPGLSIGDVAK 1246 sp|P09429|HMGB1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 2-UNIMOD:1031 ms_run[2]:scan=18413 54.949 2 1715.957 1715.9570 K K 113 128 PSM ILCFYGPPGVGKTSIAR 1247 sp|P36776-3|LONM_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 3-UNIMOD:4,12-UNIMOD:1031 ms_run[2]:scan=28293 81.644 3 2031.0976 2031.0976 K S 322 339 PSM ILKCAGNEDIITLR 1248 sp|P12004|PCNA_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 3-UNIMOD:1031,4-UNIMOD:4 ms_run[2]:scan=25070 72.7 2 1810.9975 1810.9975 K A 78 92 PSM INEELESQYQQSMDSKLSGR 1249 sp|O00193|SMAP_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 13-UNIMOD:35,16-UNIMOD:1031 ms_run[2]:scan=19667 58.248 3 2553.2017 2553.2017 K Y 76 96 PSM IQSIAPSLQVITSKQR 1250 sp|P42345|MTOR_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 14-UNIMOD:1031 ms_run[2]:scan=27191 78.56 2 1964.1419 1964.1419 R P 2153 2169 PSM ISMADVKFSFQCPGR 1251 sp|Q13418-3|ILK_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 3-UNIMOD:35,7-UNIMOD:1031,12-UNIMOD:4 ms_run[2]:scan=28400 81.94 2 1953.9441 1953.9441 R M 201 216 PSM ISQGPYKGYIGVVK 1252 sp|O00267-2|SPT5H_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 7-UNIMOD:1031 ms_run[2]:scan=23274 67.844 2 1703.961 1703.9610 R D 708 722 PSM IVEIPFNSTNKYQLSIHK 1253 sp|P05023-3|AT1A1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 11-UNIMOD:1031 ms_run[2]:scan=26788 77.44 3 2326.2685 2326.2685 K N 446 464 PSM KAEEIANEMIEAAK 1254 sp|P49588|SYAC_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 1-UNIMOD:1031 ms_run[2]:scan=23941 69.62 2 1741.892 1741.8920 K A 651 665 PSM KGGSWIQEINVAEK 1255 sp|P78527-2|PRKDC_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 1-UNIMOD:1031,14-UNIMOD:1031 ms_run[2]:scan=25037 72.585 2 1761.9505 1761.9505 K N 3992 4006 PSM KGPSGYGFNLHSDK 1256 sp|O14745|NHRF1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 1-UNIMOD:1031 ms_run[2]:scan=17188 51.731 2 1701.8475 1701.8475 K S 159 173 PSM KHMVFLGGAVLADIMK 1257 sp|P61160|ARP2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 1-UNIMOD:1031,3-UNIMOD:35 ms_run[2]:scan=31243 89.921 2 1941.058 1941.0580 R D 351 367 PSM KIAEGAQQGDPLSR 1258 sp|Q9UJ70|NAGK_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 1-UNIMOD:1031 ms_run[2]:scan=15594 47.51 2 1664.8846 1664.8846 R Y 219 233 PSM KLGEMWNNTAADDK 1259 sp|P09429|HMGB1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 1-UNIMOD:1031 ms_run[2]:scan=20854 61.373 2 1787.8512 1787.8512 K Q 128 142 PSM KLGGTIDDCELVEGLVLTQK 1260 sp|P50991|TCPD_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 1-UNIMOD:1031,9-UNIMOD:4 ms_run[2]:scan=32087 92.319 3 2383.2669 2383.2669 K V 213 233 PSM KNMLFSGTNIAAGK 1261 sp|P16615-5|AT2A2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 1-UNIMOD:1031,3-UNIMOD:35 ms_run[2]:scan=20958 61.648 2 1662.8763 1662.8763 K A 205 219 PSM KQGGLGPMNIPLVSDPK 1262 sp|Q06830|PRDX1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 1-UNIMOD:1031 ms_run[2]:scan=28365 81.845 3 1946.0659 1946.0659 K R 93 110 PSM KTEAPAAPAAQETK 1263 sp|P80723|BASP1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 1-UNIMOD:1031 ms_run[2]:scan=10764 34.724 2 1607.8519 1607.8519 K S 150 164 PSM KTGQAPGYSYTAANK 1264 sp|P99999|CYC_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 1-UNIMOD:1031 ms_run[2]:scan=12630 39.73 2 1751.8842 1751.8842 R N 40 55 PSM KVTHAVVTVPAYFNDAQR 1265 sp|P11021|BIP_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 1-UNIMOD:1031 ms_run[2]:scan=22175 64.926 3 2211.18 2211.1800 K Q 164 182 PSM KYLLSQSSPAPLTAAEEELR 1266 sp|Q12792-4|TWF1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 1-UNIMOD:1031 ms_run[2]:scan=29563 85.168 3 2398.2744 2398.2744 K Q 38 58 PSM KYVATLGVEVHPLVFHTNR 1267 sp|P62826|RAN_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 1-UNIMOD:1031 ms_run[2]:scan=25304 73.37 4 2375.3114 2375.3114 K G 38 57 PSM LAMQEFMILPVGAANFR 1268 sp|P06733|ENOA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 3-UNIMOD:35,7-UNIMOD:35 ms_run[2]:scan=28418 81.989 2 1938.9696 1938.9696 K E 163 180 PSM LATQSNEITIPVTFESR 1269 sp|P04792|HSPB1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 17-UNIMOD:267 ms_run[2]:scan=24329 70.666 2 1914.9926 1914.9926 K A 172 189 PSM LCVPAMNVNDSVTKQK 1270 sp|O43865|SAHH2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 2-UNIMOD:4,6-UNIMOD:35,14-UNIMOD:1031 ms_run[2]:scan=18067 54.04 3 2015.018 2015.0180 K F 271 287 PSM LDINTNTYTSQDLKSALAK 1271 sp|Q9H173|SIL1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 14-UNIMOD:1031,19-UNIMOD:1031 ms_run[2]:scan=27496 79.446 2 2299.2151 2299.2151 R F 119 138 PSM LHHSEAPELHGKIR 1272 sp|Q8NB16|MLKL_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 12-UNIMOD:1031 ms_run[2]:scan=11021 35.404 2 1818.9853 1818.9853 R S 320 334 PSM LIGDAAKNQLTSNPENTVFDAK 1273 sp|P11021|BIP_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 7-UNIMOD:1031 ms_run[2]:scan=26528 76.676 3 2541.3075 2541.3075 R R 75 97 PSM LIGDAAKNQVAMNPTNTVFDAK 1274 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 7-UNIMOD:1031 ms_run[2]:scan=26952 77.908 3 2513.2948 2513.2948 R R 50 72 PSM LKGSGNLEAIHIIK 1275 sp|P78371|TCPB_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 2-UNIMOD:1031 ms_run[2]:scan=22237 65.087 3 1687.9985 1687.9985 R K 190 204 PSM LLDTKLMASTQPFK 1276 sp|O95453-4|PARN_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 5-UNIMOD:1031 ms_run[2]:scan=28432 82.027 2 1787.9855 1787.9855 R D 147 161 PSM LLLQVQHASKQIAADK 1277 sp|P12236|ADT3_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 10-UNIMOD:1031 ms_run[2]:scan=20440 60.286 2 1958.1313 1958.1313 K Q 34 50 PSM LLSKTPELNLDQFHDK 1278 sp|P27824|CALX_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 4-UNIMOD:1031 ms_run[2]:scan=25502 73.903 2 2093.1157 2093.1157 K T 167 183 PSM LMTGDTYTAHAGAKFPIK 1279 sp|P42684-4|ABL2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 2-UNIMOD:35,14-UNIMOD:1031 ms_run[2]:scan=20730 61.05 3 2133.0929 2133.0929 R W 397 415 PSM LNCQVIGASVDSHFCHLAWVNTPKK 1280 sp|Q06830|PRDX1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 3-UNIMOD:4,15-UNIMOD:4,25-UNIMOD:1031 ms_run[2]:scan=25476 73.832 3 3076.5375 3076.5375 K Q 69 94 PSM LNEQASEEILKVEQK 1281 sp|Q01105-2|SET_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 11-UNIMOD:1031 ms_run[2]:scan=22109 64.739 2 1953.0419 1953.0419 R Y 45 60 PSM LPMNKEWPSNLDLR 1282 sp|P31327|CPSM_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 5-UNIMOD:1031 ms_run[2]:scan=28878 83.253 2 1907.9928 1907.9928 R K 827 841 PSM LQVKEHQHEEIQNVR 1283 sp|Q6DD88|ATLA3_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 4-UNIMOD:1031 ms_run[2]:scan=11924 37.82 3 2082.097 2082.0970 R N 236 251 PSM LTEDKADVQSIIGLQR 1284 sp|Q13263|TIF1B_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 5-UNIMOD:1031 ms_run[2]:scan=27608 79.758 2 1981.0844 1981.0844 K F 775 791 PSM LVKEVIAVSCGPAQCQETIR 1285 sp|P38117|ETFB_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 3-UNIMOD:1031,10-UNIMOD:4,15-UNIMOD:4 ms_run[2]:scan=24546 71.251 3 2453.277 2453.2771 K T 57 77 PSM NMSVIAHVDHGKSTLTDSLVCK 1286 sp|P13639|EF2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 12-UNIMOD:1031,21-UNIMOD:4 ms_run[2]:scan=23184 67.604 4 2607.3149 2607.3149 R A 21 43 PSM NQVALNPQNTVFDAKR 1287 sp|P0DMV9|HS71B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 15-UNIMOD:1031 ms_run[2]:scan=23602 68.717 3 2010.0647 2010.0647 K L 57 73 PSM NQVALNPQNTVFDAKR 1288 sp|P0DMV9|HS71B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 15-UNIMOD:1031 ms_run[2]:scan=23606 68.73 2 2010.0647 2010.0647 K L 57 73 PSM NSEPAGLETPEAKVLFDK 1289 sp|P07814|SYEP_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 13-UNIMOD:1031 ms_run[2]:scan=27664 79.915 2 2140.1052 2140.1052 R V 890 908 PSM NVTNNLKSLEAASEK 1290 sp|P67936|TPM4_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 7-UNIMOD:1031 ms_run[2]:scan=21432 62.949 2 1812.9581 1812.9581 K Y 163 178 PSM QGGLGPMNIPLVSDPKR 1291 sp|Q06830|PRDX1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 16-UNIMOD:1031 ms_run[2]:scan=29533 85.086 2 1974.0721 1974.0721 K T 94 111 PSM QKGADFLVTEVENGGSLGSK 1292 sp|P14618|KPYM_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 2-UNIMOD:1031 ms_run[2]:scan=27958 80.725 3 2231.1434 2231.1434 K K 187 207 PSM SADGSAPAGEGEGVTLQR 1293 sp|Q01650|LAT1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 ms_run[2]:scan=9343 30.903 2 1700.7966 1700.7966 K N 31 49 PSM SGNLTEDDKHNNAK 1294 sp|P13797-2|PLST_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 9-UNIMOD:1031 ms_run[2]:scan=7880 27.025 2 1737.8282 1737.8282 K Y 561 575 PSM SGTPMQSAAKAPYLAK 1295 sp|A4QPH2-4|PI4P2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 10-UNIMOD:1031 ms_run[2]:scan=20317 59.96 2 1815.9553 1815.9553 K F 258 274 PSM SHAAGSKQHESIPGK 1296 sp|Q9GZP8|IMUP_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 7-UNIMOD:1031 ms_run[2]:scan=7063 24.857 3 1728.8907 1728.8907 K A 68 83 PSM SINPDEAVAYGAAVQAAILSGDK 1297 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 23-UNIMOD:259 ms_run[2]:scan=32660 94.121 3 2267.1525 2267.1525 K S 362 385 PSM SPYQEFTDHLVKTHTR 1298 sp|P15880|RS2_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 12-UNIMOD:1031 ms_run[2]:scan=20893 61.481 4 2154.0858 2154.0858 K V 264 280 PSM SQVISNAKNTVQGFK 1299 sp|P34932|HSP74_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 8-UNIMOD:1031 ms_run[2]:scan=21393 62.848 2 1815.9843 1815.9843 K R 54 69 PSM SSALASKATGYPLAFIAAK 1300 sp|P31327|CPSM_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 7-UNIMOD:1031 ms_run[2]:scan=31810 91.531 2 2062.1463 2062.1463 R I 722 741 PSM SSFYVNGLTLGGQKCSVIR 1301 sp|P07737|PROF1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 14-UNIMOD:1031,15-UNIMOD:4 ms_run[2]:scan=28696 82.748 3 2281.1889 2281.1889 R D 57 76 PSM SYELPDGQVITIGNER 1302 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 16-UNIMOD:267 ms_run[2]:scan=23352 68.051 2 1799.8929 1799.8929 K F 239 255 PSM TDLEKDIISDTSGDFR 1303 sp|P07355|ANXA2_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 5-UNIMOD:1031 ms_run[2]:scan=27233 78.673 2 2006.9797 2006.9797 K K 153 169 PSM TFNTSTGGLLLPSDTKR 1304 sp|P12956|XRCC6_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 16-UNIMOD:1031 ms_run[2]:scan=25152 72.943 2 2003.0688 2003.0688 R S 302 319 PSM TGISDVFAKNDLAVVDVR 1305 sp|P19338|NUCL_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 9-UNIMOD:1031 ms_run[2]:scan=32323 93.069 2 2114.1372 2114.1372 K I 325 343 PSM TGSESSQTGTSTTSSR 1306 sp|P23588-2|IF4B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 ms_run[2]:scan=1959 10.628 2 1572.6863 1572.6863 R N 381 397 PSM THYSNIEANESEEVR 1307 sp|P04632|CPNS1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 ms_run[2]:scan=7027 24.76 2 1776.7915 1776.7915 R Q 85 100 PSM TKAAAAAAAAAPAAAATAPTTAATTAATAAQ 1308 sp|P37108|SRP14_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 2-UNIMOD:1031 ms_run[2]:scan=23433 68.267 3 2792.4668 2792.4668 K - 106 137 PSM TKAIEHADGGVAAGVAVLDNPYPV 1309 sp|P48637-2|GSHB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 2-UNIMOD:1031 ms_run[2]:scan=28956 83.474 2 2559.3333 2559.3333 R - 340 364 PSM TSGHVDKFADFMVK 1310 sp|P41250|GARS_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 7-UNIMOD:1031,12-UNIMOD:35 ms_run[2]:scan=22448 65.649 2 1792.8818 1792.8818 K D 191 205 PSM TSGHVDKFADFMVK 1311 sp|P41250|GARS_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 7-UNIMOD:1031,12-UNIMOD:35 ms_run[2]:scan=24090 70.029 2 1792.8818 1792.8818 K D 191 205 PSM TSGHVDKFADFMVK 1312 sp|P41250|GARS_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 7-UNIMOD:1031 ms_run[2]:scan=25012 72.518 3 1776.8869 1776.8869 K D 191 205 PSM TSIMSKQYGNEVFLAK 1313 sp|P50990-2|TCPQ_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 4-UNIMOD:35,6-UNIMOD:1031 ms_run[2]:scan=23666 68.886 2 2027.0398 2027.0398 R L 147 163 PSM TSIMSKQYGNEVFLAK 1314 sp|P50990-2|TCPQ_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 4-UNIMOD:35,6-UNIMOD:1031 ms_run[2]:scan=24397 70.851 2 2027.0398 2027.0398 R L 147 163 PSM TSIMSKQYGNEVFLAK 1315 sp|P50990-2|TCPQ_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 4-UNIMOD:35,6-UNIMOD:1031 ms_run[2]:scan=25950 75.118 2 2027.0398 2027.0398 R L 147 163 PSM TSLGPNGLDKMMVDK 1316 sp|P48643|TCPE_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 10-UNIMOD:1031,11-UNIMOD:35,12-UNIMOD:35 ms_run[2]:scan=18844 56.083 2 1832.9012 1832.9012 R D 50 65 PSM TSLGPNGLDKMMVDK 1317 sp|P48643|TCPE_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 10-UNIMOD:1031,12-UNIMOD:35 ms_run[2]:scan=22478 65.728 2 1816.9063 1816.9063 R D 50 65 PSM TSSAQVEGGVHSLHSYEKR 1318 sp|P12268|IMDH2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 18-UNIMOD:1031 ms_run[2]:scan=13313 41.54 4 2267.1295 2267.1295 R L 494 513 PSM TTHLIAKEEMIHNLQ 1319 sp|O00232-2|PSD12_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 7-UNIMOD:1031 ms_run[2]:scan=24920 72.258 3 1973.0404 1973.0404 K - 422 437 PSM TTVVAQLKQLQAETEPIVK 1320 sp|P60228|EIF3E_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 8-UNIMOD:1031 ms_run[2]:scan=31977 92.013 3 2291.31 2291.3100 R M 75 94 PSM TVIIEQSWGSPKVTK 1321 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 12-UNIMOD:1031 ms_run[2]:scan=23667 68.889 2 1868.0407 1868.0407 R D 61 76 PSM TVSKVDDFLANEAK 1322 sp|P52209-2|6PGD_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 4-UNIMOD:1031 ms_run[2]:scan=25462 73.794 2 1731.9043 1731.9043 R G 22 36 PSM VAEDEAEAAAAAKFTGLSK 1323 sp|P08195-2|4F2_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 13-UNIMOD:1031 ms_run[2]:scan=27701 80.019 3 2074.0582 2074.0582 K E 47 66 PSM VAGIAKVLVAQHDVYK 1324 sp|P13804|ETFA_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 6-UNIMOD:1031 ms_run[2]:scan=24892 72.182 3 1906.104 1906.1040 K G 70 86 PSM VDKAAAAAAALQAK 1325 sp|P36578|RL4_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 3-UNIMOD:1031 ms_run[2]:scan=22871 66.767 2 1493.8566 1493.8566 R S 351 365 PSM VEEEIQTLSQVLAAKEK 1326 sp|P55327-2|TPD52_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 15-UNIMOD:1031 ms_run[2]:scan=32034 92.173 3 2110.1522 2110.1522 K H 46 63 PSM VGEVIVTKDDAMLLK 1327 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 8-UNIMOD:1031 ms_run[2]:scan=29009 83.621 2 1826.0223 1826.0223 K G 345 360 PSM VGINYQPPTVVPGGDLAKVQR 1328 sp|P68363|TBA1B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 18-UNIMOD:1031 ms_run[2]:scan=26861 77.654 3 2403.3274 2403.3274 K A 353 374 PSM VGLKGQPAIIDGELYNEVK 1329 sp|Q9Y266|NUDC_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 4-UNIMOD:1031 ms_run[2]:scan=28543 82.334 2 2238.226 2238.2260 R V 209 228 PSM VHLDKAQQNNVEHK 1330 sp|P62081|RS7_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 5-UNIMOD:1031 ms_run[2]:scan=9899 32.386 3 1854.97 1854.9700 K V 156 170 PSM VICAEEPYICKDFPETNNILK 1331 sp|P49915-2|GUAA_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 3-UNIMOD:4,10-UNIMOD:4,11-UNIMOD:1031 ms_run[2]:scan=29991 86.364 3 2748.3503 2748.3503 R I 348 369 PSM VLGQVSCELVSPKLNR 1332 sp|Q06265|EXOS9_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 7-UNIMOD:4,13-UNIMOD:1031 ms_run[2]:scan=25463 73.796 2 1994.0983 1994.0983 R A 55 71 PSM VLQATVVAVGSGSKGK 1333 sp|P61604|CH10_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 14-UNIMOD:1031 ms_run[2]:scan=19756 58.479 2 1695.9883 1695.9883 K G 41 57 PSM VMSQNFTNCHTKIR 1334 sp|Q13283|G3BP1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 9-UNIMOD:4,12-UNIMOD:1031 ms_run[2]:scan=15145 46.34 2 1930.9506 1930.9506 K H 65 79 PSM VNQIGSVTESLQACK 1335 sp|P06733|ENOA_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 14-UNIMOD:4 ms_run[2]:scan=15592 47.505 2 1632.8141 1632.8141 K L 344 359 PSM VPLEVQEADEAKLQQTEAELR 1336 sp|P26640|SYVC_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 12-UNIMOD:1031 ms_run[2]:scan=28457 82.096 3 2591.3443 2591.3443 K K 1231 1252 PSM VSEKVSHVLAALQAGNR 1337 sp|Q9Y490|TLN1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 4-UNIMOD:1031 ms_run[2]:scan=27194 78.568 3 1974.1011 1974.1011 R G 1957 1974 PSM VTDDLVCLVYKTDQAQDVK 1338 sp|P49458|SRP09_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 7-UNIMOD:4,11-UNIMOD:1031 ms_run[2]:scan=29866 86.013 2 2405.2148 2405.2148 K K 42 61 PSM VTTVTEIGKDVIGLR 1339 sp|P53621|COPA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 9-UNIMOD:1031 ms_run[2]:scan=30170 86.861 2 1796.0407 1796.0407 R I 1203 1218 PSM VVAVDCGIKNNVIR 1340 sp|P31327|CPSM_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 6-UNIMOD:4,9-UNIMOD:1031 ms_run[2]:scan=23092 67.357 2 1751.9716 1751.9716 K L 220 234 PSM VVGSEFVQKYLGEGPR 1341 sp|P43686-2|PRS6B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 9-UNIMOD:1031 ms_run[2]:scan=29007 83.616 2 1960.0418 1960.0418 R M 199 215 PSM VVSSIEQKTEGAEK 1342 sp|P63104|1433Z_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 8-UNIMOD:1031 ms_run[2]:scan=16998 51.232 2 1699.8992 1699.8992 R K 61 75 PSM YQGVNLYVKNLDDGIDDER 1343 sp|P11940|PABP1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 37 9-UNIMOD:1031 ms_run[2]:scan=27897 80.557 3 2421.1812 2421.1812 R L 291 310 PSM LIGDAAKNQVAMNPTNTVFDAK 1344 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 37 7-UNIMOD:1031 ms_run[1]:scan=27404 79.18548 3 2514.279396 2513.294809 R R 50 72 PSM GDLDASVPSMKVHAPGLNLSGVGGK 1345 sp|Q09666|AHNK_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 37 11-UNIMOD:1031 ms_run[1]:scan=26933 77.85425 3 2602.366956 2601.358472 K M 5313 5338 PSM IQEIIEQLDVTTSEYEKEK 1346 sp|P10809|CH60_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 37 17-UNIMOD:1031 ms_run[1]:scan=28235 81.483629 3 2491.275779 2490.274117 R L 371 390 PSM LIGDAAKNQVALNPQNTVFDAK 1347 sp|P0DMV8|HS71A_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 37 7-UNIMOD:1031 ms_run[1]:scan=27439 79.285901 3 2523.346561 2522.349288 R R 50 72 PSM NLGTIAKSGTSEFLNK 1348 sp|P14625|ENPL_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 37 7-UNIMOD:1031 ms_run[1]:scan=26677 77.102712 2 1875.008320 1875.010178 K M 162 178 PSM NLGTIAKSGTSEFLNK 1349 sp|P14625|ENPL_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 37 7-UNIMOD:1031 ms_run[1]:scan=27575 79.669422 2 1876.018289 1875.010178 K M 162 178 PSM NLGTIAKSGTSEFLNK 1350 sp|P14625|ENPL_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 37 7-UNIMOD:1031 ms_run[1]:scan=32880 94.756379 2 1876.010446 1875.010178 K M 162 178 PSM NLGTIAKSGTSEFLNK 1351 sp|P14625|ENPL_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 37 7-UNIMOD:1031 ms_run[1]:scan=26365 76.236151 2 1876.001170 1875.010178 K M 162 178 PSM NLGTIAKSGTSEFLNK 1352 sp|P14625|ENPL_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 37 7-UNIMOD:1031 ms_run[1]:scan=27965 80.745905 2 1876.015547 1875.010178 K M 162 178 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 1353 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 37 1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=34502 99.628646 3 2991.3592 2990.3382 M A 2 29 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 1354 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 37 1-UNIMOD:1,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=34708 100.62737 3 2974.3419 2974.3432 M A 2 29 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 1355 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 37 1-UNIMOD:1,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=33505 96.47863 3 2974.3456 2974.3432 M A 2 29 PSM EEEIAALVIDNGSGMCKAGFAGDDAPR 1356 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 37 1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=34126 98.174674 3 3048.4242 3046.4002 M A 2 29 PSM EEEIAALVIDNGSGMCKAGFAGDDAPR 1357 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 37 1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=34505 99.642363 3 3047.4162 3046.4002 M A 2 29 PSM EEEIAALVIDNGSGMCKAGFAGDDAPR 1358 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 37 1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=34609 100.14219 3 3047.4182 3046.4002 M A 2 29 PSM ALHVPKAPGFAQMLK 1359 sp|P50990|TCPQ_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 37 1-UNIMOD:1,6-UNIMOD:1031 ms_run[1]:scan=31434 90.458308 2 1845.0378 1845.0330 M E 2 17 PSM ALHVPKAPGFAQMLK 1360 sp|P50990|TCPQ_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 37 1-UNIMOD:1,6-UNIMOD:1031,13-UNIMOD:35 ms_run[1]:scan=27329 78.963223 2 1861.0251 1861.0279 M E 2 17 PSM TSIMSKQYGNEVFLAK 1361 sp|P50990|TCPQ_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 37 4-UNIMOD:35,6-UNIMOD:1031 ms_run[1]:scan=25760 74.598404 2 2027.036335 2027.039764 R L 166 182 PSM QLFHPEQLITGKEDAANNYAR 1362 sp|P68363|TBA1B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 37 1-UNIMOD:28,12-UNIMOD:1031 ms_run[1]:scan=31724 91.280342 3 2593.2953 2593.2920 R G 85 106 PSM IVSGKDYNVTANSK 1363 sp|P00338|LDHA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 37 5-UNIMOD:1031 ms_run[1]:scan=15700 47.783754 2 1690.882863 1690.889000 K L 77 91 PSM EAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIR 1364 sp|P04350|TBB4A_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 37 5-UNIMOD:4,7-UNIMOD:4,25-UNIMOD:35,32-UNIMOD:1031 ms_run[1]:scan=30947 89.079534 3 3791.847481 3791.828081 K E 123 157 PSM IFVGGIKEDTEEHHLR 1365 sp|Q32P51|RA1L2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 37 7-UNIMOD:1031 ms_run[1]:scan=19560 57.967786 2 2075.080908 2075.079989 K D 107 123 PSM LNISFPATGCQKLIEVDDER 1366 sp|P62753|RS6_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 37 10-UNIMOD:4,12-UNIMOD:1031 ms_run[1]:scan=30536 87.927069 3 2500.276903 2500.263175 K K 3 23 PSM AEAEAWYQTKFETLQAQAGK 1367 sp|P08729|K2C7_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 37 10-UNIMOD:1031 ms_run[1]:scan=30804 88.683405 3 2465.224272 2465.222690 R H 277 297 PSM KGISLNPEQWSQLK 1368 sp|P53999|TCP4_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 37 1-UNIMOD:1031 ms_run[1]:scan=28790 83.010765 2 1822.993036 1822.994134 R E 101 115 PSM TVDFTQDSNYLLTGGQDKLLR 1369 sp|Q9Y3F4|STRAP_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 37 18-UNIMOD:1031 ms_run[1]:scan=31394 90.342173 3 2578.329733 2579.323132 K I 105 126 PSM MKPGATGESDLAEVLPQHK 1370 sp|Q709F0|ACD11_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 37 1-UNIMOD:1,2-UNIMOD:1031 ms_run[1]:scan=27184 78.539886 3 2245.1446 2245.1407 - F 1 20 PSM WNGFGGKVQEGETIEDGAR 1371 sp|P36639|8ODP_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 37 7-UNIMOD:1031 ms_run[1]:scan=24175 70.252036 3 2246.080553 2245.076360 R R 73 92 PSM SHLKITDSAGHILYSK 1372 sp|P49755|TMEDA_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 37 4-UNIMOD:1031 ms_run[1]:scan=19176 56.956177 3 1964.068339 1965.068362 R E 72 88 PSM DIKPQNLLVDPDTAVLK 1373 sp|P49840|GSK3A_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 37 3-UNIMOD:1031 ms_run[1]:scan=30732 88.471492 2 2074.163603 2074.167407 R L 244 261 PSM LIGDAAKNQVAMNPTNTVFDAK 1374 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 37 7-UNIMOD:1031 ms_run[1]:scan=27413 79.212909 2 2514.276755 2513.294809 R R 50 72 PSM AALDKATVLLSMSK 1375 sp|Q53EL6-2|PDCD4_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 5-UNIMOD:1031 ms_run[2]:scan=31982 92.028 2 1642.9328 1642.9328 R G 282 296 PSM AASIFGGAKPVDTAAR 1376 sp|P23588-2|IF4B_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 9-UNIMOD:1031 ms_run[2]:scan=23142 67.491 2 1726.9366 1726.9366 R E 318 334 PSM AAYLQETGKPLDETLK 1377 sp|P04083|ANXA1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 9-UNIMOD:1031 ms_run[2]:scan=23798 69.239 2 1972.0517 1972.0517 K K 82 98 PSM ADALQAGASQFETSAAKLK 1378 sp|Q15836|VAMP3_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 17-UNIMOD:1031 ms_run[2]:scan=25597 74.16 2 2102.1008 2102.1008 R R 50 69 PSM ADLINNLGTIAKSGTK 1379 sp|P07900|HS90A_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 12-UNIMOD:1031 ms_run[2]:scan=26833 77.571 2 1811.0153 1811.0153 K A 101 117 PSM ADLINNLGTIAKSGTK 1380 sp|P07900|HS90A_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 12-UNIMOD:1031 ms_run[2]:scan=26605 76.882 3 1811.0153 1811.0153 K A 101 117 PSM AEGSDVANAVLDGADCIMLSGETAKGDYPLEAVR 1381 sp|P14618|KPYM_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 16-UNIMOD:4,18-UNIMOD:35,25-UNIMOD:1031 ms_run[2]:scan=32941 94.935 4 3705.7502 3705.7502 R M 343 377 PSM AELIKTHHNDTELIR 1382 sp|P49915-2|GUAA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 5-UNIMOD:1031 ms_run[2]:scan=16236 49.222 4 1985.0694 1985.0694 K K 286 301 PSM AFLDALQNQAEASSK 1383 sp|Q12931-2|TRAP1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 ms_run[2]:scan=19858 58.749 2 1591.7842 1591.7842 K I 129 144 PSM AGGKHNDLDDVGK 1384 sp|P49588|SYAC_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 4-UNIMOD:1031 ms_run[2]:scan=11086 35.579 3 1520.7583 1520.7583 R D 78 91 PSM AGQKLIDVNHYAK 1385 sp|Q13813-3|SPTN1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 4-UNIMOD:1031 ms_run[2]:scan=18135 54.22 3 1651.9046 1651.9046 K D 634 647 PSM AHLGTALKANPFGGASHAK 1386 sp|P62266|RS23_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 8-UNIMOD:1031 ms_run[2]:scan=18634 55.532 4 2043.1014 2043.1014 K G 30 49 PSM ALAAAGYDVEKNNSR 1387 sp|P10412|H14_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 11-UNIMOD:1031 ms_run[2]:scan=17331 52.102 2 1773.901 1773.9010 K I 65 80 PSM ALELDSNNEKGLFR 1388 sp|Q02790|FKBP4_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 10-UNIMOD:1031 ms_run[2]:scan=25665 74.342 2 1800.937 1800.9370 K R 345 359 PSM AQQNNVEHKVETFSGVYK 1389 sp|P62081|RS7_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 9-UNIMOD:1031 ms_run[2]:scan=23489 68.42 3 2273.144 2273.1440 K K 161 179 PSM DAIHFYNKSLAEHR 1390 sp|P31948|STIP1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 8-UNIMOD:1031 ms_run[2]:scan=19805 58.609 3 1895.9642 1895.9642 K T 318 332 PSM DGLLENQTPEFFQDVCKPK 1391 sp|P49327|FAS_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 16-UNIMOD:4,17-UNIMOD:1031 ms_run[2]:scan=30579 88.046 2 2460.1995 2460.1995 R Y 1977 1996 PSM DGVVEITGKHEER 1392 sp|P04792|HSPB1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 9-UNIMOD:1031 ms_run[2]:scan=16499 49.917 2 1663.8529 1663.8529 K Q 115 128 PSM DHCVAHKLFNNLK 1393 sp|P07919|QCR6_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 3-UNIMOD:4,7-UNIMOD:1031 ms_run[2]:scan=20047 59.249 3 1790.925 1790.9250 R - 79 92 PSM DITVLDLGCGKGGDLLK 1394 sp|O43148|MCES_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 9-UNIMOD:4,11-UNIMOD:1031 ms_run[2]:scan=32648 94.087 2 1969.0554 1969.0554 R W 198 215 PSM DLEEDHACIPIKK 1395 sp|P13639|EF2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 8-UNIMOD:4,12-UNIMOD:1031 ms_run[2]:scan=19931 58.941 2 1762.8924 1762.8924 K S 560 573 PSM DLKSNNIFLHEDLTVK 1396 sp|P15056|BRAF_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 3-UNIMOD:1031,16-UNIMOD:1031 ms_run[2]:scan=27204 78.596 3 2089.1299 2089.1299 R I 576 592 PSM DLSHIGDAVVISCAKDGVK 1397 sp|P12004|PCNA_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 13-UNIMOD:4,15-UNIMOD:1031 ms_run[2]:scan=25931 75.065 3 2179.1307 2179.1307 R F 150 169 PSM DSSGNLHGYVAEGGAKDIR 1398 sp|Q8IZ83-3|A16A1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 16-UNIMOD:1031 ms_run[2]:scan=18063 54.03 3 2141.0501 2141.0501 R G 498 517 PSM DTEPLIQTAKTTLGSK 1399 sp|P48643|TCPE_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 10-UNIMOD:1031 ms_run[2]:scan=27727 80.091 2 1898.0361 1898.0361 K V 161 177 PSM DVKPHNVMIDHEHR 1400 sp|Q8NEV1|CSK23_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 3-UNIMOD:1031 ms_run[2]:scan=12576 39.583 3 1921.9581 1921.9581 R K 156 170 PSM EANFTVSSMHGDMPQKER 1401 sp|P38919|IF4A3_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 9-UNIMOD:35,16-UNIMOD:1031 ms_run[2]:scan=15946 48.456 3 2275.0362 2275.0362 R E 299 317 PSM EDKQPEQATTSAQVACLYR 1402 sp|P18858-3|DNLI1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 3-UNIMOD:1031,16-UNIMOD:4 ms_run[2]:scan=19792 58.575 3 2390.1536 2390.1536 R K 849 868 PSM EENVKTVLMNPNIASVQTNEVGLK 1403 sp|P31327|CPSM_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 5-UNIMOD:1031 ms_run[2]:scan=30984 89.186 3 2822.4848 2822.4848 K Q 454 478 PSM EFHLNESGDPSSKSTEIK 1404 sp|Q01105-2|SET_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 13-UNIMOD:1031 ms_run[2]:scan=18157 54.275 3 2200.0648 2200.0648 K W 142 160 PSM EGAKYVSHGATGK 1405 sp|P00966|ASSY_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 4-UNIMOD:1031 ms_run[2]:scan=8793 29.441 2 1499.7732 1499.7732 R G 109 122 PSM EKNLLHVTDTGVGMTR 1406 sp|P14625|ENPL_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 2-UNIMOD:1031 ms_run[2]:scan=22440 65.626 3 1966.0306 1966.0306 K E 141 157 PSM EQCCYNCGKPGHLAR 1407 sp|P62633-7|CNBP_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 3-UNIMOD:4,4-UNIMOD:4,7-UNIMOD:4,9-UNIMOD:1031 ms_run[2]:scan=12494 39.355 2 2044.903 2044.9030 R D 78 93 PSM EVIAVSCGPAQCQETIR 1408 sp|P38117|ETFB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 7-UNIMOD:4,12-UNIMOD:4 ms_run[2]:scan=14597 44.904 2 1916.9084 1916.9084 K T 60 77 PSM EVYELLDSPGKVLLQSK 1409 sp|P22234|PUR6_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 11-UNIMOD:1031 ms_run[2]:scan=31585 90.885 2 2113.1671 2113.1671 K D 20 37 PSM FKAADLNGDLTATR 1410 sp|Q15293|RCN1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 2-UNIMOD:1031 ms_run[2]:scan=21636 63.492 2 1687.8893 1687.8893 R E 175 189 PSM FKGQILMPNIGYGSNK 1411 sp|P62910|RL32_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 2-UNIMOD:1031 ms_run[2]:scan=27869 80.48 2 1962.0397 1962.0397 R K 49 65 PSM FLSGLELVKQGAEAR 1412 sp|Q96S44|PRPK_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 9-UNIMOD:1031 ms_run[2]:scan=29808 85.851 2 1813.0098 1813.0098 R V 32 47 PSM FSNISAAKAVADAIR 1413 sp|P50991|TCPD_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 8-UNIMOD:1031 ms_run[2]:scan=27671 79.936 2 1728.9523 1728.9523 R T 35 50 PSM FSVCVLGDQQHCDEAKAVDIPHMDIEALK 1414 sp|P62906|RL10A_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 4-UNIMOD:4,12-UNIMOD:4,16-UNIMOD:1031 ms_run[2]:scan=29728 85.627 4 3520.6789 3520.6789 K K 63 92 PSM FVLCPECENPETDLHVNPKK 1415 sp|P55010|IF5_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 4-UNIMOD:4,7-UNIMOD:4,20-UNIMOD:1031 ms_run[2]:scan=23391 68.155 3 2621.2618 2621.2618 K Q 96 116 PSM GAGTNEKVLTEIIASR 1416 sp|P08758|ANXA5_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 7-UNIMOD:1031 ms_run[2]:scan=27776 80.224 2 1854.0211 1854.0211 K T 102 118 PSM GDLSGHFEHLMVALVTPPAVFDAKQLK 1417 sp|P12429|ANXA3_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 11-UNIMOD:35,24-UNIMOD:1031 ms_run[2]:scan=31783 91.454 4 3131.6478 3131.6478 K K 74 101 PSM GFFIKPTVFGGVQDDMR 1418 sp|P30837|AL1B1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 5-UNIMOD:1031,16-UNIMOD:35 ms_run[2]:scan=32730 94.326 2 2125.0666 2125.0666 R I 395 412 PSM GGETIKSISQQSGAR 1419 sp|Q96AE4|FUBP1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 6-UNIMOD:1031 ms_run[2]:scan=16513 49.954 2 1713.901 1713.9010 K I 395 410 PSM GGNEESTKTGNAGSR 1420 sp|P00441|SODC_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 8-UNIMOD:1031 ms_run[2]:scan=7190 25.19 2 1659.7812 1659.7812 K L 130 145 PSM GILLVGPPGTGKTLLAR 1421 sp|Q96TA2-3|YMEL1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 12-UNIMOD:1031 ms_run[2]:scan=31298 90.075 2 1858.1404 1858.1404 K A 284 301 PSM GILLYGPPGTGKTLIAR 1422 sp|P55072|TERA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 12-UNIMOD:1031 ms_run[2]:scan=30002 86.394 2 1922.1353 1922.1353 R A 240 257 PSM GIVDQSQQAYQEAFEISKK 1423 sp|P63104|1433Z_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 18-UNIMOD:1031 ms_run[2]:scan=27290 78.837 3 2364.1961 2364.1961 K E 140 159 PSM GKLPGPTLWASYSLEYGK 1424 sp|P07741-2|APT_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 2-UNIMOD:1031 ms_run[2]:scan=31997 92.069 2 2162.1412 2162.1412 R A 90 108 PSM GLESTTLADKDGEIYCK 1425 sp|P21291|CSRP1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 10-UNIMOD:1031,16-UNIMOD:4 ms_run[2]:scan=22523 65.845 2 2095.0143 2095.0143 K G 152 169 PSM GLKEGIPALDNFLDK 1426 sp|P13639|EF2_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 3-UNIMOD:1031 ms_run[2]:scan=33200 95.689 2 1824.9986 1824.9986 K L 843 858 PSM GMGSLDAMDKHLSSQNR 1427 sp|P12268|IMDH2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 8-UNIMOD:35,10-UNIMOD:1031 ms_run[2]:scan=15608 47.547 3 2057.9623 2057.9623 R Y 413 430 PSM GSSKQQSEEDLLLQDFSR 1428 sp|Q9UNL2|SSRG_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 4-UNIMOD:1031 ms_run[2]:scan=28046 80.969 2 2262.1128 2262.1128 K N 5 23 PSM GVLLFGPPGTGKTLCAR 1429 sp|P35998|PRS7_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 12-UNIMOD:1031,15-UNIMOD:4 ms_run[2]:scan=29757 85.711 2 1939.0713 1939.0713 K A 211 228 PSM HADIVTTTTHKTLR 1430 sp|P34897-3|GLYM_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 11-UNIMOD:1031 ms_run[2]:scan=15173 46.414 3 1788.9846 1788.9846 K G 249 263 PSM HAQGEKTAGINVR 1431 sp|P50991|TCPD_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 6-UNIMOD:1031 ms_run[2]:scan=12490 39.345 2 1575.8481 1575.8481 R K 484 497 PSM HEQNIDCGGGYVK 1432 sp|P27797|CALR_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 7-UNIMOD:4 ms_run[2]:scan=5494 20.591 2 1475.6463 1475.6463 K L 99 112 PSM HESGASIKIDEPLEGSEDR 1433 sp|P61978|HNRPK_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 8-UNIMOD:1031 ms_run[2]:scan=19450 57.674 3 2264.0921 2264.0921 R I 415 434 PSM HLEINPDHSIIETLR 1434 sp|P07900|HS90A_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 ms_run[2]:scan=19164 56.923 3 1785.9373 1785.9373 K Q 633 648 PSM HNGTGGKSIYGEK 1435 sp|P62937|PPIA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 7-UNIMOD:1031 ms_run[2]:scan=11004 35.361 2 1542.7791 1542.7791 R F 70 83 PSM HSQFIGYPITLFVEK 1436 sp|P07900|HS90A_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 ms_run[2]:scan=28900 83.317 2 1777.9403 1777.9403 K E 210 225 PSM HVFGESDELIGQK 1437 sp|P60174-1|TPIS_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 13-UNIMOD:259 ms_run[2]:scan=13264 41.41 2 1465.7293 1465.7293 R V 101 114 PSM HWILPQDYDHAQAEAR 1438 sp|Q15293|RCN1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 16-UNIMOD:267 ms_run[2]:scan=14879 45.642 3 1958.9263 1958.9263 R H 271 287 PSM IDKLMIEMDGTENK 1439 sp|P06733|ENOA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 3-UNIMOD:1031,5-UNIMOD:35,8-UNIMOD:35 ms_run[2]:scan=20770 61.155 2 1863.8958 1863.8958 K S 90 104 PSM IEDLSQQAQLAAAEKFK 1440 sp|E9PAV3|NACAM_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 15-UNIMOD:1031 ms_run[2]:scan=27397 79.165 3 2085.1106 2085.1106 K V 1991 2008 PSM IEKAYAQQLTEWAR 1441 sp|Q9UNF0-2|PACN2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 3-UNIMOD:1031 ms_run[2]:scan=27141 78.425 2 1901.9999 1901.9999 R R 51 65 PSM IGDFGLVTSLKNDGK 1442 sp|P19525-2|E2AK2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 11-UNIMOD:1031,15-UNIMOD:1031 ms_run[2]:scan=29618 85.321 2 1766.9658 1766.9658 K R 389 404 PSM IGHPAPNFKATAVMPDGQFK 1443 sp|Q06830|PRDX1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 9-UNIMOD:1031,14-UNIMOD:35 ms_run[2]:scan=20733 61.058 3 2337.194 2337.1940 K D 8 28 PSM IGSSMKSVGEVMAIGR 1444 sp|P31327|CPSM_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 5-UNIMOD:35,6-UNIMOD:1031,12-UNIMOD:35 ms_run[2]:scan=22328 65.333 2 1848.9438 1848.9438 R T 788 804 PSM IGSSMKSVGEVMAIGR 1445 sp|P31327|CPSM_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 5-UNIMOD:35,6-UNIMOD:1031 ms_run[2]:scan=24579 71.337 2 1832.9488 1832.9488 R T 788 804 PSM IGSSMKSVGEVMAIGR 1446 sp|P31327|CPSM_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 6-UNIMOD:1031,12-UNIMOD:35 ms_run[2]:scan=25224 73.15 2 1832.9488 1832.9488 R T 788 804 PSM IGSSMKSVGEVMAIGR 1447 sp|P31327|CPSM_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 5-UNIMOD:35,6-UNIMOD:1031 ms_run[2]:scan=26272 75.981 2 1832.9488 1832.9488 R T 788 804 PSM IIDEKTGVIEHEHPVNK 1448 sp|P98082-2|DAB2_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 5-UNIMOD:1031 ms_run[2]:scan=16400 49.658 4 2153.1481 2153.1481 K I 104 121 PSM IIFVVGGPGSGKGTQCEK 1449 sp|P00568|KAD1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 12-UNIMOD:1031,16-UNIMOD:4 ms_run[2]:scan=23894 69.497 3 2029.0666 2029.0666 K I 10 28 PSM IISNASCTTNCLAPLAK 1450 sp|P04406|G3P_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 7-UNIMOD:4,11-UNIMOD:4 ms_run[2]:scan=16613 50.217 2 1832.9125 1832.9125 K V 146 163 PSM IKGEHPGLSIGDVAK 1451 sp|P09429|HMGB1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 2-UNIMOD:1031 ms_run[2]:scan=18410 54.941 3 1715.957 1715.9570 K K 113 128 PSM ILNEKVNTPTTTVYR 1452 sp|P26639|SYTC_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 5-UNIMOD:1031 ms_run[2]:scan=20644 60.823 2 1944.068 1944.0680 R C 239 254 PSM ISMADVKFSFQCPGR 1453 sp|Q13418-3|ILK_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 3-UNIMOD:35,7-UNIMOD:1031,12-UNIMOD:4 ms_run[2]:scan=28917 83.364 2 1953.9441 1953.9441 R M 201 216 PSM ISMADVKFSFQCPGR 1454 sp|Q13418-3|ILK_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 7-UNIMOD:1031,12-UNIMOD:4 ms_run[2]:scan=29753 85.698 2 1937.9492 1937.9492 R M 201 216 PSM IVADKDYSVTANSK 1455 sp|P07195|LDHB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 5-UNIMOD:1031 ms_run[2]:scan=17047 51.36 2 1705.8887 1705.8887 K I 78 92 PSM IVEHPSDLIVSKGEPATLNCK 1456 sp|Q9Y6N7-6|ROBO1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 12-UNIMOD:1031,20-UNIMOD:4 ms_run[2]:scan=22705 66.33 3 2502.3152 2502.3152 R A 31 52 PSM IVLTNPVCTEVGEKIALSR 1457 sp|P41091|IF2G_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 8-UNIMOD:4,14-UNIMOD:1031 ms_run[2]:scan=31426 90.433 3 2294.2668 2294.2668 K R 427 446 PSM IVNSAQTGSFKQLTVK 1458 sp|O75964|ATP5L_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 11-UNIMOD:1031 ms_run[2]:scan=22405 65.534 2 1916.0731 1916.0731 K E 56 72 PSM IVSQLLTLMDGLKQR 1459 sp|P55072|TERA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 9-UNIMOD:35,13-UNIMOD:1031 ms_run[2]:scan=29129 83.953 2 1926.0972 1926.0972 R A 324 339 PSM IVSQLLTLMDGLKQR 1460 sp|P55072|TERA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 9-UNIMOD:35,13-UNIMOD:1031 ms_run[2]:scan=29392 84.679 2 1926.0972 1926.0972 R A 324 339 PSM KAHLMEIQVNGGTVAEK 1461 sp|P39023|RL3_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 1-UNIMOD:1031,5-UNIMOD:35 ms_run[2]:scan=16610 50.207 3 2036.0725 2036.0725 K L 177 194 PSM KEAQELSQNSAIK 1462 sp|Q9NR30-2|DDX21_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 1-UNIMOD:1031 ms_run[2]:scan=14374 44.323 2 1640.8733 1640.8733 K Q 381 394 PSM KGHEENGDVVTEPQVAEK 1463 sp|Q9UG63|ABCF2_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 1-UNIMOD:1031 ms_run[2]:scan=12305 38.846 3 2161.0651 2161.0651 R N 25 43 PSM KGVNLPGAAVDLPAVSEK 1464 sp|P14618|KPYM_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 1-UNIMOD:1031 ms_run[2]:scan=27117 78.36 3 1960.0993 1960.0993 K D 207 225 PSM KHLEINPDHPIVETLR 1465 sp|P08238|HS90B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 1-UNIMOD:1031 ms_run[2]:scan=21710 63.686 4 2106.1586 2106.1586 K Q 624 640 PSM KHMVFLGGAVLADIMK 1466 sp|P61160|ARP2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 1-UNIMOD:1031,3-UNIMOD:35 ms_run[2]:scan=31209 89.824 3 1941.058 1941.0580 R D 351 367 PSM KILQDGGLQVVEK 1467 sp|O43175|SERA_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 1-UNIMOD:1031 ms_run[2]:scan=22414 65.559 2 1621.9403 1621.9403 R Q 21 34 PSM KISSIQSIVPALEIANAHR 1468 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 1-UNIMOD:1031 ms_run[2]:scan=30087 86.631 3 2242.2798 2242.2798 K K 250 269 PSM KLYTGPGLAIHCMQVHK 1469 sp|O43670-2|ZN207_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 1-UNIMOD:1031,12-UNIMOD:4 ms_run[2]:scan=20183 59.606 3 2148.1336 2148.1336 K E 43 60 PSM KNMLFSGTNIAAGK 1470 sp|P16615-5|AT2A2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 1-UNIMOD:1031,3-UNIMOD:35 ms_run[2]:scan=21144 62.176 2 1662.8763 1662.8763 K A 205 219 PSM KQSTDEEVTSLAK 1471 sp|P23193-2|TCEA1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 1-UNIMOD:1031 ms_run[2]:scan=15949 48.463 2 1630.8414 1630.8414 R S 34 47 PSM KQTIDNSQGAYQEAFDISK 1472 sp|P27348|1433T_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 1-UNIMOD:1031 ms_run[2]:scan=22470 65.705 3 2338.1441 2338.1441 R K 139 158 PSM KSDIDEIVLVGGSTR 1473 sp|P11021|BIP_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 1-UNIMOD:1031 ms_run[2]:scan=25944 75.099 2 1783.968 1783.9680 K I 353 368 PSM KVAAIEALNDGELQK 1474 sp|P50502|F10A1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 1-UNIMOD:1031 ms_run[2]:scan=23414 68.217 2 1793.9887 1793.9887 K A 118 133 PSM LAHEVGWKYQAVTATLEEK 1475 sp|P40429|RL13A_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 8-UNIMOD:1031 ms_run[2]:scan=27835 80.388 3 2368.2427 2368.2427 R R 141 160 PSM LFVGNLPADITEDEFKR 1476 sp|P23246-2|SFPQ_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 16-UNIMOD:1031 ms_run[2]:scan=31424 90.428 2 2159.1263 2159.1263 R L 299 316 PSM LHHSEAPELHGKIR 1477 sp|Q8NB16|MLKL_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 12-UNIMOD:1031 ms_run[2]:scan=11019 35.399 3 1818.9853 1818.9853 R S 320 334 PSM LIAPVAEEEATVPNNK 1478 sp|P07195|LDHB_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 ms_run[2]:scan=16020 48.652 2 1693.8887 1693.8887 K I 8 24 PSM LLDTKLMASTQPFK 1479 sp|O95453-4|PARN_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 5-UNIMOD:1031,7-UNIMOD:35 ms_run[2]:scan=25821 74.764 2 1803.9805 1803.9805 R D 147 161 PSM LLGKGNIIISTPEK 1480 sp|O75643|U520_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 4-UNIMOD:1031 ms_run[2]:scan=26322 76.118 2 1678.0029 1678.0029 K W 1418 1432 PSM LLLLGAGESGKSTIVK 1481 sp|Q5JWF2-2|GNAS1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 11-UNIMOD:1031 ms_run[2]:scan=27719 80.068 2 1781.0662 1781.0662 R Q 686 702 PSM LPEGDLGKEIEQK 1482 sp|P63241|IF5A1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 8-UNIMOD:1031 ms_run[2]:scan=19903 58.865 2 1650.8829 1650.8829 R Y 114 127 PSM LPLQDVYKIGGIGTVPVGR 1483 sp|Q5VTE0|EF1A3_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 8-UNIMOD:1031 ms_run[2]:scan=31678 91.148 3 2177.2572 2177.2572 R V 248 267 PSM LTDFGLSKESIDHEK 1484 sp|P51812|KS6A3_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 8-UNIMOD:1031,15-UNIMOD:1031 ms_run[2]:scan=22517 65.831 2 1921.9877 1921.9877 K K 209 224 PSM LTEDPEKQTLPGSK 1485 sp|Q6XQN6-3|PNCB_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 7-UNIMOD:1031 ms_run[2]:scan=17049 51.365 2 1737.9149 1737.9149 K A 408 422 PSM MAVTFIGNSTAIQELFK 1486 sp|P07437|TBB5_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 1-UNIMOD:35,17-UNIMOD:259 ms_run[2]:scan=31885 91.739 2 1892.9797 1892.9797 K R 363 380 PSM MSKSTGNFLTLTQAIDK 1487 sp|Q9P2J5|SYLC_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 1-UNIMOD:35,3-UNIMOD:1031 ms_run[2]:scan=28593 82.473 2 2066.0718 2066.0718 K F 717 734 PSM NKSTESLQANVQR 1488 sp|P26373|RL13_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 2-UNIMOD:1031 ms_run[2]:scan=14175 43.806 2 1669.8747 1669.8747 R L 104 117 PSM NLGTIAKSGTSEFLNK 1489 sp|P14625|ENPL_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 7-UNIMOD:1031 ms_run[2]:scan=26939 77.873 2 1875.0102 1875.0102 K M 162 178 PSM NPDDITNEEYGEFYK 1490 sp|P07900|HS90A_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 ms_run[2]:scan=17755 53.218 2 1832.7741 1832.7741 R S 300 315 PSM PKEAFSDGITSVK 1491 sp|P08243-3|ASNS_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 2-UNIMOD:1031 ms_run[2]:scan=20499 60.443 2 1573.8352 1573.8352 R N 383 396 PSM PLAKDLLHPSPEEEK 1492 sp|P42677|RS27_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 4-UNIMOD:1031 ms_run[2]:scan=21193 62.312 3 1898.0149 1898.0149 M R 2 17 PSM QATKDAGVIAGLNVLR 1493 sp|P0DMV9|HS71B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 4-UNIMOD:1031 ms_run[2]:scan=28670 82.678 2 1821.0472 1821.0472 R I 156 172 PSM QKLEAQLTENNIVK 1494 sp|O15212|PFD6_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 2-UNIMOD:1031 ms_run[2]:scan=21928 64.263 2 1823.0153 1823.0153 R E 31 45 PSM SAPELKTGISDVFAK 1495 sp|P19338|NUCL_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 6-UNIMOD:1031 ms_run[2]:scan=28033 80.933 2 1757.9564 1757.9564 K N 319 334 PSM SGSKAFLDALQNQAEASSK 1496 sp|Q12931-2|TRAP1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 4-UNIMOD:1031 ms_run[2]:scan=26738 77.304 3 2147.0859 2147.0859 R I 125 144 PSM SGTPMQSAAKAPYLAK 1497 sp|A4QPH2-4|PI4P2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 5-UNIMOD:35,10-UNIMOD:1031 ms_run[2]:scan=17377 52.222 2 1831.9502 1831.9502 K F 258 274 PSM SHEAEVLKQLAEK 1498 sp|P16949|STMN1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 8-UNIMOD:1031 ms_run[2]:scan=20608 60.729 2 1676.9097 1676.9097 K R 63 76 PSM SIGAAAKSQVISNAK 1499 sp|P34932|HSP74_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 7-UNIMOD:1031 ms_run[2]:scan=19677 58.274 2 1639.9257 1639.9257 R N 47 62 PSM SKVTVDTGVIPASEEK 1500 sp|O60841|IF2P_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 2-UNIMOD:1031 ms_run[2]:scan=20773 61.163 2 1854.9939 1854.9939 K A 283 299 PSM SLYYYIQQDTKGDYQK 1501 sp|P07355|ANXA2_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 11-UNIMOD:1031 ms_run[2]:scan=24062 69.951 2 2208.0739 2208.0739 K A 314 330 PSM SQIFSTASDNQPTVTIK 1502 sp|P11021|BIP_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 17-UNIMOD:259 ms_run[2]:scan=17677 53.008 2 1843.9407 1843.9407 K V 448 465 PSM SQVFSTAADGQTQVEIK 1503 sp|P38646|GRP75_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 17-UNIMOD:259 ms_run[2]:scan=15635 47.617 2 1815.9094 1815.9094 K V 469 486 PSM SSGMSSLLGKIGAK 1504 sp|Q9UEE9|CFDP1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 4-UNIMOD:35,10-UNIMOD:1031 ms_run[2]:scan=23940 69.617 2 1546.8389 1546.8389 R K 221 235 PSM SYCAEIAHNVSSK 1505 sp|P62910|RL32_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 3-UNIMOD:4,13-UNIMOD:259 ms_run[2]:scan=8176 27.813 2 1472.6809 1472.6809 K N 94 107 PSM SYELPDGQVITIGNER 1506 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 ms_run[2]:scan=23351 68.048 2 1789.8846 1789.8846 K F 239 255 PSM TAYGPNGMNKMVINHLEK 1507 sp|P50990-2|TCPQ_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 8-UNIMOD:35,10-UNIMOD:1031 ms_run[2]:scan=19124 56.82 3 2228.1082 2228.1082 R L 26 44 PSM TDTLEDLFPTTKIPNPR 1508 sp|P13010|XRCC5_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 12-UNIMOD:1031 ms_run[2]:scan=32004 92.089 2 2153.1368 2153.1368 K F 470 487 PSM THINIVVIGHVDSGK 1509 sp|Q5VTE0|EF1A3_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 ms_run[2]:scan=14746 45.298 3 1587.8733 1587.8733 K S 6 21 PSM THINIVVIGHVDSGK 1510 sp|Q5VTE0|EF1A3_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 15-UNIMOD:259 ms_run[2]:scan=14748 45.303 3 1595.8875 1595.8875 K S 6 21 PSM TLAQLNPESSLFIIASK 1511 sp|P06744|G6PI_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 17-UNIMOD:259 ms_run[2]:scan=30771 88.582 2 1839.0233 1839.0233 K T 195 212 PSM TLDVAVKNSGGFLSK 1512 sp|A0FGR8-5|ESYT2_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 7-UNIMOD:1031 ms_run[2]:scan=25075 72.719 2 1730.9567 1730.9567 R D 276 291 PSM TLVIKEVSSEDIADMHSNLSNYHQYIVK 1513 sp|Q8TBX8|PI42C_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 5-UNIMOD:1031 ms_run[2]:scan=28783 82.991 3 3428.7286 3428.7286 R C 148 176 PSM TLVLLMGKEGVHGGLINK 1514 sp|P07737|PROF1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 8-UNIMOD:1031 ms_run[2]:scan=28406 81.955 2 2074.1973 2074.1973 K K 109 127 PSM TLVSVTKEGLELPEDEEEK 1515 sp|P07900|HS90A_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 7-UNIMOD:1031 ms_run[2]:scan=27871 80.485 3 2340.1948 2340.1948 K K 540 559 PSM TLVVHEKADDLGK 1516 sp|P00441|SODC_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 7-UNIMOD:1031 ms_run[2]:scan=16830 50.787 2 1619.8883 1619.8883 R G 117 130 PSM TNEKVELQELNDR 1517 sp|P08670|VIME_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 4-UNIMOD:1031 ms_run[2]:scan=20653 60.848 2 1782.9112 1782.9112 R F 101 114 PSM TPALKYQQLFEDIR 1518 sp|P33991|MCM4_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 5-UNIMOD:1031 ms_run[2]:scan=32086 92.316 2 1917.036 1917.0360 K G 815 829 PSM TPSDVKELVLDNSR 1519 sp|P39687|AN32A_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 6-UNIMOD:1031 ms_run[2]:scan=27339 78.993 2 1767.9367 1767.9367 R S 15 29 PSM TQLEELEDELQATEDAK 1520 sp|P35579|MYH9_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 ms_run[2]:scan=25503 73.906 2 1960.9113 1960.9113 K L 1539 1556 PSM TSGHVDKFADFMVK 1521 sp|P41250|GARS_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 7-UNIMOD:1031,12-UNIMOD:35 ms_run[2]:scan=22688 66.285 2 1792.8818 1792.8818 K D 191 205 PSM TSGNVEDDLIIFPDDCEFKR 1522 sp|Q16186|ADRM1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 16-UNIMOD:4,19-UNIMOD:1031 ms_run[2]:scan=31637 91.03 3 2565.2057 2565.2057 R V 65 85 PSM TSIMSKQYGNEVFLAK 1523 sp|P50990-2|TCPQ_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 4-UNIMOD:35,6-UNIMOD:1031 ms_run[2]:scan=23210 67.671 3 2027.0398 2027.0398 R L 147 163 PSM TSIMSKQYGNEVFLAK 1524 sp|P50990-2|TCPQ_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 4-UNIMOD:35,6-UNIMOD:1031 ms_run[2]:scan=25558 74.057 2 2027.0398 2027.0398 R L 147 163 PSM TVDFTQDSNYLLTGGQDK 1525 sp|Q9Y3F4|STRAP_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 18-UNIMOD:259 ms_run[2]:scan=22344 65.376 2 2008.9469 2008.9469 K L 105 123 PSM TVGALQVLGTEAQSSLLK 1526 sp|P78527-2|PRKDC_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 18-UNIMOD:259 ms_run[2]:scan=28237 81.489 2 1822.0291 1822.0291 R A 1275 1293 PSM TYDATTHFETTCDDIK 1527 sp|P50395-2|GDIB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 12-UNIMOD:4,16-UNIMOD:259 ms_run[2]:scan=11960 37.916 3 1924.824 1924.8240 R N 358 374 PSM VAQPKEVYQQQQYGSGGR 1528 sp|Q99729-3|ROAA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 5-UNIMOD:1031 ms_run[2]:scan=15888 48.295 2 2218.1131 2218.1131 K G 228 246 PSM VCENIPIVLCGNKVDIK 1529 sp|P62826|RAN_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 2-UNIMOD:4,10-UNIMOD:4,13-UNIMOD:1031 ms_run[2]:scan=28897 83.31 2 2166.1541 2166.1541 R D 111 128 PSM VDDSSEDKTEFTVK 1530 sp|P49588|SYAC_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 8-UNIMOD:1031 ms_run[2]:scan=19153 56.894 2 1794.8523 1794.8523 K N 551 565 PSM VDQSAVGFEYQGKTEK 1531 sp|Q14247|SRC8_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 13-UNIMOD:1031 ms_run[2]:scan=19328 57.351 2 1980.9793 1980.9793 R H 132 148 PSM VETGVLKPGMVVTFAPVNVTTEVK 1532 sp|Q5VTE0|EF1A3_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 7-UNIMOD:1031,10-UNIMOD:35 ms_run[2]:scan=31335 90.177 3 2726.4928 2726.4928 R S 267 291 PSM VFEVNASNLEKQTSK 1533 sp|Q9P2J5|SYLC_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 11-UNIMOD:1031 ms_run[2]:scan=21323 62.663 2 1888.9894 1888.9894 R G 29 44 PSM VGGTSDVEVNEKK 1534 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 12-UNIMOD:1031 ms_run[2]:scan=12781 40.125 2 1556.8046 1556.8046 K D 406 419 PSM VGINYQPPTVVPGGDLAKVQR 1535 sp|P68363|TBA1B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 18-UNIMOD:1031 ms_run[2]:scan=26874 77.69 2 2403.3274 2403.3274 K A 353 374 PSM VILHLKEDQTEYLEER 1536 sp|P07900|HS90A_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 6-UNIMOD:1031 ms_run[2]:scan=23539 68.554 3 2210.1583 2210.1583 K R 186 202 PSM VIVCNTKLDNNWGR 1537 sp|P17931|LEG3_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 4-UNIMOD:4,7-UNIMOD:1031 ms_run[2]:scan=22846 66.701 2 1883.9676 1883.9676 R E 170 184 PSM VLGTGAYGKVFLVR 1538 sp|O75676-2|KS6A4_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 9-UNIMOD:1031 ms_run[2]:scan=29245 84.276 2 1674.9821 1674.9821 K K 38 52 PSM VLKQVHPDTGISSK 1539 sp|P62807|H2B1C_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 3-UNIMOD:1031 ms_run[2]:scan=14765 45.346 2 1703.957 1703.9570 K A 45 59 PSM VPTANVSVVDLTCR 1540 sp|P04406|G3P_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 13-UNIMOD:4 ms_run[2]:scan=19570 57.995 2 1529.7872 1529.7872 R L 235 249 PSM VPTANVSVVDLTCR 1541 sp|P04406|G3P_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 13-UNIMOD:4,14-UNIMOD:267 ms_run[2]:scan=19593 58.057 2 1539.7954 1539.7954 R L 235 249 PSM VSAKNALESYAFNMK 1542 sp|P0DMV9|HS71B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 4-UNIMOD:1031 ms_run[2]:scan=28697 82.751 2 1867.9502 1867.9502 R S 536 551 PSM VSQEHPVVLTKFVEGAR 1543 sp|P31327|CPSM_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 11-UNIMOD:1031 ms_run[2]:scan=24953 72.349 3 2091.1477 2091.1477 R E 1158 1175 PSM VTEGLTDVILYHQPDDKK 1544 sp|O60506|HNRPQ_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 18-UNIMOD:1031 ms_run[2]:scan=24226 70.387 3 2266.1845 2266.1845 K K 266 284 PSM VVADGAGLPGEDWVFVSSKDADLTDTAQTR 1545 sp|Q13630|FCL_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 19-UNIMOD:1031 ms_run[2]:scan=33117 95.46 3 3315.6259 3315.6259 K A 26 56 PSM VVFEQTKVIADNVK 1546 sp|P60174-1|TPIS_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 7-UNIMOD:1031 ms_run[2]:scan=23831 69.329 2 1785.0036 1785.0036 K D 143 157 PSM YADLTEDQLPSCESLK 1547 sp|P18669|PGAM1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 12-UNIMOD:4 ms_run[2]:scan=18249 54.518 2 1867.851 1867.8510 R D 142 158 PSM YADLTEDQLPSCESLK 1548 sp|P18669|PGAM1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 12-UNIMOD:4,16-UNIMOD:259 ms_run[2]:scan=18252 54.529 2 1875.8652 1875.8652 R D 142 158 PSM YKYGYEIPVDMLCK 1549 sp|P60900-3|PSA6_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 2-UNIMOD:1031,13-UNIMOD:4 ms_run[2]:scan=29492 84.972 2 1973.9631 1973.9631 K R 24 38 PSM YVASYLLAALGGNSSPSAK 1550 sp|P05387|RLA2_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 36 ms_run[2]:scan=28839 83.146 2 1867.968 1867.9680 R D 3 22 PSM IGSSMKSVGEVMAIGR 1551 sp|P31327|CPSM_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 36 5-UNIMOD:35,6-UNIMOD:1031,12-UNIMOD:35 ms_run[1]:scan=21010 61.787413 2 1849.935376 1848.943755 R T 788 804 PSM DDDIAALVVDNGSGMCKAGFAGDDAPR 1552 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 36 1-UNIMOD:1,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=31956 91.950207 3 2974.3413 2974.3432 M A 2 29 PSM EEEIAALVIDNGSGMCKAGFAGDDAPR 1553 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 36 15-UNIMOD:35,16-UNIMOD:4,17-UNIMOD:1031 ms_run[1]:scan=30742 88.498115 3 3005.4172 3004.3902 M A 2 29 PSM TSIMSKQYGNEVFLAK 1554 sp|P50990|TCPQ_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 36 4-UNIMOD:35,6-UNIMOD:1031 ms_run[1]:scan=26079 75.464543 2 2028.042265 2027.039764 R L 166 182 PSM KILATPPQEDAPSVDIANIR 1555 sp|P29401|TKT_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 36 1-UNIMOD:1031 ms_run[1]:scan=26956 77.918533 3 2344.280400 2343.279811 K M 283 303 PSM ALCNGDSKLENAGGDLK 1556 sp|P49915|GUAA_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 36 1-UNIMOD:1,3-UNIMOD:4,8-UNIMOD:1031 ms_run[1]:scan=25264 73.256739 2 1998.9663 1998.9675 M D 2 19 PSM LLLQVQHASKQITADK 1557 sp|P05141|ADT2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 36 10-UNIMOD:1031 ms_run[1]:scan=20407 60.201423 3 1988.143456 1988.141861 K Q 34 50 PSM TSGHVDKFADFMVK 1558 sp|P41250|GARS_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 36 7-UNIMOD:1031 ms_run[1]:scan=25440 73.736615 2 1776.898704 1776.886892 K D 191 205 PSM TLAQLNPESSLFIIASK 1559 sp|P06744|G6PI_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 36 ms_run[1]:scan=30758 88.545263 2 1831.006231 1831.009115 K T 195 212 PSM KYDAFLASESLIK 1560 sp|P62906|RL10A_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 36 1-UNIMOD:1031 ms_run[1]:scan=28982 83.547928 2 1679.918937 1679.913424 K Q 106 119 PSM NQQITHANNTVSNFKR 1561 sp|Q92598|HS105_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 36 15-UNIMOD:1031 ms_run[1]:scan=14732 45.26133 3 2067.053765 2067.060985 K F 54 70 PSM AVVPAKYLDEDTIYHLQPSGR 1562 sp|P31153|METK2_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 36 6-UNIMOD:1031 ms_run[1]:scan=27067 78.225292 3 2568.338456 2567.338389 K F 229 250 PSM EELGTVNGMTITMVGDLKHGR 1563 sp|P27708|PYR1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 36 18-UNIMOD:1031 ms_run[1]:scan=30280 87.162994 3 2454.255602 2453.240665 R T 2065 2086 PSM GVLMYGPPGTGKTLLAR 1564 sp|P17980|PRS6A_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 36 4-UNIMOD:35,12-UNIMOD:1031 ms_run[1]:scan=26887 77.72596 2 1942.068964 1942.071005 K A 222 239 PSM EKEEFAVPENSSVQQFK 1565 sp|Q9UMX0|UBQL1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 36 2-UNIMOD:1031 ms_run[1]:scan=22692 66.295417 2 2192.082929 2191.079714 K E 46 63 PSM HSQFIGYPITLYLEK 1566 sp|Q58FF7|H90B3_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 36 15-UNIMOD:259 ms_run[1]:scan=27288 78.830911 2 1815.961266 1815.965071 K E 184 199 PSM NPDDITNEEYGEFYK 1567 sp|P07900|HS90A_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 36 15-UNIMOD:259 ms_run[1]:scan=17765 53.245261 2 1840.785519 1840.788288 R S 300 315 PSM NLGTIAKSGTSEFLNK 1568 sp|P14625|ENPL_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 36 7-UNIMOD:1031 ms_run[1]:scan=29043 83.715715 2 1874.011084 1875.010178 K M 162 178 PSM NLGTIAKSGTSEFLNK 1569 sp|P14625|ENPL_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 36 7-UNIMOD:1031 ms_run[1]:scan=29155 84.022944 2 1874.011084 1875.010178 K M 162 178 PSM INLEKCQTSMDELLK 1570 sp|O95747|OXSR1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 36 5-UNIMOD:1031,6-UNIMOD:4 ms_run[1]:scan=27512 79.492565 2 2016.029398 2017.022399 R E 48 63 PSM AAEDDEDDDVDTKK 1571 sp|P06454-2|PTMA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35 13-UNIMOD:1031 ms_run[2]:scan=11040 35.453 2 1760.7588 1760.7588 R Q 90 104 PSM ADLINNLGTIAKSGTK 1572 sp|P07900|HS90A_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35 12-UNIMOD:1031 ms_run[2]:scan=26834 77.573 3 1811.0153 1811.0153 K A 101 117 PSM ADLINNLGTIAKSGTK 1573 sp|P07900|HS90A_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35 12-UNIMOD:1031 ms_run[2]:scan=27227 78.659 2 1811.0153 1811.0153 K A 101 117 PSM AELLDNEKPAAVVAPITTGYTVK 1574 sp|Q9HB71|CYBP_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35 8-UNIMOD:1031 ms_run[2]:scan=29898 86.099 3 2595.416 2595.4160 K I 52 75 PSM AFLDALQNQAEASSK 1575 sp|Q12931-2|TRAP1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35 15-UNIMOD:259 ms_run[2]:scan=19864 58.763 2 1599.7984 1599.7984 K I 129 144 PSM AGEKGVAYTLLTPK 1576 sp|Q86XP3-2|DDX42_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35 4-UNIMOD:1031 ms_run[2]:scan=25356 73.509 2 1642.9294 1642.9294 R D 473 487 PSM AGIKVTVAGLAGK 1577 sp|Q99497|PARK7_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35 4-UNIMOD:1031 ms_run[2]:scan=24507 71.143 2 1379.85 1379.8500 R D 29 42 PSM AKGSETPGATPGSK 1578 sp|O75533|SF3B1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35 2-UNIMOD:1031 ms_run[2]:scan=9019 30.042 2 1482.7678 1482.7678 R I 239 253 PSM AKWDAWNALGSLPK 1579 sp|O75521-2|ECI2_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35 2-UNIMOD:1031 ms_run[2]:scan=32375 93.232 2 1751.9359 1751.9359 K E 56 70 PSM ALASQLQDSLKDLK 1580 sp|P18206-2|VINC_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35 11-UNIMOD:1031 ms_run[2]:scan=26473 76.53 2 1724.9672 1724.9673 R A 571 585 PSM ALELDHKNAQAQQEFK 1581 sp|Q99615-2|DNJC7_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35 7-UNIMOD:1031 ms_run[2]:scan=18156 54.272 3 2065.0593 2065.0593 R N 66 82 PSM ALGKSTVVPVPYEK 1582 sp|P78347-2|GTF2I_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35 4-UNIMOD:1031 ms_run[2]:scan=24073 69.981 2 1682.9607 1682.9607 K M 127 141 PSM ALQASALKAWGGK 1583 sp|P04075|ALDOA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35 8-UNIMOD:1031 ms_run[2]:scan=24094 70.039 2 1495.8511 1495.8511 R K 305 318 PSM APSAKGTISAPGK 1584 sp|Q13428-6|TCOF_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35 5-UNIMOD:1031 ms_run[2]:scan=14089 43.578 2 1379.7773 1379.7773 R V 799 812 PSM AQAAAPASVPAQAPKR 1585 sp|P47914|RL29_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35 15-UNIMOD:1031 ms_run[2]:scan=14132 43.693 2 1728.9635 1728.9635 K T 135 151 PSM ATVASSTQKFQDLGVK 1586 sp|Q9UHD8-7|SEPT9_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35 9-UNIMOD:1031 ms_run[2]:scan=24010 69.812 2 1875.0102 1875.0102 R N 35 51 PSM AVDIPHMDIEALKK 1587 sp|P62906|RL10A_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35 13-UNIMOD:1031 ms_run[2]:scan=27199 78.581 2 1774.9651 1774.9651 K L 79 93 PSM AVHISNPKTAEFQVAR 1588 sp|Q9NSD9-2|SYFB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35 8-UNIMOD:1031 ms_run[2]:scan=20367 60.096 3 1963.0639 1963.0639 K T 337 353 PSM AVKYVECSALTQK 1589 sp|P60953|CDC42_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35 3-UNIMOD:1031,7-UNIMOD:4 ms_run[2]:scan=18982 56.448 2 1691.8916 1691.8916 K G 151 164 PSM AVLLGPPGAGKGTQAPR 1590 sp|P54819-3|KAD2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35 11-UNIMOD:1031 ms_run[2]:scan=20955 61.641 3 1785.0261 1785.0261 R L 18 35 PSM AVLLGPPGAGKGTQAPR 1591 sp|P54819-3|KAD2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35 11-UNIMOD:1031 ms_run[2]:scan=21074 61.98 3 1785.0261 1785.0261 R L 18 35 PSM AVLLGPPGAGKGTQAPR 1592 sp|P54819-3|KAD2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35 11-UNIMOD:1031 ms_run[2]:scan=21202 62.337 3 1785.0261 1785.0261 R L 18 35 PSM CELLYEGPPDDEAAMGIKSCDPK 1593 sp|P13639|EF2_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35 1-UNIMOD:4,18-UNIMOD:1031,20-UNIMOD:4 ms_run[2]:scan=26412 76.362 3 2790.2551 2790.2551 R G 369 392 PSM CPDIATQLAGTKK 1594 sp|P48637-2|GSHB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35 1-UNIMOD:4,12-UNIMOD:1031 ms_run[2]:scan=20718 61.018 2 1597.8498 1597.8498 K V 183 196 PSM CSKICEPGYSPTYK 1595 sp|P07858|CATB_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35 1-UNIMOD:4,3-UNIMOD:1031,5-UNIMOD:4 ms_run[2]:scan=17672 52.996 2 1884.875 1884.8750 K Q 207 221 PSM DAFPVAGQKLIYAGK 1596 sp|P54727|RD23B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35 9-UNIMOD:1031 ms_run[2]:scan=27931 80.651 2 1772.9825 1772.9825 K I 37 52 PSM DCEECIQLEPTFIKGYTR 1597 sp|P31948|STIP1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35 2-UNIMOD:4,5-UNIMOD:4,14-UNIMOD:1031 ms_run[2]:scan=30330 87.299 3 2454.1559 2454.1559 K K 416 434 PSM DEFEGLFKQPAENVNQYLTDPK 1598 sp|P22314-2|UBA1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35 8-UNIMOD:1031 ms_run[2]:scan=32858 94.695 3 2777.3548 2777.3548 R F 610 632 PSM DGLLENQTPEFFQDVCKPK 1599 sp|P49327|FAS_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35 16-UNIMOD:4,17-UNIMOD:1031 ms_run[2]:scan=30565 88.007 3 2460.1995 2460.1995 R Y 1977 1996 PSM DIKAANVLLSEHGEVK 1600 sp|Q9Y6E0-2|STK24_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35 3-UNIMOD:1031 ms_run[2]:scan=23508 68.469 2 1918.0524 1918.0524 R L 144 160 PSM DIKAGNILLTEPGQVK 1601 sp|Q7L7X3-3|TAOK1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35 3-UNIMOD:1031 ms_run[2]:scan=27149 78.448 2 1891.0779 1891.0779 R L 151 167 PSM DIKAGNILLTEPGQVK 1602 sp|Q7L7X3-3|TAOK1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35 3-UNIMOD:1031,16-UNIMOD:1031 ms_run[2]:scan=27025 78.11 2 1899.0921 1899.0921 R L 151 167 PSM DIKGANILLTDHGDVK 1603 sp|Q9Y4K4|M4K5_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35 3-UNIMOD:1031 ms_run[2]:scan=24187 70.284 3 1904.0367 1904.0367 R L 140 156 PSM DLADELALVDVIEDKLK 1604 sp|P00338|LDHA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35 15-UNIMOD:1031 ms_run[2]:scan=33951 97.672 3 2094.146 2094.1460 K G 43 60 PSM DLKLDNVLLDSEGHIK 1605 sp|P41743|KPCI_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35 3-UNIMOD:1031 ms_run[2]:scan=28858 83.2 3 2004.0892 2004.0892 R L 378 394 PSM DLKPENLLYYSQDEESK 1606 sp|Q8IU85-2|KCC1D_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35 3-UNIMOD:1031 ms_run[2]:scan=27917 80.613 2 2266.1005 2266.1005 R I 144 161 PSM DLKPENVLLDAHMNAK 1607 sp|Q13131|AAPK1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35 3-UNIMOD:1031,13-UNIMOD:35 ms_run[2]:scan=23371 68.103 3 2019.0459 2019.0459 R I 150 166 PSM DLKPENVLLSSQEEDCLIK 1608 sp|O96017-13|CHK2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35 3-UNIMOD:1031,16-UNIMOD:4 ms_run[2]:scan=30430 87.633 3 2425.241 2425.2410 R I 126 145 PSM DLKPGNLAVNEDCELK 1609 sp|P53778-2|MK12_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35 3-UNIMOD:1031,13-UNIMOD:4 ms_run[2]:scan=23309 67.938 2 2010.0092 2010.0092 R I 143 159 PSM DLKPSNILYVDESGNPECLR 1610 sp|Q15418-4|KS6A1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35 3-UNIMOD:1031,18-UNIMOD:4 ms_run[2]:scan=28655 82.64 3 2514.2424 2514.2424 R I 519 539 PSM DLKVENLLLSNQGTIK 1611 sp|O14976|GAK_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35 3-UNIMOD:1031 ms_run[2]:scan=31415 90.402 2 1980.1255 1980.1255 R L 173 189 PSM DLSDGIHVVKDAR 1612 sp|Q07065|CKAP4_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35 10-UNIMOD:1031 ms_run[2]:scan=21625 63.462 2 1619.8631 1619.8631 K E 214 227 PSM DVLFLKDCVGPEVEK 1613 sp|P00558|PGK1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35 6-UNIMOD:1031,8-UNIMOD:4 ms_run[2]:scan=30324 87.285 2 1943.0074 1943.0074 K A 92 107 PSM DVVNVYEPQLQHHVAQKK 1614 sp|Q16222-2|UAP1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001583, MaxQuant, ] 35 18-UNIMOD:1031 ms_run[2]:scan=17999 53.8