MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000200 -- main
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20200325\20200325191219627270^10.242.132.111^jpost@jpost.jpost\PeakList.MaxQuantPlist1\150211tk04-whole_2m8h-5.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20200325\20200325191219627270^10.242.132.111^jpost@jpost.jpost\Psearch.MaxQuantExec1\150211tk04-whole_2m8h-5.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.2.10]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[1]-setting	enzymes=Trypsin+Lys-C
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Oxidation (M)
MTD	software[1]-setting	maxMissedCleavages=1
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[R]|{P},[K]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=20
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=1
MTD	software[3]	[MS, MS:1002251, Comet, 2015.02 rev. 0]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Oxidation (M)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=1
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[1]-site	M
MTD	variable_mod[1]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P26599|PTBP1_HUMAN	Polypyrimidine tract-binding protein 1 OS=Homo sapiens OX=9606 GN=PTBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	91.0	null	175-UNIMOD:35	0.21	91.0	26	3	0
PRT	sp|P04406|G3P_HUMAN	Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	86.0	null		0.36	86.0	57	4	2
PRT	sp|Q16881-7|TRXR1_HUMAN	Isoform 7 of Thioredoxin reductase 1, cytoplasmic OS=Homo sapiens OX=9606 GN=TXNRD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	78.0	null		0.08	78.0	4	1	0
PRT	sp|Q01105-3|SET_HUMAN	Isoform 3 of Protein SET OS=Homo sapiens OX=9606 GN=SET	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	74.0	null		0.12	74.0	16	1	0
PRT	sp|P04179-4|SODM_HUMAN	Isoform 4 of Superoxide dismutase [Mn], mitochondrial OS=Homo sapiens OX=9606 GN=SOD2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	71.0	null	118-UNIMOD:4	0.23	71.0	7	2	1
PRT	sp|Q9NTJ3-2|SMC4_HUMAN	Isoform 2 of Structural maintenance of chromosomes protein 4 OS=Homo sapiens OX=9606 GN=SMC4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	71.0	null		0.05	71.0	4	2	0
PRT	sp|P22234|PUR6_HUMAN	Multifunctional protein ADE2 OS=Homo sapiens OX=9606 GN=PAICS PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	69.0	null	374-UNIMOD:4,63-UNIMOD:4	0.13	69.0	4	2	1
PRT	sp|P22314-2|UBA1_HUMAN	Isoform 2 of Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	68.0	null	708-UNIMOD:4	0.06	68.0	8	2	0
PRT	sp|P36776-3|LONM_HUMAN	Isoform 3 of Lon protease homolog, mitochondrial OS=Homo sapiens OX=9606 GN=LONP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	68.0	null		0.06	68.0	7	2	0
PRT	sp|P05787|K2C8_HUMAN	Keratin, type II cytoskeletal 8 OS=Homo sapiens OX=9606 GN=KRT8 PE=1 SV=7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	67.0	null	60-UNIMOD:35,226-UNIMOD:28	0.23	67.0	12	3	2
PRT	sp|P62263|RS14_HUMAN	40S ribosomal protein S14 OS=Homo sapiens OX=9606 GN=RPS14 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	67.0	null	31-UNIMOD:4	0.28	67.0	6	2	0
PRT	sp|P14174|MIF_HUMAN	Macrophage migration inhibitory factor OS=Homo sapiens OX=9606 GN=MIF PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	67.0	null	57-UNIMOD:4,60-UNIMOD:4,48-UNIMOD:35	0.49	67.0	38	1	0
PRT	sp|P34897-3|GLYM_HUMAN	Isoform 3 of Serine hydroxymethyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=SHMT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	66.0	null		0.08	66.0	5	1	0
PRT	sp|P11586|C1TC_HUMAN	C-1-tetrahydrofolate synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=MTHFD1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	66.0	null	408-UNIMOD:4	0.07	66.0	8	2	0
PRT	sp|Q71DI3|H32_HUMAN	Histone H3.2 OS=Homo sapiens OX=9606 GN=HIST2H3A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	66.0	null	111-UNIMOD:4,91-UNIMOD:35	0.24	66.0	14	1	0
PRT	sp|Q16881|TRXR1_HUMAN	Thioredoxin reductase 1, cytoplasmic OS=Homo sapiens OX=9606 GN=TXNRD1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	65.0	null		0.06	65.0	4	1	0
PRT	sp|P20674|COX5A_HUMAN	Cytochrome c oxidase subunit 5A, mitochondrial OS=Homo sapiens OX=9606 GN=COX5A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	64.0	null		0.21	64.0	10	1	0
PRT	sp|P68431|H31_HUMAN	Histone H3.1 OS=Homo sapiens OX=9606 GN=H3C1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	64.0	null	97-UNIMOD:4,111-UNIMOD:4,91-UNIMOD:35	0.24	64.0	15	1	0
PRT	sp|P31040|SDHA_HUMAN	Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Homo sapiens OX=9606 GN=SDHA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	64.0	null		0.05	64.0	5	1	0
PRT	sp|Q9Y490|TLN1_HUMAN	Talin-1 OS=Homo sapiens OX=9606 GN=TLN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	64.0	null	2243-UNIMOD:4	0.03	64.0	8	4	1
PRT	sp|O75369-5|FLNB_HUMAN	Isoform 5 of Filamin-B OS=Homo sapiens OX=9606 GN=FLNB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	63.0	null	1087-UNIMOD:4,1095-UNIMOD:4	0.04	63.0	5	2	0
PRT	sp|Q12906|ILF3_HUMAN	Interleukin enhancer-binding factor 3 OS=Homo sapiens OX=9606 GN=ILF3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	63.0	null		0.04	63.0	1	1	0
PRT	sp|Q16836|HCDH_HUMAN	Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=HADH PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	62.0	null		0.19	62.0	11	2	0
PRT	sp|O43175|SERA_HUMAN	D-3-phosphoglycerate dehydrogenase OS=Homo sapiens OX=9606 GN=PHGDH PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	62.0	null	295-UNIMOD:385,295-UNIMOD:4	0.20	62.0	18	4	0
PRT	sp|O00487|PSDE_HUMAN	26S proteasome non-ATPase regulatory subunit 14 OS=Homo sapiens OX=9606 GN=PSMD14 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	61.0	null		0.11	61.0	3	1	0
PRT	sp|P04844|RPN2_HUMAN	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Homo sapiens OX=9606 GN=RPN2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	61.0	null		0.13	61.0	7	4	3
PRT	sp|O95336|6PGL_HUMAN	6-phosphogluconolactonase OS=Homo sapiens OX=9606 GN=PGLS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	61.0	null	156-UNIMOD:4	0.15	61.0	3	1	0
PRT	sp|P06744|G6PI_HUMAN	Glucose-6-phosphate isomerase OS=Homo sapiens OX=9606 GN=GPI PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	61.0	null	166-UNIMOD:35	0.13	61.0	18	3	1
PRT	sp|P04908|H2A1B_HUMAN	Histone H2A type 1-B/E OS=Homo sapiens OX=9606 GN=H2AC4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	61.0	null		0.23	61.0	1	1	1
PRT	sp|Q16719-2|KYNU_HUMAN	Isoform 2 of Kynureninase OS=Homo sapiens OX=9606 GN=KYNU	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	60.0	null		0.10	60.0	9	1	0
PRT	sp|P52306-6|GDS1_HUMAN	Isoform 6 of Rap1 GTPase-GDP dissociation stimulator 1 OS=Homo sapiens OX=9606 GN=RAP1GDS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	60.0	null	27-UNIMOD:4,30-UNIMOD:4,86-UNIMOD:4	0.10	60.0	3	2	1
PRT	sp|P09874|PARP1_HUMAN	Poly [ADP-ribose] polymerase 1 OS=Homo sapiens OX=9606 GN=PARP1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	60.0	null		0.03	60.0	3	1	0
PRT	sp|P13284|GILT_HUMAN	Gamma-interferon-inducible lysosomal thiol reductase OS=Homo sapiens OX=9606 GN=IFI30 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	60.0	null	226-UNIMOD:4,162-UNIMOD:4,178-UNIMOD:4,176-UNIMOD:35	0.26	60.0	10	2	0
PRT	sp|Q14697|GANAB_HUMAN	Neutral alpha-glucosidase AB OS=Homo sapiens OX=9606 GN=GANAB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	59.0	null		0.12	59.0	12	3	0
PRT	sp|O60610-2|DIAP1_HUMAN	Isoform 2 of Protein diaphanous homolog 1 OS=Homo sapiens OX=9606 GN=DIAPH1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	59.0	null	305-UNIMOD:4	0.04	59.0	3	2	1
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	59.0	null	40-UNIMOD:35,55-UNIMOD:35,316-UNIMOD:35	0.21	59.0	78	5	1
PRT	sp|Q13492-4|PICAL_HUMAN	Isoform 4 of Phosphatidylinositol-binding clathrin assembly protein OS=Homo sapiens OX=9606 GN=PICALM	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	59.0	null		0.07	59.0	3	2	1
PRT	sp|P37837|TALDO_HUMAN	Transaldolase OS=Homo sapiens OX=9606 GN=TALDO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	59.0	null		0.15	59.0	5	1	0
PRT	sp|Q9UJS0|CMC2_HUMAN	Calcium-binding mitochondrial carrier protein Aralar2 OS=Homo sapiens OX=9606 GN=SLC25A13 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	58.0	null	532-UNIMOD:35	0.06	58.0	5	1	0
PRT	sp|O43598-2|DNPH1_HUMAN	Isoform 2 of 2'-deoxynucleoside 5'-phosphate N-hydrolase 1 OS=Homo sapiens OX=9606 GN=DNPH1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	58.0	null		0.23	58.0	4	1	0
PRT	sp|O75367-3|H2AY_HUMAN	Isoform 3 of Core histone macro-H2A.1 OS=Homo sapiens OX=9606 GN=MACROH2A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	58.0	null		0.11	58.0	1	1	0
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	58.0	null	536-UNIMOD:4,557-UNIMOD:4,751-UNIMOD:4,741-UNIMOD:35,353-UNIMOD:35	0.15	58.0	103	6	1
PRT	sp|P23434|GCSH_HUMAN	Glycine cleavage system H protein, mitochondrial OS=Homo sapiens OX=9606 GN=GCSH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	57.0	null	85-UNIMOD:4	0.22	57.0	3	1	0
PRT	sp|P13797-3|PLST_HUMAN	Isoform 3 of Plastin-3 OS=Homo sapiens OX=9606 GN=PLS3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	57.0	null	164-UNIMOD:4,521-UNIMOD:4	0.13	57.0	9	3	1
PRT	sp|P52701-4|MSH6_HUMAN	Isoform 4 of DNA mismatch repair protein Msh6 OS=Homo sapiens OX=9606 GN=MSH6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	56.0	null		0.04	56.0	2	2	2
PRT	sp|P08195-2|4F2_HUMAN	Isoform 2 of 4F2 cell-surface antigen heavy chain OS=Homo sapiens OX=9606 GN=SLC3A2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	56.0	null		0.14	56.0	16	4	2
PRT	sp|P26641|EF1G_HUMAN	Elongation factor 1-gamma OS=Homo sapiens OX=9606 GN=EEF1G PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	56.0	null	68-UNIMOD:4,121-UNIMOD:35,339-UNIMOD:4	0.21	56.0	12	3	0
PRT	sp|P49368-2|TCPG_HUMAN	Isoform 2 of T-complex protein 1 subunit gamma OS=Homo sapiens OX=9606 GN=CCT3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	56.0	null	241-UNIMOD:4,232-UNIMOD:35	0.11	56.0	8	2	0
PRT	sp|P14866-2|HNRPL_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein L OS=Homo sapiens OX=9606 GN=HNRNPL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	56.0	null	388-UNIMOD:4	0.07	56.0	10	1	0
PRT	sp|P13804-2|ETFA_HUMAN	Isoform 2 of Electron transfer flavoprotein subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ETFA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	56.0	null	241-UNIMOD:35	0.18	56.0	6	2	0
PRT	sp|Q12906-5|ILF3_HUMAN	Isoform 5 of Interleukin enhancer-binding factor 3 OS=Homo sapiens OX=9606 GN=ILF3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	56.0	null		0.05	56.0	10	1	0
PRT	sp|P06576|ATPB_HUMAN	ATP synthase subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	56.0	null	443-UNIMOD:35	0.11	56.0	31	3	0
PRT	sp|P05386|RLA1_HUMAN	60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	56.0	null	2-UNIMOD:1,9-UNIMOD:4	0.24	56.0	1	1	1
PRT	sp|P49753|ACOT2_HUMAN	Acyl-coenzyme A thioesterase 2, mitochondrial OS=Homo sapiens OX=9606 GN=ACOT2 PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	55.0	null		0.11	55.0	3	2	1
PRT	sp|P56192|SYMC_HUMAN	Methionine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=MARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	55.0	null	566-UNIMOD:4	0.07	55.0	2	2	2
PRT	sp|Q27J81-2|INF2_HUMAN	Isoform 2 of Inverted formin-2 OS=Homo sapiens OX=9606 GN=INF2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	55.0	null		0.05	55.0	6	3	0
PRT	sp|O00264|PGRC1_HUMAN	Membrane-associated progesterone receptor component 1 OS=Homo sapiens OX=9606 GN=PGRMC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	55.0	null		0.16	55.0	4	1	0
PRT	sp|P27708|PYR1_HUMAN	CAD protein OS=Homo sapiens OX=9606 GN=CAD PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	55.0	null	1668-UNIMOD:28,1682-UNIMOD:4	0.03	55.0	4	2	1
PRT	sp|P27797|CALR_HUMAN	Calreticulin OS=Homo sapiens OX=9606 GN=CALR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	55.0	null		0.16	55.0	17	2	0
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	55.0	null	32-UNIMOD:35,161-UNIMOD:4,180-UNIMOD:4	0.07	55.0	28	6	1
PRT	sp|Q12849|GRSF1_HUMAN	G-rich sequence factor 1 OS=Homo sapiens OX=9606 GN=GRSF1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	55.0	null		0.11	55.0	10	2	0
PRT	sp|Q27J81|INF2_HUMAN	Inverted formin-2 OS=Homo sapiens OX=9606 GN=INF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	55.0	null	1129-UNIMOD:28	0.03	55.0	1	1	1
PRT	sp|O94766|B3GA3_HUMAN	Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 3 OS=Homo sapiens OX=9606 GN=B3GAT3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	55.0	null		0.13	55.0	1	1	1
PRT	sp|Q6FI13|H2A2A_HUMAN	Histone H2A type 2-A OS=Homo sapiens OX=9606 GN=HIST2H2AA3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	55.0	null		0.23	55.0	2	1	0
PRT	sp|Q7L1Q6-2|BZW1_HUMAN	Isoform 2 of Basic leucine zipper and W2 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=BZW1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	54.0	null	35-UNIMOD:4,96-UNIMOD:4	0.15	54.0	3	2	1
PRT	sp|Q99832-2|TCPH_HUMAN	Isoform 2 of T-complex protein 1 subunit eta OS=Homo sapiens OX=9606 GN=CCT7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	54.0	null	307-UNIMOD:4	0.17	54.0	4	2	0
PRT	sp|P55786-2|PSA_HUMAN	Isoform 2 of Puromycin-sensitive aminopeptidase OS=Homo sapiens OX=9606 GN=NPEPPS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	54.0	null		0.03	54.0	3	1	0
PRT	sp|P09622-2|DLDH_HUMAN	Isoform 2 of Dihydrolipoyl dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=DLD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	54.0	null		0.08	54.0	1	1	1
PRT	sp|P27824-3|CALX_HUMAN	Isoform 3 of Calnexin OS=Homo sapiens OX=9606 GN=CANX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	54.0	null	158-UNIMOD:35	0.08	54.0	2	1	0
PRT	sp|P18206-2|VINC_HUMAN	Isoform 1 of Vinculin OS=Homo sapiens OX=9606 GN=VCL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	54.0	null		0.03	54.0	6	1	0
PRT	sp|Q9Y5L0|TNPO3_HUMAN	Transportin-3 OS=Homo sapiens OX=9606 GN=TNPO3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	54.0	null	1-UNIMOD:1	0.05	54.0	3	2	1
PRT	sp|Q08945|SSRP1_HUMAN	FACT complex subunit SSRP1 OS=Homo sapiens OX=9606 GN=SSRP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	53.0	null	139-UNIMOD:4,252-UNIMOD:28	0.06	53.0	3	2	1
PRT	sp|P04040|CATA_HUMAN	Catalase OS=Homo sapiens OX=9606 GN=CAT PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	53.0	null		0.12	53.0	3	2	1
PRT	sp|P54819-6|KAD2_HUMAN	Isoform 6 of Adenylate kinase 2, mitochondrial OS=Homo sapiens OX=9606 GN=AK2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	53.0	null		0.14	53.0	7	2	0
PRT	sp|P13010|XRCC5_HUMAN	X-ray repair cross-complementing protein 5 OS=Homo sapiens OX=9606 GN=XRCC5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	53.0	null	633-UNIMOD:35,157-UNIMOD:4	0.17	53.0	17	5	1
PRT	sp|O00429-4|DNM1L_HUMAN	Isoform 3 of Dynamin-1-like protein OS=Homo sapiens OX=9606 GN=DNM1L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	53.0	null		0.10	53.0	7	3	0
PRT	sp|Q9BQG0|MBB1A_HUMAN	Myb-binding protein 1A OS=Homo sapiens OX=9606 GN=MYBBP1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	53.0	null	530-UNIMOD:28	0.08	53.0	15	4	0
PRT	sp|P26440-2|IVD_HUMAN	Isoform 2 of Isovaleryl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=IVD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	53.0	null		0.09	53.0	2	1	0
PRT	sp|P28340|DPOD1_HUMAN	DNA polymerase delta catalytic subunit OS=Homo sapiens OX=9606 GN=POLD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	53.0	null	617-UNIMOD:4	0.08	53.0	7	4	2
PRT	sp|P08237-2|PFKAM_HUMAN	Isoform 2 of ATP-dependent 6-phosphofructokinase, muscle type OS=Homo sapiens OX=9606 GN=PFKM	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	53.0	null	170-UNIMOD:4	0.04	53.0	1	1	1
PRT	sp|O75643|U520_HUMAN	U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens OX=9606 GN=SNRNP200 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	53.0	null	133-UNIMOD:4	0.10	53.0	18	9	3
PRT	sp|Q14240|IF4A2_HUMAN	Eukaryotic initiation factor 4A-II OS=Homo sapiens OX=9606 GN=EIF4A2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	52.0	null		0.08	52.0	2	1	0
PRT	sp|P55263-3|ADK_HUMAN	Isoform 3 of Adenosine kinase OS=Homo sapiens OX=9606 GN=ADK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	52.0	null	279-UNIMOD:4	0.17	52.0	4	2	0
PRT	sp|P05023-3|AT1A1_HUMAN	Isoform 3 of Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	52.0	null		0.05	52.0	6	2	0
PRT	sp|P52272|HNRPM_HUMAN	Heterogeneous nuclear ribonucleoprotein M OS=Homo sapiens OX=9606 GN=HNRNPM PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	52.0	null	274-UNIMOD:35	0.11	52.0	5	2	1
PRT	sp|Q15363|TMED2_HUMAN	Transmembrane emp24 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=TMED2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	52.0	null	133-UNIMOD:35	0.14	52.0	5	1	0
PRT	sp|P49321-2|NASP_HUMAN	Isoform 2 of Nuclear autoantigenic sperm protein OS=Homo sapiens OX=9606 GN=NASP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	52.0	null		0.05	52.0	7	1	0
PRT	sp|P07237|PDIA1_HUMAN	Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	52.0	null		0.06	52.0	3	1	0
PRT	sp|Q13363-2|CTBP1_HUMAN	Isoform 2 of C-terminal-binding protein 1 OS=Homo sapiens OX=9606 GN=CTBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	52.0	null	107-UNIMOD:4,123-UNIMOD:4	0.08	52.0	1	1	1
PRT	sp|P17987|TCPA_HUMAN	T-complex protein 1 subunit alpha OS=Homo sapiens OX=9606 GN=TCP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	52.0	null	76-UNIMOD:4	0.10	52.0	12	3	0
PRT	sp|P05783|K1C18_HUMAN	Keratin, type I cytoskeletal 18 OS=Homo sapiens OX=9606 GN=KRT18 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	52.0	null	335-UNIMOD:35	0.10	52.0	15	2	0
PRT	sp|P11498|PYC_HUMAN	Pyruvate carboxylase, mitochondrial OS=Homo sapiens OX=9606 GN=PC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	52.0	null		0.05	52.0	2	2	2
PRT	sp|P50991|TCPD_HUMAN	T-complex protein 1 subunit delta OS=Homo sapiens OX=9606 GN=CCT4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	52.0	null	458-UNIMOD:35	0.06	52.0	7	1	0
PRT	sp|P49321|NASP_HUMAN	Nuclear autoantigenic sperm protein OS=Homo sapiens OX=9606 GN=NASP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	52.0	null		0.03	52.0	1	1	0
PRT	sp|P41250|GARS_HUMAN	Glycine--tRNA ligase OS=Homo sapiens OX=9606 GN=GARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	51.0	null		0.04	51.0	7	1	0
PRT	sp|P48643-2|TCPE_HUMAN	Isoform 2 of T-complex protein 1 subunit epsilon OS=Homo sapiens OX=9606 GN=CCT5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	null	367-UNIMOD:35,375-UNIMOD:35	0.07	51.0	5	1	0
PRT	sp|P35579-2|MYH9_HUMAN	Isoform 2 of Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	null		0.02	51.0	3	1	0
PRT	sp|Q14137-2|BOP1_HUMAN	Isoform 2 of Ribosome biogenesis protein BOP1 OS=Homo sapiens OX=9606 GN=BOP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	null		0.04	51.0	3	1	0
PRT	sp|P78527-2|PRKDC_HUMAN	Isoform 2 of DNA-dependent protein kinase catalytic subunit OS=Homo sapiens OX=9606 GN=PRKDC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	null	1229-UNIMOD:4,1791-UNIMOD:4,630-UNIMOD:4	0.04	51.0	15	7	3
PRT	sp|O15355|PPM1G_HUMAN	Protein phosphatase 1G OS=Homo sapiens OX=9606 GN=PPM1G PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	null		0.06	51.0	2	2	2
PRT	sp|P20810-3|ICAL_HUMAN	Isoform 3 of Calpastatin OS=Homo sapiens OX=9606 GN=CAST	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	null		0.06	51.0	3	2	1
PRT	sp|P24752|THIL_HUMAN	Acetyl-CoA acetyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=ACAT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	51.0	null	335-UNIMOD:35	0.07	51.0	9	1	0
PRT	sp|Q96KG9-5|SCYL1_HUMAN	Isoform 5 of N-terminal kinase-like protein OS=Homo sapiens OX=9606 GN=SCYL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	null		0.10	51.0	2	2	1
PRT	sp|Q9Y678|COPG1_HUMAN	Coatomer subunit gamma-1 OS=Homo sapiens OX=9606 GN=COPG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	51.0	null	735-UNIMOD:4,420-UNIMOD:4,97-UNIMOD:4	0.11	51.0	5	4	3
PRT	sp|Q92552|RT27_HUMAN	28S ribosomal protein S27, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS27 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	null	367-UNIMOD:4	0.07	51.0	3	1	0
PRT	sp|P52292|IMA1_HUMAN	Importin subunit alpha-1 OS=Homo sapiens OX=9606 GN=KPNA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	null		0.11	51.0	8	2	1
PRT	sp|Q13813-3|SPTN1_HUMAN	Isoform 3 of Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	null		0.07	51.0	15	7	1
PRT	sp|P23588-2|IF4B_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 4B OS=Homo sapiens OX=9606 GN=EIF4B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	null		0.05	51.0	3	1	0
PRT	sp|P31939-2|PUR9_HUMAN	Isoform 2 of Bifunctional purine biosynthesis protein PURH OS=Homo sapiens OX=9606 GN=ATIC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	null	574-UNIMOD:4	0.10	51.0	7	2	0
PRT	sp|O75607|NPM3_HUMAN	Nucleoplasmin-3 OS=Homo sapiens OX=9606 GN=NPM3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	null	70-UNIMOD:4,79-UNIMOD:4	0.20	51.0	1	1	1
PRT	sp|P07814|SYEP_HUMAN	Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	null	381-UNIMOD:4	0.03	51.0	8	2	0
PRT	sp|P31947|1433S_HUMAN	14-3-3 protein sigma OS=Homo sapiens OX=9606 GN=SFN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	51.0	null	96-UNIMOD:4	0.21	51.0	11	3	1
PRT	sp|P21333|FLNA_HUMAN	Filamin-A OS=Homo sapiens OX=9606 GN=FLNA PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	51.0	null		0.03	51.0	8	3	1
PRT	sp|P31930|QCR1_HUMAN	Cytochrome b-c1 complex subunit 1, mitochondrial OS=Homo sapiens OX=9606 GN=UQCRC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	51.0	null	316-UNIMOD:4	0.13	51.0	4	1	0
PRT	sp|O75390|CISY_HUMAN	Citrate synthase, mitochondrial OS=Homo sapiens OX=9606 GN=CS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	null		0.07	50.0	4	1	0
PRT	sp|Q00610-2|CLH1_HUMAN	Isoform 2 of Clathrin heavy chain 1 OS=Homo sapiens OX=9606 GN=CLTC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	null	666-UNIMOD:4,1565-UNIMOD:4,1569-UNIMOD:4,1573-UNIMOD:4,996-UNIMOD:35	0.08	50.0	10	5	1
PRT	sp|Q96IR7|HPDL_HUMAN	4-hydroxyphenylpyruvate dioxygenase-like protein OS=Homo sapiens OX=9606 GN=HPDL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	null		0.11	50.0	6	2	0
PRT	sp|P32969|RL9_HUMAN	60S ribosomal protein L9 OS=Homo sapiens OX=9606 GN=RPL9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	null		0.15	50.0	4	1	0
PRT	sp|P47712|PA24A_HUMAN	Cytosolic phospholipase A2 OS=Homo sapiens OX=9606 GN=PLA2G4A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	50.0	null	38-UNIMOD:35	0.08	50.0	5	2	0
PRT	sp|Q96RP9|EFGM_HUMAN	Elongation factor G, mitochondrial OS=Homo sapiens OX=9606 GN=GFM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	null		0.05	50.0	1	1	1
PRT	sp|P56537|IF6_HUMAN	Eukaryotic translation initiation factor 6 OS=Homo sapiens OX=9606 GN=EIF6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	50.0	null	110-UNIMOD:4	0.14	50.0	5	1	0
PRT	sp|P00505-2|AATM_HUMAN	Isoform 2 of Aspartate aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=GOT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	null		0.07	50.0	1	1	0
PRT	sp|P09923|PPBI_HUMAN	Intestinal-type alkaline phosphatase OS=Homo sapiens OX=9606 GN=ALPI PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	50.0	null	202-UNIMOD:4,199-UNIMOD:28	0.20	50.0	21	5	0
PRT	sp|P29401|TKT_HUMAN	Transketolase OS=Homo sapiens OX=9606 GN=TKT PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	50.0	null		0.13	50.0	9	3	1
PRT	sp|P23921|RIR1_HUMAN	Ribonucleoside-diphosphate reductase large subunit OS=Homo sapiens OX=9606 GN=RRM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	null		0.07	50.0	5	2	0
PRT	sp|O14773-2|TPP1_HUMAN	Isoform 2 of Tripeptidyl-peptidase 1 OS=Homo sapiens OX=9606 GN=TPP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	null		0.09	50.0	2	1	0
PRT	sp|P60709|ACTB_HUMAN	Actin, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=ACTB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	50.0	null	217-UNIMOD:4,257-UNIMOD:4,272-UNIMOD:4	0.22	50.0	38	3	0
PRT	sp|Q71U36|TBA1A_HUMAN	Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	50.0	null	200-UNIMOD:4,213-UNIMOD:4,129-UNIMOD:4	0.19	50.0	9	3	1
PRT	sp|Q86V81|THOC4_HUMAN	THO complex subunit 4 OS=Homo sapiens OX=9606 GN=ALYREF PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	50.0	null		0.11	50.0	1	1	1
PRT	sp|Q14978-3|NOLC1_HUMAN	Isoform 3 of Nucleolar and coiled-body phosphoprotein 1 OS=Homo sapiens OX=9606 GN=NOLC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null		0.06	49.0	12	2	0
PRT	sp|P54136-2|SYRC_HUMAN	Isoform Monomeric of Arginine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=RARS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null		0.04	49.0	6	1	0
PRT	sp|P43243|MATR3_HUMAN	Matrin-3 OS=Homo sapiens OX=9606 GN=MATR3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	49.0	null	38-UNIMOD:35	0.10	49.0	6	3	1
PRT	sp|Q15056-2|IF4H_HUMAN	Isoform Short of Eukaryotic translation initiation factor 4H OS=Homo sapiens OX=9606 GN=EIF4H	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null		0.13	49.0	3	1	0
PRT	sp|P25705-2|ATPA_HUMAN	Isoform 2 of ATP synthase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null		0.05	49.0	5	1	0
PRT	sp|Q9NRH3|TBG2_HUMAN	Tubulin gamma-2 chain OS=Homo sapiens OX=9606 GN=TUBG2 PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null		0.06	49.0	2	1	0
PRT	sp|Q14980-4|NUMA1_HUMAN	Isoform 4 of Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null		0.02	49.0	5	1	0
PRT	sp|Q96ER9-2|MITOK_HUMAN	Isoform 2 of Mitochondrial potassium channel OS=Homo sapiens OX=9606 GN=CCDC51	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null		0.12	49.0	1	1	1
PRT	sp|O60828-7|PQBP1_HUMAN	Isoform 7 of Polyglutamine-binding protein 1 OS=Homo sapiens OX=9606 GN=PQBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null	60-UNIMOD:4	0.27	49.0	2	1	0
PRT	sp|Q86UE4|LYRIC_HUMAN	Protein LYRIC OS=Homo sapiens OX=9606 GN=MTDH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null		0.06	49.0	5	1	0
PRT	sp|P39210|MPV17_HUMAN	Protein Mpv17 OS=Homo sapiens OX=9606 GN=MPV17 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	49.0	null	27-UNIMOD:35	0.14	49.0	3	1	0
PRT	sp|Q92504|S39A7_HUMAN	Zinc transporter SLC39A7 OS=Homo sapiens OX=9606 GN=SLC39A7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null		0.06	49.0	2	1	0
PRT	sp|O43819|SCO2_HUMAN	Protein SCO2 homolog, mitochondrial OS=Homo sapiens OX=9606 GN=SCO2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null		0.14	49.0	1	1	1
PRT	sp|P62913-2|RL11_HUMAN	Isoform 2 of 60S ribosomal protein L11 OS=Homo sapiens OX=9606 GN=RPL11	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null		0.28	49.0	3	2	0
PRT	sp|P54725|RD23A_HUMAN	UV excision repair protein RAD23 homolog A OS=Homo sapiens OX=9606 GN=RAD23A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	49.0	null		0.09	49.0	2	1	0
PRT	sp|P20290|BTF3_HUMAN	Transcription factor BTF3 OS=Homo sapiens OX=9606 GN=BTF3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	49.0	null		0.11	49.0	6	1	0
PRT	sp|P55809|SCOT1_HUMAN	Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=OXCT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null		0.10	48.0	4	2	1
PRT	sp|P30419-2|NMT1_HUMAN	Isoform Short of Glycylpeptide N-tetradecanoyltransferase 1 OS=Homo sapiens OX=9606 GN=NMT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null		0.06	48.0	3	1	0
PRT	sp|P09543-2|CN37_HUMAN	Isoform CNPI of 2',3'-cyclic-nucleotide 3'-phosphodiesterase OS=Homo sapiens OX=9606 GN=CNP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	315-UNIMOD:4	0.06	48.0	1	1	1
PRT	sp|O14880|MGST3_HUMAN	Microsomal glutathione S-transferase 3 OS=Homo sapiens OX=9606 GN=MGST3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null		0.17	48.0	9	1	0
PRT	sp|Q14978|NOLC1_HUMAN	Nucleolar and coiled-body phosphoprotein 1 OS=Homo sapiens OX=9606 GN=NOLC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	48.0	null		0.06	48.0	3	2	0
PRT	sp|P30153|2AAA_HUMAN	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R1A PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	48.0	null	377-UNIMOD:4	0.06	48.0	11	3	0
PRT	sp|O60664-2|PLIN3_HUMAN	Isoform 2 of Perilipin-3 OS=Homo sapiens OX=9606 GN=PLIN3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null		0.12	48.0	5	1	0
PRT	sp|Q8WUM4|PDC6I_HUMAN	Programmed cell death 6-interacting protein OS=Homo sapiens OX=9606 GN=PDCD6IP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	48.0	null		0.04	48.0	4	1	0
PRT	sp|P47897-2|SYQ_HUMAN	Isoform 2 of Glutamine--tRNA ligase OS=Homo sapiens OX=9606 GN=QARS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	100-UNIMOD:4	0.05	48.0	5	2	1
PRT	sp|Q13868-3|EXOS2_HUMAN	Isoform 3 of Exosome complex component RRP4 OS=Homo sapiens OX=9606 GN=EXOSC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null		0.11	48.0	1	1	1
PRT	sp|Q8IXI1|MIRO2_HUMAN	Mitochondrial Rho GTPase 2 OS=Homo sapiens OX=9606 GN=RHOT2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null		0.05	48.0	2	1	0
PRT	sp|Q9UL46|PSME2_HUMAN	Proteasome activator complex subunit 2 OS=Homo sapiens OX=9606 GN=PSME2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	48.0	null	118-UNIMOD:4	0.25	48.0	9	3	1
PRT	sp|Q9NQZ2|SAS10_HUMAN	Something about silencing protein 10 OS=Homo sapiens OX=9606 GN=UTP3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null		0.05	48.0	4	1	0
PRT	sp|Q8IZ83-2|A16A1_HUMAN	Isoform 2 of Aldehyde dehydrogenase family 16 member A1 OS=Homo sapiens OX=9606 GN=ALDH16A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	59-UNIMOD:4,71-UNIMOD:4	0.11	48.0	1	1	1
PRT	sp|Q86VP6-2|CAND1_HUMAN	Isoform 2 of Cullin-associated NEDD8-dissociated protein 1 OS=Homo sapiens OX=9606 GN=CAND1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null		0.06	48.0	10	3	0
PRT	sp|Q02818|NUCB1_HUMAN	Nucleobindin-1 OS=Homo sapiens OX=9606 GN=NUCB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null		0.06	48.0	2	1	0
PRT	sp|Q86UP2-2|KTN1_HUMAN	Isoform 2 of Kinectin OS=Homo sapiens OX=9606 GN=KTN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null		0.02	48.0	2	1	0
PRT	sp|Q9NX58|LYAR_HUMAN	Cell growth-regulating nucleolar protein OS=Homo sapiens OX=9606 GN=LYAR PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null		0.07	48.0	2	1	0
PRT	sp|P35221-3|CTNA1_HUMAN	Isoform 3 of Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null		0.10	48.0	2	2	2
PRT	sp|P25705|ATPA_HUMAN	ATP synthase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	48.0	null	473-UNIMOD:28	0.08	48.0	11	2	0
PRT	sp|Q5XKP0|MIC13_HUMAN	MICOS complex subunit MIC13 OS=Homo sapiens OX=9606 GN=MICOS13 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	48.0	null	60-UNIMOD:4	0.46	48.0	6	2	0
PRT	sp|P62304|RUXE_HUMAN	Small nuclear ribonucleoprotein E OS=Homo sapiens OX=9606 GN=SNRPE PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	48.0	null	46-UNIMOD:4	0.28	48.0	5	1	0
PRT	sp|Q6NUK1-2|SCMC1_HUMAN	Isoform 2 of Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Homo sapiens OX=9606 GN=SLC25A24	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	372-UNIMOD:4,379-UNIMOD:4	0.07	47.0	1	1	0
PRT	sp|Q9BRK5-2|CAB45_HUMAN	Isoform 2 of 45 kDa calcium-binding protein OS=Homo sapiens OX=9606 GN=SDF4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.25	47.0	5	2	1
PRT	sp|Q92499-2|DDX1_HUMAN	Isoform 2 of ATP-dependent RNA helicase DDX1 OS=Homo sapiens OX=9606 GN=DDX1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.07	47.0	3	2	1
PRT	sp|Q13185|CBX3_HUMAN	Chromobox protein homolog 3 OS=Homo sapiens OX=9606 GN=CBX3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	47.0	null	69-UNIMOD:4	0.16	47.0	3	1	0
PRT	sp|O95983-2|MBD3_HUMAN	Isoform 2 of Methyl-CpG-binding domain protein 3 OS=Homo sapiens OX=9606 GN=MBD3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	140-UNIMOD:4	0.15	47.0	1	1	1
PRT	sp|P46013|KI67_HUMAN	Proliferation marker protein Ki-67 OS=Homo sapiens OX=9606 GN=MKI67 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.01	47.0	2	1	0
PRT	sp|P00367-2|DHE3_HUMAN	Isoform 2 of Glutamate dehydrogenase 1, mitochondrial OS=Homo sapiens OX=9606 GN=GLUD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.07	47.0	2	1	0
PRT	sp|Q6XQN6-3|PNCB_HUMAN	Isoform 3 of Nicotinate phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=NAPRT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.06	47.0	1	1	0
PRT	sp|P61758-2|PFD3_HUMAN	Isoform 2 of Prefoldin subunit 3 OS=Homo sapiens OX=9606 GN=VBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.14	47.0	1	1	1
PRT	sp|Q03701|CEBPZ_HUMAN	CCAAT/enhancer-binding protein zeta OS=Homo sapiens OX=9606 GN=CEBPZ PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.05	47.0	3	2	1
PRT	sp|P21333-2|FLNA_HUMAN	Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.01	47.0	1	1	0
PRT	sp|O76003|GLRX3_HUMAN	Glutaredoxin-3 OS=Homo sapiens OX=9606 GN=GLRX3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	46-UNIMOD:4	0.08	47.0	2	1	0
PRT	sp|Q6P2Q9|PRP8_HUMAN	Pre-mRNA-processing-splicing factor 8 OS=Homo sapiens OX=9606 GN=PRPF8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.02	47.0	8	2	0
PRT	sp|Q12769|NU160_HUMAN	Nuclear pore complex protein Nup160 OS=Homo sapiens OX=9606 GN=NUP160 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.02	47.0	2	1	0
PRT	sp|P14324-2|FPPS_HUMAN	Isoform 2 of Farnesyl pyrophosphate synthase OS=Homo sapiens OX=9606 GN=FDPS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.08	47.0	2	1	0
PRT	sp|P46379-4|BAG6_HUMAN	Isoform 4 of Large proline-rich protein BAG6 OS=Homo sapiens OX=9606 GN=BAG6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	724-UNIMOD:4	0.03	47.0	2	1	0
PRT	sp|Q9BTE7|DCNL5_HUMAN	DCN1-like protein 5 OS=Homo sapiens OX=9606 GN=DCUN1D5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	47.0	null		0.12	47.0	3	1	0
PRT	sp|Q07666-3|KHDR1_HUMAN	Isoform 3 of KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Homo sapiens OX=9606 GN=KHDRBS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.07	47.0	2	1	0
PRT	sp|P05187|PPB1_HUMAN	Alkaline phosphatase, placental type OS=Homo sapiens OX=9606 GN=ALPP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	47.0	null	205-UNIMOD:4	0.05	47.0	2	2	0
PRT	sp|Q15084|PDIA6_HUMAN	Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	47.0	null		0.07	47.0	10	3	0
PRT	sp|P23246|SFPQ_HUMAN	Splicing factor, proline- and glutamine-rich OS=Homo sapiens OX=9606 GN=SFPQ PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	47.0	null		0.03	47.0	2	1	0
PRT	sp|Q16401|PSMD5_HUMAN	26S proteasome non-ATPase regulatory subunit 5 OS=Homo sapiens OX=9606 GN=PSMD5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	47.0	null		0.11	47.0	3	2	1
PRT	sp|Q15404|RSU1_HUMAN	Ras suppressor protein 1 OS=Homo sapiens OX=9606 GN=RSU1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.29	46.0	6	3	1
PRT	sp|P62424|RL7A_HUMAN	60S ribosomal protein L7a OS=Homo sapiens OX=9606 GN=RPL7A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	174-UNIMOD:4	0.09	46.0	3	1	0
PRT	sp|Q9UIG0-2|BAZ1B_HUMAN	Isoform 2 of Tyrosine-protein kinase BAZ1B OS=Homo sapiens OX=9606 GN=BAZ1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.02	46.0	2	1	0
PRT	sp|P11940-2|PABP1_HUMAN	Isoform 2 of Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.05	46.0	3	1	0
PRT	sp|P08670|VIME_HUMAN	Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	46.0	null		0.12	46.0	13	2	0
PRT	sp|Q8NAV1|PR38A_HUMAN	Pre-mRNA-splicing factor 38A OS=Homo sapiens OX=9606 GN=PRPF38A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.07	46.0	2	1	0
PRT	sp|P12956-2|XRCC6_HUMAN	Isoform 2 of X-ray repair cross-complementing protein 6 OS=Homo sapiens OX=9606 GN=XRCC6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.08	46.0	9	2	0
PRT	sp|Q7Z2T5-2|TRM1L_HUMAN	Isoform 2 of TRMT1-like protein OS=Homo sapiens OX=9606 GN=TRMT1L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.06	46.0	1	1	1
PRT	sp|O15027-2|SC16A_HUMAN	Isoform 2 of Protein transport protein Sec16A OS=Homo sapiens OX=9606 GN=SEC16A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.04	46.0	4	3	2
PRT	sp|P33176|KINH_HUMAN	Kinesin-1 heavy chain OS=Homo sapiens OX=9606 GN=KIF5B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.05	46.0	5	2	1
PRT	sp|Q9NQX3|GEPH_HUMAN	Gephyrin OS=Homo sapiens OX=9606 GN=GPHN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.05	46.0	1	1	1
PRT	sp|Q14152-2|EIF3A_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens OX=9606 GN=EIF3A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.03	46.0	3	1	0
PRT	sp|Q9NWU2|GID8_HUMAN	Glucose-induced degradation protein 8 homolog OS=Homo sapiens OX=9606 GN=GID8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.11	46.0	1	1	1
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0	null	389-UNIMOD:4,119-UNIMOD:4	0.20	46.0	41	4	1
PRT	sp|P07737|PROF1_HUMAN	Profilin-1 OS=Homo sapiens OX=9606 GN=PFN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	46.0	null	2-UNIMOD:1,17-UNIMOD:4,12-UNIMOD:35	0.38	46.0	14	3	1
PRT	sp|P55263|ADK_HUMAN	Adenosine kinase OS=Homo sapiens OX=9606 GN=ADK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0	null	336-UNIMOD:4	0.09	46.0	1	1	0
PRT	sp|P30040|ERP29_HUMAN	Endoplasmic reticulum resident protein 29 OS=Homo sapiens OX=9606 GN=ERP29 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	46.0	null	157-UNIMOD:4,154-UNIMOD:35	0.10	46.0	4	1	0
PRT	sp|Q03468|ERCC6_HUMAN	DNA excision repair protein ERCC-6 OS=Homo sapiens OX=9606 GN=ERCC6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0	null		0.03	46.0	1	1	1
PRT	sp|Q01518|CAP1_HUMAN	Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.09	45.0	8	2	1
PRT	sp|Q15084-3|PDIA6_HUMAN	Isoform 3 of Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.06	45.0	14	2	0
PRT	sp|P43490|NAMPT_HUMAN	Nicotinamide phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=NAMPT PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	287-UNIMOD:4	0.06	45.0	2	1	0
PRT	sp|Q14204|DYHC1_HUMAN	Cytoplasmic dynein 1 heavy chain 1 OS=Homo sapiens OX=9606 GN=DYNC1H1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	45.0	null		0.02	45.0	10	4	1
PRT	sp|P52597|HNRPF_HUMAN	Heterogeneous nuclear ribonucleoprotein F OS=Homo sapiens OX=9606 GN=HNRNPF PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.07	45.0	6	1	0
PRT	sp|P07355|ANXA2_HUMAN	Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	262-UNIMOD:4	0.12	45.0	5	3	2
PRT	sp|P07741-2|APT_HUMAN	Isoform 2 of Adenine phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=APRT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	83-UNIMOD:4	0.16	45.0	4	1	0
PRT	sp|P07195|LDHB_HUMAN	L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	45.0	null	294-UNIMOD:4,36-UNIMOD:4,281-UNIMOD:35,264-UNIMOD:35	0.19	45.0	15	3	2
PRT	sp|Q96T76-5|MMS19_HUMAN	Isoform 4 of MMS19 nucleotide excision repair protein homolog OS=Homo sapiens OX=9606 GN=MMS19	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	696-UNIMOD:4	0.06	45.0	3	2	1
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	45.0	null	217-UNIMOD:4,1-UNIMOD:1,17-UNIMOD:4,257-UNIMOD:385,257-UNIMOD:4,272-UNIMOD:4	0.33	45.0	44	5	1
PRT	sp|P33992|MCM5_HUMAN	DNA replication licensing factor MCM5 OS=Homo sapiens OX=9606 GN=MCM5 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	45.0	null	671-UNIMOD:35	0.04	45.0	3	1	0
PRT	sp|Q15029-2|U5S1_HUMAN	Isoform 2 of 116 kDa U5 small nuclear ribonucleoprotein component OS=Homo sapiens OX=9606 GN=EFTUD2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	807-UNIMOD:4	0.05	45.0	5	2	1
PRT	sp|P23246-2|SFPQ_HUMAN	Isoform Short of Splicing factor, proline- and glutamine-rich OS=Homo sapiens OX=9606 GN=SFPQ	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.04	45.0	2	1	0
PRT	sp|Q5JTZ9|SYAM_HUMAN	Alanine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=AARS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.02	45.0	1	1	1
PRT	sp|P49588|SYAC_HUMAN	Alanine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=AARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	45.0	null	947-UNIMOD:4	0.10	45.0	8	4	2
PRT	sp|Q96AJ9-1|VTI1A_HUMAN	Isoform 1 of Vesicle transport through interaction with t-SNAREs homolog 1A OS=Homo sapiens OX=9606 GN=VTI1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.14	45.0	2	1	0
PRT	sp|Q5JPE7-3|NOMO2_HUMAN	Isoform 3 of Nodal modulator 2 OS=Homo sapiens OX=9606 GN=NOMO2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.04	45.0	7	2	0
PRT	sp|Q9NXH9-2|TRM1_HUMAN	Isoform 2 of tRNA (guanine(26)-N(2))-dimethyltransferase OS=Homo sapiens OX=9606 GN=TRMT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	150-UNIMOD:4	0.04	45.0	1	1	1
PRT	sp|P61088|UBE2N_HUMAN	Ubiquitin-conjugating enzyme E2 N OS=Homo sapiens OX=9606 GN=UBE2N PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.19	45.0	3	1	0
PRT	sp|Q9ULF5|S39AA_HUMAN	Zinc transporter ZIP10 OS=Homo sapiens OX=9606 GN=SLC39A10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	364-UNIMOD:4	0.04	45.0	1	1	1
PRT	sp|P11142|HSP7C_HUMAN	Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	45.0	null	17-UNIMOD:4	0.17	45.0	27	4	0
PRT	sp|Q8TEM1|PO210_HUMAN	Nuclear pore membrane glycoprotein 210 OS=Homo sapiens OX=9606 GN=NUP210 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	45.0	null	1611-UNIMOD:4,1643-UNIMOD:4	0.03	45.0	1	1	1
PRT	sp|P54577|SYYC_HUMAN	Tyrosine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=YARS1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	45.0	null	155-UNIMOD:28,67-UNIMOD:4	0.09	45.0	5	2	0
PRT	sp|P25398|RS12_HUMAN	40S ribosomal protein S12 OS=Homo sapiens OX=9606 GN=RPS12 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	45.0	null	2-UNIMOD:1,12-UNIMOD:35	0.17	45.0	16	1	0
PRT	sp|Q13561|DCTN2_HUMAN	Dynactin subunit 2 OS=Homo sapiens OX=9606 GN=DCTN2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	45.0	null	338-UNIMOD:28	0.07	45.0	1	1	1
PRT	sp|Q9NZ53|PDXL2_HUMAN	Podocalyxin-like protein 2 OS=Homo sapiens OX=9606 GN=PODXL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0	null		0.05	45.0	1	1	1
PRT	sp|Q15428|SF3A2_HUMAN	Splicing factor 3A subunit 2 OS=Homo sapiens OX=9606 GN=SF3A2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.06	44.0	2	1	0
PRT	sp|P52788-2|SPSY_HUMAN	Isoform 2 of Spermine synthase OS=Homo sapiens OX=9606 GN=SMS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.09	44.0	1	1	1
PRT	sp|Q07960|RHG01_HUMAN	Rho GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=ARHGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.06	44.0	2	1	0
PRT	sp|Q2VIR3-2|IF2GL_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 2 subunit 3B OS=Homo sapiens OX=9606 GN=EIF2S3B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.06	44.0	2	1	0
PRT	sp|Q9H4M9|EHD1_HUMAN	EH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=EHD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	138-UNIMOD:4	0.05	44.0	3	1	0
PRT	sp|Q13547|HDAC1_HUMAN	Histone deacetylase 1 OS=Homo sapiens OX=9606 GN=HDAC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	44.0	null	100-UNIMOD:4,110-UNIMOD:4	0.06	44.0	2	1	0
PRT	sp|Q15165-1|PON2_HUMAN	Isoform 1 of Serum paraoxonase/arylesterase 2 OS=Homo sapiens OX=9606 GN=PON2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.17	44.0	5	2	0
PRT	sp|P08397-4|HEM3_HUMAN	Isoform 4 of Porphobilinogen deaminase OS=Homo sapiens OX=9606 GN=HMBS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.07	44.0	4	1	0
PRT	sp|P28070|PSB4_HUMAN	Proteasome subunit beta type-4 OS=Homo sapiens OX=9606 GN=PSMB4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.09	44.0	2	1	0
PRT	sp|Q92665|RT31_HUMAN	28S ribosomal protein S31, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS31 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.06	44.0	1	1	1
PRT	sp|P68104-2|EF1A1_HUMAN	Isoform 2 of Elongation factor 1-alpha 1 OS=Homo sapiens OX=9606 GN=EEF1A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.17	44.0	9	3	0
PRT	sp|Q9UBV2|SE1L1_HUMAN	Protein sel-1 homolog 1 OS=Homo sapiens OX=9606 GN=SEL1L PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.04	44.0	1	1	1
PRT	sp|P10109|ADX_HUMAN	Adrenodoxin, mitochondrial OS=Homo sapiens OX=9606 GN=FDX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.12	44.0	1	1	1
PRT	sp|P46060|RAGP1_HUMAN	Ran GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RANGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	44.0	null	338-UNIMOD:4	0.05	44.0	2	1	0
PRT	sp|Q08J23-3|NSUN2_HUMAN	Isoform 3 of RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	85-UNIMOD:4	0.09	44.0	7	2	0
PRT	sp|P51659-3|DHB4_HUMAN	Isoform 3 of Peroxisomal multifunctional enzyme type 2 OS=Homo sapiens OX=9606 GN=HSD17B4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	517-UNIMOD:4	0.05	44.0	3	1	0
PRT	sp|Q99436|PSB7_HUMAN	Proteasome subunit beta type-7 OS=Homo sapiens OX=9606 GN=PSMB7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	44.0	null	219-UNIMOD:4,274-UNIMOD:35	0.18	44.0	6	2	0
PRT	sp|Q09161|NCBP1_HUMAN	Nuclear cap-binding protein subunit 1 OS=Homo sapiens OX=9606 GN=NCBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	44.0	null	44-UNIMOD:4,409-UNIMOD:4	0.09	44.0	7	3	0
PRT	sp|Q8TEX9|IPO4_HUMAN	Importin-4 OS=Homo sapiens OX=9606 GN=IPO4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.02	44.0	2	1	0
PRT	sp|P08754|GNAI3_HUMAN	Guanine nucleotide-binding protein G(i) subunit alpha OS=Homo sapiens OX=9606 GN=GNAI3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	286-UNIMOD:4,305-UNIMOD:4	0.09	44.0	1	1	1
PRT	sp|O00571-2|DDX3X_HUMAN	Isoform 2 of ATP-dependent RNA helicase DDX3X OS=Homo sapiens OX=9606 GN=DDX3X	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.06	44.0	9	2	0
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	94-UNIMOD:4	0.16	44.0	7	2	0
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	374-UNIMOD:4,371-UNIMOD:35	0.08	44.0	12	3	0
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	44.0	null	366-UNIMOD:4,363-UNIMOD:35,412-UNIMOD:385,412-UNIMOD:4	0.08	44.0	24	3	0
PRT	sp|P50395|GDIB_HUMAN	Rab GDP dissociation inhibitor beta OS=Homo sapiens OX=9606 GN=GDI2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.10	44.0	10	3	0
PRT	sp|O95394|AGM1_HUMAN	Phosphoacetylglucosamine mutase OS=Homo sapiens OX=9606 GN=PGM3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.07	44.0	1	1	1
PRT	sp|P12955-2|PEPD_HUMAN	Isoform 2 of Xaa-Pro dipeptidase OS=Homo sapiens OX=9606 GN=PEPD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.06	44.0	2	1	0
PRT	sp|P42126|ECI1_HUMAN	Enoyl-CoA delta isomerase 1, mitochondrial OS=Homo sapiens OX=9606 GN=ECI1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	173-UNIMOD:4	0.07	44.0	4	1	0
PRT	sp|O60684|IMA7_HUMAN	Importin subunit alpha-7 OS=Homo sapiens OX=9606 GN=KPNA6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	44.0	null	422-UNIMOD:4,427-UNIMOD:4,335-UNIMOD:4,340-UNIMOD:4	0.10	44.0	5	2	0
PRT	sp|P20810|ICAL_HUMAN	Calpastatin OS=Homo sapiens OX=9606 GN=CAST PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44.0	null	506-UNIMOD:35	0.11	44.0	2	2	1
PRT	sp|P63241|IF5A1_HUMAN	Eukaryotic translation initiation factor 5A-1 OS=Homo sapiens OX=9606 GN=EIF5A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	44.0	null		0.16	44.0	3	2	1
PRT	sp|P62937|PPIA_HUMAN	Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44.0	null	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:1	0.12	44.0	9	2	0
PRT	sp|P32754|HPPD_HUMAN	4-hydroxyphenylpyruvate dioxygenase OS=Homo sapiens OX=9606 GN=HPD PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44.0	null	176-UNIMOD:385,176-UNIMOD:4,150-UNIMOD:35	0.13	44.0	4	2	0
PRT	sp|O75934|SPF27_HUMAN	Pre-mRNA-splicing factor SPF27 OS=Homo sapiens OX=9606 GN=BCAS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44.0	null	2-UNIMOD:1	0.13	44.0	2	1	0
PRT	sp|Q16555|DPYL2_HUMAN	Dihydropyrimidinase-related protein 2 OS=Homo sapiens OX=9606 GN=DPYSL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	null		0.05	44.0	1	1	1
PRT	sp|P08579|RU2B_HUMAN	U2 small nuclear ribonucleoprotein B'' OS=Homo sapiens OX=9606 GN=SNRPB2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	44.0	null		0.09	44.0	3	1	0
PRT	sp|P09661|RU2A_HUMAN	U2 small nuclear ribonucleoprotein A' OS=Homo sapiens OX=9606 GN=SNRPA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	null		0.10	44.0	3	1	0
PRT	sp|P48643|TCPE_HUMAN	T-complex protein 1 subunit epsilon OS=Homo sapiens OX=9606 GN=CCT5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	null	460-UNIMOD:35	0.06	44.0	1	1	0
PRT	sp|O43242|PSMD3_HUMAN	26S proteasome non-ATPase regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PSMD3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.04	43.0	2	1	0
PRT	sp|Q9Y4E8-2|UBP15_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 15 OS=Homo sapiens OX=9606 GN=USP15	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	844-UNIMOD:4,477-UNIMOD:4	0.07	43.0	4	3	2
PRT	sp|Q96I59-2|SYNM_HUMAN	Isoform 2 of Probable asparagine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=NARS2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.12	43.0	1	1	1
PRT	sp|Q9H936|GHC1_HUMAN	Mitochondrial glutamate carrier 1 OS=Homo sapiens OX=9606 GN=SLC25A22 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.08	43.0	2	1	0
PRT	sp|Q99829|CPNE1_HUMAN	Copine-1 OS=Homo sapiens OX=9606 GN=CPNE1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	43.0	null	30-UNIMOD:4	0.08	43.0	7	2	0
PRT	sp|Q9BQG2-2|NUD12_HUMAN	Isoform 2 of Peroxisomal NADH pyrophosphatase NUDT12 OS=Homo sapiens OX=9606 GN=NUDT12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.06	43.0	2	1	0
PRT	sp|P61619-3|S61A1_HUMAN	Isoform 3 of Protein transport protein Sec61 subunit alpha isoform 1 OS=Homo sapiens OX=9606 GN=SEC61A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.07	43.0	4	1	0
PRT	sp|Q8N8S7-3|ENAH_HUMAN	Isoform 3 of Protein enabled homolog OS=Homo sapiens OX=9606 GN=ENAH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.04	43.0	2	1	0
PRT	sp|P16435|NCPR_HUMAN	NADPH--cytochrome P450 reductase OS=Homo sapiens OX=9606 GN=POR PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.07	43.0	5	2	0
PRT	sp|Q00839-2|HNRPU_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	629-UNIMOD:4	0.06	43.0	10	2	1
PRT	sp|P55072|TERA_HUMAN	Transitional endoplasmic reticulum ATPase OS=Homo sapiens OX=9606 GN=VCP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.05	43.0	6	2	1
PRT	sp|P06132|DCUP_HUMAN	Uroporphyrinogen decarboxylase OS=Homo sapiens OX=9606 GN=UROD PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.06	43.0	2	1	0
PRT	sp|Q96AC1-2|FERM2_HUMAN	Isoform 2 of Fermitin family homolog 2 OS=Homo sapiens OX=9606 GN=FERMT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.12	43.0	5	3	1
PRT	sp|Q92974-3|ARHG2_HUMAN	Isoform 3 of Rho guanine nucleotide exchange factor 2 OS=Homo sapiens OX=9606 GN=ARHGEF2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.03	43.0	2	1	0
PRT	sp|P47985|UCRI_HUMAN	Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Homo sapiens OX=9606 GN=UQCRFS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	43.0	null	270-UNIMOD:35	0.17	43.0	5	2	0
PRT	sp|P33991|MCM4_HUMAN	DNA replication licensing factor MCM4 OS=Homo sapiens OX=9606 GN=MCM4 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.02	43.0	4	1	0
PRT	sp|Q96S52-2|PIGS_HUMAN	Isoform 2 of GPI transamidase component PIG-S OS=Homo sapiens OX=9606 GN=PIGS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.04	43.0	2	1	0
PRT	sp|P08240-2|SRPRA_HUMAN	Isoform 2 of Signal recognition particle receptor subunit alpha OS=Homo sapiens OX=9606 GN=SRPRA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.04	43.0	1	1	1
PRT	sp|P19338|NUCL_HUMAN	Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.03	43.0	1	1	1
PRT	sp|Q9H2H9|S38A1_HUMAN	Sodium-coupled neutral amino acid transporter 1 OS=Homo sapiens OX=9606 GN=SLC38A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	288-UNIMOD:4	0.06	43.0	2	1	0
PRT	sp|P13797|PLST_HUMAN	Plastin-3 OS=Homo sapiens OX=9606 GN=PLS3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	null	566-UNIMOD:4,407-UNIMOD:35	0.09	43.0	2	2	1
PRT	sp|P54819|KAD2_HUMAN	Adenylate kinase 2, mitochondrial OS=Homo sapiens OX=9606 GN=AK2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	null		0.11	43.0	1	1	0
PRT	sp|Q9Y5P4|CERT_HUMAN	Ceramide transfer protein OS=Homo sapiens OX=9606 GN=CERT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	null		0.05	43.0	1	1	1
PRT	sp|O75439|MPPB_HUMAN	Mitochondrial-processing peptidase subunit beta OS=Homo sapiens OX=9606 GN=PMPCB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	43.0	null		0.06	43.0	3	1	0
PRT	sp|Q13501|SQSTM_HUMAN	Sequestosome-1 OS=Homo sapiens OX=9606 GN=SQSTM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	null		0.05	43.0	1	1	1
PRT	sp|P00966|ASSY_HUMAN	Argininosuccinate synthase OS=Homo sapiens OX=9606 GN=ASS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	null		0.05	43.0	7	1	0
PRT	sp|Q9P2T1|GMPR2_HUMAN	GMP reductase 2 OS=Homo sapiens OX=9606 GN=GMPR2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	null	95-UNIMOD:4	0.14	43.0	1	1	1
PRT	sp|Q15293|RCN1_HUMAN	Reticulocalbin-1 OS=Homo sapiens OX=9606 GN=RCN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	null		0.14	43.0	3	1	0
PRT	sp|P02786|TFR1_HUMAN	Transferrin receptor protein 1 OS=Homo sapiens OX=9606 GN=TFRC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	null		0.04	43.0	1	1	1
PRT	sp|Q14974-2|IMB1_HUMAN	Isoform 2 of Importin subunit beta-1 OS=Homo sapiens OX=9606 GN=KPNB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	206-UNIMOD:4,213-UNIMOD:4,214-UNIMOD:4	0.04	42.0	2	1	0
PRT	sp|P05556-2|ITB1_HUMAN	Isoform 2 of Integrin beta-1 OS=Homo sapiens OX=9606 GN=ITGB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.03	42.0	1	1	1
PRT	sp|P61163|ACTZ_HUMAN	Alpha-centractin OS=Homo sapiens OX=9606 GN=ACTR1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.08	42.0	3	2	1
PRT	sp|P15927|RFA2_HUMAN	Replication protein A 32 kDa subunit OS=Homo sapiens OX=9606 GN=RPA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	42.0	null	49-UNIMOD:4	0.09	42.0	4	1	0
PRT	sp|P62993-2|GRB2_HUMAN	Isoform 2 of Growth factor receptor-bound protein 2 OS=Homo sapiens OX=9606 GN=GRB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.17	42.0	1	1	0
PRT	sp|Q5VT66-3|MARC1_HUMAN	Isoform 3 of Mitochondrial amidoxime-reducing component 1 OS=Homo sapiens OX=9606 GN=MTARC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.10	42.0	2	1	0
PRT	sp|O94826|TOM70_HUMAN	Mitochondrial import receptor subunit TOM70 OS=Homo sapiens OX=9606 GN=TOMM70 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	206-UNIMOD:4,214-UNIMOD:4,427-UNIMOD:4	0.08	42.0	3	2	1
PRT	sp|Q6Y7W6-4|GGYF2_HUMAN	Isoform 3 of GRB10-interacting GYF protein 2 OS=Homo sapiens OX=9606 GN=GIGYF2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.02	42.0	1	1	1
PRT	sp|O15145|ARPC3_HUMAN	Actin-related protein 2/3 complex subunit 3 OS=Homo sapiens OX=9606 GN=ARPC3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.15	42.0	6	1	0
PRT	sp|Q9BW72|HIG2A_HUMAN	HIG1 domain family member 2A, mitochondrial OS=Homo sapiens OX=9606 GN=HIGD2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	53-UNIMOD:4	0.25	42.0	2	1	0
PRT	sp|Q15642-5|CIP4_HUMAN	Isoform 5 of Cdc42-interacting protein 4 OS=Homo sapiens OX=9606 GN=TRIP10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.06	42.0	2	1	0
PRT	sp|Q9BYG3|MK67I_HUMAN	MKI67 FHA domain-interacting nucleolar phosphoprotein OS=Homo sapiens OX=9606 GN=NIFK PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.08	42.0	4	1	0
PRT	sp|Q9UL15|BAG5_HUMAN	BAG family molecular chaperone regulator 5 OS=Homo sapiens OX=9606 GN=BAG5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	218-UNIMOD:4,233-UNIMOD:4	0.05	42.0	2	1	0
PRT	sp|Q96SI9-2|STRBP_HUMAN	Isoform 2 of Spermatid perinuclear RNA-binding protein OS=Homo sapiens OX=9606 GN=STRBP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	26-UNIMOD:4	0.04	42.0	3	1	0
PRT	sp|P30084|ECHM_HUMAN	Enoyl-CoA hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=ECHS1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	213-UNIMOD:4,225-UNIMOD:4	0.06	42.0	8	1	0
PRT	sp|O95340|PAPS2_HUMAN	Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2 OS=Homo sapiens OX=9606 GN=PAPSS2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	155-UNIMOD:4,117-UNIMOD:4	0.10	42.0	4	3	2
PRT	sp|Q8IUF8-2|RIOX2_HUMAN	Isoform 2 of Ribosomal oxygenase 2 OS=Homo sapiens OX=9606 GN=RIOX2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.10	42.0	2	1	0
PRT	sp|P84077|ARF1_HUMAN	ADP-ribosylation factor 1 OS=Homo sapiens OX=9606 GN=ARF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	42.0	null	159-UNIMOD:4	0.26	42.0	5	2	0
PRT	sp|P52756|RBM5_HUMAN	RNA-binding protein 5 OS=Homo sapiens OX=9606 GN=RBM5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	42.0	null		0.03	42.0	3	1	0
PRT	sp|Q93009-3|UBP7_HUMAN	Isoform 3 of Ubiquitin carboxyl-terminal hydrolase 7 OS=Homo sapiens OX=9606 GN=USP7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	207-UNIMOD:4	0.04	42.0	5	2	0
PRT	sp|P35754|GLRX1_HUMAN	Glutaredoxin-1 OS=Homo sapiens OX=9606 GN=GLRX PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.28	42.0	2	1	0
PRT	sp|Q9Y262-2|EIF3L_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit L OS=Homo sapiens OX=9606 GN=EIF3L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.10	42.0	3	2	1
PRT	sp|P04632|CPNS1_HUMAN	Calpain small subunit 1 OS=Homo sapiens OX=9606 GN=CAPNS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.09	42.0	3	2	1
PRT	sp|Q9NSE4|SYIM_HUMAN	Isoleucine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=IARS2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	42.0	null	819-UNIMOD:4	0.04	42.0	8	2	0
PRT	sp|P51570|GALK1_HUMAN	Galactokinase OS=Homo sapiens OX=9606 GN=GALK1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	322-UNIMOD:4	0.08	42.0	1	1	1
PRT	sp|P42285|MTREX_HUMAN	Exosome RNA helicase MTR4 OS=Homo sapiens OX=9606 GN=MTREX PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	42.0	null	2-UNIMOD:1	0.05	42.0	5	2	0
PRT	sp|Q92947-2|GCDH_HUMAN	Isoform Short of Glutaryl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=GCDH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.11	42.0	2	2	2
PRT	sp|Q9NSV4-1|DIAP3_HUMAN	Isoform 1 of Protein diaphanous homolog 3 OS=Homo sapiens OX=9606 GN=DIAPH3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.05	42.0	2	2	2
PRT	sp|Q9BSD7|NTPCR_HUMAN	Cancer-related nucleoside-triphosphatase OS=Homo sapiens OX=9606 GN=NTPCR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.11	42.0	2	1	0
PRT	sp|Q15427|SF3B4_HUMAN	Splicing factor 3B subunit 4 OS=Homo sapiens OX=9606 GN=SF3B4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.06	42.0	4	1	0
PRT	sp|Q9BVI4|NOC4L_HUMAN	Nucleolar complex protein 4 homolog OS=Homo sapiens OX=9606 GN=NOC4L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	42.0	null		0.11	42.0	5	2	1
PRT	sp|Q9H4A4|AMPB_HUMAN	Aminopeptidase B OS=Homo sapiens OX=9606 GN=RNPEP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	254-UNIMOD:4	0.04	42.0	2	1	0
PRT	sp|Q9GZL7|WDR12_HUMAN	Ribosome biogenesis protein WDR12 OS=Homo sapiens OX=9606 GN=WDR12 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.06	42.0	4	1	0
PRT	sp|O60664|PLIN3_HUMAN	Perilipin-3 OS=Homo sapiens OX=9606 GN=PLIN3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	null	365-UNIMOD:28	0.06	42.0	1	1	1
PRT	sp|Q12874|SF3A3_HUMAN	Splicing factor 3A subunit 3 OS=Homo sapiens OX=9606 GN=SF3A3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	42.0	null	437-UNIMOD:385,437-UNIMOD:4	0.08	42.0	4	2	0
PRT	sp|P12956|XRCC6_HUMAN	X-ray repair cross-complementing protein 6 OS=Homo sapiens OX=9606 GN=XRCC6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null		0.04	42.0	3	1	0
PRT	sp|P42704|LPPRC_HUMAN	Leucine-rich PPR motif-containing protein, mitochondrial OS=Homo sapiens OX=9606 GN=LRPPRC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	42.0	null		0.04	42.0	11	3	0
PRT	sp|Q14444|CAPR1_HUMAN	Caprin-1 OS=Homo sapiens OX=9606 GN=CAPRIN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null		0.03	42.0	8	1	0
PRT	sp|Q9NVM6|DJC17_HUMAN	DnaJ homolog subfamily C member 17 OS=Homo sapiens OX=9606 GN=DNAJC17 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.07	41.0	1	1	1
PRT	sp|O14744-4|ANM5_HUMAN	Isoform 4 of Protein arginine N-methyltransferase 5 OS=Homo sapiens OX=9606 GN=PRMT5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	278-UNIMOD:4	0.07	41.0	3	1	0
PRT	sp|Q9GZR7|DDX24_HUMAN	ATP-dependent RNA helicase DDX24 OS=Homo sapiens OX=9606 GN=DDX24 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null		0.03	41.0	3	1	0
PRT	sp|Q16658|FSCN1_HUMAN	Fascin OS=Homo sapiens OX=9606 GN=FSCN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.04	41.0	2	1	0
PRT	sp|P53701|CCHL_HUMAN	Cytochrome c-type heme lyase OS=Homo sapiens OX=9606 GN=HCCS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.09	41.0	3	1	0
PRT	sp|Q04637-6|IF4G1_HUMAN	Isoform E of Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	1069-UNIMOD:4	0.01	41.0	2	1	0
PRT	sp|P17174-2|AATC_HUMAN	Isoform 2 of Aspartate aminotransferase, cytoplasmic OS=Homo sapiens OX=9606 GN=GOT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.05	41.0	3	1	0
PRT	sp|Q92616|GCN1_HUMAN	eIF-2-alpha kinase activator GCN1 OS=Homo sapiens OX=9606 GN=GCN1 PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null		0.08	41.0	19	9	4
PRT	sp|Q68E01-4|INT3_HUMAN	Isoform 4 of Integrator complex subunit 3 OS=Homo sapiens OX=9606 GN=INTS3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.05	41.0	2	1	0
PRT	sp|P0DMV8-2|HS71A_HUMAN	Isoform 2 of Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.04	41.0	1	1	0
PRT	sp|P46783|RS10_HUMAN	40S ribosomal protein S10 OS=Homo sapiens OX=9606 GN=RPS10 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null		0.19	41.0	8	1	0
PRT	sp|O75323-2|NIPS2_HUMAN	Isoform 2 of Protein NipSnap homolog 2 OS=Homo sapiens OX=9606 GN=NIPSNAP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.09	41.0	4	1	0
PRT	sp|O15230|LAMA5_HUMAN	Laminin subunit alpha-5 OS=Homo sapiens OX=9606 GN=LAMA5 PE=1 SV=8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.01	41.0	2	1	0
PRT	sp|Q9Y2G8-2|DJC16_HUMAN	Isoform 2 of DnaJ homolog subfamily C member 16 OS=Homo sapiens OX=9606 GN=DNAJC16	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.06	41.0	1	1	1
PRT	sp|O75694-2|NU155_HUMAN	Isoform 2 of Nuclear pore complex protein Nup155 OS=Homo sapiens OX=9606 GN=NUP155	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	1149-UNIMOD:4,785-UNIMOD:4	0.03	41.0	4	3	2
PRT	sp|P60228|EIF3E_HUMAN	Eukaryotic translation initiation factor 3 subunit E OS=Homo sapiens OX=9606 GN=EIF3E PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null		0.08	41.0	13	2	0
PRT	sp|Q9Y248|PSF2_HUMAN	DNA replication complex GINS protein PSF2 OS=Homo sapiens OX=9606 GN=GINS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.14	41.0	1	1	1
PRT	sp|O00410-2|IPO5_HUMAN	Isoform 2 of Importin-5 OS=Homo sapiens OX=9606 GN=IPO5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	1018-UNIMOD:4,690-UNIMOD:4	0.07	41.0	6	3	2
PRT	sp|Q9UHG3-2|PCYOX_HUMAN	Isoform 2 of Prenylcysteine oxidase 1 OS=Homo sapiens OX=9606 GN=PCYOX1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	385-UNIMOD:4	0.07	41.0	1	1	1
PRT	sp|P07942|LAMB1_HUMAN	Laminin subunit beta-1 OS=Homo sapiens OX=9606 GN=LAMB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	540-UNIMOD:4	0.03	41.0	3	2	1
PRT	sp|O43237-2|DC1L2_HUMAN	Isoform 2 of Cytoplasmic dynein 1 light intermediate chain 2 OS=Homo sapiens OX=9606 GN=DYNC1LI2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.05	41.0	2	1	0
PRT	sp|Q8N163-2|CCAR2_HUMAN	Isoform 2 of Cell cycle and apoptosis regulator protein 2 OS=Homo sapiens OX=9606 GN=CCAR2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.06	41.0	6	2	0
PRT	sp|P06733-2|ENOA_HUMAN	Isoform MBP-1 of Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	296-UNIMOD:4,26-UNIMOD:4	0.22	41.0	30	4	0
PRT	sp|P56182|RRP1_HUMAN	Ribosomal RNA processing protein 1 homolog A OS=Homo sapiens OX=9606 GN=RRP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null		0.06	41.0	2	1	0
PRT	sp|Q99460-2|PSMD1_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PSMD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	217-UNIMOD:4,219-UNIMOD:4	0.07	41.0	3	2	1
PRT	sp|P25205|MCM3_HUMAN	DNA replication licensing factor MCM3 OS=Homo sapiens OX=9606 GN=MCM3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null		0.06	41.0	9	2	0
PRT	sp|Q9Y3A6-2|TMED5_HUMAN	Isoform 2 of Transmembrane emp24 domain-containing protein 5 OS=Homo sapiens OX=9606 GN=TMED5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.12	41.0	1	1	1
PRT	sp|Q9NRG7|D39U1_HUMAN	Epimerase family protein SDR39U1 OS=Homo sapiens OX=9606 GN=SDR39U1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.13	41.0	4	2	0
PRT	sp|Q13158|FADD_HUMAN	FAS-associated death domain protein OS=Homo sapiens OX=9606 GN=FADD PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.13	41.0	1	1	1
PRT	sp|P38919|IF4A3_HUMAN	Eukaryotic initiation factor 4A-III OS=Homo sapiens OX=9606 GN=EIF4A3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.06	41.0	7	1	0
PRT	sp|P68104|EF1A1_HUMAN	Elongation factor 1-alpha 1 OS=Homo sapiens OX=9606 GN=EEF1A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	41.0	null	201-UNIMOD:35,208-UNIMOD:35	0.07	41.0	16	1	0
PRT	sp|Q08211|DHX9_HUMAN	ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	41.0	null	1059-UNIMOD:35	0.06	41.0	7	3	1
PRT	sp|P29466|CASP1_HUMAN	Caspase-1 OS=Homo sapiens OX=9606 GN=CASP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null		0.05	41.0	1	1	1
PRT	sp|Q9BPZ3|PAIP2_HUMAN	Polyadenylate-binding protein-interacting protein 2 OS=Homo sapiens OX=9606 GN=PAIP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	null	60-UNIMOD:385,60-UNIMOD:4	0.16	41.0	1	1	1
PRT	sp|P17844|DDX5_HUMAN	Probable ATP-dependent RNA helicase DDX5 OS=Homo sapiens OX=9606 GN=DDX5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	null	112-UNIMOD:28	0.06	41.0	2	1	0
PRT	sp|Q99471|PFD5_HUMAN	Prefoldin subunit 5 OS=Homo sapiens OX=9606 GN=PFDN5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null		0.12	41.0	1	1	1
PRT	sp|Q15006|EMC2_HUMAN	ER membrane protein complex subunit 2 OS=Homo sapiens OX=9606 GN=EMC2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null		0.11	41.0	1	1	1
PRT	sp|P34932|HSP74_HUMAN	Heat shock 70 kDa protein 4 OS=Homo sapiens OX=9606 GN=HSPA4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	290-UNIMOD:4,292-UNIMOD:35	0.03	41.0	2	1	0
PRT	sp|P62826|RAN_HUMAN	GTP-binding nuclear protein Ran OS=Homo sapiens OX=9606 GN=RAN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	null	189-UNIMOD:35,179-UNIMOD:35	0.24	41.0	16	1	0
PRT	sp|Q15637|SF01_HUMAN	Splicing factor 1 OS=Homo sapiens OX=9606 GN=SF1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null		0.03	41.0	3	1	0
PRT	sp|Q9C0C2|TB182_HUMAN	182 kDa tankyrase-1-binding protein OS=Homo sapiens OX=9606 GN=TNKS1BP1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	631-UNIMOD:4	0.03	41.0	1	1	1
PRT	sp|P49354|FNTA_HUMAN	Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha OS=Homo sapiens OX=9606 GN=FNTA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null		0.05	41.0	1	1	0
PRT	sp|Q9Y6G9|DC1L1_HUMAN	Cytoplasmic dynein 1 light intermediate chain 1 OS=Homo sapiens OX=9606 GN=DYNC1LI1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.04	40.0	1	1	1
PRT	sp|Q9UQE7|SMC3_HUMAN	Structural maintenance of chromosomes protein 3 OS=Homo sapiens OX=9606 GN=SMC3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	1134-UNIMOD:4	0.05	40.0	7	3	1
PRT	sp|Q13428-5|TCOF_HUMAN	Isoform 5 of Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	38-UNIMOD:4	0.03	40.0	2	1	0
PRT	sp|O15144|ARPC2_HUMAN	Actin-related protein 2/3 complex subunit 2 OS=Homo sapiens OX=9606 GN=ARPC2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null		0.07	40.0	3	1	0
PRT	sp|P51398-2|RT29_HUMAN	Isoform 2 of 28S ribosomal protein S29, mitochondrial OS=Homo sapiens OX=9606 GN=DAP3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.12	40.0	4	2	1
PRT	sp|P28288-2|ABCD3_HUMAN	Isoform 2 of ATP-binding cassette sub-family D member 3 OS=Homo sapiens OX=9606 GN=ABCD3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	24-UNIMOD:4	0.07	40.0	3	2	1
PRT	sp|Q8WX92|NELFB_HUMAN	Negative elongation factor B OS=Homo sapiens OX=9606 GN=NELFB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.04	40.0	3	1	0
PRT	sp|Q9Y2X3|NOP58_HUMAN	Nucleolar protein 58 OS=Homo sapiens OX=9606 GN=NOP58 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null		0.04	40.0	5	1	0
PRT	sp|Q9Y3C6|PPIL1_HUMAN	Peptidyl-prolyl cis-trans isomerase-like 1 OS=Homo sapiens OX=9606 GN=PPIL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	100-UNIMOD:35	0.21	40.0	3	1	0
PRT	sp|P61764|STXB1_HUMAN	Syntaxin-binding protein 1 OS=Homo sapiens OX=9606 GN=STXBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.07	40.0	2	2	2
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null		0.08	40.0	2	1	0
PRT	sp|Q13155-2|AIMP2_HUMAN	Isoform 2 of Aminoacyl tRNA synthase complex-interacting multifunctional protein 2 OS=Homo sapiens OX=9606 GN=AIMP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.09	40.0	1	1	1
PRT	sp|Q9BYD6|RM01_HUMAN	39S ribosomal protein L1, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	40.0	null	279-UNIMOD:4,262-UNIMOD:35	0.08	40.0	3	1	0
PRT	sp|P61086-2|UBE2K_HUMAN	Isoform 2 of Ubiquitin-conjugating enzyme E2 K OS=Homo sapiens OX=9606 GN=UBE2K	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	41-UNIMOD:4	0.39	40.0	3	2	1
PRT	sp|P43246-2|MSH2_HUMAN	Isoform 2 of DNA mismatch repair protein Msh2 OS=Homo sapiens OX=9606 GN=MSH2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	110-UNIMOD:4	0.03	40.0	1	1	1
PRT	sp|P32929-2|CGL_HUMAN	Isoform 2 of Cystathionine gamma-lyase OS=Homo sapiens OX=9606 GN=CTH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.06	40.0	2	1	0
PRT	sp|Q13200|PSMD2_HUMAN	26S proteasome non-ATPase regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PSMD2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	139-UNIMOD:4	0.06	40.0	5	4	3
PRT	sp|Q9UBE0|SAE1_HUMAN	SUMO-activating enzyme subunit 1 OS=Homo sapiens OX=9606 GN=SAE1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.06	40.0	1	1	1
PRT	sp|Q96ST3|SIN3A_HUMAN	Paired amphipathic helix protein Sin3a OS=Homo sapiens OX=9606 GN=SIN3A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.02	40.0	3	1	0
PRT	sp|P58107|EPIPL_HUMAN	Epiplakin OS=Homo sapiens OX=9606 GN=EPPK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.04	40.0	5	4	3
PRT	sp|O95379-3|TFIP8_HUMAN	Isoform 3 of Tumor necrosis factor alpha-induced protein 8 OS=Homo sapiens OX=9606 GN=TNFAIP8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.11	40.0	1	1	1
PRT	sp|Q13620-3|CUL4B_HUMAN	Isoform 3 of Cullin-4B OS=Homo sapiens OX=9606 GN=CUL4B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	52-UNIMOD:4	0.09	40.0	4	3	2
PRT	sp|P10768|ESTD_HUMAN	S-formylglutathione hydrolase OS=Homo sapiens OX=9606 GN=ESD PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	243-UNIMOD:4	0.13	40.0	3	1	0
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	73-UNIMOD:4	0.14	40.0	6	2	1
PRT	sp|P18085|ARF4_HUMAN	ADP-ribosylation factor 4 OS=Homo sapiens OX=9606 GN=ARF4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	159-UNIMOD:4	0.16	40.0	2	1	0
PRT	sp|P30740-2|ILEU_HUMAN	Isoform 2 of Leukocyte elastase inhibitor OS=Homo sapiens OX=9606 GN=SERPINB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.13	40.0	1	1	0
PRT	sp|P23381-2|SYWC_HUMAN	Isoform 2 of Tryptophan--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=WARS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.05	40.0	5	1	0
PRT	sp|Q14166|TTL12_HUMAN	Tubulin--tyrosine ligase-like protein 12 OS=Homo sapiens OX=9606 GN=TTLL12 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	40.0	null	638-UNIMOD:4,642-UNIMOD:4,538-UNIMOD:28	0.07	40.0	4	2	0
PRT	sp|Q7Z6Z7|HUWE1_HUMAN	E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	40.0	null	2181-UNIMOD:4,2190-UNIMOD:4,1483-UNIMOD:28	0.03	40.0	6	4	3
PRT	sp|P62244|RS15A_HUMAN	40S ribosomal protein S15a OS=Homo sapiens OX=9606 GN=RPS15A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	null	98-UNIMOD:28	0.16	40.0	3	1	0
PRT	sp|P46459|NSF_HUMAN	Vesicle-fusing ATPase OS=Homo sapiens OX=9606 GN=NSF PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null		0.04	40.0	1	1	1
PRT	sp|Q14694|UBP10_HUMAN	Ubiquitin carboxyl-terminal hydrolase 10 OS=Homo sapiens OX=9606 GN=USP10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	null	2-UNIMOD:1	0.03	40.0	2	1	0
PRT	sp|Q6XQN6|PNCB_HUMAN	Nicotinate phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=NAPRT PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	437-UNIMOD:35	0.09	40.0	3	2	0
PRT	sp|Q7L2E3-3|DHX30_HUMAN	Isoform 3 of ATP-dependent RNA helicase DHX30 OS=Homo sapiens OX=9606 GN=DHX30	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.04	39.0	4	3	2
PRT	sp|Q9H6X2-3|ANTR1_HUMAN	Isoform 3 of Anthrax toxin receptor 1 OS=Homo sapiens OX=9606 GN=ANTXR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.08	39.0	2	1	0
PRT	sp|P00338|LDHA_HUMAN	L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null	293-UNIMOD:4	0.26	39.0	42	5	0
PRT	sp|P26196|DDX6_HUMAN	Probable ATP-dependent RNA helicase DDX6 OS=Homo sapiens OX=9606 GN=DDX6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.06	39.0	1	1	1
PRT	sp|P68363-2|TBA1B_HUMAN	Isoform 2 of Tubulin alpha-1B chain OS=Homo sapiens OX=9606 GN=TUBA1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	179-UNIMOD:4	0.20	39.0	3	3	3
PRT	sp|O95453-2|PARN_HUMAN	Isoform 2 of Poly(A)-specific ribonuclease PARN OS=Homo sapiens OX=9606 GN=PARN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	241-UNIMOD:4	0.09	39.0	2	2	2
PRT	sp|P04062-4|GLCM_HUMAN	Isoform 4 of Lysosomal acid glucosylceramidase OS=Homo sapiens OX=9606 GN=GBA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.06	39.0	2	1	0
PRT	sp|O75477|ERLN1_HUMAN	Erlin-1 OS=Homo sapiens OX=9606 GN=ERLIN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	130-UNIMOD:4	0.09	39.0	2	1	0
PRT	sp|Q92973-3|TNPO1_HUMAN	Isoform 3 of Transportin-1 OS=Homo sapiens OX=9606 GN=TNPO1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.05	39.0	5	2	0
PRT	sp|Q9Y5S2|MRCKB_HUMAN	Serine/threonine-protein kinase MRCK beta OS=Homo sapiens OX=9606 GN=CDC42BPB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.01	39.0	1	1	1
PRT	sp|Q9UI26|IPO11_HUMAN	Importin-11 OS=Homo sapiens OX=9606 GN=IPO11 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.04	39.0	2	2	2
PRT	sp|Q9Y276|BCS1_HUMAN	Mitochondrial chaperone BCS1 OS=Homo sapiens OX=9606 GN=BCS1L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.11	39.0	2	2	2
PRT	sp|Q5T4S7-3|UBR4_HUMAN	Isoform 3 of E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	2629-UNIMOD:4,2630-UNIMOD:4	0.02	39.0	6	4	2
PRT	sp|Q15003|CND2_HUMAN	Condensin complex subunit 2 OS=Homo sapiens OX=9606 GN=NCAPH PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null	296-UNIMOD:4,299-UNIMOD:35	0.07	39.0	3	2	1
PRT	sp|P43304-2|GPDM_HUMAN	Isoform 2 of Glycerol-3-phosphate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=GPD2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.03	39.0	3	1	0
PRT	sp|Q9NYU2-2|UGGG1_HUMAN	Isoform 2 of UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.06	39.0	3	3	2
PRT	sp|Q96K17-2|BT3L4_HUMAN	Isoform 2 of Transcription factor BTF3 homolog 4 OS=Homo sapiens OX=9606 GN=BTF3L4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.23	39.0	2	1	0
PRT	sp|Q9UL45|BL1S6_HUMAN	Biogenesis of lysosome-related organelles complex 1 subunit 6 OS=Homo sapiens OX=9606 GN=BLOC1S6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.14	39.0	1	1	1
PRT	sp|Q9NVP1|DDX18_HUMAN	ATP-dependent RNA helicase DDX18 OS=Homo sapiens OX=9606 GN=DDX18 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.05	39.0	7	2	0
PRT	sp|Q15397|PUM3_HUMAN	Pumilio homolog 3 OS=Homo sapiens OX=9606 GN=PUM3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.03	39.0	3	1	0
PRT	sp|P41743|KPCI_HUMAN	Protein kinase C iota type OS=Homo sapiens OX=9606 GN=PRKCI PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	595-UNIMOD:4	0.09	39.0	2	2	2
PRT	sp|Q9Y5Q9-2|TF3C3_HUMAN	Isoform 2 of General transcription factor 3C polypeptide 3 OS=Homo sapiens OX=9606 GN=GTF3C3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.05	39.0	1	1	1
PRT	sp|Q13085-3|ACACA_HUMAN	Isoform 3 of Acetyl-CoA carboxylase 1 OS=Homo sapiens OX=9606 GN=ACACA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.01	39.0	1	1	0
PRT	sp|P39656-2|OST48_HUMAN	Isoform 2 of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Homo sapiens OX=9606 GN=DDOST	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.07	39.0	2	1	0
PRT	sp|Q96CS3|FAF2_HUMAN	FAS-associated factor 2 OS=Homo sapiens OX=9606 GN=FAF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.04	39.0	4	1	0
PRT	sp|Q9HCS7|SYF1_HUMAN	Pre-mRNA-splicing factor SYF1 OS=Homo sapiens OX=9606 GN=XAB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.02	39.0	1	1	1
PRT	sp|Q9NYU2|UGGG1_HUMAN	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null		0.02	39.0	1	1	0
PRT	sp|O15260|SURF4_HUMAN	Surfeit locus protein 4 OS=Homo sapiens OX=9606 GN=SURF4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	null	2-UNIMOD:1,7-UNIMOD:35	0.07	39.0	3	1	0
PRT	sp|O75367|H2AY_HUMAN	Core histone macro-H2A.1 OS=Homo sapiens OX=9606 GN=MACROH2A1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	49-UNIMOD:35	0.19	39.0	3	2	1
PRT	sp|Q92841|DDX17_HUMAN	Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens OX=9606 GN=DDX17 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	199-UNIMOD:4	0.06	39.0	2	1	0
PRT	sp|Q9H2P9|DPH5_HUMAN	Diphthine methyl ester synthase OS=Homo sapiens OX=9606 GN=DPH5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null		0.10	39.0	1	1	1
PRT	sp|Q9NRX4|PHP14_HUMAN	14 kDa phosphohistidine phosphatase OS=Homo sapiens OX=9606 GN=PHPT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	null	2-UNIMOD:1	0.17	39.0	4	1	0
PRT	sp|Q8IXH7-4|NELFD_HUMAN	Isoform NELF-D of Negative elongation factor C/D OS=Homo sapiens OX=9606 GN=NELFCD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	408-UNIMOD:4	0.08	38.0	3	2	1
PRT	sp|O95817|BAG3_HUMAN	BAG family molecular chaperone regulator 3 OS=Homo sapiens OX=9606 GN=BAG3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.07	38.0	2	1	0
PRT	sp|Q15435-5|PP1R7_HUMAN	Isoform 5 of Protein phosphatase 1 regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PPP1R7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.09	38.0	1	1	1
PRT	sp|Q01081|U2AF1_HUMAN	Splicing factor U2AF 35 kDa subunit OS=Homo sapiens OX=9606 GN=U2AF1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	38.0	null	67-UNIMOD:4,2-UNIMOD:1	0.17	38.0	4	2	1
PRT	sp|Q15149-7|PLEC_HUMAN	Isoform 7 of Plectin OS=Homo sapiens OX=9606 GN=PLEC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.01	38.0	3	2	0
PRT	sp|O60701-3|UGDH_HUMAN	Isoform 3 of UDP-glucose 6-dehydrogenase OS=Homo sapiens OX=9606 GN=UGDH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	191-UNIMOD:4,144-UNIMOD:4	0.13	38.0	2	2	2
PRT	sp|Q6PL18|ATAD2_HUMAN	ATPase family AAA domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ATAD2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	631-UNIMOD:4,635-UNIMOD:4	0.02	38.0	1	1	1
PRT	sp|Q86XI2|CNDG2_HUMAN	Condensin-2 complex subunit G2 OS=Homo sapiens OX=9606 GN=NCAPG2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.02	38.0	1	1	1
PRT	sp|Q8NE71-2|ABCF1_HUMAN	Isoform 2 of ATP-binding cassette sub-family F member 1 OS=Homo sapiens OX=9606 GN=ABCF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	327-UNIMOD:4	0.08	38.0	5	2	0
PRT	sp|Q9UJZ1|STML2_HUMAN	Stomatin-like protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=STOML2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	167-UNIMOD:4	0.06	38.0	2	1	0
PRT	sp|Q9H845|ACAD9_HUMAN	Complex I assembly factor ACAD9, mitochondrial OS=Homo sapiens OX=9606 GN=ACAD9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null		0.10	38.0	9	3	0
PRT	sp|Q96S66|CLCC1_HUMAN	Chloride channel CLIC-like protein 1 OS=Homo sapiens OX=9606 GN=CLCC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.05	38.0	1	1	1
PRT	sp|Q6UW56-2|ARAID_HUMAN	Isoform 2 of All-trans retinoic acid-induced differentiation factor OS=Homo sapiens OX=9606 GN=ATRAID	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	72-UNIMOD:4,91-UNIMOD:4	0.23	38.0	3	1	0
PRT	sp|Q6UB35|C1TM_HUMAN	Monofunctional C1-tetrahydrofolate synthase, mitochondrial OS=Homo sapiens OX=9606 GN=MTHFD1L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.04	38.0	1	1	1
PRT	sp|Q15654|TRIP6_HUMAN	Thyroid receptor-interacting protein 6 OS=Homo sapiens OX=9606 GN=TRIP6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null		0.06	38.0	3	1	0
PRT	sp|P12270|TPR_HUMAN	Nucleoprotein TPR OS=Homo sapiens OX=9606 GN=TPR PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null		0.01	38.0	3	1	0
PRT	sp|O95232|LC7L3_HUMAN	Luc7-like protein 3 OS=Homo sapiens OX=9606 GN=LUC7L3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.06	38.0	1	1	1
PRT	sp|O60936|NOL3_HUMAN	Nucleolar protein 3 OS=Homo sapiens OX=9606 GN=NOL3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null		0.10	38.0	3	1	0
PRT	sp|Q8NBL1|PGLT1_HUMAN	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	38.0	null	357-UNIMOD:4,108-UNIMOD:385,108-UNIMOD:4	0.09	38.0	2	2	2
PRT	sp|Q92889|XPF_HUMAN	DNA repair endonuclease XPF OS=Homo sapiens OX=9606 GN=ERCC4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.03	38.0	1	1	1
PRT	sp|Q9ULA0|DNPEP_HUMAN	Aspartyl aminopeptidase OS=Homo sapiens OX=9606 GN=DNPEP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.10	38.0	3	2	1
PRT	sp|Q52LJ0-1|FA98B_HUMAN	Isoform 1 of Protein FAM98B OS=Homo sapiens OX=9606 GN=FAM98B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.06	38.0	4	1	0
PRT	sp|Q14258|TRI25_HUMAN	E3 ubiquitin/ISG15 ligase TRIM25 OS=Homo sapiens OX=9606 GN=TRIM25 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	70-UNIMOD:4	0.03	38.0	4	1	0
PRT	sp|O95785-4|WIZ_HUMAN	Isoform 4 of Protein Wiz OS=Homo sapiens OX=9606 GN=WIZ	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.03	38.0	1	1	1
PRT	sp|Q9Y6E2-2|BZW2_HUMAN	Isoform 2 of Basic leucine zipper and W2 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=BZW2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.11	38.0	1	1	1
PRT	sp|Q9Y5L0-5|TNPO3_HUMAN	Isoform 4 of Transportin-3 OS=Homo sapiens OX=9606 GN=TNPO3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.02	38.0	4	1	0
PRT	sp|P33240-2|CSTF2_HUMAN	Isoform 2 of Cleavage stimulation factor subunit 2 OS=Homo sapiens OX=9606 GN=CSTF2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.06	38.0	1	1	1
PRT	sp|Q16531-2|DDB1_HUMAN	Isoform 2 of DNA damage-binding protein 1 OS=Homo sapiens OX=9606 GN=DDB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.05	38.0	2	1	0
PRT	sp|Q01658|NC2B_HUMAN	Protein Dr1 OS=Homo sapiens OX=9606 GN=DR1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.14	38.0	1	1	1
PRT	sp|Q7Z7H8|RM10_HUMAN	39S ribosomal protein L10, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL10 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	180-UNIMOD:4	0.08	38.0	2	1	0
PRT	sp|P06748-3|NPM_HUMAN	Isoform 3 of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.11	38.0	10	1	0
PRT	sp|O14974-5|MYPT1_HUMAN	Isoform 5 of Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens OX=9606 GN=PPP1R12A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.03	38.0	1	1	1
PRT	sp|P23368-2|MAOM_HUMAN	Isoform 2 of NAD-dependent malic enzyme, mitochondrial OS=Homo sapiens OX=9606 GN=ME2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	274-UNIMOD:4	0.05	38.0	1	1	1
PRT	sp|P19388|RPAB1_HUMAN	DNA-directed RNA polymerases I, II, and III subunit RPABC1 OS=Homo sapiens OX=9606 GN=POLR2E PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.14	38.0	1	1	1
PRT	sp|Q9UN86-2|G3BP2_HUMAN	Isoform B of Ras GTPase-activating protein-binding protein 2 OS=Homo sapiens OX=9606 GN=G3BP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.08	38.0	2	1	0
PRT	sp|Q86VP6|CAND1_HUMAN	Cullin-associated NEDD8-dissociated protein 1 OS=Homo sapiens OX=9606 GN=CAND1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	38.0	null	165-UNIMOD:28,179-UNIMOD:4,1195-UNIMOD:35	0.06	38.0	5	3	1
PRT	sp|P28288|ABCD3_HUMAN	ATP-binding cassette sub-family D member 3 OS=Homo sapiens OX=9606 GN=ABCD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null		0.04	38.0	2	1	0
PRT	sp|Q13011|ECH1_HUMAN	Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial OS=Homo sapiens OX=9606 GN=ECH1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	38.0	null	113-UNIMOD:35	0.13	38.0	11	2	0
PRT	sp|Q15031|SYLM_HUMAN	Probable leucine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=LARS2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	38.0	null	464-UNIMOD:4,467-UNIMOD:4,341-UNIMOD:4	0.07	38.0	3	2	1
PRT	sp|P40926|MDHM_HUMAN	Malate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=MDH2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	null	128-UNIMOD:4,132-UNIMOD:4,138-UNIMOD:4	0.14	38.0	2	1	0
PRT	sp|O43447|PPIH_HUMAN	Peptidyl-prolyl cis-trans isomerase H OS=Homo sapiens OX=9606 GN=PPIH PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	null	2-UNIMOD:1	0.15	38.0	2	1	0
PRT	sp|O43324|MCA3_HUMAN	Eukaryotic translation elongation factor 1 epsilon-1 OS=Homo sapiens OX=9606 GN=EEF1E1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	null	29-UNIMOD:28	0.15	38.0	3	1	0
PRT	sp|O75616|ERAL1_HUMAN	GTPase Era, mitochondrial OS=Homo sapiens OX=9606 GN=ERAL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	38.0	null	425-UNIMOD:4	0.06	38.0	2	1	0
PRT	sp|P14735|IDE_HUMAN	Insulin-degrading enzyme OS=Homo sapiens OX=9606 GN=IDE PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	null	736-UNIMOD:28	0.03	38.0	1	1	1
PRT	sp|P14618|KPYM_HUMAN	Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	239-UNIMOD:35	0.03	38.0	12	1	0
PRT	sp|Q01844|EWS_HUMAN	RNA-binding protein EWS OS=Homo sapiens OX=9606 GN=EWSR1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	null	340-UNIMOD:35	0.08	38.0	4	1	0
PRT	sp|Q5JTH9|RRP12_HUMAN	RRP12-like protein OS=Homo sapiens OX=9606 GN=RRP12 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null		0.04	38.0	3	1	0
PRT	sp|P50991-2|TCPD_HUMAN	Isoform 2 of T-complex protein 1 subunit delta OS=Homo sapiens OX=9606 GN=CCT4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.06	37.0	1	1	0
PRT	sp|O43156|TTI1_HUMAN	TELO2-interacting protein 1 homolog OS=Homo sapiens OX=9606 GN=TTI1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.02	37.0	2	1	0
PRT	sp|P37802|TAGL2_HUMAN	Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	37.0	null	63-UNIMOD:4,89-UNIMOD:28	0.19	37.0	11	2	0
PRT	sp|Q8NBT2-2|SPC24_HUMAN	Isoform 2 of Kinetochore protein Spc24 OS=Homo sapiens OX=9606 GN=SPC24	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.12	37.0	2	1	0
PRT	sp|P61586|RHOA_HUMAN	Transforming protein RhoA OS=Homo sapiens OX=9606 GN=RHOA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.13	37.0	4	1	0
PRT	sp|Q9H6R4-3|NOL6_HUMAN	Isoform 3 of Nucleolar protein 6 OS=Homo sapiens OX=9606 GN=NOL6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.05	37.0	3	1	0
PRT	sp|P55795|HNRH2_HUMAN	Heterogeneous nuclear ribonucleoprotein H2 OS=Homo sapiens OX=9606 GN=HNRNPH2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.06	37.0	1	1	1
PRT	sp|O75489|NDUS3_HUMAN	NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.07	37.0	2	1	0
PRT	sp|P36871|PGM1_HUMAN	Phosphoglucomutase-1 OS=Homo sapiens OX=9606 GN=PGM1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.04	37.0	1	1	1
PRT	sp|Q99733|NP1L4_HUMAN	Nucleosome assembly protein 1-like 4 OS=Homo sapiens OX=9606 GN=NAP1L4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null		0.11	37.0	5	2	0
PRT	sp|O94925-3|GLSK_HUMAN	Isoform 3 of Glutaminase kidney isoform, mitochondrial OS=Homo sapiens OX=9606 GN=GLS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.04	37.0	1	1	1
PRT	sp|O14925|TIM23_HUMAN	Mitochondrial import inner membrane translocase subunit Tim23 OS=Homo sapiens OX=9606 GN=TIMM23 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.11	37.0	2	1	0
PRT	sp|P00813|ADA_HUMAN	Adenosine deaminase OS=Homo sapiens OX=9606 GN=ADA PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.17	37.0	2	2	2
PRT	sp|Q9UIV1-2|CNOT7_HUMAN	Isoform 2 of CCR4-NOT transcription complex subunit 7 OS=Homo sapiens OX=9606 GN=CNOT7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.08	37.0	1	1	1
PRT	sp|Q6PGP7|TTC37_HUMAN	Tetratricopeptide repeat protein 37 OS=Homo sapiens OX=9606 GN=TTC37 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.02	37.0	1	1	1
PRT	sp|Q12996|CSTF3_HUMAN	Cleavage stimulation factor subunit 3 OS=Homo sapiens OX=9606 GN=CSTF3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.04	37.0	1	1	1
PRT	sp|P00491|PNPH_HUMAN	Purine nucleoside phosphorylase OS=Homo sapiens OX=9606 GN=PNP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.07	37.0	8	2	0
PRT	sp|O14976-2|GAK_HUMAN	Isoform 2 of Cyclin-G-associated kinase OS=Homo sapiens OX=9606 GN=GAK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.01	37.0	1	1	0
PRT	sp|Q9BSJ8|ESYT1_HUMAN	Extended synaptotagmin-1 OS=Homo sapiens OX=9606 GN=ESYT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null		0.02	37.0	3	1	0
PRT	sp|Q9BT78-2|CSN4_HUMAN	Isoform 2 of COP9 signalosome complex subunit 4 OS=Homo sapiens OX=9606 GN=COPS4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.06	37.0	2	1	0
PRT	sp|P32754-2|HPPD_HUMAN	Isoform 2 of 4-hydroxyphenylpyruvate dioxygenase OS=Homo sapiens OX=9606 GN=HPD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.07	37.0	4	1	0
PRT	sp|Q9BXP5-5|SRRT_HUMAN	Isoform 5 of Serrate RNA effector molecule homolog OS=Homo sapiens OX=9606 GN=SRRT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.05	37.0	1	1	1
PRT	sp|P33993-3|MCM7_HUMAN	Isoform 3 of DNA replication licensing factor MCM7 OS=Homo sapiens OX=9606 GN=MCM7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.04	37.0	1	1	0
PRT	sp|P27816-7|MAP4_HUMAN	Isoform 7 of Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.23	37.0	1	1	1
PRT	sp|P53985|MOT1_HUMAN	Monocarboxylate transporter 1 OS=Homo sapiens OX=9606 GN=SLC16A1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	399-UNIMOD:4,400-UNIMOD:4	0.09	37.0	2	2	2
PRT	sp|Q5UIP0-2|RIF1_HUMAN	Isoform 2 of Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.01	37.0	1	1	1
PRT	sp|O75569-3|PRKRA_HUMAN	Isoform 3 of Interferon-inducible double-stranded RNA-dependent protein kinase activator A OS=Homo sapiens OX=9606 GN=PRKRA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.07	37.0	3	1	0
PRT	sp|P26640|SYVC_HUMAN	Valine--tRNA ligase OS=Homo sapiens OX=9606 GN=VARS1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.03	37.0	2	2	2
PRT	sp|Q9NXS2|QPCTL_HUMAN	Glutaminyl-peptide cyclotransferase-like protein OS=Homo sapiens OX=9606 GN=QPCTL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.09	37.0	1	1	1
PRT	sp|Q9BTC0|DIDO1_HUMAN	Death-inducer obliterator 1 OS=Homo sapiens OX=9606 GN=DIDO1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.01	37.0	7	2	0
PRT	sp|Q6P1J9|CDC73_HUMAN	Parafibromin OS=Homo sapiens OX=9606 GN=CDC73 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null		0.12	37.0	9	3	0
PRT	sp|P42330-2|AK1C3_HUMAN	Isoform 2 of Aldo-keto reductase family 1 member C3 OS=Homo sapiens OX=9606 GN=AKR1C3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	26-UNIMOD:4	0.09	37.0	1	1	1
PRT	sp|Q8N3U4|STAG2_HUMAN	Cohesin subunit SA-2 OS=Homo sapiens OX=9606 GN=STAG2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.05	37.0	5	3	1
PRT	sp|Q9UBQ5-2|EIF3K_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit K OS=Homo sapiens OX=9606 GN=EIF3K	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.08	37.0	1	1	1
PRT	sp|Q01105|SET_HUMAN	Protein SET OS=Homo sapiens OX=9606 GN=SET PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null		0.11	37.0	7	1	0
PRT	sp|Q9UIA9|XPO7_HUMAN	Exportin-7 OS=Homo sapiens OX=9606 GN=XPO7 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null		0.02	37.0	2	1	0
PRT	sp|Q6NUK1|SCMC1_HUMAN	Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Homo sapiens OX=9606 GN=SLC25A24 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	386-UNIMOD:35,391-UNIMOD:4,398-UNIMOD:4	0.07	37.0	1	1	0
PRT	sp|P55060|XPO2_HUMAN	Exportin-2 OS=Homo sapiens OX=9606 GN=CSE1L PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	null	1-UNIMOD:1	0.02	37.0	2	1	0
PRT	sp|Q99714|HCD2_HUMAN	3-hydroxyacyl-CoA dehydrogenase type-2 OS=Homo sapiens OX=9606 GN=HSD17B10 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null		0.10	37.0	1	1	1
PRT	sp|P36542|ATPG_HUMAN	ATP synthase subunit gamma, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1C PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null		0.11	37.0	1	1	1
PRT	sp|Q13144|EI2BE_HUMAN	Translation initiation factor eIF-2B subunit epsilon OS=Homo sapiens OX=9606 GN=EIF2B5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null		0.04	36.0	2	1	0
PRT	sp|Q13148-4|TADBP_HUMAN	Isoform 2 of TAR DNA-binding protein 43 OS=Homo sapiens OX=9606 GN=TARDBP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	128-UNIMOD:4	0.08	36.0	1	1	1
PRT	sp|O15067|PUR4_HUMAN	Phosphoribosylformylglycinamidine synthase OS=Homo sapiens OX=9606 GN=PFAS PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	66-UNIMOD:4	0.04	36.0	2	2	2
PRT	sp|Q8TEM1-2|PO210_HUMAN	Isoform 2 of Nuclear pore membrane glycoprotein 210 OS=Homo sapiens OX=9606 GN=NUP210	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	109-UNIMOD:4	0.02	36.0	2	1	0
PRT	sp|Q13444-13|ADA15_HUMAN	Isoform 13 of Disintegrin and metalloproteinase domain-containing protein 15 OS=Homo sapiens OX=9606 GN=ADAM15	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.03	36.0	2	1	0
PRT	sp|P52209-2|6PGD_HUMAN	Isoform 2 of 6-phosphogluconate dehydrogenase, decarboxylating OS=Homo sapiens OX=9606 GN=PGD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.04	36.0	3	1	0
PRT	sp|P38606-2|VATA_HUMAN	Isoform 2 of V-type proton ATPase catalytic subunit A OS=Homo sapiens OX=9606 GN=ATP6V1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.03	36.0	2	1	0
PRT	sp|Q8IYI6|EXOC8_HUMAN	Exocyst complex component 8 OS=Homo sapiens OX=9606 GN=EXOC8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null		0.03	36.0	2	1	0
PRT	sp|Q9BS26|ERP44_HUMAN	Endoplasmic reticulum resident protein 44 OS=Homo sapiens OX=9606 GN=ERP44 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.06	36.0	1	1	1
PRT	sp|P43686-2|PRS6B_HUMAN	Isoform 2 of 26S proteasome regulatory subunit 6B OS=Homo sapiens OX=9606 GN=PSMC4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.05	36.0	4	2	1
PRT	sp|Q8IY17-5|PLPL6_HUMAN	Isoform 5 of Neuropathy target esterase OS=Homo sapiens OX=9606 GN=PNPLA6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	3	1	0
PRT	sp|O96005-3|CLPT1_HUMAN	Isoform 2 of Cleft lip and palate transmembrane protein 1 OS=Homo sapiens OX=9606 GN=CLPTM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.04	36.0	3	1	0
PRT	sp|Q5VYK3|ECM29_HUMAN	Proteasome adapter and scaffold protein ECM29 OS=Homo sapiens OX=9606 GN=ECPAS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.01	36.0	3	1	0
PRT	sp|Q15057|ACAP2_HUMAN	Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ACAP2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.04	36.0	1	1	1
PRT	sp|Q8TDD1|DDX54_HUMAN	ATP-dependent RNA helicase DDX54 OS=Homo sapiens OX=9606 GN=DDX54 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	4	1	0
PRT	sp|P12081-3|HARS1_HUMAN	Isoform 3 of Histidine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=HARS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.12	36.0	2	2	2
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null		0.03	36.0	14	1	0
PRT	sp|P06865|HEXA_HUMAN	Beta-hexosaminidase subunit alpha OS=Homo sapiens OX=9606 GN=HEXA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.04	36.0	1	1	1
PRT	sp|O60502-2|OGA_HUMAN	Isoform 2 of Protein O-GlcNAcase OS=Homo sapiens OX=9606 GN=OGA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.03	36.0	1	1	1
PRT	sp|Q9H9T3|ELP3_HUMAN	Elongator complex protein 3 OS=Homo sapiens OX=9606 GN=ELP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.04	36.0	1	1	1
PRT	sp|Q68EM7-4|RHG17_HUMAN	Isoform 4 of Rho GTPase-activating protein 17 OS=Homo sapiens OX=9606 GN=ARHGAP17	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.12	36.0	1	1	1
PRT	sp|Q86Y37-4|CACL1_HUMAN	Isoform 4 of CDK2-associated and cullin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CACUL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	43-UNIMOD:4	0.13	36.0	1	1	1
PRT	sp|P26368-2|U2AF2_HUMAN	Isoform 2 of Splicing factor U2AF 65 kDa subunit OS=Homo sapiens OX=9606 GN=U2AF2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.06	36.0	2	1	0
PRT	sp|P57678|GEMI4_HUMAN	Gem-associated protein 4 OS=Homo sapiens OX=9606 GN=GEMIN4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.03	36.0	1	1	1
PRT	sp|P49748-2|ACADV_HUMAN	Isoform 2 of Very long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADVL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.03	36.0	2	1	0
PRT	sp|Q9HAV4|XPO5_HUMAN	Exportin-5 OS=Homo sapiens OX=9606 GN=XPO5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	685-UNIMOD:35	0.04	36.0	2	2	2
PRT	sp|Q9H0A0-2|NAT10_HUMAN	Isoform 2 of RNA cytidine acetyltransferase OS=Homo sapiens OX=9606 GN=NAT10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	2	1	0
PRT	sp|O75935-3|DCTN3_HUMAN	Isoform 3 of Dynactin subunit 3 OS=Homo sapiens OX=9606 GN=DCTN3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	145-UNIMOD:4	0.15	36.0	1	1	1
PRT	sp|Q14444-2|CAPR1_HUMAN	Isoform 2 of Caprin-1 OS=Homo sapiens OX=9606 GN=CAPRIN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.03	36.0	2	1	0
PRT	sp|Q96EY1-3|DNJA3_HUMAN	Isoform 3 of DnaJ homolog subfamily A member 3, mitochondrial OS=Homo sapiens OX=9606 GN=DNAJA3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.08	36.0	1	1	1
PRT	sp|Q9BVC5-2|ASHWN_HUMAN	Isoform 2 of Ashwin OS=Homo sapiens OX=9606 GN=C2orf49	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	48-UNIMOD:4	0.12	36.0	2	1	0
PRT	sp|Q9Y303|NAGA_HUMAN	N-acetylglucosamine-6-phosphate deacetylase OS=Homo sapiens OX=9606 GN=AMDHD2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.05	36.0	1	1	1
PRT	sp|P29466-2|CASP1_HUMAN	Isoform Beta of Caspase-1 OS=Homo sapiens OX=9606 GN=CASP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.05	36.0	1	1	1
PRT	sp|P63092-3|GNAS2_HUMAN	Isoform 3 of Guanine nucleotide-binding protein G(s) subunit alpha isoforms short OS=Homo sapiens OX=9606 GN=GNAS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	159-UNIMOD:4	0.06	36.0	2	1	0
PRT	sp|Q7Z478|DHX29_HUMAN	ATP-dependent RNA helicase DHX29 OS=Homo sapiens OX=9606 GN=DHX29 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	2	1	0
PRT	sp|O14734|ACOT8_HUMAN	Acyl-coenzyme A thioesterase 8 OS=Homo sapiens OX=9606 GN=ACOT8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.06	36.0	1	1	1
PRT	sp|Q9Y696|CLIC4_HUMAN	Chloride intracellular channel protein 4 OS=Homo sapiens OX=9606 GN=CLIC4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	100-UNIMOD:4	0.08	36.0	5	1	0
PRT	sp|Q5TFE4|NT5D1_HUMAN	5'-nucleotidase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=NT5DC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null		0.14	36.0	8	3	1
PRT	sp|Q9UBK8|MTRR_HUMAN	Methionine synthase reductase OS=Homo sapiens OX=9606 GN=MTRR PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.05	36.0	2	1	0
PRT	sp|Q99536-2|VAT1_HUMAN	Isoform 2 of Synaptic vesicle membrane protein VAT-1 homolog OS=Homo sapiens OX=9606 GN=VAT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.07	36.0	1	1	0
PRT	sp|P40121-2|CAPG_HUMAN	Isoform 2 of Macrophage-capping protein OS=Homo sapiens OX=9606 GN=CAPG	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	267-UNIMOD:4,275-UNIMOD:4	0.08	36.0	1	1	1
PRT	sp|Q00613-2|HSF1_HUMAN	Isoform Short of Heat shock factor protein 1 OS=Homo sapiens OX=9606 GN=HSF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.06	36.0	1	1	1
PRT	sp|P51784|UBP11_HUMAN	Ubiquitin carboxyl-terminal hydrolase 11 OS=Homo sapiens OX=9606 GN=USP11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.04	36.0	1	1	1
PRT	sp|Q99504-2|EYA3_HUMAN	Isoform 2 of Eyes absent homolog 3 OS=Homo sapiens OX=9606 GN=EYA3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.05	36.0	1	1	1
PRT	sp|Q8NFF5-3|FAD1_HUMAN	Isoform 3 of FAD synthase OS=Homo sapiens OX=9606 GN=FLAD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.09	36.0	5	3	1
PRT	sp|Q92973-2|TNPO1_HUMAN	Isoform 2 of Transportin-1 OS=Homo sapiens OX=9606 GN=TNPO1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	36.0	2	1	0
PRT	sp|Q15149|PLEC_HUMAN	Plectin OS=Homo sapiens OX=9606 GN=PLEC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null		0.00	36.0	3	1	0
PRT	sp|Q8N8S7|ENAH_HUMAN	Protein enabled homolog OS=Homo sapiens OX=9606 GN=ENAH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null		0.05	36.0	1	1	1
PRT	sp|P31327|CPSM_HUMAN	Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Homo sapiens OX=9606 GN=CPS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	36.0	null		0.03	36.0	7	2	1
PRT	sp|Q8WV74|NUDT8_HUMAN	Nucleoside diphosphate-linked moiety X motif 8 OS=Homo sapiens OX=9606 GN=NUDT8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	null	159-UNIMOD:4	0.21	36.0	1	1	1
PRT	sp|Q8IWA0|WDR75_HUMAN	WD repeat-containing protein 75 OS=Homo sapiens OX=9606 GN=WDR75 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	2	1	0
PRT	sp|P31949|S10AB_HUMAN	Protein S100-A11 OS=Homo sapiens OX=9606 GN=S100A11 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	36.0	null	43-UNIMOD:35	0.16	36.0	8	1	0
PRT	sp|O43143|DHX15_HUMAN	Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 OS=Homo sapiens OX=9606 GN=DHX15 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null		0.03	36.0	4	1	0
PRT	sp|Q13217|DNJC3_HUMAN	DnaJ homolog subfamily C member 3 OS=Homo sapiens OX=9606 GN=DNAJC3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.06	35.0	1	1	1
PRT	sp|P50336|PPOX_HUMAN	Protoporphyrinogen oxidase OS=Homo sapiens OX=9606 GN=PPOX PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.07	35.0	2	1	0
PRT	sp|O75533|SF3B1_HUMAN	Splicing factor 3B subunit 1 OS=Homo sapiens OX=9606 GN=SF3B1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	677-UNIMOD:4	0.05	35.0	6	3	1
PRT	sp|Q9Y3B8-2|ORN_HUMAN	Isoform 2 of Oligoribonuclease, mitochondrial OS=Homo sapiens OX=9606 GN=REXO2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.10	35.0	3	1	0
PRT	sp|Q7KZF4|SND1_HUMAN	Staphylococcal nuclease domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SND1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	549-UNIMOD:4,560-UNIMOD:4	0.08	35.0	6	3	1
PRT	sp|Q86TG7|PEG10_HUMAN	Retrotransposon-derived protein PEG10 OS=Homo sapiens OX=9606 GN=PEG10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.03	35.0	2	1	0
PRT	sp|Q9NZN4|EHD2_HUMAN	EH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=EHD2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	138-UNIMOD:4	0.05	35.0	1	1	1
PRT	sp|Q8NBS9|TXND5_HUMAN	Thioredoxin domain-containing protein 5 OS=Homo sapiens OX=9606 GN=TXNDC5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	89-UNIMOD:4,92-UNIMOD:4,83-UNIMOD:35	0.07	35.0	5	1	0
PRT	sp|Q08AM6|VAC14_HUMAN	Protein VAC14 homolog OS=Homo sapiens OX=9606 GN=VAC14 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null		0.06	35.0	3	2	1
PRT	sp|Q9H2U2-3|IPYR2_HUMAN	Isoform 3 of Inorganic pyrophosphatase 2, mitochondrial OS=Homo sapiens OX=9606 GN=PPA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.11	35.0	4	2	0
PRT	sp|P61978-3|HNRPK_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.04	35.0	12	2	0
PRT	sp|O43707-3|ACTN4_HUMAN	Isoform 3 of Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	425-UNIMOD:35	0.05	35.0	2	1	0
PRT	sp|P12277|KCRB_HUMAN	Creatine kinase B-type OS=Homo sapiens OX=9606 GN=CKB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.05	35.0	4	1	0
PRT	sp|O60568|PLOD3_HUMAN	Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3 OS=Homo sapiens OX=9606 GN=PLOD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	144-UNIMOD:4	0.04	35.0	1	1	1
PRT	sp|Q9NRG9-2|AAAS_HUMAN	Isoform 2 of Aladin OS=Homo sapiens OX=9606 GN=AAAS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.04	35.0	1	1	1
PRT	sp|Q9C0B1|FTO_HUMAN	Alpha-ketoglutarate-dependent dioxygenase FTO OS=Homo sapiens OX=9606 GN=FTO PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null		0.10	35.0	7	3	0
PRT	sp|Q15021|CND1_HUMAN	Condensin complex subunit 1 OS=Homo sapiens OX=9606 GN=NCAPD2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.01	35.0	1	1	1
PRT	sp|P80217|IN35_HUMAN	Interferon-induced 35 kDa protein OS=Homo sapiens OX=9606 GN=IFI35 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null		0.06	35.0	2	1	0
PRT	sp|Q9H6S3-2|ES8L2_HUMAN	Isoform 2 of Epidermal growth factor receptor kinase substrate 8-like protein 2 OS=Homo sapiens OX=9606 GN=EPS8L2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.06	35.0	2	1	0
PRT	sp|Q8NBF2|NHLC2_HUMAN	NHL repeat-containing protein 2 OS=Homo sapiens OX=9606 GN=NHLRC2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.08	35.0	4	2	1
PRT	sp|Q9H0S4-2|DDX47_HUMAN	Isoform 2 of Probable ATP-dependent RNA helicase DDX47 OS=Homo sapiens OX=9606 GN=DDX47	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.05	35.0	7	1	0
PRT	sp|O00567|NOP56_HUMAN	Nucleolar protein 56 OS=Homo sapiens OX=9606 GN=NOP56 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null		0.03	35.0	4	1	0
PRT	sp|Q9UGM6-2|SYWM_HUMAN	Isoform 2 of Tryptophan--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=WARS2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	102-UNIMOD:4	0.31	35.0	4	3	2
PRT	sp|P35611-5|ADDA_HUMAN	Isoform 5 of Alpha-adducin OS=Homo sapiens OX=9606 GN=ADD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.05	35.0	1	1	1
PRT	sp|Q02880-2|TOP2B_HUMAN	Isoform Beta-1 of DNA topoisomerase 2-beta OS=Homo sapiens OX=9606 GN=TOP2B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.01	35.0	1	1	1
PRT	sp|P10599|THIO_HUMAN	Thioredoxin OS=Homo sapiens OX=9606 GN=TXN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	62-UNIMOD:4,69-UNIMOD:4	0.24	35.0	2	1	0
PRT	sp|P49368|TCPG_HUMAN	T-complex protein 1 subunit gamma OS=Homo sapiens OX=9606 GN=CCT3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	152-UNIMOD:35	0.05	35.0	1	1	0
PRT	sp|P0C7P4|UCRIL_HUMAN	Putative cytochrome b-c1 complex subunit Rieske-like protein 1 OS=Homo sapiens OX=9606 GN=UQCRFS1P1 PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null		0.08	35.0	3	1	0
PRT	sp|P40227|TCPZ_HUMAN	T-complex protein 1 subunit zeta OS=Homo sapiens OX=9606 GN=CCT6A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null		0.07	35.0	7	2	0
PRT	sp|P51610|HCFC1_HUMAN	Host cell factor 1 OS=Homo sapiens OX=9606 GN=HCFC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|Q04837|SSBP_HUMAN	Single-stranded DNA-binding protein, mitochondrial OS=Homo sapiens OX=9606 GN=SSBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	35.0	null	128-UNIMOD:28	0.13	35.0	4	1	0
PRT	sp|Q9UNX4|WDR3_HUMAN	WD repeat-containing protein 3 OS=Homo sapiens OX=9606 GN=WDR3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null		0.05	35.0	2	2	2
PRT	sp|Q8IWX8|CHERP_HUMAN	Calcium homeostasis endoplasmic reticulum protein OS=Homo sapiens OX=9606 GN=CHERP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	35.0	null	154-UNIMOD:35,168-UNIMOD:4	0.03	35.0	3	1	0
PRT	sp|O95782-2|AP2A1_HUMAN	Isoform B of AP-2 complex subunit alpha-1 OS=Homo sapiens OX=9606 GN=AP2A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	null		0.06	35.0	2	1	0
PRT	sp|P34897|GLYM_HUMAN	Serine hydroxymethyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=SHMT2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null		0.08	35.0	1	1	0
PRT	sp|O15042-2|SR140_HUMAN	Isoform 2 of U2 snRNP-associated SURP motif-containing protein OS=Homo sapiens OX=9606 GN=U2SURP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.04	34.0	2	2	2
PRT	sp|P11388|TOP2A_HUMAN	DNA topoisomerase 2-alpha OS=Homo sapiens OX=9606 GN=TOP2A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	405-UNIMOD:4	0.04	34.0	5	3	2
PRT	sp|A0FGR8-2|ESYT2_HUMAN	Isoform 2 of Extended synaptotagmin-2 OS=Homo sapiens OX=9606 GN=ESYT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	1	1	1
PRT	sp|O75351|VPS4B_HUMAN	Vacuolar protein sorting-associated protein 4B OS=Homo sapiens OX=9606 GN=VPS4B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.05	34.0	2	1	0
PRT	sp|P15311|EZRI_HUMAN	Ezrin OS=Homo sapiens OX=9606 GN=EZR PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	3	1	0
PRT	sp|Q14232|EI2BA_HUMAN	Translation initiation factor eIF-2B subunit alpha OS=Homo sapiens OX=9606 GN=EIF2B1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	169-UNIMOD:4	0.08	34.0	1	1	1
PRT	sp|Q15345-3|LRC41_HUMAN	Isoform 3 of Leucine-rich repeat-containing protein 41 OS=Homo sapiens OX=9606 GN=LRRC41	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	1	1	1
PRT	sp|P53396-3|ACLY_HUMAN	Isoform 3 of ATP-citrate synthase OS=Homo sapiens OX=9606 GN=ACLY	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	4	1	0
PRT	sp|O95251-3|KAT7_HUMAN	Isoform 3 of Histone acetyltransferase KAT7 OS=Homo sapiens OX=9606 GN=KAT7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.06	34.0	2	1	0
PRT	sp|Q96G03|PGM2_HUMAN	Phosphoglucomutase-2 OS=Homo sapiens OX=9606 GN=PGM2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	3	1	0
PRT	sp|Q15388|TOM20_HUMAN	Mitochondrial import receptor subunit TOM20 homolog OS=Homo sapiens OX=9606 GN=TOMM20 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.14	34.0	2	1	0
PRT	sp|P35241-3|RADI_HUMAN	Isoform 3 of Radixin OS=Homo sapiens OX=9606 GN=RDX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.09	34.0	14	1	0
PRT	sp|P14618-3|KPYM_HUMAN	Isoform 3 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	224-UNIMOD:35	0.03	34.0	13	1	0
PRT	sp|P83916|CBX1_HUMAN	Chromobox protein homolog 1 OS=Homo sapiens OX=9606 GN=CBX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	60-UNIMOD:4	0.16	34.0	2	1	0
PRT	sp|O15260-2|SURF4_HUMAN	Isoform 2 of Surfeit locus protein 4 OS=Homo sapiens OX=9606 GN=SURF4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	7-UNIMOD:35	0.23	34.0	5	2	0
PRT	sp|P48163-2|MAOX_HUMAN	Isoform 2 of NADP-dependent malic enzyme OS=Homo sapiens OX=9606 GN=ME1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.04	34.0	2	1	0
PRT	sp|O60306|AQR_HUMAN	RNA helicase aquarius OS=Homo sapiens OX=9606 GN=AQR PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	4	2	1
PRT	sp|Q99613|EIF3C_HUMAN	Eukaryotic translation initiation factor 3 subunit C OS=Homo sapiens OX=9606 GN=EIF3C PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|O75844|FACE1_HUMAN	CAAX prenyl protease 1 homolog OS=Homo sapiens OX=9606 GN=ZMPSTE24 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.04	34.0	3	1	0
PRT	sp|Q99538|LGMN_HUMAN	Legumain OS=Homo sapiens OX=9606 GN=LGMN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.05	34.0	1	1	1
PRT	sp|Q9BZE4-2|NOG1_HUMAN	Isoform 2 of Nucleolar GTP-binding protein 1 OS=Homo sapiens OX=9606 GN=GTPBP4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	1	1	0
PRT	sp|Q9Y4L1|HYOU1_HUMAN	Hypoxia up-regulated protein 1 OS=Homo sapiens OX=9606 GN=HYOU1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	4	1	0
PRT	sp|O75691|UTP20_HUMAN	Small subunit processome component 20 homolog OS=Homo sapiens OX=9606 GN=UTP20 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	1411-UNIMOD:4	0.01	34.0	3	2	1
PRT	sp|P62495-2|ERF1_HUMAN	Isoform 2 of Eukaryotic peptide chain release factor subunit 1 OS=Homo sapiens OX=9606 GN=ETF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.13	34.0	5	2	0
PRT	sp|Q9UH65|SWP70_HUMAN	Switch-associated protein 70 OS=Homo sapiens OX=9606 GN=SWAP70 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	2	1	0
PRT	sp|Q9NX18|SDHF2_HUMAN	Succinate dehydrogenase assembly factor 2, mitochondrial OS=Homo sapiens OX=9606 GN=SDHAF2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.10	34.0	1	1	1
PRT	sp|Q9BVP2-2|GNL3_HUMAN	Isoform 2 of Guanine nucleotide-binding protein-like 3 OS=Homo sapiens OX=9606 GN=GNL3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.05	34.0	1	1	0
PRT	sp|Q96LD4-2|TRI47_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase TRIM47 OS=Homo sapiens OX=9606 GN=TRIM47	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.06	34.0	2	1	0
PRT	sp|O60443-3|GSDME_HUMAN	Isoform 3 of Gasdermin-E OS=Homo sapiens OX=9606 GN=GSDME	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	201-UNIMOD:4,207-UNIMOD:4	0.09	34.0	1	1	0
PRT	sp|Q96M27-5|PRRC1_HUMAN	Isoform 5 of Protein PRRC1 OS=Homo sapiens OX=9606 GN=PRRC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.04	34.0	3	1	0
PRT	sp|Q5T160|SYRM_HUMAN	Probable arginine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=RARS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	1	1	1
PRT	sp|P40763-3|STAT3_HUMAN	Isoform 3 of Signal transducer and activator of transcription 3 OS=Homo sapiens OX=9606 GN=STAT3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.07	34.0	2	2	2
PRT	sp|Q16539-5|MK14_HUMAN	Isoform 5 of Mitogen-activated protein kinase 14 OS=Homo sapiens OX=9606 GN=MAPK14	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.10	34.0	1	1	1
PRT	sp|Q96R06|SPAG5_HUMAN	Sperm-associated antigen 5 OS=Homo sapiens OX=9606 GN=SPAG5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	1	1	1
PRT	sp|P49902-2|5NTC_HUMAN	Isoform 2 of Cytosolic purine 5'-nucleotidase OS=Homo sapiens OX=9606 GN=NT5C2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.04	34.0	3	1	0
PRT	sp|P51665|PSMD7_HUMAN	26S proteasome non-ATPase regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PSMD7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.12	34.0	2	1	0
PRT	sp|Q6PKG0-3|LARP1_HUMAN	Isoform 2 of La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	2	1	0
PRT	sp|Q9NW15-2|ANO10_HUMAN	Isoform 2 of Anoctamin-10 OS=Homo sapiens OX=9606 GN=ANO10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.07	34.0	2	1	0
PRT	sp|Q9Y6W5-2|WASF2_HUMAN	Isoform 2 of Wiskott-Aldrich syndrome protein family member 2 OS=Homo sapiens OX=9606 GN=WASF2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.07	34.0	1	1	1
PRT	sp|O14980|XPO1_HUMAN	Exportin-1 OS=Homo sapiens OX=9606 GN=XPO1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.04	34.0	4	2	1
PRT	sp|P62495|ERF1_HUMAN	Eukaryotic peptide chain release factor subunit 1 OS=Homo sapiens OX=9606 GN=ETF1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null		0.06	34.0	2	1	0
PRT	sp|O60518|RNBP6_HUMAN	Ran-binding protein 6 OS=Homo sapiens OX=9606 GN=RANBP6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	2	2	2
PRT	sp|Q9Y5Q0|FADS3_HUMAN	Fatty acid desaturase 3 OS=Homo sapiens OX=9606 GN=FADS3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null		0.07	34.0	1	1	1
PRT	sp|Q99567|NUP88_HUMAN	Nuclear pore complex protein Nup88 OS=Homo sapiens OX=9606 GN=NUP88 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	null	2-UNIMOD:1	0.04	34.0	3	1	0
PRT	sp|Q9BQ70|TCF25_HUMAN	Transcription factor 25 OS=Homo sapiens OX=9606 GN=TCF25 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null		0.04	34.0	3	1	0
PRT	sp|O76094|SRP72_HUMAN	Signal recognition particle subunit SRP72 OS=Homo sapiens OX=9606 GN=SRP72 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null		0.03	34.0	2	1	0
PRT	sp|O15269|SPTC1_HUMAN	Serine palmitoyltransferase 1 OS=Homo sapiens OX=9606 GN=SPTLC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	100-UNIMOD:4	0.04	34.0	1	1	1
PRT	sp|P40939|ECHA_HUMAN	Trifunctional enzyme subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=HADHA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	4	1	0
PRT	sp|Q96PZ0|PUS7_HUMAN	Pseudouridylate synthase 7 homolog OS=Homo sapiens OX=9606 GN=PUS7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	2	1	0
PRT	sp|O15397-2|IPO8_HUMAN	Isoform 2 of Importin-8 OS=Homo sapiens OX=9606 GN=IPO8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.04	33.0	3	2	1
PRT	sp|O95486|SC24A_HUMAN	Protein transport protein Sec24A OS=Homo sapiens OX=9606 GN=SEC24A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.01	33.0	1	1	1
PRT	sp|P55884|EIF3B_HUMAN	Eukaryotic translation initiation factor 3 subunit B OS=Homo sapiens OX=9606 GN=EIF3B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	3	1	0
PRT	sp|O95373|IPO7_HUMAN	Importin-7 OS=Homo sapiens OX=9606 GN=IPO7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	378-UNIMOD:35,401-UNIMOD:4	0.06	33.0	4	3	2
PRT	sp|Q96ST2-2|IWS1_HUMAN	Isoform 2 of Protein IWS1 homolog OS=Homo sapiens OX=9606 GN=IWS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.04	33.0	1	1	1
PRT	sp|P49354-2|FNTA_HUMAN	Isoform 2 of Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha OS=Homo sapiens OX=9606 GN=FNTA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.06	33.0	1	1	0
PRT	sp|P15531|NDKA_HUMAN	Nucleoside diphosphate kinase A OS=Homo sapiens OX=9606 GN=NME1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	145-UNIMOD:4	0.16	33.0	2	1	0
PRT	sp|Q9BTW9-5|TBCD_HUMAN	Isoform 5 of Tubulin-specific chaperone D OS=Homo sapiens OX=9606 GN=TBCD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|P12429|ANXA3_HUMAN	Annexin A3 OS=Homo sapiens OX=9606 GN=ANXA3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	246-UNIMOD:4	0.06	33.0	1	1	1
PRT	sp|Q9P0W2-2|HM20B_HUMAN	Isoform 2 of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1-related OS=Homo sapiens OX=9606 GN=HMG20B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	75-UNIMOD:4	0.12	33.0	2	1	0
PRT	sp|Q16850-2|CP51A_HUMAN	Isoform 2 of Lanosterol 14-alpha demethylase OS=Homo sapiens OX=9606 GN=CYP51A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.04	33.0	3	1	0
PRT	sp|P49756|RBM25_HUMAN	RNA-binding protein 25 OS=Homo sapiens OX=9606 GN=RBM25 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	767-UNIMOD:35	0.03	33.0	1	1	1
PRT	sp|P49761-3|CLK3_HUMAN	Isoform 3 of Dual specificity protein kinase CLK3 OS=Homo sapiens OX=9606 GN=CLK3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.04	33.0	1	1	1
PRT	sp|O96008|TOM40_HUMAN	Mitochondrial import receptor subunit TOM40 homolog OS=Homo sapiens OX=9606 GN=TOMM40 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.05	33.0	3	1	0
PRT	sp|P11216|PYGB_HUMAN	Glycogen phosphorylase, brain form OS=Homo sapiens OX=9606 GN=PYGB PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null		0.02	33.0	3	1	0
PRT	sp|P78417-3|GSTO1_HUMAN	Isoform 3 of Glutathione S-transferase omega-1 OS=Homo sapiens OX=9606 GN=GSTO1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	87-UNIMOD:35	0.09	33.0	3	1	0
PRT	sp|Q8IWT6|LRC8A_HUMAN	Volume-regulated anion channel subunit LRRC8A OS=Homo sapiens OX=9606 GN=LRRC8A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|Q13045-2|FLII_HUMAN	Isoform 2 of Protein flightless-1 homolog OS=Homo sapiens OX=9606 GN=FLII	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	3	1	0
PRT	sp|O60547|GMDS_HUMAN	GDP-mannose 4,6 dehydratase OS=Homo sapiens OX=9606 GN=GMDS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.06	33.0	1	1	1
PRT	sp|P49720|PSB3_HUMAN	Proteasome subunit beta type-3 OS=Homo sapiens OX=9606 GN=PSMB3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.09	33.0	2	1	0
PRT	sp|Q01970-2|PLCB3_HUMAN	Isoform 2 of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3 OS=Homo sapiens OX=9606 GN=PLCB3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	767-UNIMOD:4	0.06	33.0	3	2	1
PRT	sp|Q6P3X3|TTC27_HUMAN	Tetratricopeptide repeat protein 27 OS=Homo sapiens OX=9606 GN=TTC27 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	210-UNIMOD:4	0.02	33.0	1	1	1
PRT	sp|O76071|CIAO1_HUMAN	Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Homo sapiens OX=9606 GN=CIAO1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	261-UNIMOD:4,271-UNIMOD:4	0.07	33.0	1	1	1
PRT	sp|Q13813|SPTN1_HUMAN	Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null		0.01	33.0	1	1	0
PRT	sp|Q86TX2|ACOT1_HUMAN	Acyl-coenzyme A thioesterase 1 OS=Homo sapiens OX=9606 GN=ACOT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null		0.13	33.0	2	2	1
PRT	sp|P35579|MYH9_HUMAN	Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	null	210-UNIMOD:28	0.01	33.0	1	1	1
PRT	sp|O75348|VATG1_HUMAN	V-type proton ATPase subunit G 1 OS=Homo sapiens OX=9606 GN=ATP6V1G1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	null	90-UNIMOD:28,104-UNIMOD:4	0.23	33.0	2	1	0
PRT	sp|Q99584|S10AD_HUMAN	Protein S100-A13 OS=Homo sapiens OX=9606 GN=S100A13 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	null	2-UNIMOD:1	0.26	33.0	2	1	0
PRT	sp|P54727|RD23B_HUMAN	UV excision repair protein RAD23 homolog B OS=Homo sapiens OX=9606 GN=RAD23B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	null	290-UNIMOD:28	0.05	33.0	3	1	0
PRT	sp|O95071|UBR5_HUMAN	E3 ubiquitin-protein ligase UBR5 OS=Homo sapiens OX=9606 GN=UBR5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null		0.01	33.0	1	1	1
PRT	sp|Q9C005|DPY30_HUMAN	Protein dpy-30 homolog OS=Homo sapiens OX=9606 GN=DPY30 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null		0.17	33.0	7	1	0
PRT	sp|Q9BVP2|GNL3_HUMAN	Guanine nucleotide-binding protein-like 3 OS=Homo sapiens OX=9606 GN=GNL3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	null	300-UNIMOD:28	0.05	33.0	1	1	0
PRT	sp|Q15042|RB3GP_HUMAN	Rab3 GTPase-activating protein catalytic subunit OS=Homo sapiens OX=9606 GN=RAB3GAP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	322-UNIMOD:4	0.02	33.0	2	1	0
PRT	sp|Q8NHH9|ATLA2_HUMAN	Atlastin-2 OS=Homo sapiens OX=9606 GN=ATL2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null		0.03	33.0	1	1	0
PRT	sp|P27695|APEX1_HUMAN	DNA-(apurinic or apyrimidinic site) lyase OS=Homo sapiens OX=9606 GN=APEX1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	33.0	null	238-UNIMOD:28	0.06	33.0	2	1	0
PRT	sp|P49841|GSK3B_HUMAN	Glycogen synthase kinase-3 beta OS=Homo sapiens OX=9606 GN=GSK3B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null		0.07	33.0	1	1	1
PRT	sp|P23588|IF4B_HUMAN	Eukaryotic translation initiation factor 4B OS=Homo sapiens OX=9606 GN=EIF4B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null		0.04	33.0	1	1	0
PRT	sp|O00506-3|STK25_HUMAN	Isoform 3 of Serine/threonine-protein kinase 25 OS=Homo sapiens OX=9606 GN=STK25	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.05	32.0	1	1	1
PRT	sp|Q9UKX7-2|NUP50_HUMAN	Isoform 2 of Nuclear pore complex protein Nup50 OS=Homo sapiens OX=9606 GN=NUP50	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	388-UNIMOD:4	0.05	32.0	1	1	1
PRT	sp|Q9H078-5|CLPB_HUMAN	Isoform 5 of Caseinolytic peptidase B protein homolog OS=Homo sapiens OX=9606 GN=CLPB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|P42695|CNDD3_HUMAN	Condensin-2 complex subunit D3 OS=Homo sapiens OX=9606 GN=NCAPD3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.01	32.0	1	1	1
PRT	sp|P40227-2|TCPZ_HUMAN	Isoform 2 of T-complex protein 1 subunit zeta OS=Homo sapiens OX=9606 GN=CCT6A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	4	1	0
PRT	sp|Q9Y320-2|TMX2_HUMAN	Isoform 2 of Thioredoxin-related transmembrane protein 2 OS=Homo sapiens OX=9606 GN=TMX2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.06	32.0	3	1	0
PRT	sp|P31937|3HIDH_HUMAN	3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=HIBADH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.05	32.0	2	1	0
PRT	sp|Q14008-2|CKAP5_HUMAN	Isoform 2 of Cytoskeleton-associated protein 5 OS=Homo sapiens OX=9606 GN=CKAP5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.01	32.0	1	1	1
PRT	sp|Q969Y2-3|GTPB3_HUMAN	Isoform 3 of tRNA modification GTPase GTPBP3, mitochondrial OS=Homo sapiens OX=9606 GN=GTPBP3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.05	32.0	1	1	1
PRT	sp|P07602|SAP_HUMAN	Prosaposin OS=Homo sapiens OX=9606 GN=PSAP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	2	1	0
PRT	sp|Q53GS9-2|SNUT2_HUMAN	Isoform 2 of U4/U6.U5 tri-snRNP-associated protein 2 OS=Homo sapiens OX=9606 GN=USP39	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	3	1	0
PRT	sp|P23141|EST1_HUMAN	Liver carboxylesterase 1 OS=Homo sapiens OX=9606 GN=CES1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.08	32.0	5	2	1
PRT	sp|P57740-3|NU107_HUMAN	Isoform 3 of Nuclear pore complex protein Nup107 OS=Homo sapiens OX=9606 GN=NUP107	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.05	32.0	2	2	2
PRT	sp|Q9NP92|RT30_HUMAN	39S ribosomal protein S30, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS30 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.05	32.0	3	1	0
PRT	sp|Q9Y5Y2|NUBP2_HUMAN	Cytosolic Fe-S cluster assembly factor NUBP2 OS=Homo sapiens OX=9606 GN=NUBP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.10	32.0	2	1	0
PRT	sp|Q3SXM5-2|HSDL1_HUMAN	Isoform 2 of Inactive hydroxysteroid dehydrogenase-like protein 1 OS=Homo sapiens OX=9606 GN=HSDL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.09	32.0	1	1	0
PRT	sp|P0DPD7|EFMT4_HUMAN	EEF1A lysine methyltransferase 4 OS=Homo sapiens OX=9606 GN=EEF1AKMT4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.13	32.0	2	1	0
PRT	sp|Q9H568|ACTL8_HUMAN	Actin-like protein 8 OS=Homo sapiens OX=9606 GN=ACTL8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.06	32.0	1	1	1
PRT	sp|P49590-2|SYHM_HUMAN	Isoform 2 of Histidine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=HARS2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	172-UNIMOD:4	0.04	32.0	1	1	1
PRT	sp|Q05209-2|PTN12_HUMAN	Isoform 2 of Tyrosine-protein phosphatase non-receptor type 12 OS=Homo sapiens OX=9606 GN=PTPN12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|P60891-2|PRPS1_HUMAN	Isoform 2 of Ribose-phosphate pyrophosphokinase 1 OS=Homo sapiens OX=9606 GN=PRPS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.06	32.0	4	1	0
PRT	sp|O75382-4|TRIM3_HUMAN	Isoform 4 of Tripartite motif-containing protein 3 OS=Homo sapiens OX=9606 GN=TRIM3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|P13995-2|MTDC_HUMAN	Isoform 2 of Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=MTHFD2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	64-UNIMOD:4	0.19	32.0	2	2	2
PRT	sp|Q09028-3|RBBP4_HUMAN	Isoform 3 of Histone-binding protein RBBP4 OS=Homo sapiens OX=9606 GN=RBBP4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.09	32.0	2	1	0
PRT	sp|O75165|DJC13_HUMAN	DnaJ homolog subfamily C member 13 OS=Homo sapiens OX=9606 GN=DNAJC13 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	2	2	2
PRT	sp|Q9Y3C4-2|TPRKB_HUMAN	Isoform 2 of EKC/KEOPS complex subunit TPRKB OS=Homo sapiens OX=9606 GN=TPRKB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	134-UNIMOD:4	0.13	32.0	2	1	0
PRT	sp|Q8WXH0|SYNE2_HUMAN	Nesprin-2 OS=Homo sapiens OX=9606 GN=SYNE2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	6663-UNIMOD:4	0.01	32.0	3	2	1
PRT	sp|P10586-2|PTPRF_HUMAN	Isoform 2 of Receptor-type tyrosine-protein phosphatase F OS=Homo sapiens OX=9606 GN=PTPRF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.01	32.0	1	1	1
PRT	sp|P42224-2|STAT1_HUMAN	Isoform Beta of Signal transducer and activator of transcription 1-alpha/beta OS=Homo sapiens OX=9606 GN=STAT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|Q12788|TBL3_HUMAN	Transducin beta-like protein 3 OS=Homo sapiens OX=9606 GN=TBL3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	3	2	1
PRT	sp|P07954-2|FUMH_HUMAN	Isoform Cytoplasmic of Fumarate hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=FH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	290-UNIMOD:4,293-UNIMOD:35	0.09	32.0	2	1	0
PRT	sp|Q8N3E9|PLCD3_HUMAN	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3 OS=Homo sapiens OX=9606 GN=PLCD3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|O94966-4|UBP19_HUMAN	Isoform 4 of Ubiquitin carboxyl-terminal hydrolase 19 OS=Homo sapiens OX=9606 GN=USP19	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.01	32.0	1	1	1
PRT	sp|O14802|RPC1_HUMAN	DNA-directed RNA polymerase III subunit RPC1 OS=Homo sapiens OX=9606 GN=POLR3A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|P61221|ABCE1_HUMAN	ATP-binding cassette sub-family E member 1 OS=Homo sapiens OX=9606 GN=ABCE1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	2	1	0
PRT	sp|Q00610|CLH1_HUMAN	Clathrin heavy chain 1 OS=Homo sapiens OX=9606 GN=CLTC PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	1596-UNIMOD:35	0.03	32.0	2	2	2
PRT	sp|Q69YN4|VIR_HUMAN	Protein virilizer homolog OS=Homo sapiens OX=9606 GN=VIRMA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	null	781-UNIMOD:385,781-UNIMOD:4	0.02	32.0	1	1	1
PRT	sp|P46940|IQGA1_HUMAN	Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens OX=9606 GN=IQGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	32.0	null	148-UNIMOD:385,148-UNIMOD:4,151-UNIMOD:4	0.02	32.0	2	2	2
PRT	sp|Q9H7Z7|PGES2_HUMAN	Prostaglandin E synthase 2 OS=Homo sapiens OX=9606 GN=PTGES2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	null	236-UNIMOD:28	0.05	32.0	2	1	0
PRT	sp|P16383|GCFC2_HUMAN	GC-rich sequence DNA-binding factor 2 OS=Homo sapiens OX=9606 GN=GCFC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	585-UNIMOD:4	0.03	32.0	1	1	1
PRT	sp|P13861|KAP2_HUMAN	cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	null	2-UNIMOD:1	0.06	32.0	3	1	0
PRT	sp|Q02878|RL6_HUMAN	60S ribosomal protein L6 OS=Homo sapiens OX=9606 GN=RPL6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	32.0	null	167-UNIMOD:28	0.06	32.0	4	1	0
PRT	sp|P49902|5NTC_HUMAN	Cytosolic purine 5'-nucleotidase OS=Homo sapiens OX=9606 GN=NT5C2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null		0.03	32.0	2	1	0
PRT	sp|Q9BWM7|SFXN3_HUMAN	Sideroflexin-3 OS=Homo sapiens OX=9606 GN=SFXN3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	null	145-UNIMOD:28	0.07	32.0	1	1	1
PRT	sp|P14314|GLU2B_HUMAN	Glucosidase 2 subunit beta OS=Homo sapiens OX=9606 GN=PRKCSH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	null	500-UNIMOD:385,500-UNIMOD:4,512-UNIMOD:4	0.06	32.0	1	1	0
PRT	sp|Q9H8Y8|GORS2_HUMAN	Golgi reassembly-stacking protein 2 OS=Homo sapiens OX=9606 GN=GORASP2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	103-UNIMOD:4	0.18	31.0	3	2	1
PRT	sp|Q7Z4S6-6|KI21A_HUMAN	Isoform 6 of Kinesin-like protein KIF21A OS=Homo sapiens OX=9606 GN=KIF21A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	299-UNIMOD:4	0.02	31.0	1	1	1
PRT	sp|P10619-2|PPGB_HUMAN	Isoform 2 of Lysosomal protective protein OS=Homo sapiens OX=9606 GN=CTSA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	345-UNIMOD:4	0.05	31.0	1	1	1
PRT	sp|Q99880|H2B1L_HUMAN	Histone H2B type 1-L OS=Homo sapiens OX=9606 GN=H2BC13 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.13	31.0	1	1	0
PRT	sp|Q96RL7-4|VP13A_HUMAN	Isoform 4 of Vacuolar protein sorting-associated protein 13A OS=Homo sapiens OX=9606 GN=VPS13A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.01	31.0	1	1	1
PRT	sp|Q5SY16|NOL9_HUMAN	Polynucleotide 5'-hydroxyl-kinase NOL9 OS=Homo sapiens OX=9606 GN=NOL9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	3	1	0
PRT	sp|Q9GZT4|SRR_HUMAN	Serine racemase OS=Homo sapiens OX=9606 GN=SRR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.05	31.0	1	1	1
PRT	sp|Q92878-3|RAD50_HUMAN	Isoform 3 of DNA repair protein RAD50 OS=Homo sapiens OX=9606 GN=RAD50	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|Q86YQ8-2|CPNE8_HUMAN	Isoform 2 of Copine-8 OS=Homo sapiens OX=9606 GN=CPNE8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.07	31.0	1	1	1
PRT	sp|Q8WVY7|UBCP1_HUMAN	Ubiquitin-like domain-containing CTD phosphatase 1 OS=Homo sapiens OX=9606 GN=UBLCP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.13	31.0	1	1	1
PRT	sp|P37198|NUP62_HUMAN	Nuclear pore glycoprotein p62 OS=Homo sapiens OX=9606 GN=NUP62 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	2	1	0
PRT	sp|O43592|XPOT_HUMAN	Exportin-T OS=Homo sapiens OX=9606 GN=XPOT PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|Q96CN7|ISOC1_HUMAN	Isochorismatase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ISOC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.07	31.0	2	1	0
PRT	sp|P98155-2|VLDLR_HUMAN	Isoform Short of Very low-density lipoprotein receptor OS=Homo sapiens OX=9606 GN=VLDLR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.04	31.0	1	1	1
PRT	sp|P40937-2|RFC5_HUMAN	Isoform 2 of Replication factor C subunit 5 OS=Homo sapiens OX=9606 GN=RFC5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.08	31.0	2	1	0
PRT	sp|P11802-2|CDK4_HUMAN	Isoform 2 of Cyclin-dependent kinase 4 OS=Homo sapiens OX=9606 GN=CDK4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.17	31.0	1	1	1
PRT	sp|O95302|FKBP9_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP9 OS=Homo sapiens OX=9606 GN=FKBP9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.07	31.0	3	1	0
PRT	sp|Q9Y617-2|SERC_HUMAN	Isoform 2 of Phosphoserine aminotransferase OS=Homo sapiens OX=9606 GN=PSAT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	152-UNIMOD:4	0.11	31.0	1	1	1
PRT	sp|O75083-3|WDR1_HUMAN	Isoform 2 of WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=WDR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	145-UNIMOD:4	0.07	31.0	1	1	1
PRT	sp|Q16718-2|NDUA5_HUMAN	Isoform 2 of NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 OS=Homo sapiens OX=9606 GN=NDUFA5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.22	31.0	1	1	1
PRT	sp|Q14566|MCM6_HUMAN	DNA replication licensing factor MCM6 OS=Homo sapiens OX=9606 GN=MCM6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|Q5JTH9-2|RRP12_HUMAN	Isoform 2 of RRP12-like protein OS=Homo sapiens OX=9606 GN=RRP12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.01	31.0	2	1	0
PRT	sp|O95352-3|ATG7_HUMAN	Isoform 3 of Ubiquitin-like modifier-activating enzyme ATG7 OS=Homo sapiens OX=9606 GN=ATG7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|Q9UK61-2|TASOR_HUMAN	Isoform 2 of Protein TASOR OS=Homo sapiens OX=9606 GN=TASOR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.01	31.0	1	1	1
PRT	sp|Q8NF37|PCAT1_HUMAN	Lysophosphatidylcholine acyltransferase 1 OS=Homo sapiens OX=9606 GN=LPCAT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.07	31.0	1	1	1
PRT	sp|Q6P587|FAHD1_HUMAN	Acylpyruvase FAHD1, mitochondrial OS=Homo sapiens OX=9606 GN=FAHD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.10	31.0	3	1	0
PRT	sp|Q5H9R7-3|PP6R3_HUMAN	Isoform 3 of Serine/threonine-protein phosphatase 6 regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PPP6R3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	2	1	0
PRT	sp|Q14997-3|PSME4_HUMAN	Isoform 3 of Proteasome activator complex subunit 4 OS=Homo sapiens OX=9606 GN=PSME4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|Q9NQG5|RPR1B_HUMAN	Regulation of nuclear pre-mRNA domain-containing protein 1B OS=Homo sapiens OX=9606 GN=RPRD1B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.10	31.0	2	1	0
PRT	sp|P49454|CENPF_HUMAN	Centromere protein F OS=Homo sapiens OX=9606 GN=CENPF PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.01	31.0	1	1	1
PRT	sp|P04181-2|OAT_HUMAN	Isoform 2 of Ornithine aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=OAT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.13	31.0	2	1	0
PRT	sp|Q7Z2Z2-2|EFL1_HUMAN	Isoform 2 of Elongation factor-like GTPase 1 OS=Homo sapiens OX=9606 GN=EFL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.06	31.0	4	2	1
PRT	sp|Q69YN4-2|VIR_HUMAN	Isoform 2 of Protein virilizer homolog OS=Homo sapiens OX=9606 GN=VIRMA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	1045-UNIMOD:4	0.03	31.0	2	2	2
PRT	sp|P29692-3|EF1D_HUMAN	Isoform 3 of Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.11	31.0	1	1	1
PRT	sp|Q92621|NU205_HUMAN	Nuclear pore complex protein Nup205 OS=Homo sapiens OX=9606 GN=NUP205 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	2	2	2
PRT	sp|Q7Z4H8-3|PLGT3_HUMAN	Isoform 3 of Protein O-glucosyltransferase 3 OS=Homo sapiens OX=9606 GN=POGLUT3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.05	31.0	1	1	0
PRT	sp|Q15637-4|SF01_HUMAN	Isoform 4 of Splicing factor 1 OS=Homo sapiens OX=9606 GN=SF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	141-UNIMOD:35	0.04	31.0	1	1	0
PRT	sp|Q92598-2|HS105_HUMAN	Isoform Beta of Heat shock protein 105 kDa OS=Homo sapiens OX=9606 GN=HSPH1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.07	31.0	3	2	1
PRT	sp|P17812-2|PYRG1_HUMAN	Isoform 2 of CTP synthase 1 OS=Homo sapiens OX=9606 GN=CTPS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.05	31.0	1	1	1
PRT	sp|A8MT69|CENPX_HUMAN	Centromere protein X OS=Homo sapiens OX=9606 GN=CENPX PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.19	31.0	1	1	1
PRT	sp|Q86VU5|CMTD1_HUMAN	Catechol O-methyltransferase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=COMTD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	198-UNIMOD:385,198-UNIMOD:4	0.13	31.0	2	2	2
PRT	sp|Q9BYZ2|LDH6B_HUMAN	L-lactate dehydrogenase A-like 6B OS=Homo sapiens OX=9606 GN=LDHAL6B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.05	31.0	3	1	0
PRT	sp|P22314|UBA1_HUMAN	Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	410-UNIMOD:35	0.03	31.0	2	1	0
PRT	sp|Q9NTJ3|SMC4_HUMAN	Structural maintenance of chromosomes protein 4 OS=Homo sapiens OX=9606 GN=SMC4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.03	31.0	2	1	0
PRT	sp|O14975|S27A2_HUMAN	Very long-chain acyl-CoA synthetase OS=Homo sapiens OX=9606 GN=SLC27A2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.04	31.0	2	1	0
PRT	sp|Q10567|AP1B1_HUMAN	AP-1 complex subunit beta-1 OS=Homo sapiens OX=9606 GN=AP1B1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	391-UNIMOD:385,391-UNIMOD:4	0.04	31.0	4	2	1
PRT	sp|Q14527|HLTF_HUMAN	Helicase-like transcription factor OS=Homo sapiens OX=9606 GN=HLTF PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	null	524-UNIMOD:28	0.02	31.0	1	1	1
PRT	sp|Q9BT67|NFIP1_HUMAN	NEDD4 family-interacting protein 1 OS=Homo sapiens OX=9606 GN=NDFIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	null	2-UNIMOD:1,15-UNIMOD:4	0.08	31.0	3	1	0
PRT	sp|Q96DC8|ECHD3_HUMAN	Enoyl-CoA hydratase domain-containing protein 3, mitochondrial OS=Homo sapiens OX=9606 GN=ECHDC3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.09	31.0	1	1	1
PRT	sp|O00483|NDUA4_HUMAN	Cytochrome c oxidase subunit NDUFA4 OS=Homo sapiens OX=9606 GN=NDUFA4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.32	31.0	2	1	0
PRT	sp|Q92499|DDX1_HUMAN	ATP-dependent RNA helicase DDX1 OS=Homo sapiens OX=9606 GN=DDX1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.04	31.0	1	1	1
PRT	sp|P60891|PRPS1_HUMAN	Ribose-phosphate pyrophosphokinase 1 OS=Homo sapiens OX=9606 GN=PRPS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.19	31.0	2	2	1
PRT	sp|O00308-3|WWP2_HUMAN	Isoform 3 of NEDD4-like E3 ubiquitin-protein ligase WWP2 OS=Homo sapiens OX=9606 GN=WWP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.04	30.0	1	1	1
PRT	sp|Q9H4A6|GOLP3_HUMAN	Golgi phosphoprotein 3 OS=Homo sapiens OX=9606 GN=GOLPH3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.10	30.0	3	2	1
PRT	sp|Q5SRE5-2|NU188_HUMAN	Isoform 2 of Nucleoporin NUP188 homolog OS=Homo sapiens OX=9606 GN=NUP188	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	2	1	0
PRT	sp|Q96ER3|SAAL1_HUMAN	Protein SAAL1 OS=Homo sapiens OX=9606 GN=SAAL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	430-UNIMOD:4	0.05	30.0	2	1	0
PRT	sp|P06737-2|PYGL_HUMAN	Isoform 2 of Glycogen phosphorylase, liver form OS=Homo sapiens OX=9606 GN=PYGL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	3	1	0
PRT	sp|Q96JB5|CK5P3_HUMAN	CDK5 regulatory subunit-associated protein 3 OS=Homo sapiens OX=9606 GN=CDK5RAP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|P15880|RS2_HUMAN	40S ribosomal protein S2 OS=Homo sapiens OX=9606 GN=RPS2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null		0.07	30.0	7	2	0
PRT	sp|Q9NU22|MDN1_HUMAN	Midasin OS=Homo sapiens OX=9606 GN=MDN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	43-UNIMOD:4	0.01	30.0	3	3	3
PRT	sp|Q15046|SYK_HUMAN	Lysine--tRNA ligase OS=Homo sapiens OX=9606 GN=KARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	209-UNIMOD:4	0.05	30.0	1	1	1
PRT	sp|P24928|RPB1_HUMAN	DNA-directed RNA polymerase II subunit RPB1 OS=Homo sapiens OX=9606 GN=POLR2A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	2	1	0
PRT	sp|P52789|HXK2_HUMAN	Hexokinase-2 OS=Homo sapiens OX=9606 GN=HK2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	133-UNIMOD:4	0.02	30.0	1	1	1
PRT	sp|Q9Y6Y8-2|S23IP_HUMAN	Isoform 2 of SEC23-interacting protein OS=Homo sapiens OX=9606 GN=SEC23IP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	678-UNIMOD:4	0.02	30.0	1	1	1
PRT	sp|P22626-2|ROA2_HUMAN	Isoform A2 of Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.19	30.0	3	3	3
PRT	sp|Q9NTI5-2|PDS5B_HUMAN	Isoform 2 of Sister chromatid cohesion protein PDS5 homolog B OS=Homo sapiens OX=9606 GN=PDS5B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	2	1	0
PRT	sp|Q8N122-3|RPTOR_HUMAN	Isoform 3 of Regulatory-associated protein of mTOR OS=Homo sapiens OX=9606 GN=RPTOR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	2	1	0
PRT	sp|Q13362-2|2A5G_HUMAN	Isoform Gamma-1 of Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform OS=Homo sapiens OX=9606 GN=PPP2R5C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.09	30.0	3	2	1
PRT	sp|Q15459-2|SF3A1_HUMAN	Isoform 2 of Splicing factor 3A subunit 1 OS=Homo sapiens OX=9606 GN=SF3A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.04	30.0	4	1	0
PRT	sp|Q9NWX6|THG1_HUMAN	Probable tRNA(His) guanylyltransferase OS=Homo sapiens OX=9606 GN=THG1L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	180-UNIMOD:4	0.11	30.0	1	1	1
PRT	sp|Q00005-6|2ABB_HUMAN	Isoform 6 of Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform OS=Homo sapiens OX=9606 GN=PPP2R2B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	2	1	0
PRT	sp|Q13084|RM28_HUMAN	39S ribosomal protein L28, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL28 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.17	30.0	2	2	2
PRT	sp|Q9Y3Z3-3|SAMH1_HUMAN	Isoform 3 of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 OS=Homo sapiens OX=9606 GN=SAMHD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|O95837|GNA14_HUMAN	Guanine nucleotide-binding protein subunit alpha-14 OS=Homo sapiens OX=9606 GN=GNA14 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.06	30.0	2	1	0
PRT	sp|O14519-2|CDKA1_HUMAN	Isoform 2 of Cyclin-dependent kinase 2-associated protein 1 OS=Homo sapiens OX=9606 GN=CDK2AP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.16	30.0	2	1	0
PRT	sp|Q8NHH9-3|ATLA2_HUMAN	Isoform 3 of Atlastin-2 OS=Homo sapiens OX=9606 GN=ATL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.05	30.0	1	1	0
PRT	sp|P31943|HNRH1_HUMAN	Heterogeneous nuclear ribonucleoprotein H OS=Homo sapiens OX=9606 GN=HNRNPH1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	30.0	null		0.10	30.0	4	2	1
PRT	sp|Q96S52|PIGS_HUMAN	GPI transamidase component PIG-S OS=Homo sapiens OX=9606 GN=PIGS PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null		0.04	30.0	1	1	0
PRT	sp|P29084|T2EB_HUMAN	Transcription initiation factor IIE subunit beta OS=Homo sapiens OX=9606 GN=GTF2E2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null		0.07	30.0	1	1	1
PRT	sp|Q9Y4X5|ARI1_HUMAN	E3 ubiquitin-protein ligase ARIH1 OS=Homo sapiens OX=9606 GN=ARIH1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	null	63-UNIMOD:4,116-UNIMOD:4	0.11	30.0	1	1	1
PRT	sp|P04181|OAT_HUMAN	Ornithine aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=OAT PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	201-UNIMOD:35	0.09	30.0	1	1	0
PRT	sp|Q5VTL8|PR38B_HUMAN	Pre-mRNA-splicing factor 38B OS=Homo sapiens OX=9606 GN=PRPF38B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null		0.04	30.0	1	1	1
PRT	sp|Q86TU7|SETD3_HUMAN	Actin-histidine N-methyltransferase OS=Homo sapiens OX=9606 GN=SETD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null		0.05	30.0	1	1	1
PRT	sp|P61978|HNRPK_HUMAN	Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null		0.04	30.0	3	2	0
PRT	sp|P35232|PHB_HUMAN	Prohibitin OS=Homo sapiens OX=9606 GN=PHB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	30.0	null		0.17	30.0	2	2	2
PRT	sp|Q8IVP5|FUND1_HUMAN	FUN14 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FUNDC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.12	29.0	2	1	0
PRT	sp|Q92614-5|MY18A_HUMAN	Isoform 5 of Unconventional myosin-XVIIIa OS=Homo sapiens OX=9606 GN=MYO18A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	246-UNIMOD:4	0.01	29.0	1	1	1
PRT	sp|Q14573|ITPR3_HUMAN	Inositol 1,4,5-trisphosphate receptor type 3 OS=Homo sapiens OX=9606 GN=ITPR3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	2455-UNIMOD:4,2461-UNIMOD:4	0.01	29.0	1	1	1
PRT	sp|Q8WUQ7|CATIN_HUMAN	Cactin OS=Homo sapiens OX=9606 GN=CACTIN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|Q16222-2|UAP1_HUMAN	Isoform AGX1 of UDP-N-acetylhexosamine pyrophosphorylase OS=Homo sapiens OX=9606 GN=UAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	464-UNIMOD:4	0.06	29.0	1	1	1
PRT	sp|Q4G0J3-2|LARP7_HUMAN	Isoform 2 of La-related protein 7 OS=Homo sapiens OX=9606 GN=LARP7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	125-UNIMOD:4	0.12	29.0	1	1	1
PRT	sp|Q9UHB9-4|SRP68_HUMAN	Isoform 4 of Signal recognition particle subunit SRP68 OS=Homo sapiens OX=9606 GN=SRP68	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|O95155-3|UBE4B_HUMAN	Isoform 3 of Ubiquitin conjugation factor E4 B OS=Homo sapiens OX=9606 GN=UBE4B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	188-UNIMOD:4	0.03	29.0	2	2	2
PRT	sp|Q6YHK3-2|CD109_HUMAN	Isoform 2 of CD109 antigen OS=Homo sapiens OX=9606 GN=CD109	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.05	29.0	4	3	2
PRT	sp|Q16706|MA2A1_HUMAN	Alpha-mannosidase 2 OS=Homo sapiens OX=9606 GN=MAN2A1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|P35237|SPB6_HUMAN	Serpin B6 OS=Homo sapiens OX=9606 GN=SERPINB6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null		0.05	29.0	2	1	0
PRT	sp|O15554|KCNN4_HUMAN	Intermediate conductance calcium-activated potassium channel protein 4 OS=Homo sapiens OX=9606 GN=KCNN4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	2	1	0
PRT	sp|O95861-3|BPNT1_HUMAN	Isoform 3 of 3'(2'),5'-bisphosphate nucleotidase 1 OS=Homo sapiens OX=9606 GN=BPNT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.12	29.0	1	1	1
PRT	sp|Q32P28-2|P3H1_HUMAN	Isoform 2 of Prolyl 3-hydroxylase 1 OS=Homo sapiens OX=9606 GN=P3H1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	242-UNIMOD:4	0.17	29.0	2	2	1
PRT	sp|P51649|SSDH_HUMAN	Succinate-semialdehyde dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ALDH5A1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	426-UNIMOD:4,434-UNIMOD:4	0.06	29.0	1	1	1
PRT	sp|Q9Y5U8|MPC1_HUMAN	Mitochondrial pyruvate carrier 1 OS=Homo sapiens OX=9606 GN=MPC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	83-UNIMOD:4	0.45	29.0	2	2	2
PRT	sp|Q9NRL2-2|BAZ1A_HUMAN	Isoform 2 of Bromodomain adjacent to zinc finger domain protein 1A OS=Homo sapiens OX=9606 GN=BAZ1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|P52948-6|NUP98_HUMAN	Isoform 6 of Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens OX=9606 GN=NUP98	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|Q02218-2|ODO1_HUMAN	Isoform 2 of 2-oxoglutarate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=OGDH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	9	2	0
PRT	sp|Q8TCD5-2|NT5C_HUMAN	Isoform 2 of 5'(3')-deoxyribonucleotidase, cytosolic type OS=Homo sapiens OX=9606 GN=NT5C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.38	29.0	3	2	1
PRT	sp|Q9P0U1|TOM7_HUMAN	Mitochondrial import receptor subunit TOM7 homolog OS=Homo sapiens OX=9606 GN=TOMM7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	44-UNIMOD:35	0.58	29.0	3	2	1
PRT	sp|Q32P28|P3H1_HUMAN	Prolyl 3-hydroxylase 1 OS=Homo sapiens OX=9606 GN=P3H1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null		0.04	29.0	1	1	0
PRT	sp|O60784|TOM1_HUMAN	Target of Myb protein 1 OS=Homo sapiens OX=9606 GN=TOM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	null	1-UNIMOD:1	0.03	29.0	1	1	1
PRT	sp|Q9BUR5|MIC26_HUMAN	MICOS complex subunit MIC26 OS=Homo sapiens OX=9606 GN=APOO PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	29.0	null	89-UNIMOD:35	0.13	29.0	2	1	0
PRT	sp|Q5VV41|ARHGG_HUMAN	Rho guanine nucleotide exchange factor 16 OS=Homo sapiens OX=9606 GN=ARHGEF16 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null		0.04	29.0	1	1	1
PRT	sp|Q8IU81|I2BP1_HUMAN	Interferon regulatory factor 2-binding protein 1 OS=Homo sapiens OX=9606 GN=IRF2BP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	1	1	1
PRT	sp|Q8N3Z3-2|GTPB8_HUMAN	Isoform 2 of GTP-binding protein 8 OS=Homo sapiens OX=9606 GN=GTPBP8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.06	28.0	1	1	1
PRT	sp|Q96QK1|VPS35_HUMAN	Vacuolar protein sorting-associated protein 35 OS=Homo sapiens OX=9606 GN=VPS35 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null		0.05	28.0	4	2	0
PRT	sp|O15294-2|OGT1_HUMAN	Isoform 2 of UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens OX=9606 GN=OGT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|Q9UKJ3-2|GPTC8_HUMAN	Isoform 2 of G patch domain-containing protein 8 OS=Homo sapiens OX=9606 GN=GPATCH8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|O15270|SPTC2_HUMAN	Serine palmitoyltransferase 2 OS=Homo sapiens OX=9606 GN=SPTLC2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.07	28.0	2	2	2
PRT	sp|P18858-2|DNLI1_HUMAN	Isoform 2 of DNA ligase 1 OS=Homo sapiens OX=9606 GN=LIG1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	2	1	0
PRT	sp|Q14956-2|GPNMB_HUMAN	Isoform 2 of Transmembrane glycoprotein NMB OS=Homo sapiens OX=9606 GN=GPNMB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|P49585|PCY1A_HUMAN	Choline-phosphate cytidylyltransferase A OS=Homo sapiens OX=9606 GN=PCYT1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.05	28.0	1	1	1
PRT	sp|O60884|DNJA2_HUMAN	DnaJ homolog subfamily A member 2 OS=Homo sapiens OX=9606 GN=DNAJA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null	84-UNIMOD:35,100-UNIMOD:35	0.08	28.0	2	1	0
PRT	sp|O00411|RPOM_HUMAN	DNA-directed RNA polymerase, mitochondrial OS=Homo sapiens OX=9606 GN=POLRMT PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null		0.02	28.0	2	1	0
PRT	sp|P17655-2|CAN2_HUMAN	Isoform 2 of Calpain-2 catalytic subunit OS=Homo sapiens OX=9606 GN=CAPN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	2	1	0
PRT	sp|Q5T2N8|ATD3C_HUMAN	ATPase family AAA domain-containing protein 3C OS=Homo sapiens OX=9606 GN=ATAD3C PE=2 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	1	1	1
PRT	sp|Q8TF76|HASP_HUMAN	Serine/threonine-protein kinase haspin OS=Homo sapiens OX=9606 GN=HASPIN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|Q14257|RCN2_HUMAN	Reticulocalbin-2 OS=Homo sapiens OX=9606 GN=RCN2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null		0.25	28.0	3	3	3
PRT	sp|Q13057|COASY_HUMAN	Bifunctional coenzyme A synthase OS=Homo sapiens OX=9606 GN=COASY PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|Q06830|PRDX1_HUMAN	Peroxiredoxin-1 OS=Homo sapiens OX=9606 GN=PRDX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	71-UNIMOD:4,83-UNIMOD:4	0.13	28.0	1	1	1
PRT	sp|O00178|GTPB1_HUMAN	GTP-binding protein 1 OS=Homo sapiens OX=9606 GN=GTPBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	2	1	0
PRT	sp|Q9ULT8|HECD1_HUMAN	E3 ubiquitin-protein ligase HECTD1 OS=Homo sapiens OX=9606 GN=HECTD1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	287-UNIMOD:4	0.01	28.0	1	1	1
PRT	sp|Q6PIY7-2|GLD2_HUMAN	Isoform 2 of Poly(A) RNA polymerase GLD2 OS=Homo sapiens OX=9606 GN=TENT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|Q04917|1433F_HUMAN	14-3-3 protein eta OS=Homo sapiens OX=9606 GN=YWHAH PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.12	28.0	1	1	1
PRT	sp|Q15365|PCBP1_HUMAN	Poly(rC)-binding protein 1 OS=Homo sapiens OX=9606 GN=PCBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	28.0	null	163-UNIMOD:4,293-UNIMOD:4,161-UNIMOD:28	0.13	28.0	4	2	1
PRT	sp|P35251-2|RFC1_HUMAN	Isoform 2 of Replication factor C subunit 1 OS=Homo sapiens OX=9606 GN=RFC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|Q7Z3B4-2|NUP54_HUMAN	Isoform 2 of Nucleoporin p54 OS=Homo sapiens OX=9606 GN=NUP54	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.08	28.0	2	1	0
PRT	sp|P30260|CDC27_HUMAN	Cell division cycle protein 27 homolog OS=Homo sapiens OX=9606 GN=CDC27 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	156-UNIMOD:4	0.04	28.0	2	1	0
PRT	sp|O14975-2|S27A2_HUMAN	Isoform 2 of Very long-chain acyl-CoA synthetase OS=Homo sapiens OX=9606 GN=SLC27A2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|Q9UGM6|SYWM_HUMAN	Tryptophan--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=WARS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	null	149-UNIMOD:28	0.07	28.0	1	1	1
PRT	sp|O14929|HAT1_HUMAN	Histone acetyltransferase type B catalytic subunit OS=Homo sapiens OX=9606 GN=HAT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	null	376-UNIMOD:385,376-UNIMOD:4	0.09	28.0	1	1	1
PRT	sp|P36957|ODO2_HUMAN	Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial OS=Homo sapiens OX=9606 GN=DLST PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	null		0.12	28.0	1	1	1
PRT	sp|O43181|NDUS4_HUMAN	NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.16	28.0	2	1	0
PRT	sp|Q5VIR6-2|VPS53_HUMAN	Isoform 2 of Vacuolar protein sorting-associated protein 53 homolog OS=Homo sapiens OX=9606 GN=VPS53	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.04	27.0	1	1	1
PRT	sp|Q9Y597-2|KCTD3_HUMAN	Isoform 2 of BTB/POZ domain-containing protein KCTD3 OS=Homo sapiens OX=9606 GN=KCTD3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|O95295|SNAPN_HUMAN	SNARE-associated protein Snapin OS=Homo sapiens OX=9606 GN=SNAPIN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.20	27.0	1	1	1
PRT	sp|Q92696|PGTA_HUMAN	Geranylgeranyl transferase type-2 subunit alpha OS=Homo sapiens OX=9606 GN=RABGGTA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	457-UNIMOD:4	0.04	27.0	1	1	1
PRT	sp|P10253|LYAG_HUMAN	Lysosomal alpha-glucosidase OS=Homo sapiens OX=9606 GN=GAA PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|Q9NXX6|NSE4A_HUMAN	Non-structural maintenance of chromosomes element 4 homolog A OS=Homo sapiens OX=9606 GN=NSMCE4A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.06	27.0	1	1	1
PRT	sp|P10398|ARAF_HUMAN	Serine/threonine-protein kinase A-Raf OS=Homo sapiens OX=9606 GN=ARAF PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|O15446|RPA34_HUMAN	DNA-directed RNA polymerase I subunit RPA34 OS=Homo sapiens OX=9606 GN=CD3EAP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	55-UNIMOD:4	0.06	27.0	1	1	1
PRT	sp|Q9UHD2|TBK1_HUMAN	Serine/threonine-protein kinase TBK1 OS=Homo sapiens OX=9606 GN=TBK1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|P00568|KAD1_HUMAN	Adenylate kinase isoenzyme 1 OS=Homo sapiens OX=9606 GN=AK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.08	27.0	2	1	0
PRT	sp|P28482|MK01_HUMAN	Mitogen-activated protein kinase 1 OS=Homo sapiens OX=9606 GN=MAPK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	254-UNIMOD:4	0.08	27.0	1	1	1
PRT	sp|O00469-3|PLOD2_HUMAN	Isoform 3 of Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 OS=Homo sapiens OX=9606 GN=PLOD2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	243-UNIMOD:4	0.06	27.0	2	1	0
PRT	sp|Q07157-2|ZO1_HUMAN	Isoform Short of Tight junction protein ZO-1 OS=Homo sapiens OX=9606 GN=TJP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	3	1	0
PRT	sp|O00159-2|MYO1C_HUMAN	Isoform 2 of Unconventional myosin-Ic OS=Homo sapiens OX=9606 GN=MYO1C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|Q15813|TBCE_HUMAN	Tubulin-specific chaperone E OS=Homo sapiens OX=9606 GN=TBCE PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|P52735-3|VAV2_HUMAN	Isoform 3 of Guanine nucleotide exchange factor VAV2 OS=Homo sapiens OX=9606 GN=VAV2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	0
PRT	sp|O75027-3|ABCB7_HUMAN	Isoform 3 of ATP-binding cassette sub-family B member 7, mitochondrial OS=Homo sapiens OX=9606 GN=ABCB7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q6IN85-5|P4R3A_HUMAN	Isoform 5 of Serine/threonine-protein phosphatase 4 regulatory subunit 3A OS=Homo sapiens OX=9606 GN=PPP4R3A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.04	27.0	2	1	0
PRT	sp|Q92538-3|GBF1_HUMAN	Isoform 3 of Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=GBF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	592-UNIMOD:4	0.03	27.0	2	2	1
PRT	sp|P36404-2|ARL2_HUMAN	Isoform 2 of ADP-ribosylation factor-like protein 2 OS=Homo sapiens OX=9606 GN=ARL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	126-UNIMOD:4,130-UNIMOD:4	0.20	27.0	1	1	0
PRT	sp|O75153|CLU_HUMAN	Clustered mitochondria protein homolog OS=Homo sapiens OX=9606 GN=CLUH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	153-UNIMOD:4	0.03	27.0	1	1	1
PRT	sp|Q9H583|HEAT1_HUMAN	HEAT repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=HEATR1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null		0.02	27.0	2	2	2
PRT	sp|Q8WXA9-2|SREK1_HUMAN	Isoform 2 of Splicing regulatory glutamine/lysine-rich protein 1 OS=Homo sapiens OX=9606 GN=SREK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null		0.02	27.0	2	1	0
PRT	sp|Q99638|RAD9A_HUMAN	Cell cycle checkpoint control protein RAD9A OS=Homo sapiens OX=9606 GN=RAD9A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.06	27.0	1	1	1
PRT	sp|Q14974|IMB1_HUMAN	Importin subunit beta-1 OS=Homo sapiens OX=9606 GN=KPNB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	null	112-UNIMOD:4,118-UNIMOD:4,1-UNIMOD:1	0.08	27.0	3	2	1
PRT	sp|O00469|PLOD2_HUMAN	Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 OS=Homo sapiens OX=9606 GN=PLOD2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	null	615-UNIMOD:28	0.02	27.0	1	1	1
PRT	sp|P38606|VATA_HUMAN	V-type proton ATPase catalytic subunit A OS=Homo sapiens OX=9606 GN=ATP6V1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	null		0.06	27.0	1	1	1
PRT	sp|P62993|GRB2_HUMAN	Growth factor receptor-bound protein 2 OS=Homo sapiens OX=9606 GN=GRB2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.14	27.0	1	1	0
PRT	sp|Q86Y82|STX12_HUMAN	Syntaxin-12 OS=Homo sapiens OX=9606 GN=STX12 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	null	190-UNIMOD:28	0.05	27.0	1	1	1
PRT	sp|Q7L2H7|EIF3M_HUMAN	Eukaryotic translation initiation factor 3 subunit M OS=Homo sapiens OX=9606 GN=EIF3M PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	null	345-UNIMOD:28	0.04	27.0	1	1	1
PRT	sp|Q9Y3I0|RTCB_HUMAN	RNA-splicing ligase RtcB homolog OS=Homo sapiens OX=9606 GN=RTCB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.06	27.0	1	1	1
PRT	sp|Q2TBE0|C19L2_HUMAN	CWF19-like protein 2 OS=Homo sapiens OX=9606 GN=CWF19L2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q92538|GBF1_HUMAN	Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=GBF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.01	27.0	1	1	0
PRT	sp|Q9UIQ6-3|LCAP_HUMAN	Isoform 3 of Leucyl-cystinyl aminopeptidase OS=Homo sapiens OX=9606 GN=LNPEP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q96HW7-2|INT4_HUMAN	Isoform 2 of Integrator complex subunit 4 OS=Homo sapiens OX=9606 GN=INTS4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	2	1	0
PRT	sp|Q70CQ2-3|UBP34_HUMAN	Isoform 3 of Ubiquitin carboxyl-terminal hydrolase 34 OS=Homo sapiens OX=9606 GN=USP34	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.00	26.0	1	1	1
PRT	sp|Q9UQ35-2|SRRM2_HUMAN	Isoform 2 of Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	2	1	0
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	614-UNIMOD:27	0.04	26.0	5	2	0
PRT	sp|Q9UBF2-2|COPG2_HUMAN	Isoform 2 of Coatomer subunit gamma-2 OS=Homo sapiens OX=9606 GN=COPG2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|P40261|NNMT_HUMAN	Nicotinamide N-methyltransferase OS=Homo sapiens OX=9606 GN=NNMT PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	75-UNIMOD:4,115-UNIMOD:4	0.18	26.0	2	2	2
PRT	sp|Q99797|MIPEP_HUMAN	Mitochondrial intermediate peptidase OS=Homo sapiens OX=9606 GN=MIPEP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null		0.03	26.0	2	1	0
PRT	sp|P49459|UBE2A_HUMAN	Ubiquitin-conjugating enzyme E2 A OS=Homo sapiens OX=9606 GN=UBE2A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null	34-UNIMOD:35	0.26	26.0	2	1	0
PRT	sp|Q9NXF1-2|TEX10_HUMAN	Isoform 2 of Testis-expressed protein 10 OS=Homo sapiens OX=9606 GN=TEX10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	3	2	1
PRT	sp|O94973-3|AP2A2_HUMAN	Isoform 3 of AP-2 complex subunit alpha-2 OS=Homo sapiens OX=9606 GN=AP2A2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	2	1	0
PRT	sp|Q13616|CUL1_HUMAN	Cullin-1 OS=Homo sapiens OX=9606 GN=CUL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	14-UNIMOD:28	0.04	26.0	4	2	1
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|P45974-2|UBP5_HUMAN	Isoform Short of Ubiquitin carboxyl-terminal hydrolase 5 OS=Homo sapiens OX=9606 GN=USP5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|P01112-2|RASH_HUMAN	Isoform 2 of GTPase HRas OS=Homo sapiens OX=9606 GN=HRAS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	51-UNIMOD:4	0.16	26.0	1	1	1
PRT	sp|Q14683|SMC1A_HUMAN	Structural maintenance of chromosomes protein 1A OS=Homo sapiens OX=9606 GN=SMC1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	3	1	0
PRT	sp|O15460-2|P4HA2_HUMAN	Isoform IIa of Prolyl 4-hydroxylase subunit alpha-2 OS=Homo sapiens OX=9606 GN=P4HA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|P20020-5|AT2B1_HUMAN	Isoform E of Plasma membrane calcium-transporting ATPase 1 OS=Homo sapiens OX=9606 GN=ATP2B1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	547-UNIMOD:4	0.01	26.0	1	1	1
PRT	sp|Q9BYN8|RT26_HUMAN	28S ribosomal protein S26, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS26 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.09	26.0	2	1	0
PRT	sp|Q9BSH4|TACO1_HUMAN	Translational activator of cytochrome c oxidase 1 OS=Homo sapiens OX=9606 GN=TACO1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.11	26.0	2	1	0
PRT	sp|P30622-2|CLIP1_HUMAN	Isoform 3 of CAP-Gly domain-containing linker protein 1 OS=Homo sapiens OX=9606 GN=CLIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	0
PRT	sp|Q96QD8-2|S38A2_HUMAN	Isoform 2 of Sodium-coupled neutral amino acid transporter 2 OS=Homo sapiens OX=9606 GN=SLC38A2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|Q04828|AK1C1_HUMAN	Aldo-keto reductase family 1 member C1 OS=Homo sapiens OX=9606 GN=AKR1C1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.06	26.0	2	1	0
PRT	sp|O95229|ZWINT_HUMAN	ZW10 interactor OS=Homo sapiens OX=9606 GN=ZWINT PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.05	26.0	1	1	1
PRT	sp|P78527|PRKDC_HUMAN	DNA-dependent protein kinase catalytic subunit OS=Homo sapiens OX=9606 GN=PRKDC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	630-UNIMOD:4	0.02	26.0	5	4	2
PRT	sp|Q5SRE5|NU188_HUMAN	Nucleoporin NUP188 homolog OS=Homo sapiens OX=9606 GN=NUP188 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.01	26.0	1	1	0
PRT	sp|P35241|RADI_HUMAN	Radixin OS=Homo sapiens OX=9606 GN=RDX PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.03	26.0	3	1	0
PRT	sp|P52435|RPB11_HUMAN	DNA-directed RNA polymerase II subunit RPB11-a OS=Homo sapiens OX=9606 GN=POLR2J PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	null	1-UNIMOD:1	0.15	26.0	1	1	1
PRT	sp|O95551|TYDP2_HUMAN	Tyrosyl-DNA phosphodiesterase 2 OS=Homo sapiens OX=9606 GN=TDP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	null	273-UNIMOD:385,273-UNIMOD:4	0.06	26.0	1	1	1
PRT	sp|P17980|PRS6A_HUMAN	26S proteasome regulatory subunit 6A OS=Homo sapiens OX=9606 GN=PSMC3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	null	130-UNIMOD:28	0.04	26.0	1	1	1
PRT	sp|P0DMV8|HS71A_HUMAN	Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.08	26.0	2	2	1
PRT	sp|Q9NZ32|ARP10_HUMAN	Actin-related protein 10 OS=Homo sapiens OX=9606 GN=ACTR10 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	160-UNIMOD:4	0.06	26.0	1	1	1
PRT	sp|Q9H2U1|DHX36_HUMAN	ATP-dependent DNA/RNA helicase DHX36 OS=Homo sapiens OX=9606 GN=DHX36 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	null	781-UNIMOD:4	0.02	26.0	1	1	1
PRT	sp|Q9UPY3-3|DICER_HUMAN	Isoform 3 of Endoribonuclease Dicer OS=Homo sapiens OX=9606 GN=DICER1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|A6NDG6|PGP_HUMAN	Glycerol-3-phosphate phosphatase OS=Homo sapiens OX=9606 GN=PGP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.15	25.0	1	1	1
PRT	sp|O15400-2|STX7_HUMAN	Isoform 2 of Syntaxin-7 OS=Homo sapiens OX=9606 GN=STX7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.15	25.0	2	1	0
PRT	sp|O00629|IMA3_HUMAN	Importin subunit alpha-3 OS=Homo sapiens OX=9606 GN=KPNA4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	417-UNIMOD:4	0.04	25.0	1	1	1
PRT	sp|O14617-3|AP3D1_HUMAN	Isoform 3 of AP-3 complex subunit delta-1 OS=Homo sapiens OX=9606 GN=AP3D1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q14571|ITPR2_HUMAN	Inositol 1,4,5-trisphosphate receptor type 2 OS=Homo sapiens OX=9606 GN=ITPR2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|O15228-2|GNPAT_HUMAN	Isoform 2 of Dihydroxyacetone phosphate acyltransferase OS=Homo sapiens OX=9606 GN=GNPAT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|Q9HCG8|CWC22_HUMAN	Pre-mRNA-splicing factor CWC22 homolog OS=Homo sapiens OX=9606 GN=CWC22 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q13952-4|NFYC_HUMAN	Isoform 4 of Nuclear transcription factor Y subunit gamma OS=Homo sapiens OX=9606 GN=NFYC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|Q9BZH6|WDR11_HUMAN	WD repeat-containing protein 11 OS=Homo sapiens OX=9606 GN=WDR11 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null		0.02	25.0	2	1	0
PRT	sp|Q9HDC9-2|APMAP_HUMAN	Isoform 2 of Adipocyte plasma membrane-associated protein OS=Homo sapiens OX=9606 GN=APMAP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.08	25.0	1	1	1
PRT	sp|Q7Z6Z7-2|HUWE1_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	1447-UNIMOD:4	0.02	25.0	3	3	3
PRT	sp|Q03519-2|TAP2_HUMAN	Isoform 2 of Antigen peptide transporter 2 OS=Homo sapiens OX=9606 GN=TAP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	2	1	0
PRT	sp|Q8TEQ6|GEMI5_HUMAN	Gem-associated protein 5 OS=Homo sapiens OX=9606 GN=GEMIN5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null	1122-UNIMOD:4,1255-UNIMOD:4	0.03	25.0	3	2	1
PRT	sp|O00625|PIR_HUMAN	Pirin OS=Homo sapiens OX=9606 GN=PIR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	2	1	0
PRT	sp|Q96HR9-2|REEP6_HUMAN	Isoform 2 of Receptor expression-enhancing protein 6 OS=Homo sapiens OX=9606 GN=REEP6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.08	25.0	2	1	0
PRT	sp|Q13765|NACA_HUMAN	Nascent polypeptide-associated complex subunit alpha OS=Homo sapiens OX=9606 GN=NACA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	215-UNIMOD:35	0.07	25.0	2	1	0
PRT	sp|Q14562|DHX8_HUMAN	ATP-dependent RNA helicase DHX8 OS=Homo sapiens OX=9606 GN=DHX8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q9UBT7-3|CTNL1_HUMAN	Isoform 3 of Alpha-catulin OS=Homo sapiens OX=9606 GN=CTNNAL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	3	1	0
PRT	sp|Q9UHI6-2|DDX20_HUMAN	Isoform 2 of Probable ATP-dependent RNA helicase DDX20 OS=Homo sapiens OX=9606 GN=DDX20	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.20	25.0	1	1	1
PRT	sp|Q9NRB3|CHSTC_HUMAN	Carbohydrate sulfotransferase 12 OS=Homo sapiens OX=9606 GN=CHST12 PE=2 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|Q6UWE0-3|LRSM1_HUMAN	Isoform 3 of E3 ubiquitin-protein ligase LRSAM1 OS=Homo sapiens OX=9606 GN=LRSAM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|P12236|ADT3_HUMAN	ADP/ATP translocase 3 OS=Homo sapiens OX=9606 GN=SLC25A6 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	129-UNIMOD:4	0.09	25.0	1	1	1
PRT	sp|Q99447-2|PCY2_HUMAN	Isoform 2 of Ethanolamine-phosphate cytidylyltransferase OS=Homo sapiens OX=9606 GN=PCYT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.07	25.0	1	1	1
PRT	sp|Q14568|HS902_HUMAN	Heat shock protein HSP 90-alpha A2 OS=Homo sapiens OX=9606 GN=HSP90AA2P PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.06	25.0	2	1	0
PRT	sp|O75369|FLNB_HUMAN	Filamin-B OS=Homo sapiens OX=9606 GN=FLNB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	1087-UNIMOD:4,1095-UNIMOD:4,202-UNIMOD:35	0.03	25.0	3	2	0
PRT	sp|Q9NVI1|FANCI_HUMAN	Fanconi anemia group I protein OS=Homo sapiens OX=9606 GN=FANCI PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.02	25.0	2	2	2
PRT	sp|P14866|HNRPL_HUMAN	Heterogeneous nuclear ribonucleoprotein L OS=Homo sapiens OX=9606 GN=HNRNPL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	521-UNIMOD:4	0.06	25.0	1	1	0
PRT	sp|O14976|GAK_HUMAN	Cyclin-G-associated kinase OS=Homo sapiens OX=9606 GN=GAK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.01	25.0	1	1	0
PRT	sp|Q9Y6N1|COX11_HUMAN	Cytochrome c oxidase assembly protein COX11, mitochondrial OS=Homo sapiens OX=9606 GN=COX11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	25.0	null		0.14	25.0	2	2	2
PRT	sp|Q99497|PARK7_HUMAN	Protein/nucleic acid deglycase DJ-1 OS=Homo sapiens OX=9606 GN=PARK7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.14	25.0	4	2	0
PRT	sp|P39748|FEN1_HUMAN	Flap endonuclease 1 OS=Homo sapiens OX=9606 GN=FEN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|P49773|HINT1_HUMAN	Histidine triad nucleotide-binding protein 1 OS=Homo sapiens OX=9606 GN=HINT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.21	25.0	1	1	1
PRT	sp|Q9Y6E0-2|STK24_HUMAN	Isoform A of Serine/threonine-protein kinase 24 OS=Homo sapiens OX=9606 GN=STK24	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|Q8WXC6|CSN9_HUMAN	COP9 signalosome complex subunit 9 OS=Homo sapiens OX=9606 GN=COPS9 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.37	24.0	2	1	0
PRT	sp|Q9UNS1-2|TIM_HUMAN	Isoform 2 of Protein timeless homolog OS=Homo sapiens OX=9606 GN=TIMELESS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|O75976-2|CBPD_HUMAN	Isoform 2 of Carboxypeptidase D OS=Homo sapiens OX=9606 GN=CPD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	335-UNIMOD:4	0.01	24.0	1	1	1
PRT	sp|O60934|NBN_HUMAN	Nibrin OS=Homo sapiens OX=9606 GN=NBN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q6UB99|ANR11_HUMAN	Ankyrin repeat domain-containing protein 11 OS=Homo sapiens OX=9606 GN=ANKRD11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q96F07-2|CYFP2_HUMAN	Isoform 2 of Cytoplasmic FMR1-interacting protein 2 OS=Homo sapiens OX=9606 GN=CYFIP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|P35573-2|GDE_HUMAN	Isoform 5 of Glycogen debranching enzyme OS=Homo sapiens OX=9606 GN=AGL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q86XA9-2|HTR5A_HUMAN	Isoform 2 of HEAT repeat-containing protein 5A OS=Homo sapiens OX=9606 GN=HEATR5A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q9NV88-3|INT9_HUMAN	Isoform 3 of Integrator complex subunit 9 OS=Homo sapiens OX=9606 GN=INTS9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q9UH62|ARMX3_HUMAN	Armadillo repeat-containing X-linked protein 3 OS=Homo sapiens OX=9606 GN=ARMCX3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.07	24.0	1	1	1
PRT	sp|P82933|RT09_HUMAN	28S ribosomal protein S9, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.05	24.0	1	1	1
PRT	sp|Q9BU23-3|LMF2_HUMAN	Isoform 3 of Lipase maturation factor 2 OS=Homo sapiens OX=9606 GN=LMF2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	2	1	0
PRT	sp|Q15750-2|TAB1_HUMAN	Isoform 2 of TGF-beta-activated kinase 1 and MAP3K7-binding protein 1 OS=Homo sapiens OX=9606 GN=TAB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.07	24.0	1	1	1
PRT	sp|Q9UNN5-2|FAF1_HUMAN	Isoform Short of FAS-associated factor 1 OS=Homo sapiens OX=9606 GN=FAF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	2	1	0
PRT	sp|O43929-2|ORC4_HUMAN	Isoform 2 of Origin recognition complex subunit 4 OS=Homo sapiens OX=9606 GN=ORC4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	68-UNIMOD:4	0.06	24.0	2	1	0
PRT	sp|Q9Y6N7-6|ROBO1_HUMAN	Isoform 6 of Roundabout homolog 1 OS=Homo sapiens OX=9606 GN=ROBO1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q13769|THOC5_HUMAN	THO complex subunit 5 homolog OS=Homo sapiens OX=9606 GN=THOC5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	403-UNIMOD:4	0.05	24.0	1	1	1
PRT	sp|Q9H0A0|NAT10_HUMAN	RNA cytidine acetyltransferase OS=Homo sapiens OX=9606 GN=NAT10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.02	24.0	2	2	1
PRT	sp|Q13085|ACACA_HUMAN	Acetyl-CoA carboxylase 1 OS=Homo sapiens OX=9606 GN=ACACA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.02	24.0	2	2	1
PRT	sp|P00505|AATM_HUMAN	Aspartate aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=GOT2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.06	24.0	1	1	0
PRT	sp|P52735|VAV2_HUMAN	Guanine nucleotide exchange factor VAV2 OS=Homo sapiens OX=9606 GN=VAV2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.02	24.0	1	1	0
PRT	sp|P62136|PP1A_HUMAN	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Homo sapiens OX=9606 GN=PPP1CA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	99-UNIMOD:28,105-UNIMOD:4	0.04	24.0	1	1	1
PRT	sp|P16455|MGMT_HUMAN	Methylated-DNA--protein-cysteine methyltransferase OS=Homo sapiens OX=9606 GN=MGMT PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	62-UNIMOD:4	0.29	24.0	1	1	1
PRT	sp|P36952|SPB5_HUMAN	Serpin B5 OS=Homo sapiens OX=9606 GN=SERPINB5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	24.0	1	1	1
PRT	sp|Q7Z4H8|PLGT3_HUMAN	Protein O-glucosyltransferase 3 OS=Homo sapiens OX=9606 GN=POGLUT3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.04	24.0	1	1	0
PRT	sp|Q9H6T0|ESRP2_HUMAN	Epithelial splicing regulatory protein 2 OS=Homo sapiens OX=9606 GN=ESRP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|Q99536|VAT1_HUMAN	Synaptic vesicle membrane protein VAT-1 homolog OS=Homo sapiens OX=9606 GN=VAT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.05	24.0	2	1	0
PRT	sp|P33778|H2B1B_HUMAN	Histone H2B type 1-B OS=Homo sapiens OX=9606 GN=HIST1H2BB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.13	24.0	2	1	0
PRT	sp|Q9UQ80|PA2G4_HUMAN	Proliferation-associated protein 2G4 OS=Homo sapiens OX=9606 GN=PA2G4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.06	24.0	1	1	1
PRT	sp|O75155|CAND2_HUMAN	Cullin-associated NEDD8-dissociated protein 2 OS=Homo sapiens OX=9606 GN=CAND2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	1200-UNIMOD:35	0.02	24.0	1	1	1
PRT	sp|Q96G21|IMP4_HUMAN	U3 small nucleolar ribonucleoprotein protein IMP4 OS=Homo sapiens OX=9606 GN=IMP4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	165-UNIMOD:4	0.10	24.0	1	1	1
PRT	sp|Q6NVY1|HIBCH_HUMAN	3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=HIBCH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	163-UNIMOD:4	0.06	24.0	1	1	0
PRT	sp|P07951|TPM2_HUMAN	Tropomyosin beta chain OS=Homo sapiens OX=9606 GN=TPM2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.06	23.0	1	1	1
PRT	sp|Q13485|SMAD4_HUMAN	Mothers against decapentaplegic homolog 4 OS=Homo sapiens OX=9606 GN=SMAD4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|P98194-2|AT2C1_HUMAN	Isoform 2 of Calcium-transporting ATPase type 2C member 1 OS=Homo sapiens OX=9606 GN=ATP2C1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q9Y6D6|BIG1_HUMAN	Brefeldin A-inhibited guanine nucleotide-exchange protein 1 OS=Homo sapiens OX=9606 GN=ARFGEF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q86YN1-2|DOPP1_HUMAN	Isoform 2 of Dolichyldiphosphatase 1 OS=Homo sapiens OX=9606 GN=DOLPP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.09	23.0	1	1	1
PRT	sp|Q9BQ52-3|RNZ2_HUMAN	Isoform 3 of Zinc phosphodiesterase ELAC protein 2 OS=Homo sapiens OX=9606 GN=ELAC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.08	23.0	1	1	1
PRT	sp|Q13838|DX39B_HUMAN	Spliceosome RNA helicase DDX39B OS=Homo sapiens OX=9606 GN=DDX39B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.07	23.0	1	1	1
PRT	sp|O14787-2|TNPO2_HUMAN	Isoform 2 of Transportin-2 OS=Homo sapiens OX=9606 GN=TNPO2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	779-UNIMOD:4,795-UNIMOD:4	0.06	23.0	4	2	1
PRT	sp|Q92995-2|UBP13_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 13 OS=Homo sapiens OX=9606 GN=USP13	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|P28290-2|ITPI2_HUMAN	Isoform 2 of Protein ITPRID2 OS=Homo sapiens OX=9606 GN=ITPRID2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	459-UNIMOD:4	0.03	23.0	2	1	0
PRT	sp|P60842-2|IF4A1_HUMAN	Isoform 2 of Eukaryotic initiation factor 4A-I OS=Homo sapiens OX=9606 GN=EIF4A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	37-UNIMOD:35	0.11	23.0	1	1	1
PRT	sp|Q2KHR3-2|QSER1_HUMAN	Isoform 2 of Glutamine and serine-rich protein 1 OS=Homo sapiens OX=9606 GN=QSER1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q9BQL6-3|FERM1_HUMAN	Isoform 3 of Fermitin family homolog 1 OS=Homo sapiens OX=9606 GN=FERMT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.09	23.0	1	1	1
PRT	sp|Q13492|PICAL_HUMAN	Phosphatidylinositol-binding clathrin assembly protein OS=Homo sapiens OX=9606 GN=PICALM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.08	23.0	2	2	2
PRT	sp|P00367|DHE3_HUMAN	Glutamate dehydrogenase 1, mitochondrial OS=Homo sapiens OX=9606 GN=GLUD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	290-UNIMOD:35	0.05	23.0	1	1	0
PRT	sp|Q96HE7|ERO1A_HUMAN	ERO1-like protein alpha OS=Homo sapiens OX=9606 GN=ERO1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	null	438-UNIMOD:28	0.03	23.0	1	1	1
PRT	sp|Q15393|SF3B3_HUMAN	Splicing factor 3B subunit 3 OS=Homo sapiens OX=9606 GN=SF3B3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.04	23.0	4	1	0
PRT	sp|Q9Y6V7|DDX49_HUMAN	Probable ATP-dependent RNA helicase DDX49 OS=Homo sapiens OX=9606 GN=DDX49 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	null	345-UNIMOD:28	0.05	23.0	1	1	1
PRT	sp|Q9NWM8|FKB14_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP14 OS=Homo sapiens OX=9606 GN=FKBP14 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.09	23.0	1	1	1
PRT	sp|Q9NRL3|STRN4_HUMAN	Striatin-4 OS=Homo sapiens OX=9606 GN=STRN4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.04	23.0	2	1	0
PRT	sp|Q9BTU6|P4K2A_HUMAN	Phosphatidylinositol 4-kinase type 2-alpha OS=Homo sapiens OX=9606 GN=PI4K2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|Q71RC2-7|LARP4_HUMAN	Isoform 7 of La-related protein 4 OS=Homo sapiens OX=9606 GN=LARP4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.06	22.0	1	1	1
PRT	sp|P62081|RS7_HUMAN	40S ribosomal protein S7 OS=Homo sapiens OX=9606 GN=RPS7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.06	22.0	2	1	0
PRT	sp|Q9H0A8-3|COMD4_HUMAN	Isoform 3 of COMM domain-containing protein 4 OS=Homo sapiens OX=9606 GN=COMMD4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	6-UNIMOD:4,11-UNIMOD:4	0.19	22.0	1	1	1
PRT	sp|Q15067|ACOX1_HUMAN	Peroxisomal acyl-coenzyme A oxidase 1 OS=Homo sapiens OX=9606 GN=ACOX1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.05	22.0	1	1	1
PRT	sp|Q9ULK4-6|MED23_HUMAN	Isoform 6 of Mediator of RNA polymerase II transcription subunit 23 OS=Homo sapiens OX=9606 GN=MED23	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.05	22.0	1	1	1
PRT	sp|Q8NBQ5|DHB11_HUMAN	Estradiol 17-beta-dehydrogenase 11 OS=Homo sapiens OX=9606 GN=HSD17B11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.06	22.0	1	1	1
PRT	sp|Q9NRR5|UBQL4_HUMAN	Ubiquilin-4 OS=Homo sapiens OX=9606 GN=UBQLN4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.06	22.0	1	1	1
PRT	sp|P18887|XRCC1_HUMAN	DNA repair protein XRCC1 OS=Homo sapiens OX=9606 GN=XRCC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.05	22.0	1	1	1
PRT	sp|Q9BRK5|CAB45_HUMAN	45 kDa calcium-binding protein OS=Homo sapiens OX=9606 GN=SDF4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.08	22.0	2	1	0
PRT	sp|O00571|DDX3X_HUMAN	ATP-dependent RNA helicase DDX3X OS=Homo sapiens OX=9606 GN=DDX3X PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.06	22.0	2	2	0
PRT	sp|O95070|YIF1A_HUMAN	Protein YIF1A OS=Homo sapiens OX=9606 GN=YIF1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	null		0.20	22.0	1	1	1
PRT	sp|Q9UBT2|SAE2_HUMAN	SUMO-activating enzyme subunit 2 OS=Homo sapiens OX=9606 GN=UBA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	null	108-UNIMOD:28	0.02	22.0	1	1	1
PRT	sp|Q96HR9|REEP6_HUMAN	Receptor expression-enhancing protein 6 OS=Homo sapiens OX=9606 GN=REEP6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.07	22.0	1	1	0
PRT	sp|Q15070|OXA1L_HUMAN	Mitochondrial inner membrane protein OXA1L OS=Homo sapiens OX=9606 GN=OXA1L PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	null	153-UNIMOD:385,153-UNIMOD:4	0.03	22.0	1	1	1
PRT	sp|Q96I51|RCC1L_HUMAN	RCC1-like G exchanging factor-like protein OS=Homo sapiens OX=9606 GN=RCC1L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.07	22.0	1	1	1
PRT	sp|P54652|HSP72_HUMAN	Heat shock-related 70 kDa protein 2 OS=Homo sapiens OX=9606 GN=HSPA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	22.0	null		0.05	22.0	4	1	0
PRT	sp|Q8WUM0|NU133_HUMAN	Nuclear pore complex protein Nup133 OS=Homo sapiens OX=9606 GN=NUP133 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.05	22.0	2	2	2
PRT	sp|Q9NUP1|BL1S4_HUMAN	Biogenesis of lysosome-related organelles complex 1 subunit 4 OS=Homo sapiens OX=9606 GN=BLOC1S4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null	71-UNIMOD:4	0.15	21.0	1	1	1
PRT	sp|P50748|KNTC1_HUMAN	Kinetochore-associated protein 1 OS=Homo sapiens OX=9606 GN=KNTC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|P53992|SC24C_HUMAN	Protein transport protein Sec24C OS=Homo sapiens OX=9606 GN=SEC24C PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q9NZQ3-5|SPN90_HUMAN	Isoform 5 of NCK-interacting protein with SH3 domain OS=Homo sapiens OX=9606 GN=NCKIPSD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null	412-UNIMOD:4,429-UNIMOD:4	0.04	21.0	1	1	1
PRT	sp|O00754-2|MA2B1_HUMAN	Isoform 2 of Lysosomal alpha-mannosidase OS=Homo sapiens OX=9606 GN=MAN2B1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q96AX1|VP33A_HUMAN	Vacuolar protein sorting-associated protein 33A OS=Homo sapiens OX=9606 GN=VPS33A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|Q9NW68-5|BSDC1_HUMAN	Isoform 5 of BSD domain-containing protein 1 OS=Homo sapiens OX=9606 GN=BSDC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.12	21.0	1	1	1
PRT	sp|Q6P996-3|PDXD1_HUMAN	Isoform 3 of Pyridoxal-dependent decarboxylase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PDXDC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|P60866|RS20_HUMAN	40S ribosomal protein S20 OS=Homo sapiens OX=9606 GN=RPS20 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.18	21.0	1	1	1
PRT	sp|P42575-3|CASP2_HUMAN	Isoform 3 of Caspase-2 OS=Homo sapiens OX=9606 GN=CASP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.16	21.0	1	1	1
PRT	sp|O60313-13|OPA1_HUMAN	Isoform 7 of Dynamin-like 120 kDa protein, mitochondrial OS=Homo sapiens OX=9606 GN=OPA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q8NBI5|S43A3_HUMAN	Solute carrier family 43 member 3 OS=Homo sapiens OX=9606 GN=SLC43A3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null	331-UNIMOD:4	0.06	21.0	1	1	1
PRT	sp|Q14693|LPIN1_HUMAN	Phosphatidate phosphatase LPIN1 OS=Homo sapiens OX=9606 GN=LPIN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|Q53GS9|SNUT2_HUMAN	U4/U6.U5 tri-snRNP-associated protein 2 OS=Homo sapiens OX=9606 GN=USP39 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.03	21.0	2	1	0
PRT	sp|Q9NR31|SAR1A_HUMAN	GTP-binding protein SAR1a OS=Homo sapiens OX=9606 GN=SAR1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	102-UNIMOD:4	0.11	21.0	1	1	1
PRT	sp|P62736|ACTA_HUMAN	Actin, aortic smooth muscle OS=Homo sapiens OX=9606 GN=ACTA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	21.0	null	219-UNIMOD:4,229-UNIMOD:35	0.06	21.0	2	1	0
PRT	sp|P50914|RL14_HUMAN	60S ribosomal protein L14 OS=Homo sapiens OX=9606 GN=RPL14 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	21.0	null	54-UNIMOD:385,54-UNIMOD:4	0.05	21.0	3	1	0
PRT	sp|Q96L12|CALR3_HUMAN	Calreticulin-3 OS=Homo sapiens OX=9606 GN=CALR3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.08	21.0	4	1	0
PRT	sp|Q16695|H31T_HUMAN	Histone H3.1t OS=Homo sapiens OX=9606 GN=HIST3H3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	97-UNIMOD:4,111-UNIMOD:4	0.24	21.0	1	1	1
PRT	sp|P0CG39|POTEJ_HUMAN	POTE ankyrin domain family member J OS=Homo sapiens OX=9606 GN=POTEJ PE=3 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	880-UNIMOD:4	0.02	21.0	3	1	0
PRT	sp|Q6NVY1-2|HIBCH_HUMAN	Isoform 2 of 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=HIBCH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null	163-UNIMOD:4	0.07	20.0	1	1	0
PRT	sp|Q86TI2|DPP9_HUMAN	Dipeptidyl peptidase 9 OS=Homo sapiens OX=9606 GN=DPP9 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null	844-UNIMOD:4	0.02	20.0	1	1	1
PRT	sp|A0AVT1|UBA6_HUMAN	Ubiquitin-like modifier-activating enzyme 6 OS=Homo sapiens OX=9606 GN=UBA6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|P62191-2|PRS4_HUMAN	Isoform 2 of 26S proteasome regulatory subunit 4 OS=Homo sapiens OX=9606 GN=PSMC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.11	20.0	1	1	1
PRT	sp|Q9P016|THYN1_HUMAN	Thymocyte nuclear protein 1 OS=Homo sapiens OX=9606 GN=THYN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.11	20.0	2	1	0
PRT	sp|Q8TCJ2|STT3B_HUMAN	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Homo sapiens OX=9606 GN=STT3B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	2	1	0
PRT	sp|Q9UBP0-4|SPAST_HUMAN	Isoform 4 of Spastin OS=Homo sapiens OX=9606 GN=SPAST	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.05	20.0	1	1	1
PRT	sp|Q9H0H0|INT2_HUMAN	Integrator complex subunit 2 OS=Homo sapiens OX=9606 GN=INTS2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|P30038-2|AL4A1_HUMAN	Isoform 2 of Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ALDH4A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|P08195|4F2_HUMAN	4F2 cell-surface antigen heavy chain OS=Homo sapiens OX=9606 GN=SLC3A2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.08	20.0	3	2	0
PRT	sp|Q9NY61|AATF_HUMAN	Protein AATF OS=Homo sapiens OX=9606 GN=AATF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	null	2-UNIMOD:1	0.06	20.0	1	1	1
PRT	sp|Q9NR46|SHLB2_HUMAN	Endophilin-B2 OS=Homo sapiens OX=9606 GN=SH3GLB2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.07	20.0	1	1	1
PRT	sp|Q92783|STAM1_HUMAN	Signal transducing adapter molecule 1 OS=Homo sapiens OX=9606 GN=STAM PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.05	20.0	1	1	1
PRT	sp|Q96Q15-3|SMG1_HUMAN	Isoform 3 of Serine/threonine-protein kinase SMG1 OS=Homo sapiens OX=9606 GN=SMG1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q5JUR7|TEX30_HUMAN	Testis-expressed protein 30 OS=Homo sapiens OX=9606 GN=TEX30 PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.09	19.0	1	1	1
PRT	sp|Q8IWR0-2|Z3H7A_HUMAN	Isoform 2 of Zinc finger CCCH domain-containing protein 7A OS=Homo sapiens OX=9606 GN=ZC3H7A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.10	19.0	1	1	1
PRT	sp|Q9UBC2-4|EP15R_HUMAN	Isoform 4 of Epidermal growth factor receptor substrate 15-like 1 OS=Homo sapiens OX=9606 GN=EPS15L1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|P14635|CCNB1_HUMAN	G2/mitotic-specific cyclin-B1 OS=Homo sapiens OX=9606 GN=CCNB1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.07	19.0	1	1	1
PRT	sp|Q13505-3|MTX1_HUMAN	Isoform 3 of Metaxin-1 OS=Homo sapiens OX=9606 GN=MTX1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.06	19.0	2	1	0
PRT	sp|Q86X76-5|NIT1_HUMAN	Isoform 6 of Deaminated glutathione amidase OS=Homo sapiens OX=9606 GN=NIT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null	80-UNIMOD:4	0.14	19.0	1	1	1
PRT	sp|Q9H6S0|YTDC2_HUMAN	3'-5' RNA helicase YTHDC2 OS=Homo sapiens OX=9606 GN=YTHDC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q08J23|NSUN2_HUMAN	RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.03	19.0	1	1	0
PRT	sp|P23258|TBG1_HUMAN	Tubulin gamma-1 chain OS=Homo sapiens OX=9606 GN=TUBG1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.06	19.0	1	1	0
PRT	sp|P33993|MCM7_HUMAN	DNA replication licensing factor MCM7 OS=Homo sapiens OX=9606 GN=MCM7 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	null	572-UNIMOD:35	0.03	19.0	1	1	0
PRT	sp|Q3SXM5|HSDL1_HUMAN	Inactive hydroxysteroid dehydrogenase-like protein 1 OS=Homo sapiens OX=9606 GN=HSDL1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.08	19.0	1	1	0
PRT	sp|Q03154|ACY1_HUMAN	Aminoacylase-1 OS=Homo sapiens OX=9606 GN=ACY1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.09	19.0	1	1	1
PRT	sp|Q8NFH5|NUP35_HUMAN	Nucleoporin NUP35 OS=Homo sapiens OX=9606 GN=NUP35 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	null	2-UNIMOD:1	0.16	19.0	1	1	1
PRT	sp|P53621|COPA_HUMAN	Coatomer subunit alpha OS=Homo sapiens OX=9606 GN=COPA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	null	85-UNIMOD:385,85-UNIMOD:4	0.01	19.0	1	1	1
PRT	sp|P49662|CASP4_HUMAN	Caspase-4 OS=Homo sapiens OX=9606 GN=CASP4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.05	19.0	2	1	0
PRT	sp|Q01813|PFKAP_HUMAN	ATP-dependent 6-phosphofructokinase, platelet type OS=Homo sapiens OX=9606 GN=PFKP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	343-UNIMOD:4	0.04	19.0	2	1	0
PRT	sp|P37268|FDFT_HUMAN	Squalene synthase OS=Homo sapiens OX=9606 GN=FDFT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	null	120-UNIMOD:28	0.04	19.0	1	1	1
PRT	sp|Q9H173|SIL1_HUMAN	Nucleotide exchange factor SIL1 OS=Homo sapiens OX=9606 GN=SIL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	379-UNIMOD:4	0.07	19.0	1	1	1
PRT	sp|Q8IY81|SPB1_HUMAN	pre-rRNA 2'-O-ribose RNA methyltransferase FTSJ3 OS=Homo sapiens OX=9606 GN=FTSJ3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.04	19.0	2	1	0
PRT	sp|Q6P1K1-2|HRG1_HUMAN	Isoform 2 of Heme transporter HRG1 OS=Homo sapiens OX=9606 GN=SLC48A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.15	18.0	1	1	1
PRT	sp|Q12792|TWF1_HUMAN	Twinfilin-1 OS=Homo sapiens OX=9606 GN=TWF1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null	67-UNIMOD:4	0.06	18.0	1	1	1
PRT	sp|P18621-2|RL17_HUMAN	Isoform 2 of 60S ribosomal protein L17 OS=Homo sapiens OX=9606 GN=RPL17	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.12	18.0	1	1	1
PRT	sp|P21281|VATB2_HUMAN	V-type proton ATPase subunit B, brain isoform OS=Homo sapiens OX=9606 GN=ATP6V1B2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	18.0	null	162-UNIMOD:4	0.12	18.0	2	2	2
PRT	sp|Q8TD16|BICD2_HUMAN	Protein bicaudal D homolog 2 OS=Homo sapiens OX=9606 GN=BICD2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.03	18.0	1	1	1
PRT	sp|Q9HBH5|RDH14_HUMAN	Retinol dehydrogenase 14 OS=Homo sapiens OX=9606 GN=RDH14 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.04	18.0	1	1	1
PRT	sp|Q96M27|PRRC1_HUMAN	Protein PRRC1 OS=Homo sapiens OX=9606 GN=PRRC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	null	348-UNIMOD:4	0.11	18.0	1	1	1
PRT	sp|P54136|SYRC_HUMAN	Arginine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=RARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.04	18.0	1	1	0
PRT	sp|Q8NI27|THOC2_HUMAN	THO complex subunit 2 OS=Homo sapiens OX=9606 GN=THOC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	628-UNIMOD:35,646-UNIMOD:4	0.02	18.0	1	1	1
PRT	sp|Q562R1|ACTBL_HUMAN	Beta-actin-like protein 2 OS=Homo sapiens OX=9606 GN=ACTBL2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	124-UNIMOD:35,133-UNIMOD:35	0.08	18.0	2	1	0
PRT	sp|Q96HW7|INT4_HUMAN	Integrator complex subunit 4 OS=Homo sapiens OX=9606 GN=INTS4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.02	18.0	2	1	0
PRT	sp|Q9BUZ4|TRAF4_HUMAN	TNF receptor-associated factor 4 OS=Homo sapiens OX=9606 GN=TRAF4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.04	18.0	1	1	1
PRT	sp|P62913|RL11_HUMAN	60S ribosomal protein L11 OS=Homo sapiens OX=9606 GN=RPL11 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.13	18.0	2	1	0
PRT	sp|P33121-2|ACSL1_HUMAN	Isoform 2 of Long-chain-fatty-acid--CoA ligase 1 OS=Homo sapiens OX=9606 GN=ACSL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null	311-UNIMOD:4	0.04	17.0	1	1	1
PRT	sp|Q9UIF9-2|BAZ2A_HUMAN	Isoform 1 of Bromodomain adjacent to zinc finger domain protein 2A OS=Homo sapiens OX=9606 GN=BAZ2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null	861-UNIMOD:4	0.02	17.0	1	1	1
PRT	sp|Q9BVL4|SELO_HUMAN	Protein adenylyltransferase SelO, mitochondrial OS=Homo sapiens OX=9606 GN=SELENOO PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.04	17.0	1	1	1
PRT	sp|Q15165|PON2_HUMAN	Serum paraoxonase/arylesterase 2 OS=Homo sapiens OX=9606 GN=PON2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.07	17.0	1	1	0
PRT	sp|Q9BZE4|NOG1_HUMAN	Nucleolar GTP-binding protein 1 OS=Homo sapiens OX=9606 GN=GTPBP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.03	17.0	1	1	0
PRT	sp|Q09028|RBBP4_HUMAN	Histone-binding protein RBBP4 OS=Homo sapiens OX=9606 GN=RBBP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	null		0.08	17.0	1	1	0
PRT	sp|P00558|PGK1_HUMAN	Phosphoglycerate kinase 1 OS=Homo sapiens OX=9606 GN=PGK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	null	333-UNIMOD:28	0.05	17.0	1	1	1
PRT	sp|P0DP23|CALM1_HUMAN	Calmodulin-1 OS=Homo sapiens OX=9606 GN=CALM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	52-UNIMOD:35	0.26	17.0	1	1	1
PRT	sp|Q86TN4|TRPT1_HUMAN	tRNA 2'-phosphotransferase 1 OS=Homo sapiens OX=9606 GN=TRPT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	173-UNIMOD:4	0.09	17.0	1	1	1
PRT	sp|P11413|G6PD_HUMAN	Glucose-6-phosphate 1-dehydrogenase OS=Homo sapiens OX=9606 GN=G6PD PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|Q14997|PSME4_HUMAN	Proteasome activator complex subunit 4 OS=Homo sapiens OX=9606 GN=PSME4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|P30044|PRDX5_HUMAN	Peroxiredoxin-5, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX5 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.08	17.0	1	1	1
PRT	sp|P30622|CLIP1_HUMAN	CAP-Gly domain-containing linker protein 1 OS=Homo sapiens OX=9606 GN=CLIP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.03	17.0	1	1	0
PRT	sp|P78560-2|CRADD_HUMAN	Isoform 2 of Death domain-containing protein CRADD OS=Homo sapiens OX=9606 GN=CRADD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.17	16.0	1	1	1
PRT	sp|P42356|PI4KA_HUMAN	Phosphatidylinositol 4-kinase alpha OS=Homo sapiens OX=9606 GN=PI4KA PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|Q14966-2|ZN638_HUMAN	Isoform 2 of Zinc finger protein 638 OS=Homo sapiens OX=9606 GN=ZNF638	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.05	16.0	1	1	1
PRT	sp|Q8WW59|SPRY4_HUMAN	SPRY domain-containing protein 4 OS=Homo sapiens OX=9606 GN=SPRYD4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.13	16.0	1	1	1
PRT	sp|Q5VUA4|ZN318_HUMAN	Zinc finger protein 318 OS=Homo sapiens OX=9606 GN=ZNF318 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	null	1138-UNIMOD:4,1141-UNIMOD:4	0.01	16.0	1	1	1
PRT	sp|Q12894|IFRD2_HUMAN	Interferon-related developmental regulator 2 OS=Homo sapiens OX=9606 GN=IFRD2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.03	16.0	1	1	1
PRT	sp|Q9NS93|TM7S3_HUMAN	Transmembrane 7 superfamily member 3 OS=Homo sapiens OX=9606 GN=TM7SF3 PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.04	16.0	1	1	1
PRT	sp|O95758-7|PTBP3_HUMAN	Isoform 7 of Polypyrimidine tract-binding protein 3 OS=Homo sapiens OX=9606 GN=PTBP3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.07	16.0	1	1	0
PRT	sp|Q9P2D3-2|HTR5B_HUMAN	Isoform 2 of HEAT repeat-containing protein 5B OS=Homo sapiens OX=9606 GN=HEATR5B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.02	16.0	1	1	1
PRT	sp|Q8IWF6|DEN6A_HUMAN	Protein DENND6A OS=Homo sapiens OX=9606 GN=DENND6A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.03	16.0	1	1	1
PRT	sp|Q13724-2|MOGS_HUMAN	Isoform 2 of Mannosyl-oligosaccharide glucosidase OS=Homo sapiens OX=9606 GN=MOGS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.03	16.0	2	1	0
PRT	sp|Q7L2E3|DHX30_HUMAN	ATP-dependent RNA helicase DHX30 OS=Homo sapiens OX=9606 GN=DHX30 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	null	895-UNIMOD:385,895-UNIMOD:4,905-UNIMOD:4	0.01	16.0	1	1	1
PRT	sp|P30740|ILEU_HUMAN	Leukocyte elastase inhibitor OS=Homo sapiens OX=9606 GN=SERPINB1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	228-UNIMOD:35	0.08	16.0	1	1	0
PRT	sp|P36404|ARL2_HUMAN	ADP-ribosylation factor-like protein 2 OS=Homo sapiens OX=9606 GN=ARL2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	153-UNIMOD:4,157-UNIMOD:4	0.17	16.0	2	1	0
PRT	sp|Q6DD88|ATLA3_HUMAN	Atlastin-3 OS=Homo sapiens OX=9606 GN=ATL3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	197-UNIMOD:35	0.04	16.0	1	1	1
PRT	sp|Q96EY7|PTCD3_HUMAN	Pentatricopeptide repeat domain-containing protein 3, mitochondrial OS=Homo sapiens OX=9606 GN=PTCD3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	642-UNIMOD:4	0.04	16.0	1	1	1
PRT	sp|P14314-2|GLU2B_HUMAN	Isoform 2 of Glucosidase 2 subunit beta OS=Homo sapiens OX=9606 GN=PRKCSH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	15.0	null	497-UNIMOD:4,509-UNIMOD:4	0.06	15.0	1	1	0
PRT	sp|Q15102|PA1B3_HUMAN	Platelet-activating factor acetylhydrolase IB subunit gamma OS=Homo sapiens OX=9606 GN=PAFAH1B3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	15.0	null	55-UNIMOD:4	0.11	15.0	1	1	1
PRT	sp|Q8IXI2-4|MIRO1_HUMAN	Isoform 4 of Mitochondrial Rho GTPase 1 OS=Homo sapiens OX=9606 GN=RHOT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.03	15.0	1	1	1
PRT	sp|Q02809|PLOD1_HUMAN	Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 OS=Homo sapiens OX=9606 GN=PLOD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.03	15.0	1	1	1
PRT	sp|P04049|RAF1_HUMAN	RAF proto-oncogene serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=RAF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.05	15.0	1	1	1
PRT	sp|Q06323|PSME1_HUMAN	Proteasome activator complex subunit 1 OS=Homo sapiens OX=9606 GN=PSME1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.07	15.0	1	1	1
PRT	sp|P30566-2|PUR8_HUMAN	Isoform 2 of Adenylosuccinate lyase OS=Homo sapiens OX=9606 GN=ADSL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.04	15.0	1	1	1
PRT	sp|Q16795|NDUA9_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFA9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.05	15.0	1	1	1
PRT	sp|Q96AC1|FERM2_HUMAN	Fermitin family homolog 2 OS=Homo sapiens OX=9606 GN=FERMT2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.03	15.0	1	1	0
PRT	sp|Q9Y6B6|SAR1B_HUMAN	GTP-binding protein SAR1b OS=Homo sapiens OX=9606 GN=SAR1B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	102-UNIMOD:4	0.11	15.0	1	1	1
PRT	sp|P78417|GSTO1_HUMAN	Glutathione S-transferase omega-1 OS=Homo sapiens OX=9606 GN=GSTO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	115-UNIMOD:35	0.08	15.0	2	1	0
PRT	sp|Q9UBW8|CSN7A_HUMAN	COP9 signalosome complex subunit 7a OS=Homo sapiens OX=9606 GN=COPS7A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	null	110-UNIMOD:4	0.12	14.0	2	2	2
PRT	sp|Q9BZF1-3|OSBL8_HUMAN	Isoform 3 of Oxysterol-binding protein-related protein 8 OS=Homo sapiens OX=9606 GN=OSBPL8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	null		0.02	14.0	1	1	1
PRT	sp|Q92547|TOPB1_HUMAN	DNA topoisomerase 2-binding protein 1 OS=Homo sapiens OX=9606 GN=TOPBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	null	362-UNIMOD:4	0.02	14.0	1	1	1
PRT	sp|Q9H0C8|ILKAP_HUMAN	Integrin-linked kinase-associated serine/threonine phosphatase 2C OS=Homo sapiens OX=9606 GN=ILKAP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	14.0	null	344-UNIMOD:4	0.06	14.0	2	1	0
PRT	sp|Q6NXE6-2|ARMC6_HUMAN	Isoform 2 of Armadillo repeat-containing protein 6 OS=Homo sapiens OX=9606 GN=ARMC6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	null		0.08	14.0	1	1	1
PRT	sp|Q58FF7|H90B3_HUMAN	Putative heat shock protein HSP 90-beta-3 OS=Homo sapiens OX=9606 GN=HSP90AB3P PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.03	14.0	1	1	0
PRT	sp|Q8N163|CCAR2_HUMAN	Cell cycle and apoptosis regulator protein 2 OS=Homo sapiens OX=9606 GN=CCAR2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.04	14.0	1	1	0
PRT	sp|Q96KG9|SCYL1_HUMAN	N-terminal kinase-like protein OS=Homo sapiens OX=9606 GN=SCYL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.03	14.0	1	1	0
PRT	sp|Q9Y3B8|ORN_HUMAN	Oligoribonuclease, mitochondrial OS=Homo sapiens OX=9606 GN=REXO2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.08	14.0	1	1	0
PRT	sp|Q9BSH5|HDHD3_HUMAN	Haloacid dehalogenase-like hydrolase domain-containing protein 3 OS=Homo sapiens OX=9606 GN=HDHD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	243-UNIMOD:4	0.10	14.0	1	1	1
PRT	sp|Q9P287|BCCIP_HUMAN	BRCA2 and CDKN1A-interacting protein OS=Homo sapiens OX=9606 GN=BCCIP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	null	216-UNIMOD:385,216-UNIMOD:4	0.03	14.0	1	1	1
PRT	sp|Q63HN8|RN213_HUMAN	E3 ubiquitin-protein ligase RNF213 OS=Homo sapiens OX=9606 GN=RNF213 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.00	14.0	1	1	1
PRT	sp|Q9UKI2|BORG2_HUMAN	Cdc42 effector protein 3 OS=Homo sapiens OX=9606 GN=CDC42EP3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	119-UNIMOD:35	0.14	14.0	1	1	1
PRT	sp|Q9BZ67-3|FRMD8_HUMAN	Isoform 3 of FERM domain-containing protein 8 OS=Homo sapiens OX=9606 GN=FRMD8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	13.0	null		0.07	13.0	1	1	1
PRT	sp|Q92530|PSMF1_HUMAN	Proteasome inhibitor PI31 subunit OS=Homo sapiens OX=9606 GN=PSMF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	13.0	null	185-UNIMOD:4	0.09	13.0	1	1	1
PRT	sp|O60443|GSDME_HUMAN	Gasdermin-E OS=Homo sapiens OX=9606 GN=GSDME PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	365-UNIMOD:4,371-UNIMOD:4	0.06	13.0	1	1	0
PRT	sp|Q5SWX8|ODR4_HUMAN	Protein odr-4 homolog OS=Homo sapiens OX=9606 GN=ODR4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	null	317-UNIMOD:385,317-UNIMOD:4	0.04	13.0	1	1	1
PRT	sp|P84243|H33_HUMAN	Histone H3.3 OS=Homo sapiens OX=9606 GN=H3-3A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	111-UNIMOD:4	0.24	13.0	2	1	0
PRT	sp|P49815|TSC2_HUMAN	Tuberin OS=Homo sapiens OX=9606 GN=TSC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null		0.02	13.0	1	1	1
PRT	sp|Q9ULH0|KDIS_HUMAN	Kinase D-interacting substrate of 220 kDa OS=Homo sapiens OX=9606 GN=KIDINS220 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	null	2-UNIMOD:1	0.01	13.0	1	1	1
PRT	sp|O15533|TPSN_HUMAN	Tapasin OS=Homo sapiens OX=9606 GN=TAPBP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	315-UNIMOD:4	0.07	13.0	1	1	1
PRT	sp|P09622|DLDH_HUMAN	Dihydrolipoyl dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=DLD PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	361-UNIMOD:35	0.04	13.0	1	1	1
PRT	sp|Q9UKU0-7|ACSL6_HUMAN	Isoform 7 of Long-chain-fatty-acid--CoA ligase 6 OS=Homo sapiens OX=9606 GN=ACSL6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null		0.04	13.0	1	1	1
PRT	sp|P21359-2|NF1_HUMAN	Isoform 1 of Neurofibromin OS=Homo sapiens OX=9606 GN=NF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	12.0	null		0.01	12.0	1	1	1
PRT	sp|O94901-6|SUN1_HUMAN	Isoform 6 of SUN domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SUN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	12.0	null		0.03	12.0	1	1	1
PRT	sp|Q9Y6J9|TAF6L_HUMAN	TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L OS=Homo sapiens OX=9606 GN=TAF6L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	12.0	null		0.03	12.0	1	1	1
PRT	sp|Q9Y4R8|TELO2_HUMAN	Telomere length regulation protein TEL2 homolog OS=Homo sapiens OX=9606 GN=TELO2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	12.0	null		0.02	12.0	1	1	1
PRT	sp|P09001|RM03_HUMAN	39S ribosomal protein L3, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	12.0	null	338-UNIMOD:4	0.11	12.0	1	1	1
PRT	sp|Q8TBX8-2|PI42C_HUMAN	Isoform 2 of Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma OS=Homo sapiens OX=9606 GN=PIP4K2C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	12.0	null		0.03	12.0	1	1	1
PRT	sp|Q9H7Z3|NRDE2_HUMAN	Nuclear exosome regulator NRDE2 OS=Homo sapiens OX=9606 GN=NRDE2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	12.0	null		0.01	12.0	1	1	1
PRT	sp|Q14738|2A5D_HUMAN	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform OS=Homo sapiens OX=9606 GN=PPP2R5D PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null		0.03	12.0	1	1	1
PRT	sp|P54578|UBP14_HUMAN	Ubiquitin carboxyl-terminal hydrolase 14 OS=Homo sapiens OX=9606 GN=USP14 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null		0.03	12.0	1	1	1
PRT	sp|Q9UDY4|DNJB4_HUMAN	DnaJ homolog subfamily B member 4 OS=Homo sapiens OX=9606 GN=DNAJB4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12.0	null		0.08	12.0	1	1	1
PRT	sp|P25787|PSA2_HUMAN	Proteasome subunit alpha type-2 OS=Homo sapiens OX=9606 GN=PSMA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12.0	null	137-UNIMOD:4	0.20	12.0	1	1	1
PRT	sp|P98082|DAB2_HUMAN	Disabled homolog 2 OS=Homo sapiens OX=9606 GN=DAB2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12.0	null	263-UNIMOD:4	0.08	12.0	1	1	1
PRT	sp|Q9P2G1|AKIB1_HUMAN	Ankyrin repeat and IBR domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ANKIB1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12.0	null	157-UNIMOD:35,160-UNIMOD:4	0.02	12.0	1	1	1
PRT	sp|Q13416|ORC2_HUMAN	Origin recognition complex subunit 2 OS=Homo sapiens OX=9606 GN=ORC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12.0	null		0.05	12.0	1	1	1
PRT	sp|P59046|NAL12_HUMAN	NACHT, LRR and PYD domains-containing protein 12 OS=Homo sapiens OX=9606 GN=NLRP12 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	905-UNIMOD:4	0.02	12.0	1	1	1
PRT	sp|O95758|PTBP3_HUMAN	Polypyrimidine tract-binding protein 3 OS=Homo sapiens OX=9606 GN=PTBP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null		0.06	12.0	1	1	0
PRT	sp|Q9Y385|UB2J1_HUMAN	Ubiquitin-conjugating enzyme E2 J1 OS=Homo sapiens OX=9606 GN=UBE2J1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	119-UNIMOD:35	0.09	12.0	1	1	1
PRT	sp|Q9NX04-2|CA109_HUMAN	Isoform 2 of Uncharacterized protein C1orf109 OS=Homo sapiens OX=9606 GN=C1orf109	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	11.0	null	35-UNIMOD:4	0.21	11.0	1	1	1
PRT	sp|Q96TA2-3|YMEL1_HUMAN	Isoform 3 of ATP-dependent zinc metalloprotease YME1L1 OS=Homo sapiens OX=9606 GN=YME1L1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	11.0	null		0.06	11.0	1	1	1
PRT	sp|O60831|PRAF2_HUMAN	PRA1 family protein 2 OS=Homo sapiens OX=9606 GN=PRAF2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	11.0	null		0.11	11.0	1	1	1
PRT	sp|Q70Z35-3|PREX2_HUMAN	Isoform 3 of Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein OS=Homo sapiens OX=9606 GN=PREX2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	11.0	null		0.02	11.0	1	1	1
PRT	sp|Q8N7R0|NANG2_HUMAN	Putative homeobox protein NANOG2 OS=Homo sapiens OX=9606 GN=NANOGP1 PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	11.0	null	68-UNIMOD:35	0.10	11.0	1	1	1
PRT	sp|O14654|IRS4_HUMAN	Insulin receptor substrate 4 OS=Homo sapiens OX=9606 GN=IRS4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	11.0	null		0.02	11.0	1	1	1
PRT	sp|Q9C0D6|FHDC1_HUMAN	FH2 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FHDC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	11.0	null		0.02	11.0	1	1	1
PRT	sp|Q9UL42|PNMA2_HUMAN	Paraneoplastic antigen Ma2 OS=Homo sapiens OX=9606 GN=PNMA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	11.0	null	218-UNIMOD:35,233-UNIMOD:4	0.08	11.0	1	1	1
PRT	sp|Q6PIF6|MYO7B_HUMAN	Unconventional myosin-VIIb OS=Homo sapiens OX=9606 GN=MYO7B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	11.0	null		0.01	11.0	1	1	1
PRT	sp|O75955|FLOT1_HUMAN	Flotillin-1 OS=Homo sapiens OX=9606 GN=FLOT1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	11.0	null		0.04	11.0	1	1	1
PRT	sp|A6NMZ7|CO6A6_HUMAN	Collagen alpha-6(VI) chain OS=Homo sapiens OX=9606 GN=COL6A6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	11.0	null		0.01	11.0	1	1	1
PRT	sp|Q9H2G2|SLK_HUMAN	STE20-like serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=SLK PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	11.0	null	608-UNIMOD:35	0.01	11.0	1	1	1
PRT	sp|Q9NRC6|SPTN5_HUMAN	Spectrin beta chain, non-erythrocytic 5 OS=Homo sapiens OX=9606 GN=SPTBN5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	11.0	null		0.01	11.0	1	1	1
PRT	sp|Q9NWW7|CB042_HUMAN	Uncharacterized protein C2orf42 OS=Homo sapiens OX=9606 GN=C2orf42 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	11.0	null		0.04	11.0	1	1	1
PRT	sp|Q96J42|TXD15_HUMAN	Thioredoxin domain-containing protein 15 OS=Homo sapiens OX=9606 GN=TXNDC15 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	11.0	null		0.09	11.0	1	1	1
PRT	sp|Q3V6T2|GRDN_HUMAN	Girdin OS=Homo sapiens OX=9606 GN=CCDC88A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	11.0	null		0.01	11.0	1	1	1
PRT	sp|O00273|DFFA_HUMAN	DNA fragmentation factor subunit alpha OS=Homo sapiens OX=9606 GN=DFFA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	11.0	null	78-UNIMOD:4	0.09	11.0	1	1	1
PRT	sp|Q9Y2Z2|MTO1_HUMAN	Protein MTO1 homolog, mitochondrial OS=Homo sapiens OX=9606 GN=MTO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	11.0	null	75-UNIMOD:35,77-UNIMOD:4,90-UNIMOD:35	0.03	11.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	DYTRPDLPSGDSQPSLDQTMAAAFGLSVPNVHGALAPLAIPSAAAAAAAAGR	1	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	91		ms_run[1]:scan=552	2.9716131	4	5057.5277	5057.5300	R	I	274	326
PSM	GILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVK	2	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	86		ms_run[1]:scan=7022	38.48188	4	4035.893340	4035.887504	K	L	272	310
PSM	GILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVK	3	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	83		ms_run[1]:scan=7119	39.022885	4	4035.893340	4035.887504	K	L	272	310
PSM	IPVTDEEQTNVPYIYAIGDILEDKVELTPVAIQAGR	4	sp|Q16881-7|TRXR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	78		ms_run[2]:scan=3127	16.971	3	3969.0623	3969.0623	K	L	278	314
PSM	IPVTDEEQTNVPYIYAIGDILEDKVELTPVAIQAGR	5	sp|Q16881-7|TRXR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	76		ms_run[2]:scan=3225	17.491	3	3969.0623	3969.0623	K	L	278	314
PSM	IPNFWVTTFVNHPQVSALLGEEDEEALHYLTR	6	sp|Q01105-3|SET_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	74		ms_run[2]:scan=7407	40.633	4	3724.8526	3724.8526	K	V	66	98
PSM	GILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVK	7	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	74		ms_run[1]:scan=7218	39.577749	4	4035.893340	4035.887504	K	L	272	310
PSM	GILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVK	8	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	72		ms_run[1]:scan=6921	37.907147	4	4035.893340	4035.887504	K	L	272	310
PSM	GHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYK	9	sp|P04179-4|SODM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	71	8-UNIMOD:4	ms_run[2]:scan=5240	28.536	4	4292.1728	4292.1728	R	N	111	149
PSM	IPNFWVTTFVNHPQVSALLGEEDEEALHYLTR	10	sp|Q01105-3|SET_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	71		ms_run[2]:scan=739	4.0021	4	3724.8526	3724.8526	K	V	66	98
PSM	ISLHPIEDNPIEEISVLSPEDLEAIKNPDSITNQIALLEAR	11	sp|Q9NTJ3-2|SMC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	71		ms_run[2]:scan=1025	5.5219	4	4535.3647	4535.3647	K	C	984	1025
PSM	DYTRPDLPSGDSQPSLDQTMAAAFGLSVPNVHGALAPLAIPSAAAAAAAAGR	12	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	71		ms_run[1]:scan=443	2.4193961	4	5057.5277	5057.5300	R	I	274	326
PSM	GHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYK	13	sp|P04179-4|SODM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	70	8-UNIMOD:4	ms_run[2]:scan=5338	29.089	4	4292.1728	4292.1728	R	N	111	149
PSM	IPNFWVTTFVNHPQVSALLGEEDEEALHYLTR	14	sp|Q01105-3|SET_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	70		ms_run[2]:scan=783	4.2443	3	3724.8526	3724.8526	K	V	66	98
PSM	IPNFWVTTFVNHPQVSALLGEEDEEALHYLTR	15	sp|Q01105-3|SET_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	70		ms_run[2]:scan=882	4.7772	3	3724.8526	3724.8526	K	V	66	98
PSM	LPSGLGCSTVLSPEGSAQFAAQIFGLSNHLVWSK	16	sp|P22234|PUR6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	69	7-UNIMOD:4	ms_run[2]:scan=5128	27.933	3	3557.7977	3557.7977	R	L	368	402
PSM	DYTRPDLPSGDSQPSLDQTMAAAFGLSVPNVHGALAPLAIPSAAAAAAAAGR	17	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	69		ms_run[1]:scan=675	3.6472966	4	5057.5277	5057.5300	R	I	274	326
PSM	AQAALQAVNSVQSGNLALAASAAAVDAGMAMAGQSPVLR	18	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	68		ms_run[2]:scan=4039	21.96	3	3679.8774	3679.8774	R	I	147	186
PSM	RCPHPLTFDVNNPLHLDYVMAAANLFAQTYGLTGSQDR	19	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	68	2-UNIMOD:4	ms_run[2]:scan=4402	23.961	5	4302.0739	4302.0739	K	A	707	745
PSM	VVDNPIYLSDMGAALTGAESHELQDVLEETNIPK	20	sp|P36776-3|LONM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	68		ms_run[2]:scan=750	4.0604	3	3667.7927	3667.7927	R	R	128	162
PSM	GGLGGGYGGASGMGGITAVTVNQSLLSPLVLEVDPNIQAVR	21	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	67		ms_run[2]:scan=367	2.0215	3	3924.0415	3924.0415	R	T	48	89
PSM	GGLGGGYGGASGMGGITAVTVNQSLLSPLVLEVDPNIQAVR	22	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	67		ms_run[2]:scan=396	2.1834	4	3924.0415	3924.0415	R	T	48	89
PSM	KEEQVISLGPQVAEGENVFGVCHIFASFNDTFVHVTDLSGK	23	sp|P62263|RS14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	67	22-UNIMOD:4	ms_run[2]:scan=420	2.3067	5	4504.2009	4504.2009	K	E	10	51
PSM	ASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGK	24	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	67	45-UNIMOD:4,48-UNIMOD:4	ms_run[1]:scan=4788	26.02806	4	5806.8709	5806.8792	R	I	13	68
PSM	ALEAFDLDPAQWGVNVQPYSGSPANLAVYTALLQPHDR	25	sp|P34897-3|GLYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	66		ms_run[2]:scan=2554	13.838	3	4123.0439	4123.0439	R	I	102	140
PSM	AQAALQAVNSVQSGNLALAASAAAVDAGMAMAGQSPVLR	26	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	66		ms_run[2]:scan=4139	22.489	3	3679.8774	3679.8774	R	I	147	186
PSM	GGAAGGGYSQVIPMEEFNLHLTGDIHAITAANNLVAAAIDAR	27	sp|P11586|C1TC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	66		ms_run[2]:scan=2873	15.566	4	4205.0964	4205.0964	K	I	422	464
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	28	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	66	27-UNIMOD:4	ms_run[1]:scan=7572	41.543428	3	3511.699869	3512.695593	R	R	85	117
PSM	GGLGGGYGGASGMGGITAVTVNQSLLSPLVLEVDPNIQAVR	29	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	65		ms_run[2]:scan=475	2.5764	3	3924.0415	3924.0415	R	T	48	89
PSM	GILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVK	30	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	65		ms_run[1]:scan=7317	40.128206	4	4035.893340	4035.887504	K	L	272	310
PSM	IPVTDEEQTNVPYIYAIGDILEDKVELTPVAIQAGR	31	sp|Q16881|TRXR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	65		ms_run[1]:scan=3260	17.675212	4	3969.069752	3969.062280	K	L	466	502
PSM	EIYPYVIQELRPTLNELGISTPEELGLDKV	32	sp|P20674|COX5A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	64		ms_run[2]:scan=4325	23.529	3	3427.8127	3427.8127	K	-	121	151
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	33	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	64	13-UNIMOD:4,27-UNIMOD:4	ms_run[2]:scan=7517	41.251	3	3585.6942	3585.6942	R	R	85	117
PSM	GSDWLGDQDAIHYMTEQAPAAVVELENYGMPFSR	34	sp|P31040|SDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	64		ms_run[2]:scan=3951	21.48	3	3796.7138	3796.7138	K	T	129	163
PSM	QNLLQAAGNVGQASGELLQQIGESDTDPHFQDALMQLAK	35	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	64		ms_run[2]:scan=4680	25.452	4	4135.028	4135.0280	R	A	635	674
PSM	ALEAFDLDPAQWGVNVQPYSGSPANLAVYTALLQPHDR	36	sp|P34897-3|GLYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	63		ms_run[2]:scan=2653	14.369	3	4123.0439	4123.0439	R	I	102	140
PSM	EAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPK	37	sp|O75369-5|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	63		ms_run[2]:scan=4436	24.148	4	4592.188	4592.1880	R	A	200	240
PSM	EIYPYVIQELRPTLNELGISTPEELGLDKV	38	sp|P20674|COX5A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	63		ms_run[2]:scan=4226	22.972	3	3427.8127	3427.8127	K	-	121	151
PSM	IPNFWVTTFVNHPQVSALLGEEDEEALHYLTR	39	sp|Q01105-3|SET_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	63		ms_run[2]:scan=838	4.5535	4	3724.8526	3724.8526	K	V	66	98
PSM	IPNFWVTTFVNHPQVSALLGEEDEEALHYLTR	40	sp|Q01105-3|SET_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	63		ms_run[2]:scan=938	5.0798	4	3724.8526	3724.8526	K	V	66	98
PSM	IPNFWVTTFVNHPQVSALLGEEDEEALHYLTR	41	sp|Q01105-3|SET_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	63		ms_run[2]:scan=1048	5.6526	4	3724.8526	3724.8526	K	V	66	98
PSM	VADNLAIQLAAVTEDKYEILQSVDDAAIVIK	42	sp|Q12906|ILF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	63		ms_run[1]:scan=7520	41.268288	3	3326.782219	3327.781354	K	N	128	159
PSM	GGLGGGYGGASGMGGITAVTVNQSLLSPLVLEVDPNIQAVR	43	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	62		ms_run[2]:scan=7529	41.317	3	3924.0415	3924.0415	R	T	48	89
PSM	HVTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDILAK	44	sp|Q16836|HCDH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	62		ms_run[2]:scan=1961	10.602	4	3611.9345	3611.9345	K	S	29	66
PSM	IECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFK	45	sp|O75369-5|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	62	3-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=5592	30.497	4	4502.1087	4502.1087	K	A	1085	1125
PSM	SLTGVVNAQALTSAFSPHTKPWIGLAEALGTLMR	46	sp|O43175|SERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	62		ms_run[2]:scan=6833	37.405	4	3536.8814	3536.8814	K	A	311	345
PSM	EEQVISLGPQVAEGENVFGVCHIFASFNDTFVHVTDLSGK	47	sp|P62263|RS14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	61	21-UNIMOD:4	ms_run[2]:scan=4886	26.559	4	4376.106	4376.1060	K	E	11	51
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	48	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	61	7-UNIMOD:35,13-UNIMOD:4,27-UNIMOD:4	ms_run[2]:scan=6283	34.332	3	3601.6891	3601.6891	R	R	85	117
PSM	LGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLK	49	sp|O00487|PSDE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	61		ms_run[2]:scan=5966	32.57	3	3322.7119	3322.7119	R	M	7	41
PSM	NPILWNVADVVIKFPEEEAPSTVLSQNLFTPK	50	sp|P04844|RPN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	61		ms_run[2]:scan=5129	27.939	3	3594.8974	3594.8974	K	Q	492	524
PSM	QAFQGDSIPVFDLLILGVGPDGHTCSLFPDHPLLQER	51	sp|O95336|6PGL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	61	25-UNIMOD:4	ms_run[2]:scan=5062	27.558	4	4088.0466	4088.0466	R	E	132	169
PSM	TITDVINIGIGGSDLGPLMVTEALKPYSSGGPR	52	sp|P06744|G6PI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	61		ms_run[2]:scan=596	3.2095	3	3327.7384	3327.7384	K	V	148	181
PSM	VGAGAPVYLAAVLEYLTAEILELAGNAAR	53	sp|P04908|H2A1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	61		ms_run[1]:scan=7600	41.705167	3	2915.580155	2914.580410	R	D	44	73
PSM	IPVTDEEQTNVPYIYAIGDILEDKVELTPVAIQAGR	54	sp|Q16881|TRXR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	61		ms_run[1]:scan=3160	17.154345	4	3969.069752	3969.062280	K	L	466	502
PSM	IPVTDEEQTNVPYIYAIGDILEDKVELTPVAIQAGR	55	sp|Q16881-7|TRXR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	60		ms_run[2]:scan=3326	18.038	3	3969.0623	3969.0623	K	L	278	314
PSM	IQDLPPVDLSLVNKDENAIYFLGNSLGLQPK	56	sp|Q16719-2|KYNU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	60		ms_run[2]:scan=299	1.6465	3	3409.8133	3409.8133	K	M	51	82
PSM	ISLHPIEDNPIEEISVLSPEDLEAIKNPDSITNQIALLEAR	57	sp|Q9NTJ3-2|SMC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	60		ms_run[2]:scan=920	4.9878	4	4535.3647	4535.3647	K	C	984	1025
PSM	ITAVDKTEDSLEGCLDCLLQALAQNNTETSEK	58	sp|P52306-6|GDS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	60	14-UNIMOD:4,17-UNIMOD:4	ms_run[2]:scan=7406	40.628	3	3565.6764	3565.6764	K	I	14	46
PSM	QIQAAYSILSEVQQAVSQGSSDSQILDLSNR	59	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	60		ms_run[2]:scan=3538	19.211	3	3334.6641	3334.6641	R	F	705	736
PSM	TDALQPPHEYVPWVTVNGKPLEDQTQLLTLVCQLYQGK	60	sp|P13284|GILT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	60	32-UNIMOD:4	ms_run[2]:scan=258	1.4175	4	4378.2308	4378.2308	R	K	195	233
PSM	TITDVINIGIGGSDLGPLMVTEALKPYSSGGPR	61	sp|P06744|G6PI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	60		ms_run[2]:scan=387	2.1306	3	3327.7384	3327.7384	K	V	148	181
PSM	AQAALQAVNSVQSGNLALAASAAAVDAGMAMAGQSPVLR	62	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	60		ms_run[1]:scan=4061	22.08191	4	3679.880581	3679.877413	R	I	147	186
PSM	AQAALQAVNSVQSGNLALAASAAAVDAGMAMAGQSPVLR	63	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	60	29-UNIMOD:35	ms_run[1]:scan=4086	22.208631	3	3696.901507	3695.872328	R	I	147	186
PSM	ALEAFDLDPAQWGVNVQPYSGSPANLAVYTALLQPHDR	64	sp|P34897-3|GLYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	59		ms_run[2]:scan=2565	13.893	4	4123.0439	4123.0439	R	I	102	140
PSM	EIYPYVIQELRPTLNELGISTPEELGLDKV	65	sp|P20674|COX5A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	59		ms_run[2]:scan=4029	21.907	3	3427.8127	3427.8127	K	-	121	151
PSM	LYNLDVFQYELYNPMALYGSVPVLLAHNPHR	66	sp|Q14697|GANAB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	59		ms_run[2]:scan=1884	10.201	3	3645.8442	3645.8442	R	D	279	310
PSM	REQLIDMNAEGDETGVMDSLLEALQSGAAFR	67	sp|O60610-2|DIAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	59		ms_run[2]:scan=6663	36.438	3	3365.5868	3365.5868	K	R	1159	1190
PSM	TALLDAAGVASLLTTAEVVVTEIPKEEK	68	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	59		ms_run[2]:scan=7573	41.549	3	2867.5743	2867.5743	R	D	527	555
PSM	VAEQVGIDRGDIPDLSQAPSSLLDALEQHLASLEGK	69	sp|Q13492-4|PICAL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	59		ms_run[2]:scan=6151	33.607	4	3770.9327	3770.9327	K	K	202	238
PSM	QFTTVVADTGDFHAIDEYKPQDATTNPSLILAAAQMPAYQELVEEAIAYGR	70	sp|P37837|TALDO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	59		ms_run[1]:scan=4976	27.067385	4	5568.7004	5568.7030	K	K	20	71
PSM	ASFANEDGQVSPGSLLLAGAIAGMPAASLVTPADVIK	71	sp|Q9UJS0|CMC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	58		ms_run[2]:scan=4161	22.615	3	3537.8389	3537.8389	K	T	509	546
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	72	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	58	7-UNIMOD:35,13-UNIMOD:4,27-UNIMOD:4	ms_run[2]:scan=6182	33.786	3	3601.6891	3601.6891	R	R	85	117
PSM	HVTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDILAK	73	sp|Q16836|HCDH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	58		ms_run[2]:scan=1855	10.058	4	3611.9345	3611.9345	K	S	29	66
PSM	KEEQVISLGPQVAEGENVFGVCHIFASFNDTFVHVTDLSGK	74	sp|P62263|RS14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	58	22-UNIMOD:4	ms_run[2]:scan=462	2.5182	4	4504.2009	4504.2009	K	E	10	51
PSM	LIHEQDLEWLQQADVVVAEVTQPSLGVGYELGR	75	sp|O43598-2|DNPH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	58		ms_run[2]:scan=5884	32.125	3	3690.8893	3690.8893	R	A	75	108
PSM	LLSYQTSLVSDGETWHVMGISSLLPSLEAWK	76	sp|O43175|SERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	58		ms_run[2]:scan=3358	18.213	3	3446.7432	3446.7432	R	Q	492	523
PSM	LNLIHSEISNLAGFEVEAIINPTNADIDLKDDLGNTLEK	77	sp|O75367-3|H2AY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	58		ms_run[2]:scan=910	4.9332	4	4248.1802	4248.1802	K	K	196	235
PSM	TALLDAAGVASLLTTAEVVVTEIPKEEK	78	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	58		ms_run[2]:scan=7568	41.525	3	2867.5743	2867.5743	R	D	527	555
PSM	TITDVINIGIGGSDLGPLMVTEALKPYSSGGPR	79	sp|P06744|G6PI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	58		ms_run[2]:scan=695	3.7562	3	3327.7384	3327.7384	K	V	148	181
PSM	SDPMVQCIIEESGEHIIAGAGELHLEICLK	80	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	58	7-UNIMOD:4,28-UNIMOD:4	ms_run[1]:scan=7462	40.935581	3	3348.626165	3347.619985	K	D	530	560
PSM	AQAALQAVNSVQSGNLALAASAAAVDAGMAMAGQSPVLR	81	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	58		ms_run[1]:scan=3965	21.560947	4	3679.880581	3679.877413	R	I	147	186
PSM	DYTRPDLPSGDSQPSLDQTMAAAFGLSVPNVHGALAPLAIPSAAAAAAAAGR	82	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	58		ms_run[1]:scan=538	2.8977191	5	5057.5385	5057.5300	R	I	274	326
PSM	ASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGK	83	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	58	45-UNIMOD:4,48-UNIMOD:4	ms_run[1]:scan=4589	24.957311	4	5806.8709	5806.8792	R	I	13	68
PSM	EAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPK	84	sp|O75369-5|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	57		ms_run[2]:scan=4534	24.664	4	4592.188	4592.1880	R	A	200	240
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	85	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	57	13-UNIMOD:4,27-UNIMOD:4	ms_run[2]:scan=7518	41.257	4	3585.6942	3585.6942	R	R	85	117
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	86	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	57	27-UNIMOD:4	ms_run[2]:scan=7575	41.56	4	3512.6956	3512.6956	R	R	85	117
PSM	HEWVTTENGIGTVGISNFAQEALGDVVYCSLPEVGTK	87	sp|P23434|GCSH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	57	29-UNIMOD:4	ms_run[2]:scan=588	3.168	3	3976.9153	3976.9153	K	L	57	94
PSM	KLTPFIIQENLNLALNSASAIGCHVVNIGAEDLR	88	sp|P13797-3|PLST_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	57	23-UNIMOD:4	ms_run[2]:scan=4602	25.027	4	3689.9563	3689.9563	K	A	142	176
PSM	LIHEQDLEWLQQADVVVAEVTQPSLGVGYELGR	89	sp|O43598-2|DNPH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	57		ms_run[2]:scan=5784	31.557	3	3690.8893	3690.8893	R	A	75	108
PSM	LPSGLGCSTVLSPEGSAQFAAQIFGLSNHLVWSK	90	sp|P22234|PUR6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	57	7-UNIMOD:4	ms_run[2]:scan=5031	27.38	3	3557.7977	3557.7977	R	L	368	402
PSM	TITDVINIGIGGSDLGPLMVTEALKPYSSGGPR	91	sp|P06744|G6PI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	57		ms_run[2]:scan=498	2.6848	3	3327.7384	3327.7384	K	V	148	181
PSM	AGFDSDYDQALADIRENEQSLLEYLEK	92	sp|P52701-4|MSH6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	56		ms_run[2]:scan=7508	41.203	3	3131.4571	3131.4571	K	Q	629	656
PSM	FLVVLNFGDVGLSAGLQASDLPASASLPAK	93	sp|P08195-2|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	56		ms_run[2]:scan=7519	41.263	3	2956.591	2956.5910	R	A	462	492
PSM	GSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHNK	94	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	56		ms_run[2]:scan=7551	41.431	3	4290.1208	4290.1208	R	Q	86	126
PSM	ILQMEEEYIQQLCEDIIQLKPDVVITEK	95	sp|P49368-2|TCPG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	56	13-UNIMOD:4	ms_run[2]:scan=6206	33.914	3	3416.7459	3416.7459	R	G	229	257
PSM	IQDLPPVDLSLVNKDENAIYFLGNSLGLQPK	96	sp|Q16719-2|KYNU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	56		ms_run[2]:scan=7464	40.947	3	3409.8133	3409.8133	K	M	51	82
PSM	IQHPSNVLHFFNAPLEVTEENFFEICDELGVK	97	sp|P14866-2|HNRPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	56	26-UNIMOD:4	ms_run[2]:scan=2994	16.236	4	3771.8243	3771.8243	R	R	363	395
PSM	TIVAINKDPEAPIFQVADYGIVADLFK	98	sp|P13804-2|ETFA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	56		ms_run[2]:scan=1707	9.2854	3	2946.5743	2946.5743	K	V	246	273
PSM	VADNLAIQLAAVTEDKYEILQSVDDAAIVIK	99	sp|Q12906-5|ILF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	56		ms_run[2]:scan=2315	12.546	3	3327.7814	3327.7814	K	N	128	159
PSM	VADNLAIQLAAVTEDKYEILQSVDDAAIVIK	100	sp|Q12906-5|ILF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	56		ms_run[2]:scan=2422	13.104	3	3327.7814	3327.7814	K	N	128	159
PSM	GFQQILAGEYDHLPEQAFYMVGPIEEAVAK	101	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	56		ms_run[1]:scan=2477	13.401133	3	3349.633691	3349.632916	K	A	490	520
PSM	ASVSELACIYSALILHDDEVTVTEDK	102	sp|P05386|RLA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	56	1-UNIMOD:1,8-UNIMOD:4	ms_run[1]:scan=7576	41.565975	2	2920.4062	2919.4052	M	I	2	28
PSM	APALGGSFAGLEPMGLLWALEPEKPLVR	103	sp|P49753|ACOT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	55		ms_run[2]:scan=2862	15.504	3	2918.5728	2918.5728	R	L	127	155
PSM	DNVPFHSLVFPCSALGAEDNYTLVSHLIATEYLNYEDGK	104	sp|P56192|SYMC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	55	12-UNIMOD:4	ms_run[2]:scan=4521	24.595	4	4398.0791	4398.0791	K	F	555	594
PSM	DPTSLLGVLQAEADSTSEGLEDAVHSR	105	sp|Q27J81-2|INF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	55		ms_run[2]:scan=2138	11.581	3	2796.3414	2796.3414	K	G	1133	1160
PSM	EALKDEYDDLSDLTAAQQETLSDWESQFTFK	106	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	55		ms_run[2]:scan=1361	7.3898	3	3622.6475	3622.6475	K	Y	133	164
PSM	EIDVDAVASDGVVAAIAISEHVENAGVHSGDATLVTPPQDITAK	107	sp|P27708|PYR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	55		ms_run[2]:scan=4510	24.534	4	4381.1925	4381.1925	K	T	1134	1178
PSM	GSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHNK	108	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	55		ms_run[2]:scan=7469	40.977	4	4290.1208	4290.1208	R	Q	86	126
PSM	GTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVK	109	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	55		ms_run[2]:scan=4151	22.556	4	4147.9844	4147.9844	K	S	287	323
PSM	RCPHPLTFDVNNPLHLDYVMAAANLFAQTYGLTGSQDR	110	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	55	2-UNIMOD:4	ms_run[2]:scan=4339	23.609	4	4302.0739	4302.0739	K	A	707	745
PSM	SLTGVVNAQALTSAFSPHTKPWIGLAEALGTLMR	111	sp|O43175|SERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	55		ms_run[2]:scan=6855	37.53	3	3536.8814	3536.8814	K	A	311	345
PSM	TLLEGSGLESIISIIHSSLAEPR	112	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	55		ms_run[2]:scan=7167	39.289	2	2421.3115	2421.3115	R	V	2483	2506
PSM	TTYLEDLPPPPEYELAPSKLEEEVDDVFLIR	113	sp|Q12849|GRSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	55		ms_run[2]:scan=3973	21.606	3	3616.8076	3616.8076	K	A	123	154
PSM	QDAKDPTSLLGVLQAEADSTSEGLEDAVHSR	114	sp|Q27J81|INF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	55	1-UNIMOD:28	ms_run[1]:scan=429	2.3509836	3	3221.5312	3221.5319	R	G	1129	1160
PSM	VVGFHTAWEPSRPFPVDMAGFAVALPLLLDKPNAQFDSTAPR	115	sp|O94766|B3GA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	55		ms_run[1]:scan=313	1.7278958	5	4566.3562	4564.3362	R	G	236	278
PSM	VGAGAPVYMAAVLEYLTAEILELAGNAAR	116	sp|Q6FI13|H2A2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	55		ms_run[1]:scan=7598	41.693903	2	2933.531590	2932.536830	R	D	44	73
PSM	AQAALQAVNSVQSGNLALAASAAAVDAGMAMAGQSPVLR	117	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	54		ms_run[2]:scan=3936	21.395	3	3679.8774	3679.8774	R	I	147	186
PSM	EALKDEYDDLSDLTAAQQETLSDWESQFTFK	118	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	54		ms_run[2]:scan=1465	7.9354	3	3622.6475	3622.6475	K	Y	133	164
PSM	EIYPYVIQELRPTLNELGISTPEELGLDKV	119	sp|P20674|COX5A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	54		ms_run[2]:scan=4128	22.427	3	3427.8127	3427.8127	K	-	121	151
PSM	ERFDPTQFQDCIIQGLTETGTDLEAVAK	120	sp|Q7L1Q6-2|BZW1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	54	11-UNIMOD:4	ms_run[2]:scan=4754	25.845	3	3181.5238	3181.5238	K	F	25	53
PSM	GGLGGGYGGASGMGGITAVTVNQSLLSPLVLEVDPNIQAVR	121	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	54		ms_run[2]:scan=586	3.1567	3	3924.0415	3924.0415	R	T	48	89
PSM	HAQGGTWYGVDINNEDIADNFEAFVWEPAMVR	122	sp|Q99832-2|TCPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	54		ms_run[2]:scan=147	0.80021	3	3650.6525	3650.6525	R	I	264	296
PSM	HAQGGTWYGVDINNEDIADNFEAFVWEPAMVR	123	sp|Q99832-2|TCPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	54		ms_run[2]:scan=249	1.3705	3	3650.6525	3650.6525	R	I	264	296
PSM	IQDLPPVDLSLVNKDENAIYFLGNSLGLQPK	124	sp|Q16719-2|KYNU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	54		ms_run[2]:scan=400	2.1998	3	3409.8133	3409.8133	K	M	51	82
PSM	IQHPSNVLHFFNAPLEVTEENFFEICDELGVK	125	sp|P14866-2|HNRPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	54	26-UNIMOD:4	ms_run[2]:scan=2896	15.692	4	3771.8243	3771.8243	R	R	363	395
PSM	NAATEDLWESLENASGKPIAAVMNTWTK	126	sp|P55786-2|PSA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	54		ms_run[2]:scan=607	3.2715	3	3046.4706	3046.4706	K	Q	392	420
PSM	NILIATGSEVTPFPGITIDEDTIVSSTGALSLK	127	sp|P09622-2|DLDH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	54		ms_run[2]:scan=7511	41.22	3	3358.7759	3358.7759	K	K	79	112
PSM	QIQAAYSILSEVQQAVSQGSSDSQILDLSNR	128	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	54		ms_run[2]:scan=3633	19.73	3	3334.6641	3334.6641	R	F	705	736
PSM	QIQAAYSILSEVQQAVSQGSSDSQILDLSNR	129	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	54		ms_run[2]:scan=3557	19.318	4	3334.6641	3334.6641	R	F	705	736
PSM	THLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSR	130	sp|P27824-3|CALX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	54	32-UNIMOD:35	ms_run[2]:scan=1909	10.324	4	4452.2271	4452.2271	K	E	127	167
PSM	TIESILEPVAQQISHLVIMHEEGEVDGK	131	sp|P18206-2|VINC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	54		ms_run[2]:scan=4547	24.733	3	3100.5751	3100.5751	R	A	8	36
PSM	TITDVINIGIGGSDLGPLMVTEALKPYSSGGPR	132	sp|P06744|G6PI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	54		ms_run[2]:scan=577	3.1073	4	3327.7384	3327.7384	K	V	148	181
PSM	TLLEGSGLESIISIIHSSLAEPR	133	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	54		ms_run[2]:scan=7265	39.833	2	2421.3115	2421.3115	R	V	2483	2506
PSM	GILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVK	134	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	54		ms_run[1]:scan=6823	37.349582	4	4035.893340	4035.887504	K	L	272	310
PSM	GFQQILAGEYDHLPEQAFYMVGPIEEAVAK	135	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	54		ms_run[1]:scan=2576	13.947591	3	3349.633691	3349.632916	K	A	490	520
PSM	MEGAKPTLQLVYQAVQALYHDPDPSGK	136	sp|Q9Y5L0|TNPO3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	54	1-UNIMOD:1	ms_run[1]:scan=5920	32.331819	3	2997.4874	2997.4901	-	E	1	28
PSM	DGAGFLINLIDSPGHVDFSSEVTAALR	137	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	53		ms_run[2]:scan=4417	24.043	3	2800.4032	2800.4032	K	V	94	121
PSM	DGAGFLINLIDSPGHVDFSSEVTAALR	138	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	53		ms_run[2]:scan=4525	24.617	3	2800.4032	2800.4032	K	V	94	121
PSM	DGAGFLINLIDSPGHVDFSSEVTAALR	139	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	53		ms_run[2]:scan=4721	25.673	3	2800.4032	2800.4032	K	V	94	121
PSM	DMAIATGGAVFGEEGLTLNLEDVQPHDLGK	140	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	53		ms_run[2]:scan=7284	39.94	3	3096.5074	3096.5074	K	V	315	345
PSM	FGGQLLSFDIGDQPVFEIPLSNVSQCTTGK	141	sp|Q08945|SSRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	53	26-UNIMOD:4	ms_run[2]:scan=178	0.97572	3	3253.5965	3253.5965	K	N	114	144
PSM	FYTEDGNWDLVGNNTPIFFIRDPILFPSFIHSQK	142	sp|P04040|CATA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	53		ms_run[2]:scan=2892	15.674	4	4026.9945	4026.9945	K	R	136	170
PSM	GIHSAIDASQTPDVVFASILAAFSK	143	sp|P54819-6|KAD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	53		ms_run[2]:scan=7473	41	2	2544.3224	2544.3224	R	A	157	182
PSM	IPNFWVTTFVNHPQVSALLGEEDEEALHYLTR	144	sp|Q01105-3|SET_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	53		ms_run[2]:scan=992	5.3438	3	3724.8526	3724.8526	K	V	66	98
PSM	KASFEEASNQLINHIEQFLDTNETPYFMK	145	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	53		ms_run[2]:scan=6616	36.181	4	3443.6344	3443.6344	K	S	606	635
PSM	LQDVFNTVGADIIQLPQIVVVGTQSSGK	146	sp|O00429-4|DNM1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	53		ms_run[2]:scan=2719	14.735	3	2925.5811	2925.5811	K	S	11	39
PSM	LTLDLTVLLGVLQGQQQSLQQGAHSTGSSR	147	sp|Q9BQG0|MBB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	53		ms_run[2]:scan=2539	13.752	3	3134.6684	3134.6684	K	L	1101	1131
PSM	LYNLDVFQYELYNPMALYGSVPVLLAHNPHR	148	sp|Q14697|GANAB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	53		ms_run[2]:scan=1862	10.091	4	3645.8442	3645.8442	R	D	279	310
PSM	QLGNLGVLGITAPVQYGGSGLGYLEHVLVMEEISR	149	sp|P26440-2|IVD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	53		ms_run[2]:scan=5295	28.846	3	3668.9236	3668.9236	K	A	56	91
PSM	SEDPLFVLEHSLPIDTQYYLEQQLAK	150	sp|P28340|DPOD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	53		ms_run[2]:scan=2676	14.491	3	3075.5441	3075.5441	K	P	939	965
PSM	SSYLNIVGLVGSIDNDFCGTDMTIGTDSALHR	151	sp|P08237-2|PFKAM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	53	18-UNIMOD:4	ms_run[2]:scan=2051	11.099	3	3427.6024	3427.6024	K	I	153	185
PSM	TITDVINIGIGGSDLGPLMVTEALKPYSSGGPR	152	sp|P06744|G6PI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	53		ms_run[2]:scan=794	4.3063	3	3327.7384	3327.7384	K	V	148	181
PSM	NSAFESLYQDKFPFFNPIQTQVFNTVYNSDDNVFVGAPTGSGK	153	sp|O75643|U520_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	53		ms_run[1]:scan=3689	20.014546	4	4789.260891	4789.261267	R	T	1314	1357
PSM	AQAALQAVNSVQSGNLALAASAAAVDAGMAMAGQSPVLR	154	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	53	29-UNIMOD:35	ms_run[1]:scan=3987	21.682295	3	3696.901507	3695.872328	R	I	147	186
PSM	APALGGSFAGLEPMGLLWALEPEKPLVR	155	sp|P49753|ACOT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	52		ms_run[2]:scan=2765	14.988	3	2918.5728	2918.5728	R	L	127	155
PSM	DGAGFLINLIDSPGHVDFSSEVTAALR	156	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	52		ms_run[2]:scan=5117	27.871	3	2800.4032	2800.4032	K	V	94	121
PSM	DMAIATGGAVFGEEGLTLNLEDVQPHDLGK	157	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	52		ms_run[2]:scan=7383	40.496	3	3096.5074	3096.5074	K	V	315	345
PSM	DMAIATGGAVFGEEGLTLNLEDVQPHDLGK	158	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	52		ms_run[2]:scan=7483	41.059	3	3096.5074	3096.5074	K	V	315	345
PSM	EHGGPEGMDPDGVIESNWNEIVDNFDDMNLK	159	sp|Q14240|IF4A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	52		ms_run[2]:scan=2907	15.752	3	3472.4824	3472.4824	R	E	11	42
PSM	EIDVDAVASDGVVAAIAISEHVENAGVHSGDATLVTPPQDITAK	160	sp|P27708|PYR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	52		ms_run[2]:scan=4619	25.119	4	4381.1925	4381.1925	K	T	1134	1178
PSM	EIIDTNGAGDAFVGGFLSQLVSDKPLTECIR	161	sp|P55263-3|ADK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	52	29-UNIMOD:4	ms_run[2]:scan=1424	7.7131	3	3321.6551	3321.6551	K	A	251	282
PSM	EQPLDEELKDAFQNAYLELGGLGER	162	sp|P05023-3|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	52		ms_run[2]:scan=5491	29.94	3	2833.377	2833.3770	K	V	496	521
PSM	GIGTVTFEQSIEAVQAISMFNGQLLFDRPMHVK	163	sp|P52272|HNRPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	52		ms_run[2]:scan=6207	33.918	4	3662.8589	3662.8589	R	M	245	278
PSM	GQDMETEAHQNKLEEMINELAVAMTAVK	164	sp|Q15363|TMED2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	52		ms_run[2]:scan=3281	17.782	4	3129.4781	3129.4781	K	H	118	146
PSM	HLVMGDIPAAVNAFQEAASLLGK	165	sp|P49321-2|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	52		ms_run[2]:scan=1967	10.636	2	2351.2308	2351.2308	K	K	53	76
PSM	LQDVFNTVGADIIQLPQIVVVGTQSSGK	166	sp|O00429-4|DNM1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	52		ms_run[2]:scan=2826	15.317	3	2925.5811	2925.5811	K	S	11	39
PSM	LYNLDVFQYELYNPMALYGSVPVLLAHNPHR	167	sp|Q14697|GANAB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	52		ms_run[2]:scan=1778	9.6674	3	3645.8442	3645.8442	R	D	279	310
PSM	RTGPAATTLPDGAAAESLVESSEVAVIGFFK	168	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	52		ms_run[2]:scan=4965	27.006	3	3090.5873	3090.5873	K	D	132	163
PSM	SAGDLGIAVCNVPAASVEETADSTLCHILNLYR	169	sp|Q13363-2|CTBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	52	10-UNIMOD:4,26-UNIMOD:4	ms_run[2]:scan=7235	39.672	3	3515.7025	3515.7025	K	R	98	131
PSM	SGTIFDNFLITNDEAYAEEFGNETWGVTK	170	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	52		ms_run[2]:scan=3390	18.384	3	3267.4884	3267.4884	K	A	323	352
PSM	TITDVINIGIGGSDLGPLMVTEALKPYSSGGPR	171	sp|P06744|G6PI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	52		ms_run[2]:scan=470	2.5519	4	3327.7384	3327.7384	K	V	148	181
PSM	VLCELADLQDKEVGDGTTSVVIIAAELLK	172	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	52	3-UNIMOD:4	ms_run[2]:scan=3962	21.544	3	3098.6421	3098.6421	K	N	74	103
PSM	YALQMEQLNGILLHLESELAQTR	173	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	52		ms_run[2]:scan=7166	39.283	3	2669.3847	2669.3847	R	A	331	354
PSM	YALQMEQLNGILLHLESELAQTR	174	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	52		ms_run[2]:scan=7262	39.82	3	2669.3847	2669.3847	R	A	331	354
PSM	YALQMEQLNGILLHLESELAQTR	175	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	52		ms_run[2]:scan=7191	39.424	2	2669.3847	2669.3847	R	A	331	354
PSM	TNIAFLQNVLNNQQFLAGTVDTQFIDENPELFQLRPAQNR	176	sp|P11498|PYC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	52		ms_run[1]:scan=4514	24.553686	4	4616.346224	4616.341189	K	A	457	497
PSM	ASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGK	177	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	52	45-UNIMOD:4,48-UNIMOD:4	ms_run[1]:scan=4853	26.369272	6	5806.8886	5806.8792	R	I	13	68
PSM	AFADAMEVIPSTLAENAGLNPISTVTELR	178	sp|P50991|TCPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	52		ms_run[1]:scan=1532	8.293049	3	3029.542856	3029.537953	R	N	453	482
PSM	HLVMGDIPAAVNAFQEAASLLGK	179	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	52		ms_run[1]:scan=2083	11.28368	2	2352.239656	2351.230752	K	K	53	76
PSM	ASFANEDGQVSPGSLLLAGAIAGMPAASLVTPADVIK	180	sp|Q9UJS0|CMC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	52	24-UNIMOD:35	ms_run[1]:scan=4153	22.567648	3	3554.866822	3553.833801	K	T	509	546
PSM	VGAGAPVYMAAVLEYLTAEILELAGNAAR	181	sp|Q6FI13|H2A2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	52		ms_run[1]:scan=7595	41.676986	3	2933.543514	2932.536830	R	D	44	73
PSM	AEISELPSIVQDLANGNITWADVEAR	182	sp|P41250|GARS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51		ms_run[2]:scan=4461	24.277	3	2810.4087	2810.4087	R	Y	697	723
PSM	AFADALEVIPMALSENSGMNPIQTMTEVR	183	sp|P48643-2|TCPE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51		ms_run[2]:scan=6866	37.592	3	3134.5086	3134.5086	R	A	357	386
PSM	ALEQQVEEMKTQLEELEDELQATEDAK	184	sp|P35579-2|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51		ms_run[2]:scan=2095	11.35	3	3146.4813	3146.4813	R	L	951	978
PSM	ASLDRPFTNLESAFYSIVGLSSLGAQVPDAK	185	sp|P04844|RPN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51		ms_run[2]:scan=7563	41.497	3	3252.6667	3252.6667	K	K	39	70
PSM	DGAGFLINLIDSPGHVDFSSEVTAALR	186	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51		ms_run[2]:scan=4820	26.195	3	2800.4032	2800.4032	K	V	94	121
PSM	DGAGFLINLIDSPGHVDFSSEVTAALR	187	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51		ms_run[2]:scan=4921	26.754	3	2800.4032	2800.4032	K	V	94	121
PSM	DGAGFLINLIDSPGHVDFSSEVTAALR	188	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51		ms_run[2]:scan=5018	27.307	3	2800.4032	2800.4032	K	V	94	121
PSM	DGAGFLINLIDSPGHVDFSSEVTAALR	189	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51		ms_run[2]:scan=5316	28.966	3	2800.4032	2800.4032	K	V	94	121
PSM	DLGVLDVIFHPTQPWVFSSGADGTVR	190	sp|Q14137-2|BOP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51		ms_run[2]:scan=6286	34.348	3	2812.4184	2812.4184	R	L	606	632
PSM	DMAIATGGAVFGEEGLTLNLEDVQPHDLGK	191	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51		ms_run[2]:scan=7185	39.39	3	3096.5074	3096.5074	K	V	315	345
PSM	DVLKEEGVSFLINTFEGGGCGQPSGILAQPTLLYLR	192	sp|P78527-2|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51	20-UNIMOD:4	ms_run[2]:scan=6265	34.228	3	3877.9924	3877.9924	K	G	1210	1246
PSM	EHGGPEGMDPDGVIESNWNEIVDNFDDMNLK	193	sp|Q14240|IF4A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51		ms_run[2]:scan=2802	15.195	3	3472.4824	3472.4824	R	E	11	42
PSM	EKVADEDDVDNEEAALLHEEATMTIEELLTR	194	sp|O15355|PPM1G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51		ms_run[2]:scan=315	1.7391	4	3527.6461	3527.6461	K	Y	129	160
PSM	EQLPPMSEDFLLDALSEDFSGPQNASSLK	195	sp|P20810-3|ICAL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51		ms_run[2]:scan=3853	20.929	3	3164.486	3164.4860	K	F	383	412
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	196	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51	7-UNIMOD:35,13-UNIMOD:4,27-UNIMOD:4	ms_run[2]:scan=6197	33.863	4	3601.6891	3601.6891	R	R	85	117
PSM	IPVTDEEQTNVPYIYAIGDILEDKVELTPVAIQAGR	197	sp|Q16881-7|TRXR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51		ms_run[2]:scan=3030	16.433	3	3969.0623	3969.0623	K	L	278	314
PSM	IQDLPPVDLSLVNKDENAIYFLGNSLGLQPK	198	sp|Q16719-2|KYNU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51		ms_run[2]:scan=509	2.7425	3	3409.8133	3409.8133	K	M	51	82
PSM	IVAFADAAVEPIDFPIAPVYAASMVLK	199	sp|P24752|THIL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51		ms_run[2]:scan=6481	35.429	3	2817.5027	2817.5027	R	D	312	339
PSM	LGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLK	200	sp|O00487|PSDE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51		ms_run[2]:scan=5869	32.043	3	3322.7119	3322.7119	R	M	7	41
PSM	LLQQMEQFIQYLDEPTVNTQIFPHVVHGFLDTNPAIR	201	sp|Q96KG9-5|SCYL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51		ms_run[2]:scan=7411	40.656	4	4351.21	4351.2100	R	E	369	406
PSM	LMEPIYLVEIQCPEQVVGGIYGVLNR	202	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51	12-UNIMOD:4	ms_run[2]:scan=6415	35.057	3	2988.5453	2988.5453	R	K	740	766
PSM	LNFEAAWDEVGDEFEKEETFTLSTIK	203	sp|Q9Y678|COPG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51		ms_run[2]:scan=7523	41.285	3	3047.4288	3047.4288	K	T	770	796
PSM	LSTCEAEDIATYEQNLQQWHLDLVQLIQR	204	sp|Q92552|RT27_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51	4-UNIMOD:4	ms_run[2]:scan=3777	20.499	3	3513.7198	3513.7198	K	E	364	393
PSM	NPILWNVADVVIKFPEEEAPSTVLSQNLFTPK	205	sp|P04844|RPN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51		ms_run[2]:scan=5032	27.386	3	3594.8974	3594.8974	K	Q	492	524
PSM	QDQIQQVVNHGLVPFLVSVLSK	206	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51		ms_run[2]:scan=5492	29.944	3	2447.3536	2447.3536	R	A	367	389
PSM	QETFDAGLQAFQQEGIANITALKDQLLAAK	207	sp|Q13813-3|SPTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51		ms_run[2]:scan=6165	33.686	3	3231.6776	3231.6776	K	H	1998	2028
PSM	SPPYTAFLGNLPYDVTEESIKEFFR	208	sp|P23588-2|IF4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51		ms_run[2]:scan=7307	40.069	3	2919.4331	2919.4331	K	G	93	118
PSM	SPPYTAFLGNLPYDVTEESIKEFFR	209	sp|P23588-2|IF4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51		ms_run[2]:scan=7405	40.622	3	2919.4331	2919.4331	K	G	93	118
PSM	TVASPGVTVEEAVEQIDIGGVTLLR	210	sp|P31939-2|PUR9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51		ms_run[2]:scan=1027	5.5331	3	2552.3697	2552.3697	K	A	108	133
PSM	VAEQVGIDRGDIPDLSQAPSSLLDALEQHLASLEGK	211	sp|Q13492-4|PICAL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51		ms_run[2]:scan=6060	33.096	4	3770.9327	3770.9327	K	K	202	238
PSM	VEEEDDAEHVLALTMLCLTEGAKDECNVVEVVAR	212	sp|O75607|NPM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51	17-UNIMOD:4,26-UNIMOD:4	ms_run[2]:scan=3802	20.641	4	3842.8013	3842.8013	K	N	54	88
PSM	YNVYPTYDFACPIVDSIEGVTHALR	213	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51	11-UNIMOD:4	ms_run[2]:scan=1949	10.537	3	2899.3851	2899.3851	K	T	371	396
PSM	GFQQILAGEYDHLPEQAFYMVGPIEEAVAK	214	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	51		ms_run[1]:scan=2675	14.485404	3	3349.633691	3349.632916	K	A	490	520
PSM	GFQQILAGEYDHLPEQAFYMVGPIEEAVAK	215	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	51		ms_run[1]:scan=2378	12.884664	3	3349.633691	3349.632916	K	A	490	520
PSM	EKVETELQGVCDTVLGLLDSHLIK	216	sp|P31947|1433S_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	51	11-UNIMOD:4	ms_run[1]:scan=4349	23.66479	3	2695.412988	2695.410233	R	E	86	110
PSM	VGSAADIPINISETDLSLLTATVVPPSGR	217	sp|P21333|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	51		ms_run[1]:scan=233	1.280931	3	2893.553244	2892.544418	K	E	1965	1994
PSM	AFADAMEVIPSTLAENAGLNPISTVTELR	218	sp|P50991|TCPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	51		ms_run[1]:scan=1630	8.8520117	3	3029.542856	3029.537953	R	N	453	482
PSM	HRDDALPFAHVAIAVEGPGWASPDNVALQVANAIIGHYDCTYGGGVHLSSPLASGAVANK	219	sp|P31930|QCR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	51	40-UNIMOD:4	ms_run[1]:scan=5564	30.347562	6	6133.0374	6133.0288	R	L	277	337
PSM	AEISELPSIVQDLANGNITWADVEAR	220	sp|P41250|GARS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50		ms_run[2]:scan=4527	24.627	2	2810.4087	2810.4087	R	Y	697	723
PSM	AKGGEEPLPEGLFWLLVTGHIPTEEQVSWLSK	221	sp|O75390|CISY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50		ms_run[2]:scan=7026	38.504	4	3546.8399	3546.8399	K	E	108	140
PSM	AKGGEEPLPEGLFWLLVTGHIPTEEQVSWLSK	222	sp|O75390|CISY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50		ms_run[2]:scan=7225	39.617	4	3546.8399	3546.8399	K	E	108	140
PSM	AVVHTHLLNPEWLVNYFGSLSVEDSLECLR	223	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50	28-UNIMOD:4	ms_run[2]:scan=2093	11.339	4	3496.7449	3496.7449	R	A	639	669
PSM	DAQGAATYAVVSSPAGILSLTLLER	224	sp|Q96IR7|HPDL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50		ms_run[2]:scan=2272	12.315	3	2502.333	2502.3330	R	A	111	136
PSM	DELILEGNDIELVSNSAALIQQATTVK	225	sp|P32969|RL9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50		ms_run[2]:scan=2225	12.066	3	2883.5077	2883.5077	K	N	142	169
PSM	DGAGFLINLIDSPGHVDFSSEVTAALR	226	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50		ms_run[2]:scan=4259	23.158	3	2800.4032	2800.4032	K	V	94	121
PSM	DGAGFLINLIDSPGHVDFSSEVTAALR	227	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50		ms_run[2]:scan=4622	25.133	3	2800.4032	2800.4032	K	V	94	121
PSM	DGAGFLINLIDSPGHVDFSSEVTAALR	228	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50		ms_run[2]:scan=5722	31.206	3	2800.4032	2800.4032	K	V	94	121
PSM	DLGVLDVIFHPTQPWVFSSGADGTVR	229	sp|Q14137-2|BOP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50		ms_run[2]:scan=6382	34.869	3	2812.4184	2812.4184	R	L	606	632
PSM	ETEEEKEIADFDIFDDPESPFSTFNFQYPNQAFK	230	sp|P47712|PA24A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50		ms_run[2]:scan=3122	16.945	3	4073.8007	4073.8007	R	R	658	692
PSM	HGVITGQDGVEDYFTLYADVPLNDMFGYSTELR	231	sp|Q96RP9|EFGM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50		ms_run[2]:scan=2054	11.116	3	3721.7246	3721.7246	R	S	672	705
PSM	IQPGSQQADFLDALIVSMDVIQHETIGKK	232	sp|P13010|XRCC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50		ms_run[2]:scan=7099	38.91	4	3180.6489	3180.6489	K	F	98	127
PSM	LAYVAAGDLAPINAFIGGLAAQEVMK	233	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50		ms_run[2]:scan=4160	22.61	3	2602.3829	2602.3829	K	A	346	372
PSM	LMEPIYLVEIQCPEQVVGGIYGVLNR	234	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50	12-UNIMOD:4	ms_run[2]:scan=6514	35.616	3	2988.5453	2988.5453	R	K	740	766
PSM	LSALGNVTTCNDYVALVHPDLDRETEEILADVLK	235	sp|P56537|IF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50	10-UNIMOD:4	ms_run[2]:scan=1234	6.691	4	3782.9037	3782.9037	R	V	101	135
PSM	NLFAFFDMAYQGFASGDGDKDAWAVR	236	sp|P00505-2|AATM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50		ms_run[2]:scan=7308	40.075	3	2898.3072	2898.3072	R	H	194	220
PSM	QEGCQDIATQLISNMDIDVILGGGR	237	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50	4-UNIMOD:4	ms_run[2]:scan=3908	21.241	2	2702.3004	2702.3004	R	K	199	224
PSM	SDPMVQCIIEESGEHIIAGAGELHLEICLK	238	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50	7-UNIMOD:4,28-UNIMOD:4	ms_run[2]:scan=7463	40.941	4	3347.62	3347.6200	K	D	530	560
PSM	SKDDQVTVIGAGVTLHEALAAAELLK	239	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50		ms_run[2]:scan=7168	39.294	3	2648.4385	2648.4385	K	K	498	524
PSM	VIQGLYSGVTTVELDTLAAETAATLTTK	240	sp|P23921|RIR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50		ms_run[2]:scan=2848	15.426	3	2865.5223	2865.5223	K	H	43	71
PSM	VLCELADLQDKEVGDGTTSVVIIAAELLK	241	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50	3-UNIMOD:4	ms_run[2]:scan=3866	20.999	3	3098.6421	3098.6421	K	N	74	103
PSM	VPIPWVSGTSASTPVFGGILSLINEHR	242	sp|O14773-2|TPP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50		ms_run[2]:scan=2708	14.671	3	2833.5127	2833.5127	R	I	223	250
PSM	VVDNPIYLSDMGAALTGAESHELQDVLEETNIPK	243	sp|P36776-3|LONM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50		ms_run[2]:scan=773	4.1894	4	3667.7927	3667.7927	R	R	128	162
PSM	LCYVALDFEQEMATAASSSSLEK	244	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	50	2-UNIMOD:4	ms_run[1]:scan=7428	40.751569	2	2549.163358	2549.166557	K	S	216	239
PSM	CPEALFQPSFLGMESCGIHETTFNSIMK	245	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	50	1-UNIMOD:4,16-UNIMOD:4	ms_run[1]:scan=7114	38.994849	3	3230.447125	3230.454500	R	C	257	285
PSM	SKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICR	246	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	50	36-UNIMOD:4,49-UNIMOD:4	ms_run[1]:scan=7132	39.094745	5	5731.7102	5731.7156	K	R	165	215
PSM	EKVETELQGVCDTVLGLLDSHLIK	247	sp|P31947|1433S_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	50	11-UNIMOD:4	ms_run[1]:scan=4446	24.201611	3	2695.412988	2695.410233	R	E	86	110
PSM	VGSAADIPINISETDLSLLTATVVPPSGR	248	sp|P21333|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	50		ms_run[1]:scan=259	1.4231269	2	2893.543308	2892.544418	K	E	1965	1994
PSM	GTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVK	249	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	50		ms_run[1]:scan=4127	22.424679	3	4147.984029	4147.984364	K	S	287	323
PSM	VGSAADIPINISETDLSLLTATVVPPSGR	250	sp|P21333|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	50		ms_run[1]:scan=134	0.72793483	3	2893.554159	2892.544418	K	E	1965	1994
PSM	AFADAMEVIPSTLAENAGLNPISTVTELR	251	sp|P50991|TCPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	50		ms_run[1]:scan=1432	7.7555925	3	3029.542856	3029.537953	R	N	453	482
PSM	LLVSNLDFGVSDADIQELFAEFGTLKK	252	sp|Q86V81|THOC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	50		ms_run[1]:scan=7565	41.507815	3	2967.552350	2968.543356	K	A	108	135
PSM	AFADALEVIPMALSENSGMNPIQTMTEVR	253	sp|P48643-2|TCPE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49		ms_run[2]:scan=6965	38.16	3	3134.5086	3134.5086	R	A	357	386
PSM	AKGGEEPLPEGLFWLLVTGHIPTEEQVSWLSK	254	sp|O75390|CISY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49		ms_run[2]:scan=7124	39.051	4	3546.8399	3546.8399	K	E	108	140
PSM	ALEAFDLDPAQWGVNVQPYSGSPANLAVYTALLQPHDR	255	sp|P34897-3|GLYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49		ms_run[2]:scan=2469	13.36	4	4123.0439	4123.0439	R	I	102	140
PSM	ALINADELASDVAGAEALLDR	256	sp|Q13813-3|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49		ms_run[2]:scan=1767	9.6088	2	2126.0855	2126.0855	K	H	382	403
PSM	ATGATQQDANASSLLDIYSFWLNR	257	sp|Q14978-3|NOLC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49		ms_run[2]:scan=2478	13.407	2	2641.2772	2641.2772	K	S	37	61
PSM	DFVSEQLTSLLVNGVQLPALGENKK	258	sp|P54136-2|SYRC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49		ms_run[2]:scan=2961	16.053	3	2698.4541	2698.4541	K	V	97	122
PSM	DGAGFLINLIDSPGHVDFSSEVTAALR	259	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49		ms_run[2]:scan=5220	28.43	3	2800.4032	2800.4032	K	V	94	121
PSM	DGAGFLINLIDSPGHVDFSSEVTAALR	260	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49		ms_run[2]:scan=5415	29.516	3	2800.4032	2800.4032	K	V	94	121
PSM	DLSAAGIGLLAAATQSLSMPASLGR	261	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49	19-UNIMOD:35	ms_run[2]:scan=4750	25.825	3	2386.2526	2386.2526	R	M	20	45
PSM	ELPTEPPYTAYVGNLPFNTVQGDIDAIFK	262	sp|Q15056-2|IF4H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49		ms_run[2]:scan=7482	41.054	3	3208.5968	3208.5968	K	D	35	64
PSM	EVAAFAQFGSDLDAATQQLLSR	263	sp|P25705-2|ATPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49		ms_run[2]:scan=1872	10.141	2	2337.1601	2337.1601	R	G	392	414
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	264	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49	7-UNIMOD:35,13-UNIMOD:4,27-UNIMOD:4	ms_run[2]:scan=6295	34.398	4	3601.6891	3601.6891	R	R	85	117
PSM	HLVMGDIPAAVNAFQEAASLLGK	265	sp|P49321-2|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49		ms_run[2]:scan=1994	10.786	3	2351.2308	2351.2308	K	K	53	76
PSM	HLVMGDIPAAVNAFQEAASLLGK	266	sp|P49321-2|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49		ms_run[2]:scan=2092	11.333	3	2351.2308	2351.2308	K	K	53	76
PSM	IQHPSNVLHFFNAPLEVTEENFFEICDELGVK	267	sp|P14866-2|HNRPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49	26-UNIMOD:4	ms_run[2]:scan=2951	15.997	3	3771.8243	3771.8243	R	R	363	395
PSM	KASFEEASNQLINHIEQFLDTNETPYFMK	268	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49	28-UNIMOD:35	ms_run[2]:scan=3395	18.413	4	3459.6293	3459.6293	K	S	606	635
PSM	LHIQNPSFSQINQLVSTIMSASTTTLR	269	sp|Q9NRH3|TBG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49		ms_run[2]:scan=6675	36.503	3	2986.5546	2986.5546	R	Y	218	245
PSM	LHIQNPSFSQINQLVSTIMSASTTTLR	270	sp|Q9NRH3|TBG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49		ms_run[2]:scan=6767	37.027	3	2986.5546	2986.5546	R	Y	218	245
PSM	LMEPIYLVEIQCPEQVVGGIYGVLNR	271	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49	2-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=2996	16.248	3	3004.5402	3004.5402	R	K	740	766
PSM	LMEPIYLVEIQCPEQVVGGIYGVLNR	272	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49	12-UNIMOD:4	ms_run[2]:scan=6614	36.173	3	2988.5453	2988.5453	R	K	740	766
PSM	LTAQVASLTSELTTLNATIQQQDQELAGLK	273	sp|Q14980-4|NUMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49		ms_run[2]:scan=1146	6.204	3	3184.6827	3184.6827	R	Q	496	526
PSM	QDQIQQVVNHGLVPFLVSVLSK	274	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49		ms_run[2]:scan=5591	30.491	3	2447.3536	2447.3536	R	A	367	389
PSM	SAAHPGLVEPADGAMPSFLLEQGSMILALSDTEQR	275	sp|Q96ER9-2|MITOK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49		ms_run[2]:scan=2105	11.403	3	3637.7756	3637.7756	K	L	234	269
PSM	SLQDIIAILGMDELSEEDKLTVSR	276	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49		ms_run[2]:scan=5172	28.183	3	2674.3735	2674.3735	K	A	433	457
PSM	TIESILEPVAQQISHLVIMHEEGEVDGK	277	sp|P18206-2|VINC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49		ms_run[2]:scan=4646	25.263	3	3100.5751	3100.5751	R	A	8	36
PSM	VADEDDVDNEEAALLHEEATMTIEELLTR	278	sp|O15355|PPM1G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49		ms_run[2]:scan=4561	24.806	3	3270.5086	3270.5086	K	Y	131	160
PSM	VFDPSCGLPYYWNADTDLVSWLSPHDPNSVVTK	279	sp|O60828-7|PQBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49	6-UNIMOD:4	ms_run[2]:scan=1765	9.5975	3	3778.7614	3778.7614	K	S	55	88
PSM	VLTDSGSLDSTIPGIENTITVTTEQLTTASFPVGSK	280	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49		ms_run[2]:scan=6542	35.776	3	3678.8727	3678.8727	K	K	210	246
PSM	VPAFEGDDGFCVFESNAIAYYVSNEELR	281	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49	11-UNIMOD:4	ms_run[2]:scan=1857	10.07	3	3197.4288	3197.4288	K	G	58	86
PSM	VQVLTAGSLMGLGDIISQQLVER	282	sp|P39210|MPV17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49		ms_run[2]:scan=3650	19.824	2	2426.3203	2426.3203	K	R	18	41
PSM	VSGYLNLAADLAHNFTDGLAIGASFR	283	sp|Q92504|S39A7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49		ms_run[2]:scan=6768	37.032	3	2692.3609	2692.3609	R	G	317	343
PSM	VYYNAGPKDEDQDYIVDHSIAIYLLNPDGLFTDYYGR	284	sp|O43819|SCO2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49		ms_run[2]:scan=2295	12.444	4	4312.0277	4312.0277	R	S	207	244
PSM	YDPSIGIYGLDFYVVLGRPGFSIADK	285	sp|P62913-2|RL11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49		ms_run[2]:scan=717	3.8775	3	2861.464	2861.4640	K	K	118	144
PSM	LCYVALDFEQEMATAASSSSLEK	286	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	49	2-UNIMOD:4	ms_run[1]:scan=7330	40.200808	2	2549.163358	2549.166557	K	S	216	239
PSM	LCYVALDFEQEMATAASSSSLEK	287	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	49	2-UNIMOD:4	ms_run[1]:scan=7230	39.643972	2	2549.163358	2549.166557	K	S	216	239
PSM	TELMQASLDQSVTHLMGLFEPGDTK	288	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	49		ms_run[1]:scan=3	0.011197216	3	2748.322958	2747.314618	R	Y	270	295
PSM	GILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVK	289	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	49		ms_run[1]:scan=7502	41.168815	4	4035.893340	4035.887504	K	L	272	310
PSM	GTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVK	290	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	49		ms_run[1]:scan=4030	21.912722	3	4147.984029	4147.984364	K	S	287	323
PSM	QVIQQNPALLPALLQQLGQENPQLLQQISR	291	sp|P54725|RD23A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	49		ms_run[1]:scan=1874	10.148737	3	3378.883733	3377.878323	R	H	246	276
PSM	QLTEMLPSILNQLGADSLTSLR	292	sp|P20290|BTF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	49		ms_run[1]:scan=3743	20.31888	2	2399.268175	2399.273011	K	R	142	164
PSM	ASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGK	293	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	49	45-UNIMOD:4,48-UNIMOD:4	ms_run[1]:scan=4545	24.724067	5	5806.8802	5806.8792	R	I	13	68
PSM	AAETTVVEVEEIVDIGAFAPEDIHIPQIYVHR	294	sp|P55809|SCOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48		ms_run[2]:scan=1502	8.1287	4	3559.8199	3559.8199	K	L	237	269
PSM	AAYSFYNVHTQTPLLDLMSDALVLAK	295	sp|P30419-2|NMT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48		ms_run[2]:scan=6272	34.267	3	2880.4732	2880.4732	K	M	338	364
PSM	AHITLGCAADVEAVQTGLDLLEILR	296	sp|P09543-2|CN37_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48	7-UNIMOD:4	ms_run[2]:scan=7127	39.068	3	2677.4109	2677.4109	R	Q	309	334
PSM	AHQNTLEVYPPFLFFLAVGGVYHPR	297	sp|O14880|MGST3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48		ms_run[2]:scan=3228	17.502	3	2871.4861	2871.4861	R	I	60	85
PSM	ATGATQQDANASSLLDIYSFWLK	298	sp|Q14978|NOLC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48		ms_run[2]:scan=2488	13.461	2	2499.2282	2499.2282	K	S	37	60
PSM	DAQGAATYAVVSSPAGILSLTLLER	299	sp|Q96IR7|HPDL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48		ms_run[2]:scan=2159	11.693	3	2502.333	2502.3330	R	A	111	136
PSM	DGAGFLINLIDSPGHVDFSSEVTAALR	300	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48		ms_run[2]:scan=5514	30.068	3	2800.4032	2800.4032	K	V	94	121
PSM	DGAGFLINLIDSPGHVDFSSEVTAALR	301	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48		ms_run[2]:scan=5617	30.634	3	2800.4032	2800.4032	K	V	94	121
PSM	DNTIEHLLPLFLAQLKDECPEVR	302	sp|P30153|2AAA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48	19-UNIMOD:4	ms_run[2]:scan=1003	5.4043	3	2749.4109	2749.4109	K	L	359	382
PSM	EALDHMVEYVAQNTPVTWLVGPFAPGITEK	303	sp|O60664-2|PLIN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48		ms_run[2]:scan=7251	39.759	3	3311.6537	3311.6537	R	A	216	246
PSM	EATTLANGVLASLNLPAAIEDVSGDTVPQSILTK	304	sp|Q8WUM4|PDC6I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48		ms_run[2]:scan=7233	39.661	3	3407.8035	3407.8035	R	S	387	421
PSM	ECGVGVIVTPEQIEEAVEAAINR	305	sp|P47897-2|SYQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48	2-UNIMOD:4	ms_run[2]:scan=7242	39.708	2	2482.2374	2482.2374	R	H	99	122
PSM	ELPTEPPYTAYVGNLPFNTVQGDIDAIFK	306	sp|Q15056-2|IF4H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48		ms_run[2]:scan=7384	40.502	3	3208.5968	3208.5968	K	D	35	64
PSM	ERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYK	307	sp|P04179-4|SODM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48	10-UNIMOD:4	ms_run[2]:scan=2781	15.075	5	4577.3166	4577.3166	K	N	109	149
PSM	EVAAFAQFGSDLDAATQQLLSR	308	sp|P25705-2|ATPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48		ms_run[2]:scan=1766	9.6032	2	2337.1601	2337.1601	R	G	392	414
PSM	GFLQEGDLISAEVQAVFSDGAVSLHTR	309	sp|Q13868-3|EXOS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48		ms_run[2]:scan=6577	35.977	3	2845.4246	2845.4246	R	S	103	130
PSM	HDQDRDGALSPVELQSLFSVFPAAPWGPELPR	310	sp|Q8IXI1|MIRO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48		ms_run[2]:scan=1864	10.099	4	3530.7583	3530.7583	K	T	316	348
PSM	IIYLNQLLQEDSLNVADLTSLR	311	sp|Q9UL46|PSME2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48		ms_run[2]:scan=1080	5.8316	2	2530.3643	2530.3643	K	A	40	62
PSM	ILQMEEEYIQQLCEDIIQLKPDVVITEK	312	sp|P49368-2|TCPG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48	13-UNIMOD:4	ms_run[2]:scan=6229	34.037	4	3416.7459	3416.7459	R	G	229	257
PSM	IPNFWVTTFVNHPQVSALLGEEDEEALHYLTR	313	sp|Q01105-3|SET_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48		ms_run[2]:scan=1149	6.2209	4	3724.8526	3724.8526	K	V	66	98
PSM	IQHPSNVLHFFNAPLEVTEENFFEICDELGVK	314	sp|P14866-2|HNRPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48	26-UNIMOD:4	ms_run[2]:scan=3094	16.789	4	3771.8243	3771.8243	R	R	363	395
PSM	LMEPIYLVEIQCPEQVVGGIYGVLNR	315	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48	2-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=3095	16.795	3	3004.5402	3004.5402	R	K	740	766
PSM	LPESENLQEFWDNLIGGVDMVTDDDRR	316	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48	20-UNIMOD:35	ms_run[2]:scan=7504	41.18	3	3178.4513	3178.4513	K	W	13	40
PSM	LQDVFNTVGADIIQLPQIVVVGTQSSGK	317	sp|O00429-4|DNM1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48		ms_run[2]:scan=2623	14.195	3	2925.5811	2925.5811	K	S	11	39
PSM	LSTCEAEDIATYEQNLQQWHLDLVQLIQR	318	sp|Q92552|RT27_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48	4-UNIMOD:4	ms_run[2]:scan=3722	20.202	4	3513.7198	3513.7198	K	E	364	393
PSM	LTEVKDELEPLLELVEQGIIPPGK	319	sp|Q9NQZ2|SAS10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48		ms_run[2]:scan=4677	25.435	3	2658.4731	2658.4731	K	G	237	261
PSM	NSVPCQDPITGENLASCLQAQAEDVAAAVEAAR	320	sp|Q8IZ83-2|A16A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48	5-UNIMOD:4,17-UNIMOD:4	ms_run[2]:scan=3316	17.979	3	3454.6093	3454.6093	R	M	55	88
PSM	QDQIQQVVNHGLVPFLVSVLSK	321	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48		ms_run[2]:scan=5392	29.384	3	2447.3536	2447.3536	R	A	367	389
PSM	RGIHSAIDASQTPDVVFASILAAFSK	322	sp|P54819-6|KAD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48		ms_run[2]:scan=1674	9.0985	4	2700.4235	2700.4235	K	A	156	182
PSM	SGTIFDNFLITNDEAYAEEFGNETWGVTK	323	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48		ms_run[2]:scan=3293	17.848	3	3267.4884	3267.4884	K	A	323	352
PSM	SLQDIIAILGMDELSEEDKLTVSR	324	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48		ms_run[2]:scan=5075	27.633	3	2674.3735	2674.3735	K	A	433	457
PSM	SPLMSEFQSQISSNPELAAIFESIQK	325	sp|Q86VP6-2|CAND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48		ms_run[2]:scan=5370	29.27	3	2880.4215	2880.4215	K	D	1024	1050
PSM	TFFILHDINSDGVLDEQELEALFTK	326	sp|Q02818|NUCB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48		ms_run[2]:scan=924	5.0127	3	2893.4386	2893.4386	K	E	247	272
PSM	THLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSR	327	sp|P27824-3|CALX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48	32-UNIMOD:35	ms_run[2]:scan=1930	10.433	3	4452.2271	4452.2271	K	E	127	167
PSM	TIESILEPVAQQISHLVIMHEEGEVDGK	328	sp|P18206-2|VINC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48		ms_run[2]:scan=4501	24.481	4	3100.5751	3100.5751	R	A	8	36
PSM	TVEELLETGLIQVATKEEELNAIR	329	sp|Q86UP2-2|KTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48		ms_run[2]:scan=3964	21.555	3	2697.4436	2697.4436	K	T	746	770
PSM	VADNLAIQLAAVTEDKYEILQSVDDAAIVIK	330	sp|Q12906-5|ILF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48		ms_run[2]:scan=2524	13.665	3	3327.7814	3327.7814	K	N	128	159
PSM	VHNESILDQVWNIFSEASNSEPVNK	331	sp|Q9NX58|LYAR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48		ms_run[2]:scan=4739	25.768	3	2855.3726	2855.3726	K	E	124	149
PSM	VHNESILDQVWNIFSEASNSEPVNK	332	sp|Q9NX58|LYAR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48		ms_run[2]:scan=4843	26.313	3	2855.3726	2855.3726	K	E	124	149
PSM	VKAEVQNLGGELVVSGVDSAMSLIQAAK	333	sp|P35221-3|CTNA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48		ms_run[2]:scan=3309	17.94	3	2812.5004	2812.5004	K	N	426	454
PSM	YNVYPTYDFACPIVDSIEGVTHALR	334	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48	11-UNIMOD:4	ms_run[2]:scan=2048	11.082	3	2899.3851	2899.3851	K	T	371	396
PSM	ALGLGVEQLPVVFEDVVLHQATILPK	335	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	48		ms_run[1]:scan=7339	40.251383	3	2786.590337	2784.578953	R	T	902	928
PSM	DGAGFLINLIDSPGHVDFSSEVTAALR	336	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	48		ms_run[1]:scan=6217	33.97038	3	2799.404295	2800.403174	K	V	94	121
PSM	DGAGFLINLIDSPGHVDFSSEVTAALR	337	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	48		ms_run[1]:scan=6121	33.440399	3	2799.404295	2800.403174	K	V	94	121
PSM	DGAGFLINLIDSPGHVDFSSEVTAALR	338	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	48		ms_run[1]:scan=6019	32.863261	3	2799.404295	2800.403174	K	V	94	121
PSM	DGAGFLINLIDSPGHVDFSSEVTAALR	339	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	48		ms_run[1]:scan=5921	32.337434	3	2799.404295	2800.403174	K	V	94	121
PSM	LMEPIYLVEIQCPEQVVGGIYGVLNR	340	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	48	12-UNIMOD:4	ms_run[1]:scan=6528	35.69455	2	2989.541522	2988.545287	R	K	740	766
PSM	YAPTEAQLNAVDALIDSMSLAK	341	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	48		ms_run[1]:scan=105	0.56486398	2	2321.165867	2320.162064	K	K	444	466
PSM	QAPGQTQGGQPWTYHLVQFADLLLNHSHNVTTVTPFTAQQR	342	sp|Q9BQG0|MBB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	48		ms_run[1]:scan=180	0.98696612	4	4587.290724	4586.284343	K	Q	530	571
PSM	GGLGGGYGGASGMGGITAVTVNQSLLSPLVLEVDPNIQAVR	343	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	48	13-UNIMOD:35	ms_run[1]:scan=477	2.5828045	3	3941.067152	3940.036417	R	T	48	89
PSM	QLYEEEIRELQSQISDTSVVLSMDNSR	344	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	48	1-UNIMOD:28	ms_run[1]:scan=4317	23.485746	3	3151.5012	3151.4974	R	S	226	253
PSM	EVAAFAQFGSDLDAATQQLLSR	345	sp|P25705|ATPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	48		ms_run[1]:scan=1861	10.088521	3	2337.162696	2337.160090	R	G	442	464
PSM	AGEVVPPAMYQFSQYVCQQTGLQIPQLPAPPK	346	sp|Q5XKP0|MIC13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	48	17-UNIMOD:4	ms_run[1]:scan=125	0.67750349	3	3543.783468	3541.773783	K	I	44	76
PSM	IEGCIIGFDEYMNLVLDDAEEIHSK	347	sp|P62304|RUXE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	48	4-UNIMOD:4	ms_run[1]:scan=2279	12.354161	3	2909.348748	2909.346312	R	T	43	68
PSM	ASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGK	348	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	48	45-UNIMOD:4,48-UNIMOD:4	ms_run[1]:scan=4644	25.25494	5	5806.8802	5806.8792	R	I	13	68
PSM	ALEQQVEEMKTQLEELEDELQATEDAK	349	sp|P35579-2|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=2134	11.564	4	3146.4813	3146.4813	R	L	951	978
PSM	DAQGAATYAVVSSPAGILSLTLLER	350	sp|Q96IR7|HPDL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=2057	11.135	3	2502.333	2502.3330	R	A	111	136
PSM	DELILEGNDIELVSNSAALIQQATTVK	351	sp|P32969|RL9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=2128	11.528	3	2883.5077	2883.5077	K	N	142	169
PSM	DMAIATGGAVFGEEGLTLNLEDVQPHDLGK	352	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=7086	38.838	3	3096.5074	3096.5074	K	V	315	345
PSM	DPTSLLGVLQAEADSTSEGLEDAVHSR	353	sp|Q27J81-2|INF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=2236	12.128	3	2796.3414	2796.3414	K	G	1133	1160
PSM	DSVNPGVMVLLGCGALSSTCGQLASYPLALVR	354	sp|Q6NUK1-2|SCMC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47	13-UNIMOD:4,20-UNIMOD:4	ms_run[2]:scan=4473	24.339	3	3304.6618	3304.6618	K	T	360	392
PSM	ECGVGVIVTPEQIEEAVEAAINR	355	sp|P47897-2|SYQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47	2-UNIMOD:4	ms_run[2]:scan=7232	39.655	3	2482.2374	2482.2374	R	H	99	122
PSM	ECGVGVIVTPEQIEEAVEAAINR	356	sp|P47897-2|SYQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47	2-UNIMOD:4	ms_run[2]:scan=7329	40.195	3	2482.2374	2482.2374	R	H	99	122
PSM	ECGVGVIVTPEQIEEAVEAAINR	357	sp|P47897-2|SYQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47	2-UNIMOD:4	ms_run[2]:scan=7348	40.304	2	2482.2374	2482.2374	R	H	99	122
PSM	EFEELIDSNHDGIVTAEELESYMDPMNEYNALNEAK	358	sp|Q9BRK5-2|CAB45_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=730	3.9528	3	4158.8198	4158.8198	K	Q	182	218
PSM	FLVLDEADGLLSQGYSDFINR	359	sp|Q92499-2|DDX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=4932	26.815	2	2371.1696	2371.1696	R	M	350	371
PSM	GFTDADNTWEPEENLDCPELIEAFLNSQK	360	sp|Q13185|CBX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47	17-UNIMOD:4	ms_run[2]:scan=301	1.6578	3	3381.4983	3381.4983	K	A	53	82
PSM	GIHSAIDASQTPDVVFASILAAFSK	361	sp|P54819-6|KAD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=7515	41.241	3	2544.3224	2544.3224	R	A	157	182
PSM	GLQGVGPGCTDETLLSAIASALHTSTMPITGQLSAAVEK	362	sp|O95983-2|MBD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47	9-UNIMOD:4	ms_run[2]:scan=7471	40.989	3	3880.9551	3880.9551	K	N	132	171
PSM	GSDWLGDQDAIHYMTEQAPAAVVELENYGMPFSR	363	sp|P31040|SDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=4056	22.055	3	3796.7138	3796.7138	K	T	129	163
PSM	GSIPTDVEVLPTETEIHNEPFLTLWLTQVER	364	sp|P46013|KI67_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=629	3.3915	3	3562.8195	3562.8195	R	K	424	455
PSM	GVFHGIENFINEASYMSILGMTPGFGDK	365	sp|P00367-2|DHE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=4925	26.776	3	3030.4256	3030.4256	R	T	108	136
PSM	HLVMGDIPAAVNAFQEAASLLGK	366	sp|P49321-2|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=1752	9.5287	3	2351.2308	2351.2308	K	K	53	76
PSM	HLVMGDIPAAVNAFQEAASLLGK	367	sp|P49321-2|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=1891	10.239	3	2351.2308	2351.2308	K	K	53	76
PSM	HLVMGDIPAAVNAFQEAASLLGK	368	sp|P49321-2|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=2191	11.873	3	2351.2308	2351.2308	K	K	53	76
PSM	LLGSDGSPLMDMLQLAEEPVPQAGQELR	369	sp|Q6XQN6-3|PNCB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=4952	26.93	3	2993.4838	2993.4838	R	V	426	454
PSM	LMEPIYLVEIQCPEQVVGGIYGVLNR	370	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47	2-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=2893	15.682	3	3004.5402	3004.5402	R	K	740	766
PSM	LMEPIYLVEIQCPEQVVGGIYGVLNR	371	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47	12-UNIMOD:4	ms_run[2]:scan=6515	35.621	4	2988.5453	2988.5453	R	K	740	766
PSM	NAATEDLWESLENASGKPIAAVMNTWTK	372	sp|P55786-2|PSA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=504	2.7179	3	3046.4706	3046.4706	K	Q	392	420
PSM	NLDSLEEDLDFLRDQFTTTEVNMAR	373	sp|P61758-2|PFD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=7455	40.896	3	2971.3869	2971.3869	K	V	149	174
PSM	NLNDSSLFVSAEEFGHLLDENMGSK	374	sp|Q03701|CEBPZ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=576	3.1017	3	2752.265	2752.2650	R	F	969	994
PSM	SADFVVEAIGDDVGTLGFSVEGPSQAK	375	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=7454	40.891	2	2694.3025	2694.3025	K	I	594	621
PSM	SHPLDPIDTVDFERECGVGVIVTPEQIEEAVEAAINR	376	sp|P47897-2|SYQ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47	16-UNIMOD:4	ms_run[2]:scan=5807	31.689	4	4104.011	4104.0110	R	H	85	122
PSM	SLLVVHFWAPWAPQCAQMNEVMAELAK	377	sp|O76003|GLRX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47	15-UNIMOD:4	ms_run[2]:scan=1261	6.8427	3	3125.5289	3125.5289	K	E	32	59
PSM	SQEPLPDDDEEFELPEFVEPFLK	378	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=1147	6.2097	2	2748.2694	2748.2694	K	D	367	390
PSM	SQLQDLVEFPYVNLHNEVVGIIESR	379	sp|Q12769|NU160_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=2310	12.52	3	2897.4923	2897.4923	R	A	1045	1070
PSM	TAFYSFYLPIAAAMYMAGIDGEKEHANAK	380	sp|P14324-2|FPPS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=3139	17.032	4	3179.5096	3179.5096	K	K	201	230
PSM	TDALQPPHEYVPWVTVNGKPLEDQTQLLTLVCQLYQGK	381	sp|P13284|GILT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47	32-UNIMOD:4	ms_run[2]:scan=354	1.9563	4	4378.2308	4378.2308	R	K	195	233
PSM	TFFILHDINSDGVLDEQELEALFTK	382	sp|Q02818|NUCB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=1026	5.5275	3	2893.4386	2893.4386	K	E	247	272
PSM	TIESILEPVAQQISHLVIMHEEGEVDGK	383	sp|P18206-2|VINC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=4600	25.015	4	3100.5751	3100.5751	R	A	8	36
PSM	TIVAINKDPEAPIFQVADYGIVADLFK	384	sp|P13804-2|ETFA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=1613	8.7556	3	2946.5743	2946.5743	K	V	246	273
PSM	TNLEFLQEQFNSIAAHVLHCTDSGFGAR	385	sp|P46379-4|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47	20-UNIMOD:4	ms_run[2]:scan=2193	11.884	4	3161.4989	3161.4989	R	L	705	733
PSM	TTYLEDLPPPPEYELAPSKLEEEVDDVFLIR	386	sp|Q12849|GRSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=4073	22.146	3	3616.8076	3616.8076	K	A	123	154
PSM	TVHADLSNYDEDGAWPVLLDEFVEWQK	387	sp|Q9BTE7|DCNL5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=3583	19.462	3	3175.4775	3175.4775	R	V	206	233
PSM	VADNLAIQLAAVTEDKYEILQSVDDAAIVIK	388	sp|Q12906-5|ILF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=2401	12.994	4	3327.7814	3327.7814	K	N	128	159
PSM	VIQGLYSGVTTVELDTLAAETAATLTTK	389	sp|P23921|RIR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=2956	16.025	3	2865.5223	2865.5223	K	H	43	71
PSM	VQVLTAGSLMGLGDIISQQLVER	390	sp|P39210|MPV17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=3624	19.682	3	2426.3203	2426.3203	K	R	18	41
PSM	WYQADSPPADLLLTEEEFLSFLHPEHSR	391	sp|Q9BRK5-2|CAB45_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=6569	35.932	4	3326.5884	3326.5884	R	G	101	129
PSM	WYQADSPPADLLLTEEEFLSFLHPEHSR	392	sp|Q9BRK5-2|CAB45_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=6668	36.463	4	3326.5884	3326.5884	R	G	101	129
PSM	YALQMEQLNGILLHLESELAQTR	393	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=7361	40.37	3	2669.3847	2669.3847	R	A	331	354
PSM	YAQDEHLITFFVPVFEPLPPQYFIR	394	sp|O75643|U520_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=4767	25.914	3	3065.5691	3065.5691	K	V	1245	1270
PSM	YLPELMAEKDSLDPSFTHAMQLLTAEIEK	395	sp|Q07666-3|KHDR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=928	5.0306	4	3319.6356	3319.6356	K	I	103	132
PSM	DGAGFLINLIDSPGHVDFSSEVTAALR	396	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	47		ms_run[1]:scan=6316	34.512489	3	2799.404295	2800.403174	K	V	94	121
PSM	DGAGFLINLIDSPGHVDFSSEVTAALR	397	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	47		ms_run[1]:scan=6830	37.388944	3	2799.404295	2800.403174	K	V	94	121
PSM	DGAGFLINLIDSPGHVDFSSEVTAALR	398	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	47		ms_run[1]:scan=6517	35.632435	3	2799.404295	2800.403174	K	V	94	121
PSM	QEGCQDIATQLISNMDIDVILGGGRK	399	sp|P05187|PPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	47	4-UNIMOD:4	ms_run[1]:scan=7451	40.873662	3	2829.399371	2830.395328	R	Y	202	228
PSM	AQAALQAVNSVQSGNLALAASAAAVDAGMAMAGQSPVLR	400	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	47		ms_run[1]:scan=4173	22.682608	4	3679.880581	3679.877413	R	I	147	186
PSM	ALDLFSDNAPPPELLEIINEDIAKR	401	sp|Q15084|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	47		ms_run[1]:scan=1311	7.1216046	3	2792.467119	2792.459626	R	T	265	290
PSM	EVAAFAQFGSDLDAATQQLLSR	402	sp|P25705|ATPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	47		ms_run[1]:scan=1755	9.5455392	3	2337.162696	2337.160090	R	G	442	464
PSM	AFADAMEVIPSTLAENAGLNPISTVTELR	403	sp|P50991|TCPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	47	6-UNIMOD:35	ms_run[1]:scan=1631	8.8576618	3	3046.5672	3045.5322	R	N	453	482
PSM	NLSPYVSNELLEEAFSQFGPIER	404	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	47		ms_run[1]:scan=1851	10.035925	2	2638.291812	2638.291498	R	A	377	400
PSM	DGAGFLINLIDSPGHVDFSSEVTAALR	405	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	47		ms_run[1]:scan=7310	40.086198	3	2799.404295	2800.403174	K	V	94	121
PSM	VFEMIESQDPTMIGVAVDTVGILGSNVEGK	406	sp|Q16401|PSMD5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	47		ms_run[1]:scan=6666	36.45444	3	3137.556277	3134.551554	K	Q	300	330
PSM	AEISELPSIVQDLANGNITWADVEAR	407	sp|P41250|GARS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=4568	24.843	3	2810.4087	2810.4087	R	Y	697	723
PSM	AENNPWVTPIADQFQLGVSHVFEYIR	408	sp|Q15404|RSU1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=5547	30.252	3	3029.5036	3029.5036	K	S	213	239
PSM	AHQNTLEVYPPFLFFLAVGGVYHPR	409	sp|O14880|MGST3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=3338	18.105	3	2871.4861	2871.4861	R	I	60	85
PSM	ALMLQGVDLLADAVAVTMGPK	410	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46	3-UNIMOD:35	ms_run[2]:scan=4910	26.694	2	2128.1272	2128.1272	R	G	38	59
PSM	AQLVVIAHDVDPIELVVFLPALCR	411	sp|P62424|RL7A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46	23-UNIMOD:4	ms_run[2]:scan=3744	20.324	3	2686.488	2686.4880	K	K	152	176
PSM	AQLVVIAHDVDPIELVVFLPALCR	412	sp|P62424|RL7A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46	23-UNIMOD:4	ms_run[2]:scan=3842	20.868	3	2686.488	2686.4880	K	K	152	176
PSM	ASLDRPFTNLESAFYSIVGLSSLGAQVPDAKK	413	sp|P04844|RPN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=4316	23.48	4	3380.7616	3380.7616	K	A	39	71
PSM	DLSAAGIGLLAAATQSLSMPASLGR	414	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46	19-UNIMOD:35	ms_run[2]:scan=4768	25.92	2	2386.2526	2386.2526	R	M	20	45
PSM	EALDHMVEYVAQNTPVTWLVGPFAPGITEK	415	sp|O60664-2|PLIN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=7153	39.209	3	3311.6537	3311.6537	R	A	216	246
PSM	EAWEEEQEVAELLKEEFPAWYEK	416	sp|Q9UIG0-2|BAZ1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=1180	6.395	3	2881.3334	2881.3334	K	L	64	87
PSM	ERFDPTQFQDCIIQGLTETGTDLEAVAK	417	sp|Q7L1Q6-2|BZW1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46	11-UNIMOD:4	ms_run[2]:scan=4649	25.28	3	3181.5238	3181.5238	K	F	25	53
PSM	FGGQLLSFDIGDQPVFEIPLSNVSQCTTGK	418	sp|Q08945|SSRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46	26-UNIMOD:4	ms_run[2]:scan=81	0.43835	3	3253.5965	3253.5965	K	N	114	144
PSM	FPFFNPIQTQVFNTVYNSDDNVFVGAPTGSGK	419	sp|O75643|U520_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=1290	7.008	3	3506.6783	3506.6783	K	T	1325	1357
PSM	FQSVPAQPGQTSPLLQYFGILLDQGQLNK	420	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=7187	39.401	3	3186.6713	3186.6713	R	Y	401	430
PSM	GIHSAIDASQTPDVVFASILAAFSK	421	sp|P54819-6|KAD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=7418	40.695	3	2544.3224	2544.3224	R	A	157	182
PSM	GQDMETEAHQNKLEEMINELAVAMTAVK	422	sp|Q15363|TMED2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=3175	17.227	4	3129.4781	3129.4781	K	H	118	146
PSM	INEAFIEMATTEDAQAAVDYYTTTPALVFGKPVR	423	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=7500	41.155	3	3731.8393	3731.8393	K	V	434	468
PSM	IQHPSNVLHFFNAPLEVTEENFFEICDELGVK	424	sp|P14866-2|HNRPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46	26-UNIMOD:4	ms_run[2]:scan=3049	16.54	3	3771.8243	3771.8243	R	R	363	395
PSM	ITGMLLEIDNSELLHMLESPESLR	425	sp|P11940-2|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=618	3.332	3	2739.3823	2739.3823	K	S	492	516
PSM	KEEQVISLGPQVAEGENVFGVCHIFASFNDTFVHVTDLSGK	426	sp|P62263|RS14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46	22-UNIMOD:4	ms_run[2]:scan=323	1.783	5	4504.2009	4504.2009	K	E	10	51
PSM	KPLVIIAEDVDGEALSTLVLNR	427	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=7219	39.583	3	2364.3264	2364.3264	R	L	269	291
PSM	LAYVAAGDLAPINAFIGGLAAQEVMK	428	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=4063	22.093	3	2602.3829	2602.3829	K	A	346	372
PSM	LHEEEIQELQAQIQEQHVQIDVDVSKPDLTAALR	429	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=7017	38.456	4	3922.0072	3922.0072	K	D	237	271
PSM	LYNLDVFQYELYNPMALYGSVPVLLAHNPHR	430	sp|Q14697|GANAB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=1756	9.5512	4	3645.8442	3645.8442	R	D	279	310
PSM	NGEFELMHVDEFIDELLHSER	431	sp|Q8NAV1|PR38A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=4835	26.272	3	2558.1748	2558.1748	R	V	136	157
PSM	NLEALALDLMEPEQAVDLTLPK	432	sp|P12956-2|XRCC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=4468	24.314	2	2422.2665	2422.2665	R	V	448	470
PSM	NVEDIELWLYEVEGHLASDDYGK	433	sp|Q13813-3|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=6505	35.566	2	2693.2497	2693.2497	R	D	686	709
PSM	QAADMILLDDNFASIVTGVEEGR	434	sp|P05023-3|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=1836	9.9626	2	2463.1952	2463.1952	K	L	713	736
PSM	QAADMILLDDNFASIVTGVEEGR	435	sp|P05023-3|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=1941	10.493	2	2463.1952	2463.1952	K	L	713	736
PSM	QEGCQDIATQLISNMDIDVILGGGR	436	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46	4-UNIMOD:4	ms_run[2]:scan=3918	21.297	3	2702.3004	2702.3004	R	K	199	224
PSM	SFDFIHLDPFGTSVNYLDSAFR	437	sp|Q7Z2T5-2|TRM1L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=2359	12.779	3	2547.207	2547.2070	R	N	210	232
PSM	SGTIFDNFLITNDEAYAEEFGNETWGVTK	438	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=3597	19.537	3	3267.4884	3267.4884	K	A	323	352
PSM	SILTQPHLYSPVLISQLVQMASQLR	439	sp|O15027-2|SC16A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=5637	30.736	3	2821.5524	2821.5524	K	L	1832	1857
PSM	SLQDIIAILGMDELSEEDKLTVSR	440	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=5271	28.713	3	2674.3735	2674.3735	K	A	433	457
PSM	SLQDIIAILGMDELSEEDKLTVSR	441	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=5183	28.24	2	2674.3735	2674.3735	K	A	433	457
PSM	SLSALGNVISALAEGSTYVPYR	442	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=1259	6.8314	2	2267.1798	2267.1798	K	D	257	279
PSM	STLLATIQEHGYPTINLGIVGDNPDDLLNALNEGISR	443	sp|Q9NQX3|GEPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=3459	18.775	3	3933.012	3933.0120	R	A	528	565
PSM	SVVPGGGAVEAALSIYLENYATSMGSR	444	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=5359	29.205	3	2698.3272	2698.3272	K	E	407	434
PSM	TEAAKEESQQMVLDIEDLDNIQTPESVLLSAVSGEDTQDR	445	sp|Q14152-2|EIF3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=2535	13.729	3	4403.081	4403.0810	K	T	67	107
PSM	TEAAKEESQQMVLDIEDLDNIQTPESVLLSAVSGEDTQDR	446	sp|Q14152-2|EIF3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=2537	13.741	4	4403.081	4403.0810	K	T	67	107
PSM	TLALLAFDSPEESPFGDLLHTMQR	447	sp|Q9NWU2|GID8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=359	1.9802	3	2687.3265	2687.3265	R	Q	146	170
PSM	TLESVDPLGGLNTIDILTAIR	448	sp|O00429-4|DNM1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=348	1.9226	2	2210.2158	2210.2158	R	N	377	398
PSM	TNLEFLQEQFNSIAAHVLHCTDSGFGAR	449	sp|P46379-4|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46	20-UNIMOD:4	ms_run[2]:scan=2200	11.926	3	3161.4989	3161.4989	R	L	705	733
PSM	TQTSDPAMLPTMIGLLAEAGVR	450	sp|O43175|SERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=2995	16.242	2	2271.1603	2271.1603	R	L	470	492
PSM	TVASPGVTVEEAVEQIDIGGVTLLR	451	sp|P31939-2|PUR9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=921	4.9935	3	2552.3697	2552.3697	K	A	108	133
PSM	VPAFEGDDGFCVFESNAIAYYVSNEELR	452	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46	11-UNIMOD:4	ms_run[2]:scan=1746	9.4952	3	3197.4288	3197.4288	K	G	58	86
PSM	WLPAGDALLQMITIHLPSPVTAQK	453	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=5447	29.699	2	2599.4196	2599.4196	R	Y	343	367
PSM	YNVYPTYDFACPIVDSIEGVTHALR	454	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46	11-UNIMOD:4	ms_run[2]:scan=1840	9.9787	3	2899.3851	2899.3851	K	T	371	396
PSM	DGAGFLINLIDSPGHVDFSSEVTAALR	455	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46		ms_run[1]:scan=6416	35.062587	3	2799.404295	2800.403174	K	V	94	121
PSM	SGETEDTFIADLVVGLCTGQIK	456	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46	17-UNIMOD:4	ms_run[1]:scan=3742	20.31323	2	2352.151258	2352.151893	R	T	373	395
PSM	SGETEDTFIADLVVGLCTGQIK	457	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46	17-UNIMOD:4	ms_run[1]:scan=3841	20.862134	2	2352.151258	2352.151893	R	T	373	395
PSM	SGETEDTFIADLVVGLCTGQIK	458	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46	17-UNIMOD:4	ms_run[1]:scan=3645	19.795892	2	2352.151258	2352.151893	R	T	373	395
PSM	SGETEDTFIADLVVGLCTGQIK	459	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46	17-UNIMOD:4	ms_run[1]:scan=3940	21.417691	2	2352.151258	2352.151893	R	T	373	395
PSM	GFQQILAGEYDHLPEQAFYMVGPIEEAVAK	460	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46		ms_run[1]:scan=2774	15.035977	3	3349.633691	3349.632916	K	A	490	520
PSM	ALDLFSDNAPPPELLEIINEDIAKR	461	sp|Q15084|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46		ms_run[1]:scan=1509	8.1674967	3	2792.467119	2792.459626	R	T	265	290
PSM	AGWNAYIDNLMADGTCQDAAIVGYK	462	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	46	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=3545	19.250967	2	2758.2349	2758.2362	M	D	2	27
PSM	LQLETEIEALKEELLFMK	463	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46		ms_run[1]:scan=1731	9.4109097	2	2176.171206	2176.170109	R	K	197	215
PSM	EVAAFAQFGSDLDAATQQLLSR	464	sp|P25705|ATPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46		ms_run[1]:scan=1971	10.660644	3	2337.162696	2337.160090	R	G	442	464
PSM	EIIDTNGAGDAFVGGFLSQLVSDKPLTECIR	465	sp|P55263|ADK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46	29-UNIMOD:4	ms_run[1]:scan=2976	16.139813	3	3322.637531	3321.655108	K	A	308	339
PSM	ASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGK	466	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	46	45-UNIMOD:4,48-UNIMOD:4	ms_run[1]:scan=4438	24.157877	5	5806.8802	5806.8792	R	I	13	68
PSM	ASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGK	467	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	46	45-UNIMOD:4,48-UNIMOD:4	ms_run[1]:scan=4842	26.307616	5	5806.8802	5806.8792	R	I	13	68
PSM	ASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGK	468	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	46	45-UNIMOD:4,48-UNIMOD:4	ms_run[1]:scan=4941	26.868325	5	5806.8802	5806.8792	R	I	13	68
PSM	QLTEMLPSILNQLGADSLTSLR	469	sp|P20290|BTF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46		ms_run[1]:scan=3764	20.426249	3	2399.269545	2399.273011	K	R	142	164
PSM	ASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGK	470	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	46	45-UNIMOD:4,48-UNIMOD:4	ms_run[1]:scan=4645	25.257272	6	5806.8886	5806.8792	R	I	13	68
PSM	GQGVYLGMPGCLPVYDALAGEFIR	471	sp|P30040|ERP29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46	11-UNIMOD:4	ms_run[1]:scan=13	0.051386518	2	2583.269627	2582.266152	K	A	147	171
PSM	HQIQAVEPSAQALELQGLGVDVYDQDVLEQGVLQQVDNAIHEASR	472	sp|Q03468|ERCC6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46		ms_run[1]:scan=5444	29.681726	4	4908.449609	4909.448233	R	A	78	123
PSM	AGAAPYVQAFDSLLAGPVAEYLK	473	sp|Q01518|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=7186	39.396	2	2350.2209	2350.2209	K	I	38	61
PSM	AGAAPYVQAFDSLLAGPVAEYLK	474	sp|Q01518|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=7297	40.013	2	2350.2209	2350.2209	K	I	38	61
PSM	ALDLFSDNAPPPELLEIINEDIAK	475	sp|Q15084-3|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=6643	36.326	3	2636.3585	2636.3585	R	R	262	286
PSM	ALDLFSDNAPPPELLEIINEDIAK	476	sp|Q15084-3|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=6360	34.747	2	2636.3585	2636.3585	R	R	262	286
PSM	DAFEHIVTQFSSVPVSVVSDSYDIYNACEK	477	sp|P43490|NAMPT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45	28-UNIMOD:4	ms_run[2]:scan=869	4.714	3	3405.5711	3405.5711	K	I	260	290
PSM	EEFVQWVELLPDTQTPSWLGLPNNAER	478	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=4371	23.791	3	3167.5564	3167.5564	R	V	4303	4330
PSM	EEIVQFFSGLEIVPNGITLPVDPEGK	479	sp|P52597|HNRPF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=5139	27.998	3	2826.4691	2826.4691	K	I	125	151
PSM	EVAAFAQFGSDLDAATQQLLSR	480	sp|P25705-2|ATPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=1974	10.678	2	2337.1601	2337.1601	R	G	392	414
PSM	GDLENAFLNLVQCIQNKPLYFADR	481	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45	13-UNIMOD:4	ms_run[2]:scan=7489	41.093	2	2837.417	2837.4170	K	L	250	274
PSM	GFLFGPSLAQELGLGCVLIR	482	sp|P07741-2|APT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45	16-UNIMOD:4	ms_run[2]:scan=4998	27.192	2	2146.1609	2146.1609	R	K	68	88
PSM	GLIAEAAQLGPVGGVFNLAVVLR	483	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=3982	21.659	3	2263.3052	2263.3052	R	D	1954	1977
PSM	GLIAEAAQLGPVGGVFNLAVVLR	484	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=4200	22.83	3	2263.3052	2263.3052	R	D	1954	1977
PSM	GMYGIENEVFLSLPCILNAR	485	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45	15-UNIMOD:4	ms_run[2]:scan=1729	9.402	2	2295.1392	2295.1392	K	G	280	300
PSM	GMYGIENEVFLSLPCILNAR	486	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45	15-UNIMOD:4	ms_run[2]:scan=1828	9.9175	2	2295.1392	2295.1392	K	G	280	300
PSM	GQDMETEAHQNKLEEMINELAVAMTAVK	487	sp|Q15363|TMED2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=3188	17.302	3	3129.4781	3129.4781	K	H	118	146
PSM	HPAGQQLDEFLQLAVDKVEAGLGSGPCR	488	sp|Q96T76-5|MMS19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45	27-UNIMOD:4	ms_run[2]:scan=557	2.9981	4	2991.4873	2991.4873	K	S	670	698
PSM	HSQDLAFLSMLNDIAAVPATAMPFR	489	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=5337	29.084	3	2715.3513	2715.3513	R	G	444	469
PSM	IPNFWVTTFVNHPQVSALLGEEDEEALHYLTR	490	sp|Q01105-3|SET_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=7420	40.707	3	3724.8526	3724.8526	K	V	66	98
PSM	ITGMLLEIDNSELLHMLESPESLR	491	sp|P11940-2|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=516	2.7818	3	2739.3823	2739.3823	K	S	492	516
PSM	KPLVIIAEDVDGEALSTLVLNR	492	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=7121	39.034	3	2364.3264	2364.3264	R	L	269	291
PSM	KPLVIIAEDVDGEALSTLVLNR	493	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=7416	40.684	3	2364.3264	2364.3264	R	L	269	291
PSM	LCYVALDFEQEMATAASSSSLEK	494	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45	2-UNIMOD:4	ms_run[2]:scan=7264	39.828	3	2549.1666	2549.1666	K	S	216	239
PSM	LFQVSTLDAALSGTLSGVEGFTSQEDQEMLSR	495	sp|P33992|MCM5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=6599	36.101	3	3415.6453	3415.6453	R	I	643	675
PSM	LFQVSTLDAALSGTLSGVEGFTSQEDQEMLSR	496	sp|P33992|MCM5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=6708	36.692	3	3415.6453	3415.6453	R	I	643	675
PSM	LMEPYYFVEVQAPADCVSAVYTVLAR	497	sp|Q15029-2|U5S1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45	16-UNIMOD:4	ms_run[2]:scan=363	2.0027	3	2990.4558	2990.4558	R	R	792	818
PSM	LTLDLTVLLGVLQGQQQSLQQGAHSTGSSR	498	sp|Q9BQG0|MBB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=2556	13.845	4	3134.6684	3134.6684	K	L	1101	1131
PSM	LYNLDVFQYELYNPMALYGSVPVLLAHNPHR	499	sp|Q14697|GANAB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=1837	9.9682	5	3645.8442	3645.8442	R	D	279	310
PSM	NLEALALDLMEPEQAVDLTLPK	500	sp|P12956-2|XRCC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=4567	24.837	2	2422.2665	2422.2665	R	V	448	470
PSM	NLSPYVSNELLEEAFSQFGPIER	501	sp|P23246-2|SFPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=1839	9.9757	3	2638.2915	2638.2915	R	A	377	400
PSM	NSAQIANLVSEDEAAFLASLER	502	sp|Q5JTZ9|SYAM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=2150	11.646	2	2347.1656	2347.1656	R	G	393	415
PSM	NVGCLQEALQLATSFAQLR	503	sp|P49588|SYAC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45	4-UNIMOD:4	ms_run[2]:scan=4424	24.08	2	2118.0892	2118.0892	K	L	944	963
PSM	RLEAGYQIAVETEQIGQEMLENLSHDR	504	sp|Q96AJ9-1|VTI1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=3474	18.86	3	3128.5197	3128.5197	R	E	131	158
PSM	RTGPAATTLPDGAAAESLVESSEVAVIGFFK	505	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=5063	27.563	3	3090.5873	3090.5873	K	D	132	163
PSM	SEDPLFVLEHSLPIDTQYYLEQQLAK	506	sp|P28340|DPOD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=2780	15.07	3	3075.5441	3075.5441	K	P	939	965
PSM	SENLDNPIQTVSLGQSLFFHFPPLLR	507	sp|Q5JPE7-3|NOMO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=3710	20.132	3	2968.5447	2968.5447	K	D	913	939
PSM	SENLDNPIQTVSLGQSLFFHFPPLLR	508	sp|Q5JPE7-3|NOMO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=3910	21.252	3	2968.5447	2968.5447	K	D	913	939
PSM	SLLVVHFWAPWAPQCAQMNEVMAELAK	509	sp|O76003|GLRX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45	15-UNIMOD:4	ms_run[2]:scan=1355	7.3589	3	3125.5289	3125.5289	K	E	32	59
PSM	SLQDIIAILGMDELSEEDKLTVSR	510	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=5086	27.695	2	2674.3735	2674.3735	K	A	433	457
PSM	TAAVGEICEEGLHVLEGLAASGLR	511	sp|Q9NXH9-2|TRM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45	8-UNIMOD:4	ms_run[2]:scan=373	2.0553	3	2451.2428	2451.2428	R	S	143	167
PSM	TLLEGSGLESIISIIHSSLAEPR	512	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=7263	39.822	3	2421.3115	2421.3115	R	V	2483	2506
PSM	TVLLSIQALLSAPNPDDPLANDVAEQWK	513	sp|P61088|UBE2N_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=3720	20.191	3	3017.571	3017.5710	R	T	103	131
PSM	VADNLAIQLAAVTEDKYEILQSVDDAAIVIK	514	sp|Q12906-5|ILF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=7521	41.274	4	3327.7814	3327.7814	K	N	128	159
PSM	VVDNPIYLSDMGAALTGAESHELQDVLEETNIPK	515	sp|P36776-3|LONM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=656	3.5436	3	3667.7927	3667.7927	R	R	128	162
PSM	YYGHGANSPISTDLFTYLCPALLYQIDSR	516	sp|Q9ULF5|S39AA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45	19-UNIMOD:4	ms_run[2]:scan=98	0.53636	3	3334.5969	3334.5969	K	L	346	375
PSM	DGAGFLINLIDSPGHVDFSSEVTAALR	517	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45		ms_run[1]:scan=5821	31.76795	3	2799.404295	2800.403174	K	V	94	121
PSM	DGAGFLINLIDSPGHVDFSSEVTAALR	518	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45		ms_run[1]:scan=6724	36.779717	3	2800.407626	2800.403174	K	V	94	121
PSM	CPEALFQPSFLGMESCGIHETTFNSIMK	519	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45	1-UNIMOD:4,16-UNIMOD:4	ms_run[1]:scan=7309	40.080581	3	3230.447125	3230.454500	R	C	257	285
PSM	ALMLQGVDLLADAVAVTMGPK	520	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45		ms_run[1]:scan=7583	41.606232	2	2112.147068	2112.132284	R	G	38	59
PSM	DMAIATGGAVFGEEGLTLNLEDVQPHDLGK	521	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45		ms_run[1]:scan=9259	50.681649	3	3098.513083	3096.507381	K	V	315	345
PSM	SGETEDTFIADLVVGLCTGQIK	522	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45	17-UNIMOD:4	ms_run[1]:scan=4040	21.965268	2	2352.151258	2352.151893	R	T	373	395
PSM	SGETEDTFIADLVVGLCTGQIK	523	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45	17-UNIMOD:4	ms_run[1]:scan=4237	23.031473	2	2352.151258	2352.151893	R	T	373	395
PSM	SGETEDTFIADLVVGLCTGQIK	524	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45	17-UNIMOD:4	ms_run[1]:scan=4336	23.591794	2	2352.151258	2352.151893	R	T	373	395
PSM	SGETEDTFIADLVVGLCTGQIK	525	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45	17-UNIMOD:4	ms_run[1]:scan=4138	22.483483	2	2352.151258	2352.151893	R	T	373	395
PSM	SGETEDTFIADLVVGLCTGQIK	526	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45	17-UNIMOD:4	ms_run[1]:scan=4733	25.735218	2	2352.151258	2352.151893	R	T	373	395
PSM	AQAALQAVNSVQSGNLALAASAAAVDAGMAMAGQSPVLR	527	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45	29-UNIMOD:35	ms_run[1]:scan=4047	22.004699	4	3695.899987	3695.872328	R	I	147	186
PSM	GVPQIEVTFDIDANGILNVSAVDK	528	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45		ms_run[1]:scan=7395	40.563256	2	2513.293959	2513.301334	R	S	470	494
PSM	ALDLFSDNAPPPELLEIINEDIAKR	529	sp|Q15084|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45		ms_run[1]:scan=1410	7.6459737	3	2792.467119	2792.459626	R	T	265	290
PSM	IIYLNQLLQEDSLNVADLTSLR	530	sp|Q9UL46|PSME2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45		ms_run[1]:scan=1081	5.8372582	3	2530.372786	2530.364269	K	A	40	62
PSM	EVIQALHPETLISCQSQFKPAVFDFPSQDVFTVEPQFDTALGQYFCSITMHR	531	sp|Q8TEM1|PO210_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	45	14-UNIMOD:4,46-UNIMOD:4	ms_run[1]:scan=5373	29.286384	5	6060.8962	6058.9002	R	L	1598	1650
PSM	QVEHPLLSGLLYPGLQALDEEYLK	532	sp|P54577|SYYC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	45	1-UNIMOD:28	ms_run[1]:scan=3518	19.102783	2	2707.4116	2707.4104	K	V	155	179
PSM	AEEGIAAGGVMDVNTALQEVLK	533	sp|P25398|RS12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	45	1-UNIMOD:1	ms_run[1]:scan=4524	24.611253	2	2256.1309	2256.1302	M	T	2	24
PSM	QLHEQAMQFGQLLTHLDTTQQMIANSLK	534	sp|Q13561|DCTN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	45	1-UNIMOD:28	ms_run[1]:scan=896	4.8548034	3	3206.5806	3206.5847	K	D	338	366
PSM	ASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGK	535	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	45	36-UNIMOD:35,45-UNIMOD:4,48-UNIMOD:4	ms_run[1]:scan=1763	9.5868746	5	5822.8757	5822.8741	R	I	13	68
PSM	ASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGK	536	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	45	36-UNIMOD:35,45-UNIMOD:4,48-UNIMOD:4	ms_run[1]:scan=1984	10.732708	5	5822.8757	5822.8741	R	I	13	68
PSM	EQHLLMTLVGEQGVVPTQDVLSMLGDIR	537	sp|Q9NZ53|PDXL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45		ms_run[1]:scan=2572	13.928727	3	3078.581725	3077.588942	K	R	443	471
PSM	LCYVALDFEQEMATAASSSSLEK	538	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45	2-UNIMOD:4	ms_run[1]:scan=9255	50.662142	2	2548.158998	2549.166557	K	S	216	239
PSM	AEISELPSIVQDLANGNITWADVEAR	539	sp|P41250|GARS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=4418	24.049	2	2810.4087	2810.4087	R	Y	697	723
PSM	AGAAPYVQAFDSLLAGPVAEYLK	540	sp|Q01518|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=7220	39.589	3	2350.2209	2350.2209	K	I	38	61
PSM	AGAAPYVQAFDSLLAGPVAEYLK	541	sp|Q01518|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=7088	38.85	2	2350.2209	2350.2209	K	I	38	61
PSM	AHQNTLEVYPPFLFFLAVGGVYHPR	542	sp|O14880|MGST3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=3042	16.5	4	2871.4861	2871.4861	R	I	60	85
PSM	AHQNTLEVYPPFLFFLAVGGVYHPR	543	sp|O14880|MGST3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=3153	17.113	4	2871.4861	2871.4861	R	I	60	85
PSM	AHQNTLEVYPPFLFFLAVGGVYHPR	544	sp|O14880|MGST3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=3263	17.69	4	2871.4861	2871.4861	R	I	60	85
PSM	AHQNTLEVYPPFLFFLAVGGVYHPR	545	sp|O14880|MGST3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=3359	18.219	4	2871.4861	2871.4861	R	I	60	85
PSM	ALDLFSDNAPPPELLEIINEDIAK	546	sp|Q15084-3|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=6338	34.631	3	2636.3585	2636.3585	R	R	262	286
PSM	ALDLFSDNAPPPELLEIINEDIAK	547	sp|Q15084-3|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=6437	35.179	3	2636.3585	2636.3585	R	R	262	286
PSM	ALEAFDLDPAQWGVNVQPYSGSPANLAVYTALLQPHDR	548	sp|P34897-3|GLYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=2452	13.274	3	4123.0439	4123.0439	R	I	102	140
PSM	ALMLQGVDLLADAVAVTMGPK	549	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44	3-UNIMOD:35	ms_run[2]:scan=4815	26.17	2	2128.1272	2128.1272	R	G	38	59
PSM	ALMLQGVDLLADAVAVTMGPK	550	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44	3-UNIMOD:35	ms_run[2]:scan=4877	26.506	3	2128.1272	2128.1272	R	G	38	59
PSM	ALMLQGVDLLADAVAVTMGPK	551	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44	3-UNIMOD:35	ms_run[2]:scan=4975	27.062	3	2128.1272	2128.1272	R	G	38	59
PSM	ATGATQQDANASSLLDIYSFWLK	552	sp|Q14978|NOLC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=2500	13.531	3	2499.2282	2499.2282	K	S	37	60
PSM	ATGATQQDANASSLLDIYSFWLNR	553	sp|Q14978-3|NOLC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=2467	13.35	3	2641.2772	2641.2772	K	S	37	61
PSM	AVVHTHLLNPEWLVNYFGSLSVEDSLECLR	554	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44	28-UNIMOD:4	ms_run[2]:scan=2000	10.817	4	3496.7449	3496.7449	R	A	639	669
PSM	DGAGFLINLIDSPGHVDFSSEVTAALR	555	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=4162	22.621	3	2800.4032	2800.4032	K	V	94	121
PSM	DNTIEHLLPLFLAQLKDECPEVR	556	sp|P30153|2AAA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44	19-UNIMOD:4	ms_run[2]:scan=1103	5.9635	3	2749.4109	2749.4109	K	L	359	382
PSM	DSEMGQQSLLFQIDYPEIAEGIMPR	557	sp|Q15428|SF3A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=374	2.0609	3	2866.3517	2866.3517	R	H	124	149
PSM	EALDHMVEYVAQNTPVTWLVGPFAPGITEK	558	sp|O60664-2|PLIN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=7351	40.318	3	3311.6537	3311.6537	R	A	216	246
PSM	EEIVQFFSGLEIVPNGITLPVDPEGK	559	sp|P52597|HNRPF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=5043	27.448	3	2826.4691	2826.4691	K	I	125	151
PSM	EFDYVINDLTAVPISTSPEEDSTWEFLR	560	sp|P52788-2|SPSY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=1700	9.2473	3	3272.5401	3272.5401	R	L	216	244
PSM	EIYPYVIQELRPTLNELGISTPEELGLDKV	561	sp|P20674|COX5A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=4193	22.791	4	3427.8127	3427.8127	K	-	121	151
PSM	EIYPYVIQELRPTLNELGISTPEELGLDKV	562	sp|P20674|COX5A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=4293	23.35	4	3427.8127	3427.8127	K	-	121	151
PSM	ELPEPLLTFDLYPHVVGFLNIDESQR	563	sp|Q07960|RHG01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=4391	23.897	3	3040.5546	3040.5546	R	V	324	350
PSM	EQYEQILAFVQGTVAEGAPIIPISAQLK	564	sp|Q2VIR3-2|IF2GL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=7394	40.558	3	3012.6172	3012.6172	K	Y	202	230
PSM	FMCAQLPNPVLDSISIIDTPGILSGEK	565	sp|Q9H4M9|EHD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44	3-UNIMOD:4	ms_run[2]:scan=2985	16.188	3	2914.482	2914.4820	R	Q	136	163
PSM	FNVGEDCPVFDGLFEFCQLSTGGSVASAVK	566	sp|Q13547|HDAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44	7-UNIMOD:4,17-UNIMOD:4	ms_run[2]:scan=2407	13.024	3	3236.4795	3236.4795	R	L	94	124
PSM	GDLENAFLNLVQCIQNKPLYFADR	567	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44	13-UNIMOD:4	ms_run[2]:scan=7452	40.879	3	2837.417	2837.4170	K	L	250	274
PSM	GFTDADNTWEPEENLDCPELIEAFLNSQK	568	sp|Q13185|CBX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44	17-UNIMOD:4	ms_run[2]:scan=398	2.191	3	3381.4983	3381.4983	K	A	53	82
PSM	GIEAGSEDIDILPNGLAFFSVGLK	569	sp|Q15165-1|PON2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=1632	8.8633	2	2461.2741	2461.2741	K	F	47	71
PSM	GILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVK	570	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=9130	50.056	4	4035.8875	4035.8875	K	L	272	310
PSM	GLIAEAAQLGPVGGVFNLAVVLR	571	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=4098	22.272	3	2263.3052	2263.3052	R	D	1954	1977
PSM	GLPFQANAQDIINFFAPLKPVR	572	sp|Q12849|GRSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=3027	16.416	3	2455.3376	2455.3376	R	I	407	429
PSM	GLPFQANAQDIINFFAPLKPVR	573	sp|Q12849|GRSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=3126	16.966	3	2455.3376	2455.3376	R	I	407	429
PSM	GPQLAAQNLGISLANLLLSK	574	sp|P08397-4|HEM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=1986	10.744	2	2020.1681	2020.1681	R	G	269	289
PSM	GSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHNK	575	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44	36-UNIMOD:35	ms_run[2]:scan=5096	27.751	4	4306.1157	4306.1157	R	Q	86	126
PSM	GTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVK	576	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=4041	21.971	4	4147.9844	4147.9844	K	S	287	323
PSM	GVEIEGPLSTETNWDIAHMISGFE	577	sp|P28070|PSB4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=1796	9.7588	2	2631.2163	2631.2163	K	-	241	265
PSM	HSQDLAFLSMLNDIAAVPATAMPFR	578	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=5436	29.637	3	2715.3513	2715.3513	R	G	444	469
PSM	IEPLSPELVAAASAVADSLPFDK	579	sp|Q92665|RT31_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=7356	40.344	2	2339.226	2339.2260	R	Q	148	171
PSM	IGYNPDTVAFVPISGWNGDNMLEPSANMPWFK	580	sp|P68104-2|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=2389	12.943	3	3566.6639	3566.6639	K	G	160	192
PSM	IIYLNQLLQEDSLNVADLTSLR	581	sp|Q9UL46|PSME2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=976	5.2587	2	2530.3643	2530.3643	K	A	40	62
PSM	ILQMEEEYIQQLCEDIIQLKPDVVITEK	582	sp|P49368-2|TCPG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44	13-UNIMOD:4	ms_run[2]:scan=6131	33.495	4	3416.7459	3416.7459	R	G	229	257
PSM	IRLPDEVENPGMNSGMLEEDLIQYYQFLAEK	583	sp|Q9UBV2|SE1L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=2429	13.143	3	3640.7429	3640.7429	R	G	340	371
PSM	KPLVIIAEDVDGEALSTLVLNR	584	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=7318	40.134	3	2364.3264	2364.3264	R	L	269	291
PSM	LDAITDEENDMLDLAYGLTDR	585	sp|P10109|ADX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=1094	5.9129	2	2382.0897	2382.0897	K	S	127	148
PSM	LDLNGNTLGEEGCEQLQEVLEGFNMAK	586	sp|P46060|RAGP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44	13-UNIMOD:4	ms_run[2]:scan=1966	10.63	3	3007.3903	3007.3903	K	V	326	353
PSM	LFGFKEDPFVFIPEDDPLFPPIEK	587	sp|Q08J23-3|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=3335	18.088	3	2835.4411	2835.4411	K	F	276	300
PSM	LFGFKEDPFVFIPEDDPLFPPIEK	588	sp|Q08J23-3|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=3434	18.635	3	2835.4411	2835.4411	K	F	276	300
PSM	LMEPIYLVEIQCPEQVVGGIYGVLNR	589	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44	12-UNIMOD:4	ms_run[2]:scan=6318	34.524	3	2988.5453	2988.5453	R	K	740	766
PSM	LSALGNVTTCNDYVALVHPDLDRETEEILADVLK	590	sp|P56537|IF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44	10-UNIMOD:4	ms_run[2]:scan=1335	7.2448	4	3782.9037	3782.9037	R	V	101	135
PSM	LSGDWNPLHIDPNFASLAGFDKPILHGLCTFGFSAR	591	sp|P51659-3|DHB4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44	29-UNIMOD:4	ms_run[2]:scan=2062	11.163	4	3969.9625	3969.9625	R	R	489	525
PSM	NLVSEAIAAGIFNDLGSGSNIDLCVISK	592	sp|Q99436|PSB7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44	24-UNIMOD:4	ms_run[2]:scan=3703	20.093	3	2876.459	2876.4590	K	N	196	224
PSM	NLVSEAIAAGIFNDLGSGSNIDLCVISK	593	sp|Q99436|PSB7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44	24-UNIMOD:4	ms_run[2]:scan=3801	20.636	3	2876.459	2876.4590	K	N	196	224
PSM	QEGCQDIATQLISNMDIDVILGGGR	594	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44	4-UNIMOD:4	ms_run[2]:scan=4021	21.863	3	2702.3004	2702.3004	R	K	199	224
PSM	RCPHPLTFDVNNPLHLDYVMAAANLFAQTYGLTGSQDR	595	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44	2-UNIMOD:4	ms_run[2]:scan=4439	24.164	4	4302.0739	4302.0739	K	A	707	745
PSM	RGIHSAIDASQTPDVVFASILAAFSK	596	sp|P54819-6|KAD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=1677	9.1154	3	2700.4235	2700.4235	K	A	156	182
PSM	SACSLESNLEGLAGVLEADLPNYK	597	sp|Q09161|NCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44	3-UNIMOD:4	ms_run[2]:scan=4983	27.109	2	2549.2319	2549.2319	K	S	42	66
PSM	SACSLESNLEGLAGVLEADLPNYK	598	sp|Q09161|NCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44	3-UNIMOD:4	ms_run[2]:scan=5073	27.622	2	2549.2319	2549.2319	K	S	42	66
PSM	SDPMVQCIIEESGEHIIAGAGELHLEICLK	599	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44	7-UNIMOD:4,28-UNIMOD:4	ms_run[2]:scan=1612	8.75	4	3347.62	3347.6200	K	D	530	560
PSM	SENLDNPIQTVSLGQSLFFHFPPLLR	600	sp|Q5JPE7-3|NOMO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=3809	20.681	3	2968.5447	2968.5447	K	D	913	939
PSM	SFAVGTLAETIQGLGAASAQFVSR	601	sp|Q8TEX9|IPO4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=2649	14.344	2	2380.2387	2380.2387	K	L	876	900
PSM	SGNYTVLQVVEALGSSLENPEPR	602	sp|Q96T76-5|MMS19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=7334	40.223	2	2458.234	2458.2340	K	T	41	64
PSM	SGVAYIAAPSGSAADKVVIEACDELGIILAHTNLR	603	sp|P31939-2|PUR9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44	22-UNIMOD:4	ms_run[2]:scan=5892	32.17	4	3580.8559	3580.8559	R	L	553	588
PSM	SLQDIIAILGMDELSEEDKLTVSR	604	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=5372	29.281	3	2674.3735	2674.3735	K	A	433	457
PSM	SPLTICYPEYTGSNTYEEAAAYIQCQFEDLNR	605	sp|P08754|GNAI3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44	6-UNIMOD:4,25-UNIMOD:4	ms_run[2]:scan=3253	17.637	3	3802.6767	3802.6767	R	R	281	313
PSM	TAAFLLPILSQIYSDGPGEALR	606	sp|O00571-2|DDX3X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=6393	34.931	3	2331.2474	2331.2474	K	A	215	237
PSM	TAAFLLPILSQIYSDGPGEALR	607	sp|O00571-2|DDX3X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=6493	35.499	3	2331.2474	2331.2474	K	A	215	237
PSM	TAFDEAIAELDTLSEESYK	608	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=402	2.2103	2	2130.9845	2130.9845	K	D	194	213
PSM	TAFDEAIAELDTLSEESYK	609	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=508	2.7369	2	2130.9845	2130.9845	K	D	194	213
PSM	VADNLAIQLAAVTEDKYEILQSVDDAAIVIK	610	sp|Q12906-5|ILF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=2296	12.449	4	3327.7814	3327.7814	K	N	128	159
PSM	VETELQGVCDTVLGLLDSHLIK	611	sp|P31947|1433S_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44	9-UNIMOD:4	ms_run[2]:scan=6129	33.484	3	2438.2727	2438.2727	K	E	88	110
PSM	VFIMDNCEELIPEYLNFIR	612	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44	7-UNIMOD:4	ms_run[2]:scan=1300	7.065	2	2414.165	2414.1650	R	G	368	387
PSM	VFIMDSCDELIPEYLNFIR	613	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44	7-UNIMOD:4	ms_run[2]:scan=1817	9.862	2	2373.1385	2373.1385	R	G	360	379
PSM	VIHDNFGIVEGLMTTVHAITATQK	614	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=7408	40.639	3	2594.3527	2594.3527	K	T	163	187
PSM	VPSTEAEALASSLMGLFEK	615	sp|P50395|GDIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=6624	36.224	2	1978.9921	1978.9921	K	R	119	138
PSM	VVDNPIYLSDMGAALTGAESHELQDVLEETNIPK	616	sp|P36776-3|LONM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=677	3.6586	4	3667.7927	3667.7927	R	R	128	162
PSM	VYAEADSQESADHLAHEVSLAVFQLAGGIGERPQPGF	617	sp|O95394|AGM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=4586	24.942	4	3894.8813	3894.8813	R	-	506	543
PSM	YAVDDVQYVDEIASVLTSQKPSVLLTLR	618	sp|P12955-2|PEPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=5978	32.637	3	3121.6547	3121.6547	K	G	121	149
PSM	YAVDDVQYVDEIASVLTSQKPSVLLTLR	619	sp|P12955-2|PEPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=6015	32.841	4	3121.6547	3121.6547	K	G	121	149
PSM	YCIGLNETQLGIIAPFWLK	620	sp|P42126|ECI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44	2-UNIMOD:4	ms_run[2]:scan=211	1.1588	2	2235.1762	2235.1762	R	D	172	191
PSM	YLVSLGCIKPLCDLLTVMDSK	621	sp|O60684|IMA7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44	7-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=1258	6.8258	3	2424.2467	2424.2467	R	I	416	437
PSM	LCYVALDFEQEMATAASSSSLEK	622	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44	2-UNIMOD:4	ms_run[1]:scan=7135	39.111628	2	2549.163358	2549.166557	K	S	216	239
PSM	ALMLQGVDLLADAVAVTMGPK	623	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44		ms_run[1]:scan=7584	41.611829	3	2114.143647	2112.132284	R	G	38	59
PSM	TELMQASLDQSVTHLMGLFEPGDTK	624	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44		ms_run[1]:scan=107	0.57609522	3	2748.322592	2747.314618	R	Y	270	295
PSM	LDRDPASGTALQEISFWLNLER	625	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44		ms_run[1]:scan=1105	5.9747624	3	2530.275467	2530.281602	K	A	262	284
PSM	SGETEDTFIADLVVGLCTGQIK	626	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44	17-UNIMOD:4	ms_run[1]:scan=4633	25.194361	2	2352.151258	2352.151893	R	T	373	395
PSM	SGETEDTFIADLVVGLCTGQIK	627	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44	17-UNIMOD:4	ms_run[1]:scan=4437	24.153259	2	2352.151258	2352.151893	R	T	373	395
PSM	SGMDAALDDLIDTLGGPEETEEENTTYTGPEVSDPMSSTYIEELGKR	628	sp|P20810|ICAL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44		ms_run[1]:scan=2869	15.54368	4	5062.2557	5062.2589	K	E	151	198
PSM	ALDLFSDNAPPPELLEIINEDIAKR	629	sp|Q15084|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44		ms_run[1]:scan=1608	8.7275594	3	2792.467119	2792.459626	R	T	265	290
PSM	AGWNAYIDNLMADGTCQDAAIVGYK	630	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=3533	19.183317	3	2758.2397	2758.2362	M	D	2	27
PSM	RNDFQLIGIQDGYLSLLQDSGEVR	631	sp|P63241|IF5A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44		ms_run[1]:scan=7241	39.702354	3	2734.395997	2735.387858	K	E	86	110
PSM	EVAAFAQFGSDLDAATQQLLSR	632	sp|P25705|ATPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44		ms_run[1]:scan=2117	11.469553	3	2337.162696	2337.160090	R	G	442	464
PSM	MVNPTVFFDIAVDGEPLGR	633	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44	1-UNIMOD:1	ms_run[1]:scan=7594	41.671355	2	2119.0502	2118.0452	-	V	1	20
PSM	CSLEMIDHIVGNQPDQEMVSASEWYLK	634	sp|P32754|HPPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=631	3.4026883	3	3161.4182	3161.4139	K	N	176	203
PSM	AGTGLVAGEVVVDALPYFDQGYEAPGVR	635	sp|O75934|SPF27_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44	1-UNIMOD:1	ms_run[1]:scan=6000	32.754105	3	2891.4360	2891.4336	M	E	2	30
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	636	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44	27-UNIMOD:4	ms_run[1]:scan=9248	50.626911	3	3514.688009	3512.695593	R	R	85	117
PSM	AALAGGTTMIIDHVVPEPGTSLLAAFDQWR	637	sp|Q16555|DPYL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44		ms_run[1]:scan=223	1.2262081	3	3138.613547	3136.601556	K	E	95	125
PSM	SLYALFSQFGHVVDIVALK	638	sp|P08579|RU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44		ms_run[1]:scan=5124	27.910719	2	2107.160116	2106.151363	R	T	26	45
PSM	IPVIENLGATLDQFDAIDFSDNEIR	639	sp|P09661|RU2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44		ms_run[1]:scan=1856	10.064037	3	2803.405289	2804.386855	K	K	31	56
PSM	AFADALEVIPMALSENSGMNPIQTMTEVR	640	sp|P48643|TCPE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44	11-UNIMOD:35	ms_run[1]:scan=6930	37.960049	3	3153.508888	3150.503558	R	A	450	479
PSM	AFADALEVIPMALSENSGMNPIQTMTEVR	641	sp|P48643-2|TCPE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=6774	37.066	3	3134.5086	3134.5086	R	A	357	386
PSM	AIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPK	642	sp|P52292|IMA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=3463	18.797	3	3351.7926	3351.7926	R	T	316	349
PSM	ALDLFSDNAPPPELLEIINEDIAK	643	sp|Q15084-3|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=6536	35.742	3	2636.3585	2636.3585	R	R	262	286
PSM	ALDLFSDNAPPPELLEIINEDIAK	644	sp|Q15084-3|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=6261	34.206	2	2636.3585	2636.3585	R	R	262	286
PSM	ALINADELASDVAGAEALLDR	645	sp|Q13813-3|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=1768	9.6137	3	2126.0855	2126.0855	K	H	382	403
PSM	ALMLQGVDLLADAVAVTMGPK	646	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43	3-UNIMOD:35	ms_run[2]:scan=5008	27.248	2	2128.1272	2128.1272	R	G	38	59
PSM	ATGATQQDANASSLLDIYSFWLNR	647	sp|Q14978-3|NOLC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=2368	12.829	3	2641.2772	2641.2772	K	S	37	61
PSM	ATGATQQDANASSLLDIYSFWLNR	648	sp|Q14978-3|NOLC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=2370	12.84	2	2641.2772	2641.2772	K	S	37	61
PSM	DFLLPFLEEPMDTEADLQFRPR	649	sp|O43242|PSMD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=1256	6.8145	3	2678.305	2678.3050	R	T	129	151
PSM	DKLDTLVDFPINDLDMSEFLINPNAGPCR	650	sp|Q9Y4E8-2|UBP15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43	28-UNIMOD:4	ms_run[2]:scan=3056	16.579	3	3318.5901	3318.5901	R	Y	817	846
PSM	DNEDGPQHTVAAVDLLVPGVGELFGGGLR	651	sp|Q96I59-2|SYNM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=1777	9.6617	3	2931.4726	2931.4726	R	E	153	182
PSM	DVLIQGLIDENPGLQLIIR	652	sp|P78527-2|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=3137	17.021	2	2118.2049	2118.2049	K	N	2504	2523
PSM	DVPFSVVYFPLFANLNQLGRPASEEK	653	sp|Q9H936|GHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=4703	25.574	3	2936.5072	2936.5072	R	S	197	223
PSM	EALAQTVLAEVPTQLVSYFR	654	sp|Q99829|CPNE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=3869	21.016	2	2234.1947	2234.1947	R	A	495	515
PSM	EALKDEYDDLSDLTAAQQETLSDWESQFTFK	655	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=1427	7.7299	4	3622.6475	3622.6475	K	Y	133	164
PSM	EKVETELQGVCDTVLGLLDSHLIK	656	sp|P31947|1433S_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43	11-UNIMOD:4	ms_run[2]:scan=4360	23.727	4	2695.4102	2695.4102	R	E	86	110
PSM	EKVETELQGVCDTVLGLLDSHLIK	657	sp|P31947|1433S_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43	11-UNIMOD:4	ms_run[2]:scan=4459	24.266	4	2695.4102	2695.4102	R	E	86	110
PSM	ESHPATVFILFSDLNPLVTLGGNK	658	sp|Q9BQG2-2|NUD12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=5076	27.639	3	2568.3588	2568.3588	K	E	125	149
PSM	FSGNLLVSLLGTWSDTSSGGPAR	659	sp|P61619-3|S61A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=4017	21.841	2	2321.1652	2321.1652	R	A	192	215
PSM	GGAAGGGYSQVIPMEEFNLHLTGDIHAITAANNLVAAAIDAR	660	sp|P11586|C1TC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=2770	15.016	4	4205.0964	4205.0964	K	I	422	464
PSM	GGAAGGGYSQVIPMEEFNLHLTGDIHAITAANNLVAAAIDAR	661	sp|P11586|C1TC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=2973	16.123	4	4205.0964	4205.0964	K	I	422	464
PSM	GHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYK	662	sp|P04179-4|SODM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43	8-UNIMOD:4	ms_run[2]:scan=5256	28.626	3	4292.1728	4292.1728	R	N	111	149
PSM	GNGPLPLGGSGLMEEMSALLAR	663	sp|Q8N8S7-3|ENAH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=2570	13.917	2	2169.0922	2169.0922	R	R	396	418
PSM	GVFHGIENFINEASYMSILGMTPGFGDK	664	sp|P00367-2|DHE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=5021	27.324	3	3030.4256	3030.4256	R	T	108	136
PSM	HDQDRDGALSPVELQSLFSVFPAAPWGPELPR	665	sp|Q8IXI1|MIRO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=1972	10.666	4	3530.7583	3530.7583	K	T	316	348
PSM	HVTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDILAK	666	sp|Q16836|HCDH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=2074	11.23	4	3611.9345	3611.9345	K	S	29	66
PSM	IFELGLGDDDGNLEEDFITWR	667	sp|P16435|NCPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=510	2.7482	2	2453.1387	2453.1387	R	E	200	221
PSM	IFELGLGDDDGNLEEDFITWR	668	sp|P16435|NCPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=478	2.5884	3	2453.1387	2453.1387	R	E	200	221
PSM	IGWSLTTSGMLLGEEEFSYGYSLK	669	sp|Q00839-2|HNRPU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=7496	41.133	2	2667.2778	2667.2778	R	G	342	366
PSM	IHVLPIDDTVEGITGNLFEVYLK	670	sp|P55072|TERA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=1912	10.341	3	2584.3789	2584.3789	R	P	114	137
PSM	IPNFWVTTFVNHPQVSALLGEEDEEALHYLTR	671	sp|Q01105-3|SET_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=687	3.7134	3	3724.8526	3724.8526	K	V	66	98
PSM	IQVTPPGFQLVFLPFADDK	672	sp|P12956-2|XRCC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=684	3.6968	2	2131.1354	2131.1354	K	R	384	403
PSM	ISIPVDISDSDMMLNIINSSITTK	673	sp|P49368-2|TCPG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=2348	12.724	2	2606.3183	2606.3183	K	A	102	126
PSM	KASFEEASNQLINHIEQFLDTNETPYFMK	674	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=6609	36.149	4	3443.6344	3443.6344	K	S	606	635
PSM	KPLVIIAEDVDGEALSTLVLNR	675	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=2989	16.211	3	2364.3264	2364.3264	R	L	269	291
PSM	LCYVALDFEQEMATAASSSSLEK	676	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43	2-UNIMOD:4	ms_run[2]:scan=9371	51.237	2	2549.1666	2549.1666	K	S	216	239
PSM	LFGFKEDPFVFIPEDDPLFPPIEK	677	sp|Q08J23-3|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=3239	17.559	3	2835.4411	2835.4411	K	F	276	300
PSM	LRDPEVVASELGYVFQAITLTR	678	sp|P06132|DCUP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=3402	18.452	3	2476.3326	2476.3326	R	Q	121	143
PSM	LSIMTSENHLNNSDKEVDEVDAALSDLEITLEGGK	679	sp|Q96AC1-2|FERM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=888	4.8104	4	3785.8153	3785.8153	K	T	327	362
PSM	LTLDLTVLLGVLQGQQQSLQQGAHSTGSSR	680	sp|Q9BQG0|MBB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=2647	14.333	3	3134.6684	3134.6684	K	L	1101	1131
PSM	LVNLYGLLHGLQAAVAQQDTLMEAR	681	sp|Q92974-3|ARHG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=6408	35.018	3	2723.4429	2723.4429	R	F	714	739
PSM	MVYSTCSLNPIEDEAVIASLLEK	682	sp|Q08J23-3|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43	6-UNIMOD:4	ms_run[2]:scan=993	5.3494	3	2581.2655	2581.2655	R	S	80	103
PSM	NAVTQFVSSMSASADVLALAK	683	sp|P47985|UCRI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=528	2.844	2	2109.0776	2109.0776	K	I	131	152
PSM	NLNPEDIDQLITISGMVIR	684	sp|P33991|MCM4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=145	0.78891	2	2140.1198	2140.1198	R	T	273	292
PSM	SKDDQVTVIGAGVTLHEALAAAELLK	685	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=7292	39.985	3	2648.4385	2648.4385	K	K	498	524
PSM	SLPLCLQLYAPGLSPDTIMECAMGDR	686	sp|P13284|GILT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43	5-UNIMOD:4,21-UNIMOD:4	ms_run[2]:scan=706	3.8157	3	2907.3639	2907.3639	R	G	158	184
PSM	SLQDIIAILGMDELSEEDKLTVSR	687	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=5478	29.874	3	2674.3735	2674.3735	K	A	433	457
PSM	SLQDIIAILGMDELSEEDKLTVSR	688	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=5587	30.473	3	2674.3735	2674.3735	K	A	433	457
PSM	SLQDIIAILGMDELSEEDKLTVSR	689	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=5695	31.057	3	2674.3735	2674.3735	K	A	433	457
PSM	SLTGVVNAQALTSAFSPHTKPWIGLAEALGTLMR	690	sp|O43175|SERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=6743	36.891	4	3536.8814	3536.8814	K	A	311	345
PSM	STTTIGLVQALGAHLYQNVFACVR	691	sp|P11586|C1TC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43	22-UNIMOD:4	ms_run[2]:scan=3291	17.836	3	2618.3639	2618.3639	K	Q	387	411
PSM	SVENLATATTTLTSLAQLLGK	692	sp|Q96S52-2|PIGS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=1435	7.7713	2	2131.1736	2131.1736	R	I	423	444
PSM	TEIQQQSALSLLNGTFDFQNDFLR	693	sp|P08240-2|SRPRA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=439	2.3977	3	2784.3719	2784.3719	R	L	68	92
PSM	TISSSLAVVDLIDAIQPGCINYDLVK	694	sp|P13797-3|PLST_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43	19-UNIMOD:4	ms_run[2]:scan=4328	23.546	2	2803.4677	2803.4677	K	S	503	529
PSM	TLVLSNLSYSATEETLQEVFEK	695	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=7434	40.785	2	2500.2585	2500.2585	K	A	487	509
PSM	TQTSDPAMLPTMIGLLAEAGVR	696	sp|O43175|SERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=3093	16.784	2	2271.1603	2271.1603	R	L	470	492
PSM	TVYALPTIAFAFVCHPSVLPIYSELK	697	sp|Q9H2H9|S38A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43	14-UNIMOD:4	ms_run[2]:scan=3073	16.675	3	2935.5558	2935.5558	K	D	275	301
PSM	VFIMDNCEELIPEYLNFIR	698	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43	7-UNIMOD:4	ms_run[2]:scan=1201	6.5131	2	2414.165	2414.1650	R	G	368	387
PSM	VFIMDSCDELIPEYLNFIR	699	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43	7-UNIMOD:4	ms_run[2]:scan=1927	10.416	2	2373.1385	2373.1385	R	G	360	379
PSM	WLPAGDALLQMITIHLPSPVTAQK	700	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=5481	29.887	4	2599.4196	2599.4196	R	Y	343	367
PSM	YALQMEQLNGILLHLESELAQTR	701	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=7468	40.969	3	2669.3847	2669.3847	R	A	331	354
PSM	YNVYPTYDFACPIVDSIEGVTHALR	702	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43	11-UNIMOD:4	ms_run[2]:scan=1732	9.4165	3	2899.3851	2899.3851	K	T	371	396
PSM	CPEALFQPSFLGMESCGIHETTFNSIMK	703	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43	1-UNIMOD:4,16-UNIMOD:4	ms_run[1]:scan=7213	39.549745	3	3230.447125	3230.454500	R	C	257	285
PSM	GILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVK	704	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43		ms_run[1]:scan=6732	36.826952	4	4035.893340	4035.887504	K	L	272	310
PSM	SGETEDTFIADLVVGLCTGQIK	705	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43	17-UNIMOD:4	ms_run[1]:scan=5135	27.972565	2	2352.151258	2352.151893	R	T	373	395
PSM	SGETEDTFIADLVVGLCTGQIK	706	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43	17-UNIMOD:4	ms_run[1]:scan=4931	26.809585	2	2352.151258	2352.151893	R	T	373	395
PSM	SGETEDTFIADLVVGLCTGQIK	707	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43	17-UNIMOD:4	ms_run[1]:scan=4535	24.669159	2	2352.151258	2352.151893	R	T	373	395
PSM	SGETEDTFIADLVVGLCTGQIK	708	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43	17-UNIMOD:4	ms_run[1]:scan=4834	26.266208	2	2352.151258	2352.151893	R	T	373	395
PSM	SGETEDTFIADLVVGLCTGQIK	709	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43	17-UNIMOD:4	ms_run[1]:scan=5029	27.369214	2	2352.151258	2352.151893	R	T	373	395
PSM	TISSSLAVVDLIDAIQPGCINYDLVK	710	sp|P13797|PLST_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43	19-UNIMOD:4	ms_run[1]:scan=4358	23.715371	3	2804.475483	2803.467748	K	S	548	574
PSM	EGIPVMRPLWVQYPQDVTTFNIDDQYLLGDALLVHPVSDSGAHGVQVYLPGQGEVWYDIQSYQK	711	sp|Q14697|GANAB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43		ms_run[1]:scan=5033	27.391744	5	7243.5592	7243.5702	R	H	721	785
PSM	GGLGGGYGGASGMGGITAVTVNQSLLSPLVLEVDPNIQAVR	712	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43	13-UNIMOD:35	ms_run[1]:scan=368	2.0271897	3	3941.067152	3940.036417	R	T	48	89
PSM	IIYLNQLLQEDSLNVADLTSLR	713	sp|Q9UL46|PSME2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43		ms_run[1]:scan=979	5.2755954	3	2530.372786	2530.364269	K	A	40	62
PSM	GTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVK	714	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43		ms_run[1]:scan=4233	23.011271	3	4147.984029	4147.984364	K	S	287	323
PSM	GTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVK	715	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43		ms_run[1]:scan=4327	23.54079	3	4147.984029	4147.984364	K	S	287	323
PSM	RGIHSAIDASQTPDVVFASILAAFSK	716	sp|P54819|KAD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43		ms_run[1]:scan=1644	8.9272597	3	2700.431326	2700.423515	K	A	204	230
PSM	TDALQPPHEYVPWVTVNGKPLEDQTQLLTLVCQLYQGK	717	sp|P13284|GILT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43	32-UNIMOD:4	ms_run[1]:scan=2312	12.530478	4	4379.218027	4378.230760	R	K	195	233
PSM	SHFGGPDYEEGPNSLINEEEFFDAVEAALDR	718	sp|Q9Y5P4|CERT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43		ms_run[1]:scan=3640	19.769067	3	3454.536040	3453.527324	K	Q	302	333
PSM	EMQEVETNLQEVVFDYLHATAYQNTALGR	719	sp|O75439|MPPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43		ms_run[1]:scan=3919	21.302487	3	3368.596981	3368.598321	R	T	181	210
PSM	LIESLSQMLSMGFSDEGGWLTR	720	sp|Q13501|SQSTM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43		ms_run[1]:scan=5035	27.403008	2	2456.162038	2456.171582	R	L	394	416
PSM	ASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGK	721	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43	45-UNIMOD:4,48-UNIMOD:4	ms_run[1]:scan=4546	24.727753	6	5806.8886	5806.8792	R	I	13	68
PSM	AEEGIAAGGVMDVNTALQEVLK	722	sp|P25398|RS12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43	1-UNIMOD:1	ms_run[1]:scan=4623	25.138322	2	2256.1309	2256.1302	M	T	2	24
PSM	AEEGIAAGGVMDVNTALQEVLK	723	sp|P25398|RS12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43	1-UNIMOD:1	ms_run[1]:scan=4722	25.678749	2	2256.1309	2256.1302	M	T	2	24
PSM	EFVEEFIWPAIQSSALYEDR	724	sp|P00966|ASSY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43		ms_run[1]:scan=146	0.7945578	2	2429.162449	2428.158693	R	Y	67	87
PSM	AFADAMEVIPSTLAENAGLNPISTVTELR	725	sp|P50991|TCPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43	6-UNIMOD:35	ms_run[1]:scan=1533	8.2986823	3	3046.5672	3045.5322	R	N	453	482
PSM	QLTEMLPSILNQLGADSLTSLR	726	sp|P20290|BTF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43		ms_run[1]:scan=3666	19.898242	3	2399.269545	2399.273011	K	R	142	164
PSM	HYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVK	727	sp|Q9P2T1|GMPR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43	17-UNIMOD:4	ms_run[1]:scan=4620	25.125084	4	5156.4462	5156.4457	K	Y	79	125
PSM	EIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSER	728	sp|Q15293|RCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43		ms_run[1]:scan=7156	39.226193	4	5193.3499	5193.3556	K	E	205	250
PSM	NLSPYVSNELLEEAFSQFGPIER	729	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43		ms_run[1]:scan=1742	9.4726558	2	2638.291812	2638.291498	R	A	377	400
PSM	GQGVYLGMPGCLPVYDALAGEFIR	730	sp|P30040|ERP29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43	11-UNIMOD:4	ms_run[1]:scan=112	0.60176807	2	2583.268406	2582.266152	K	A	147	171
PSM	SIIFASWSAGDFGSVGATEWLEGYLSSLHLK	731	sp|P02786|TFR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43		ms_run[1]:scan=7567	41.519046	3	3327.623481	3327.645195	R	A	447	478
PSM	AAGVCLMLLATCCEDDIVPHVLPFIK	732	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42	5-UNIMOD:4,12-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=601	3.2376	3	2941.4574	2941.4574	K	E	202	228
PSM	AAYSFYNVHTQTPLLDLMSDALVLAK	733	sp|P30419-2|NMT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=6177	33.756	3	2880.4732	2880.4732	K	M	338	364
PSM	AEDYPIDLYYLMDLSYSMKDDLENVK	734	sp|P05556-2|ITB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=7049	38.628	3	3142.4403	3142.4403	R	S	138	164
PSM	AENNPWVTPIADQFQLGVSHVFEYIR	735	sp|Q15404|RSU1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=5450	29.715	3	3029.5036	3029.5036	K	S	213	239
PSM	APELLFRPDLIGEESEGIHEVLVFAIQK	736	sp|P61163|ACTZ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=3419	18.548	3	3148.6809	3148.6809	R	S	258	286
PSM	AQHIVPCTISQLLSATLVDEVFR	737	sp|P15927|RFA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42	7-UNIMOD:4	ms_run[2]:scan=2807	15.224	3	2596.3683	2596.3683	R	I	43	66
PSM	DAFEHIVTQFSSVPVSVVSDSYDIYNACEK	738	sp|P43490|NAMPT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42	28-UNIMOD:4	ms_run[2]:scan=742	4.019	3	3405.5711	3405.5711	K	I	260	290
PSM	DIEQVPQQPTYVQALFDFDPQEDGELGFR	739	sp|P62993-2|GRB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=2697	14.609	3	3380.5837	3380.5837	R	R	109	138
PSM	DNTIEHLLPLFLAQLKDECPEVR	740	sp|P30153|2AAA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42	19-UNIMOD:4	ms_run[2]:scan=898	4.866	3	2749.4109	2749.4109	K	L	359	382
PSM	DQIAYSDTSPFLILSEASLADLNSR	741	sp|Q5VT66-3|MARC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=4440	24.169	2	2725.3447	2725.3447	K	L	101	126
PSM	EATTLANGVLASLNLPAAIEDVSGDTVPQSILTK	742	sp|Q8WUM4|PDC6I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=7344	40.279	3	3407.8035	3407.8035	R	S	387	421
PSM	ECLEDVTAVCILEGFQNQQSMLLADK	743	sp|O94826|TOM70_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42	2-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=679	3.6698	3	3010.4086	3010.4086	K	V	205	231
PSM	EFLPILQEEPLPPLALVPFTEEEQR	744	sp|Q6Y7W6-4|GGYF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=7193	39.435	3	2933.5426	2933.5426	K	N	66	91
PSM	EMYTLGITNFPIPGEPGFPLNAIYAK	745	sp|O15145|ARPC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=1469	7.9547	3	2852.4459	2852.4459	K	P	94	120
PSM	ENPVVPIGCLATAAALTYGLYSFHR	746	sp|Q9BW72|HIG2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42	9-UNIMOD:4	ms_run[2]:scan=1010	5.4437	3	2719.3792	2719.3792	R	G	45	70
PSM	ESHPATVFILFSDLNPLVTLGGNK	747	sp|Q9BQG2-2|NUD12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=5023	27.335	3	2568.3588	2568.3588	K	E	125	149
PSM	EVAAFAQFGSDLDAATQQLLSR	748	sp|P25705-2|ATPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=2071	11.214	2	2337.1601	2337.1601	R	G	392	414
PSM	EVAAFAQFGSDLDAATQQLLSR	749	sp|P25705-2|ATPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=2197	11.906	2	2337.1601	2337.1601	R	G	392	414
PSM	FDLGQDVIDFTGHALALYR	750	sp|P50395|GDIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=2686	14.548	2	2150.0797	2150.0797	K	T	175	194
PSM	FLVLDEADGLLSQGYSDFINR	751	sp|Q92499-2|DDX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=4922	26.759	3	2371.1696	2371.1696	R	M	350	371
PSM	FSQQQSFVQILQEVNDFAGQR	752	sp|Q15642-5|CIP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=110	0.59293	3	2468.2084	2468.2084	K	E	67	88
PSM	FSQQQSFVQILQEVNDFAGQR	753	sp|Q15642-5|CIP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=118	0.63555	2	2468.2084	2468.2084	K	E	67	88
PSM	GFLFGPSLAQELGLGCVLIR	754	sp|P07741-2|APT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42	16-UNIMOD:4	ms_run[2]:scan=4954	26.941	3	2146.1609	2146.1609	R	K	68	88
PSM	GPQLAAQNLGISLANLLLSK	755	sp|P08397-4|HEM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=1880	10.182	2	2020.1681	2020.1681	R	G	269	289
PSM	HLPNLLDETQIFSYFSQFGTVTR	756	sp|Q9BYG3|MK67I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=3283	17.794	3	2712.3548	2712.3548	R	F	51	74
PSM	HLSCVLSGLIADLDALDVCGR	757	sp|Q9UL15|BAG5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42	4-UNIMOD:4,19-UNIMOD:4	ms_run[2]:scan=2337	12.668	3	2283.1351	2283.1351	R	T	215	236
PSM	HSTIYPSPEELEAVQNMVSTVECALK	758	sp|Q96SI9-2|STRBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42	23-UNIMOD:4	ms_run[2]:scan=5681	30.979	3	2931.3994	2931.3994	K	H	4	30
PSM	HSTIYPSPEELEAVQNMVSTVECALK	759	sp|Q96SI9-2|STRBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42	23-UNIMOD:4	ms_run[2]:scan=5778	31.524	3	2931.3994	2931.3994	K	H	4	30
PSM	ICPVETLVEEAIQCAEK	760	sp|P30084|ECHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42	2-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=585	3.1511	2	1987.9595	1987.9595	K	I	212	229
PSM	ICPVETLVEEAIQCAEK	761	sp|P30084|ECHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42	2-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=685	3.7021	2	1987.9595	1987.9595	K	I	212	229
PSM	IFELGLGDDDGNLEEDFITWR	762	sp|P16435|NCPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=405	2.2251	2	2453.1387	2453.1387	R	E	200	221
PSM	IHESAGLPFFEIFVDAPLNICESR	763	sp|O95340|PAPS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42	21-UNIMOD:4	ms_run[2]:scan=3085	16.738	3	2760.3581	2760.3581	K	D	135	159
PSM	ILTVEDHYYEGGIGEAVSSAVVGEPGITVTHLAVNR	764	sp|P29401|TKT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=7073	38.765	4	3751.9057	3751.9057	R	V	556	592
PSM	IQDLPPVDLSLVNKDENAIYFLGNSLGLQPK	765	sp|Q16719-2|KYNU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=608	3.2772	3	3409.8133	3409.8133	K	M	51	82
PSM	ISIPVDISDSDMMLNIINSSITTK	766	sp|P49368-2|TCPG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=2240	12.15	2	2606.3183	2606.3183	K	A	102	126
PSM	LCYVALDFEQEMATAASSSSLEK	767	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42	2-UNIMOD:4	ms_run[2]:scan=7169	39.3	3	2549.1666	2549.1666	K	S	216	239
PSM	LCYVALDFEQEMATAASSSSLEK	768	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42	2-UNIMOD:4	ms_run[2]:scan=7362	40.375	3	2549.1666	2549.1666	K	S	216	239
PSM	LEAAGGPSALNFDSPSSLFESLISPIK	769	sp|Q8IUF8-2|RIOX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=5771	31.484	3	2746.4065	2746.4065	K	T	24	51
PSM	LGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLK	770	sp|O00487|PSDE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=6071	33.158	3	3322.7119	3322.7119	R	M	7	41
PSM	LSTCEAEDIATYEQNLQQWHLDLVQLIQR	771	sp|Q92552|RT27_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42	4-UNIMOD:4	ms_run[2]:scan=3716	20.166	3	3513.7198	3513.7198	K	E	364	393
PSM	MLAEDELRDAVLLVFANK	772	sp|P84077|ARF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=3920	21.305	3	2046.082	2046.0820	R	Q	110	128
PSM	NIAPHTVVDSIMTALSPYASLAVNNIR	773	sp|P52756|RBM5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=6555	35.851	3	2866.5011	2866.5011	R	L	237	264
PSM	NSSLAEFVQSLSQTMGFPQDQIR	774	sp|Q93009-3|UBP7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=7163	39.268	3	2582.2435	2582.2435	K	L	583	606
PSM	NVGCLQEALQLATSFAQLR	775	sp|P49588|SYAC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42	4-UNIMOD:4	ms_run[2]:scan=4332	23.569	2	2118.0892	2118.0892	K	L	944	963
PSM	QEGCQDIATQLISNMDIDVILGGGR	776	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42	4-UNIMOD:4	ms_run[2]:scan=4007	21.79	2	2702.3004	2702.3004	R	K	199	224
PSM	QGLLEFVDITATNHTNEIQDYLQQLTGAR	777	sp|P35754|GLRX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=5396	29.407	3	3287.6422	3287.6422	K	T	40	69
PSM	QYEQQTYQVIPEVIKNFIQYFHK	778	sp|Q9Y262-2|EIF3L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=7306	40.064	4	2942.4967	2942.4967	R	T	39	62
PSM	RGIHSAIDASQTPDVVFASILAAFSK	779	sp|P54819-6|KAD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=1579	8.559	4	2700.4235	2700.4235	K	A	156	182
PSM	RLFAQLAGDDMEVSATELMNILNK	780	sp|P04632|CPNS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=832	4.521	3	2678.3408	2678.3408	R	V	103	127
PSM	SFAPILPHLAEEVFQHIPYIK	781	sp|Q9NSE4|SYIM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=1973	10.672	3	2448.3206	2448.3206	R	E	833	854
PSM	SKDDQVTVIGAGVTLHEALAAAELLK	782	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=7172	39.317	4	2648.4385	2648.4385	K	K	498	524
PSM	SLRDDYEVSCPELDQLVEAALAVPGVYGSR	783	sp|P51570|GALK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42	10-UNIMOD:4	ms_run[2]:scan=4560	24.8	3	3307.6031	3307.6031	R	M	313	343
PSM	SNVKPNSGELDPLYVVEVLLR	784	sp|P42285|MTREX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=3425	18.581	3	2340.2689	2340.2689	K	C	681	702
PSM	SNVKPNSGELDPLYVVEVLLR	785	sp|P42285|MTREX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=3522	19.123	3	2340.2689	2340.2689	K	C	681	702
PSM	SSRPEFDWQDPLVLEEQLTTDEILIR	786	sp|Q92947-2|GCDH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=345	1.9058	3	3128.5666	3128.5666	K	D	43	69
PSM	TEGDETGVMDNLLEALQSGAAFR	787	sp|Q9NSV4-1|DIAP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=5581	30.439	2	2423.1275	2423.1275	K	D	791	814
PSM	TVEELLETGLIQVATKEEELNAIR	788	sp|Q86UP2-2|KTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=3977	21.629	2	2697.4436	2697.4436	K	T	746	770
PSM	VETELQGVCDTVLGLLDSHLIK	789	sp|P31947|1433S_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42	9-UNIMOD:4	ms_run[2]:scan=6028	32.916	3	2438.2727	2438.2727	K	E	88	110
PSM	VGQYVVDLTSFEQLALPVLR	790	sp|Q9BSD7|NTPCR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=4866	26.445	2	2246.2311	2246.2311	R	N	78	98
PSM	VPAFEGDDGFCVFESNAIAYYVSNEELR	791	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42	11-UNIMOD:4	ms_run[2]:scan=1960	10.596	3	3197.4288	3197.4288	K	G	58	86
PSM	VPSTEAEALASSLMGLFEK	792	sp|P50395|GDIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=6523	35.666	2	1978.9921	1978.9921	K	R	119	138
PSM	VSEPLLWELFLQAGPVVNTHMPK	793	sp|Q15427|SF3B4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=2235	12.122	3	2604.3774	2604.3774	K	D	24	47
PSM	VTGQHPEVPPAFWNNAFTLLSAVSLPR	794	sp|Q9BVI4|NOC4L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=3101	16.828	3	2947.5345	2947.5345	R	R	195	222
PSM	VWAEPCLIDAAKEEYNGVIEEFLATGEK	795	sp|Q9H4A4|AMPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42	6-UNIMOD:4	ms_run[2]:scan=6344	34.66	3	3180.5325	3180.5325	R	L	249	277
PSM	WLPAGDALLQMITIHLPSPVTAQK	796	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=5282	28.773	3	2599.4196	2599.4196	R	Y	343	367
PSM	WLPAGDALLQMITIHLPSPVTAQK	797	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=5381	29.33	3	2599.4196	2599.4196	R	Y	343	367
PSM	WLPAGDALLQMITIHLPSPVTAQK	798	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=5480	29.882	3	2599.4196	2599.4196	R	Y	343	367
PSM	WLPAGDALLQMITIHLPSPVTAQK	799	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=5384	29.342	4	2599.4196	2599.4196	R	Y	343	367
PSM	WYQADSPPADLLLTEEEFLSFLHPEHSR	800	sp|Q9BRK5-2|CAB45_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=6473	35.384	4	3326.5884	3326.5884	R	G	101	129
PSM	YAVDDVPFSIPAASEIADLSNIINK	801	sp|Q9GZL7|WDR12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=3923	21.322	3	2661.3538	2661.3538	K	L	15	40
PSM	LCYVALDFEQEMATAASSSSLEK	802	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42	2-UNIMOD:4	ms_run[1]:scan=9266	50.717913	2	2551.165867	2549.166557	K	S	216	239
PSM	YAPTEAQLNAVDALIDSMSLAK	803	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42		ms_run[1]:scan=106	0.57048067	3	2321.168112	2320.162064	K	K	444	466
PSM	DMAIATGGAVFGEEGLTLNLEDVQPHDLGK	804	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42		ms_run[1]:scan=9242	50.594873	3	3098.512271	3096.507381	K	V	315	345
PSM	SKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICR	805	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42	36-UNIMOD:4,49-UNIMOD:4	ms_run[1]:scan=7039	38.572695	5	5731.7102	5731.7156	K	R	165	215
PSM	GVPQIEVTFDIDANGILNVSAVDK	806	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42		ms_run[1]:scan=7376	40.453941	3	2513.297096	2513.301334	R	S	470	494
PSM	QVEDLQATFSSIHSFQDLSSSILAQSR	807	sp|O60664|PLIN3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42	1-UNIMOD:28	ms_run[1]:scan=4672	25.407299	3	2976.4500	2976.4460	R	E	365	392
PSM	MVNPTVFFDIAVDGEPLGR	808	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=5216	28.411538	2	2134.0403	2134.0400	-	V	1	20
PSM	CLGIPNTAHFANVTQIEDAVSLWAK	809	sp|Q12874|SF3A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=4805	26.123781	2	2737.3542	2737.3529	R	L	437	462
PSM	NLEALALDLMEPEQAVDLTLPK	810	sp|P12956|XRCC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42		ms_run[1]:scan=4523	24.605603	3	2422.266795	2422.266529	R	V	489	511
PSM	NNNIDAAIENIENMLTSENK	811	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42		ms_run[1]:scan=2334	12.651884	2	2246.048566	2246.048490	K	V	1190	1210
PSM	NNNIDAAIENIENMLTSENK	812	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42		ms_run[1]:scan=2237	12.133168	2	2246.048566	2246.048490	K	V	1190	1210
PSM	QGLNGVPILSEEELSLLDEFYK	813	sp|Q14444|CAPR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42		ms_run[1]:scan=3280	17.778704	2	2492.268835	2492.268637	K	L	170	192
PSM	ASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGK	814	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42	45-UNIMOD:4,48-UNIMOD:4	ms_run[1]:scan=4745	25.796689	6	5806.8886	5806.8792	R	I	13	68
PSM	AEEGIAAGGVMDVNTALQEVLK	815	sp|P25398|RS12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42	1-UNIMOD:1	ms_run[1]:scan=4416	24.037665	2	2256.1309	2256.1302	M	T	2	24
PSM	AEEGIAAGGVMDVNTALQEVLK	816	sp|P25398|RS12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42	1-UNIMOD:1	ms_run[1]:scan=4823	26.208887	2	2256.1309	2256.1302	M	T	2	24
PSM	ASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGK	817	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42	36-UNIMOD:35,45-UNIMOD:4,48-UNIMOD:4	ms_run[1]:scan=1873	10.143104	5	5822.8757	5822.8741	R	I	13	68
PSM	AAELFHQLSQALEVLTDAAAR	818	sp|Q9NVM6|DJC17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=7331	40.206	3	2253.1753	2253.1753	R	A	49	70
PSM	ADIIVSELLGSFADNELSPECLDGAQHFLK	819	sp|O14744-4|ANM5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41	21-UNIMOD:4	ms_run[2]:scan=2720	14.741	3	3287.602	3287.6020	K	D	258	288
PSM	AGAAPYVQAFDSLLAGPVAEYLK	820	sp|Q01518|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=7326	40.181	3	2350.2209	2350.2209	K	I	38	61
PSM	AHQNTLEVYPPFLFFLAVGGVYHPR	821	sp|O14880|MGST3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=2935	15.91	4	2871.4861	2871.4861	R	I	60	85
PSM	AHQNTLEVYPPFLFFLAVGGVYHPR	822	sp|O14880|MGST3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=3457	18.764	4	2871.4861	2871.4861	R	I	60	85
PSM	ALDLFSDNAPPPELLEIINEDIAK	823	sp|Q15084-3|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=6240	34.093	3	2636.3585	2636.3585	R	R	262	286
PSM	ALMLQGVDLLADAVAVTMGPK	824	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41	18-UNIMOD:35	ms_run[2]:scan=790	4.2836	2	2128.1272	2128.1272	R	G	38	59
PSM	ALSFLGFSAPTPIQALTLAPAIR	825	sp|Q9GZR7|DDX24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=3592	19.509	2	2354.3362	2354.3362	R	D	206	229
PSM	AQAALQAVNSVQSGNLALAASAAAVDAGMAMAGQSPVLR	826	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=4262	23.175	3	3679.8774	3679.8774	R	I	147	186
PSM	ASFANEDGQVSPGSLLLAGAIAGMPAASLVTPADVIK	827	sp|Q9UJS0|CMC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=4053	22.038	3	3537.8389	3537.8389	K	T	509	546
PSM	DMAIATGGAVFGEEGLTLNLEDVQPHDLGK	828	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=8556	47.077	3	3096.5074	3096.5074	K	V	315	345
PSM	DQIAYSDTSPFLILSEASLADLNSR	829	sp|Q5VT66-3|MARC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=4431	24.12	3	2725.3447	2725.3447	K	L	101	126
PSM	DVPWGVDSLITLAFQDQR	830	sp|Q16658|FSCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=7442	40.826	2	2059.0375	2059.0375	R	Y	168	186
PSM	DYQFTILDVRPALDSLSAVWDR	831	sp|P53701|CCHL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=6548	35.812	3	2579.302	2579.3020	K	M	237	259
PSM	EAVQCVQELASPSLLFIFVR	832	sp|Q04637-6|IF4G1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41	5-UNIMOD:4	ms_run[2]:scan=3458	18.769	3	2305.214	2305.2140	K	H	1065	1085
PSM	FLFPFFDSAYQGFASGNLER	833	sp|P17174-2|AATC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=2921	15.833	2	2312.0902	2312.0902	R	D	196	216
PSM	FLFPFFDSAYQGFASGNLER	834	sp|P17174-2|AATC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=2953	16.008	3	2312.0902	2312.0902	R	D	196	216
PSM	FSGNLLVSLLGTWSDTSSGGPAR	835	sp|P61619-3|S61A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=3922	21.316	2	2321.1652	2321.1652	R	A	192	215
PSM	GDVTDTEQLAQEMLIISHHPSLVAVQSGLWPALLAR	836	sp|Q92616|GCN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=3035	16.461	4	3895.0302	3895.0302	K	M	658	694
PSM	GEVLPEEITEESLEESVGKPLYLIFR	837	sp|Q68E01-4|INT3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=2709	14.676	3	2975.5379	2975.5379	R	N	145	171
PSM	GLAEDIENEVVQITWNR	838	sp|Q15029-2|U5S1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=2929	15.877	2	1984.9854	1984.9854	K	K	660	677
PSM	GMYGIENEVFLSLPCILNAR	839	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41	15-UNIMOD:4	ms_run[2]:scan=1938	10.477	2	2295.1392	2295.1392	K	G	280	300
PSM	GQDMETEAHQNKLEEMINELAVAMTAVK	840	sp|Q15363|TMED2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=3292	17.842	3	3129.4781	3129.4781	K	H	118	146
PSM	GVPQIEVTFDIDANGILNVTATDK	841	sp|P0DMV8-2|HS71A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=7403	40.611	3	2529.2962	2529.2962	R	S	415	439
PSM	HFYWYLTNEGIQYLRDYLHLPPEIVPATLR	842	sp|P46783|RS10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=5209	28.376	4	3716.9144	3716.9144	R	R	66	96
PSM	HGWEELVYYTVPLIQEMESR	843	sp|O75323-2|NIPS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=5516	30.079	3	2478.1889	2478.1889	K	I	217	237
PSM	HGWEELVYYTVPLIQEMESR	844	sp|O75323-2|NIPS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=5616	30.628	3	2478.1889	2478.1889	K	I	217	237
PSM	HLPNLLDETQIFSYFSQFGTVTR	845	sp|Q9BYG3|MK67I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=3077	16.697	3	2712.3548	2712.3548	R	F	51	74
PSM	HLPNLLDETQIFSYFSQFGTVTR	846	sp|Q9BYG3|MK67I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=3181	17.263	3	2712.3548	2712.3548	R	F	51	74
PSM	ILQAVQAAEDAAGQALQQADHTWATVVR	847	sp|O15230|LAMA5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=6219	33.982	3	2960.5104	2960.5104	R	Q	2528	2556
PSM	INALTAASEAACLIVSVDETIKNPR	848	sp|Q99832-2|TCPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41	12-UNIMOD:4	ms_run[2]:scan=4088	22.22	3	2655.3902	2655.3902	R	S	296	321
PSM	IQHPSNVLHFFNAPLEVTEENFFEICDELGVK	849	sp|P14866-2|HNRPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41	26-UNIMOD:4	ms_run[2]:scan=3192	17.325	4	3771.8243	3771.8243	R	R	363	395
PSM	KDPALLSSEAVLPDLTDELAPVFLLR	850	sp|Q9Y2G8-2|DJC16_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=4839	26.294	3	2821.5477	2821.5477	R	W	175	201
PSM	KPLVIIAEDVDGEALSTLVLNR	851	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=1194	6.4712	3	2364.3264	2364.3264	R	L	269	291
PSM	LAIIHCAGYSDPILVQTLWQDIIEK	852	sp|O75694-2|NU155_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41	6-UNIMOD:4	ms_run[2]:scan=1478	8.0017	3	2895.5205	2895.5205	K	E	1144	1169
PSM	LASEILMQNWDAAMEDLTR	853	sp|P60228|EIF3E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=521	2.8047	2	2206.0398	2206.0398	K	L	173	192
PSM	LAYVAAGDLAPINAFIGGLAAQEVMK	854	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=4079	22.179	2	2602.3829	2602.3829	K	A	346	372
PSM	LAYVAAGDLAPINAFIGGLAAQEVMK	855	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=4184	22.744	2	2602.3829	2602.3829	K	A	346	372
PSM	LDNLTLMEINTSGTFLTQALNHMYK	856	sp|Q9Y248|PSF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=3431	18.615	3	2867.4198	2867.4198	K	L	145	170
PSM	LFAQLAGDDMEVSATELMNILNK	857	sp|P04632|CPNS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=7291	39.979	2	2522.2397	2522.2397	R	V	104	127
PSM	LGAGYPMGPFELLDYVGLDTTK	858	sp|Q16836|HCDH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=5513	30.062	2	2356.1661	2356.1661	K	F	250	272
PSM	LLSYQTSLVSDGETWHVMGISSLLPSLEAWK	859	sp|O43175|SERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=3264	17.696	3	3446.7432	3446.7432	R	Q	492	523
PSM	LRDPEVVASELGYVFQAITLTR	860	sp|P06132|DCUP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=3307	17.929	3	2476.3326	2476.3326	R	Q	121	143
PSM	LTAQVASLTSELTTLNATIQQQDQELAGLK	861	sp|Q14980-4|NUMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=1050	5.6638	3	3184.6827	3184.6827	R	Q	496	526
PSM	LVLEQVVTSIASVADTAEEK	862	sp|O00410-2|IPO5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=321	1.7717	3	2101.1154	2101.1154	K	F	447	467
PSM	LYYLNGIECAASAMEMSAIAAHNAALLAYHR	863	sp|Q9UHG3-2|PCYOX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41	9-UNIMOD:4	ms_run[2]:scan=743	4.0246	4	3394.6261	3394.6261	R	W	377	408
PSM	NDFQLIGIQDGYLSLLQDSGEVR	864	sp|P63241|IF5A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=7512	41.225	2	2579.2867	2579.2867	R	E	87	110
PSM	NFLTQDSADLDSIEAVANEVLK	865	sp|P07942|LAMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=5386	29.353	2	2391.1805	2391.1805	R	M	1509	1531
PSM	NLEVLNFFNNQIEELPTQISSLQK	866	sp|Q15404|RSU1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=3040	16.489	3	2817.4549	2817.4549	K	L	64	88
PSM	NNAASEGVLASFFNSLLSK	867	sp|O43237-2|DC1L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=3966	21.567	2	1967.9953	1967.9953	K	K	344	363
PSM	NPILWNVADVVIKFPEEEAPSTVLSQNLFTPK	868	sp|P04844|RPN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=5053	27.507	4	3594.8974	3594.8974	K	Q	492	524
PSM	NSSLAEFVQSLSQTMGFPQDQIR	869	sp|Q93009-3|UBP7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=7091	38.867	2	2582.2435	2582.2435	K	L	583	606
PSM	QAFQGDSIPVFDLLILGVGPDGHTCSLFPDHPLLQER	870	sp|O95336|6PGL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41	25-UNIMOD:4	ms_run[2]:scan=5162	28.127	4	4088.0466	4088.0466	R	E	132	169
PSM	QEGCQDIATQLISNMDIDVILGGGR	871	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41	4-UNIMOD:4	ms_run[2]:scan=4241	23.054	3	2702.3004	2702.3004	R	K	199	224
PSM	QEGLDGGLPEEVLFGNLDLLPPPGK	872	sp|Q8N163-2|CCAR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=641	3.4606	3	2603.3483	2603.3483	R	S	764	789
PSM	SENLDNPIQTVSLGQSLFFHFPPLLR	873	sp|Q5JPE7-3|NOMO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=3604	19.573	3	2968.5447	2968.5447	K	D	913	939
PSM	SGETEDTFIADLVVGLCTGQIK	874	sp|P06733-2|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41	17-UNIMOD:4	ms_run[2]:scan=3753	20.372	3	2352.1519	2352.1519	R	T	280	302
PSM	SGETEDTFIADLVVGLCTGQIK	875	sp|P06733-2|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41	17-UNIMOD:4	ms_run[2]:scan=3852	20.923	3	2352.1519	2352.1519	R	T	280	302
PSM	SGETEDTFIADLVVGLCTGQIK	876	sp|P06733-2|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41	17-UNIMOD:4	ms_run[2]:scan=3952	21.485	3	2352.1519	2352.1519	R	T	280	302
PSM	SGNYTVLQVVEALGSSLENPEPR	877	sp|Q96T76-5|MMS19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=7354	40.333	3	2458.234	2458.2340	K	T	41	64
PSM	SLPLCLQLYAPGLSPDTIMECAMGDR	878	sp|P13284|GILT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41	5-UNIMOD:4,21-UNIMOD:4	ms_run[2]:scan=613	3.3052	3	2907.3639	2907.3639	R	G	158	184
PSM	SLSALGNVISALAEGSTYVPYR	879	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=1356	7.3645	2	2267.1798	2267.1798	K	D	257	279
PSM	TAAFLLPILSQIYSDGPGEALR	880	sp|O00571-2|DDX3X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=6341	34.643	2	2331.2474	2331.2474	K	A	215	237
PSM	TAAFLLPILSQIYSDGPGEALR	881	sp|O00571-2|DDX3X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=6289	34.365	3	2331.2474	2331.2474	K	A	215	237
PSM	TISQLVHAFQTTEAQHLFLQAFWQTMNR	882	sp|P56182|RRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=5353	29.171	4	3345.6717	3345.6717	R	E	78	106
PSM	TITDVINIGIGGSDLGPLMVTEALKPYSSGGPR	883	sp|P06744|G6PI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=678	3.6642	4	3327.7384	3327.7384	K	V	148	181
PSM	TNLYQDDAVTGEAAGLALGLVMLGSK	884	sp|Q99460-2|PSMD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=4594	24.982	2	2606.3262	2606.3262	K	N	499	525
PSM	TVDLQDAEEAVELVQYAYFK	885	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=4732	25.73	2	2330.1318	2330.1318	K	K	636	656
PSM	TVHADLSNYDEDGAWPVLLDEFVEWQK	886	sp|Q9BTE7|DCNL5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=3482	18.901	3	3175.4775	3175.4775	R	V	206	233
PSM	VFIMDNCEELIPEYLNFIR	887	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41	7-UNIMOD:4	ms_run[2]:scan=1108	5.9917	2	2414.165	2414.1650	R	G	368	387
PSM	VFIMDSCDELIPEYLNFIR	888	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41	7-UNIMOD:4	ms_run[2]:scan=1711	9.3046	2	2373.1385	2373.1385	R	G	360	379
PSM	VFIMDSCDELIPEYLNFIR	889	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41	7-UNIMOD:4	ms_run[2]:scan=2029	10.975	2	2373.1385	2373.1385	R	G	360	379
PSM	VIFFELILDNMGEQAQEQEDWKK	890	sp|Q9Y3A6-2|TMED5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=2216	12.013	3	2809.3633	2809.3633	K	Y	119	142
PSM	VLTDSGSLDSTIPGIENTITVTTEQLTTASFPVGSK	891	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=6444	35.218	3	3678.8727	3678.8727	K	K	210	246
PSM	VLVGGGTGFIGTALTQLLNAR	892	sp|Q9NRG7|D39U1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=3636	19.747	2	2057.1633	2057.1633	R	G	3	24
PSM	VQSGLDLFSMLLEQNDLEPGHTELLR	893	sp|Q13158|FADD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=908	4.922	3	2953.4855	2953.4855	R	E	39	65
PSM	VSEPLLWELFLQAGPVVNTHMPK	894	sp|Q15427|SF3B4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=2137	11.576	3	2604.3774	2604.3774	K	D	24	47
PSM	YAQDEHLITFFVPVFEPLPPQYFIR	895	sp|O75643|U520_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=4865	26.439	3	3065.5691	3065.5691	K	V	1245	1270
PSM	YAVDDVPFSIPAASEIADLSNIINK	896	sp|Q9GZL7|WDR12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=3822	20.754	3	2661.3538	2661.3538	K	L	15	40
PSM	YLPPATQVVLISATLPHEILEMTNK	897	sp|P38919|IF4A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=3456	18.758	3	2777.5037	2777.5037	R	F	207	232
PSM	DGAGFLINLIDSPGHVDFSSEVTAALR	898	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41		ms_run[1]:scan=7182	39.370433	3	2802.416322	2800.403174	K	V	94	121
PSM	KPLVIIAEDVDGEALSTLVLNR	899	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41		ms_run[1]:scan=9157	50.187067	3	2366.335974	2364.326427	R	L	269	291
PSM	SGETEDTFIADLVVGLCTGQIK	900	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41	17-UNIMOD:4	ms_run[1]:scan=5241	28.54158	2	2352.151258	2352.151893	R	T	373	395
PSM	GFQQILAGEYDHLPEQAFYMVGPIEEAVAK	901	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41		ms_run[1]:scan=2280	12.359795	3	3349.633691	3349.632916	K	A	490	520
PSM	NMAEQIIQEIYSQIQSK	902	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41		ms_run[1]:scan=7439	40.809627	2	2022.011706	2022.009192	K	K	265	282
PSM	IGYNPDTVAFVPISGWNGDNMLEPSANMPWFK	903	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41		ms_run[1]:scan=4435	24.142019	3	3567.647572	3566.663898	K	G	181	213
PSM	SACSLESNLEGLAGVLEADLPNYK	904	sp|Q09161|NCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41	3-UNIMOD:4	ms_run[1]:scan=4987	27.131864	3	2549.240898	2549.231934	K	S	42	66
PSM	AGWNAYIDNLMADGTCQDAAIVGYK	905	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41	1-UNIMOD:1,11-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=3460	18.780473	2	2775.2612	2774.2312	M	D	2	27
PSM	VGSAADIPINISETDLSLLTATVVPPSGR	906	sp|P21333|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41		ms_run[1]:scan=31	0.15513863	3	2893.556540	2892.544418	K	E	1965	1994
PSM	GTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVK	907	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41		ms_run[1]:scan=4558	24.78873	3	4147.984029	4147.984364	K	S	287	323
PSM	MVNPTVFFDIAVDGEPLGR	908	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=5315	28.960046	2	2134.0403	2134.0400	-	V	1	20
PSM	VNPTVFFDIAVDGEPLGR	909	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41	1-UNIMOD:1	ms_run[1]:scan=7596	41.682619	2	1988.0062	1987.0042	M	V	2	20
PSM	QNQVGVVPWSPPQSNWNPWTSSNIDEGPLAFATPEQISMDLK	910	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41		ms_run[1]:scan=3749	20.352607	4	4664.230072	4664.228193	R	N	324	366
PSM	HSEQVPDILQLNAIFNMLNTK	911	sp|P29466|CASP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41		ms_run[1]:scan=17	0.073886668	3	2425.257345	2424.247131	K	N	248	269
PSM	IEGCIIGFDEYMNLVLDDAEEIHSK	912	sp|P62304|RUXE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41	4-UNIMOD:4	ms_run[1]:scan=2379	12.890299	3	2909.348748	2909.346312	R	T	43	68
PSM	QVIQQNPALLPALLQQLGQENPQLLQQISR	913	sp|P54725|RD23A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41		ms_run[1]:scan=1758	9.5624039	3	3378.883733	3377.878323	R	H	246	276
PSM	CFQEMLEEEEEHEWFIPAR	914	sp|Q9BPZ3|PAIP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=710	3.8382072	2	2491.0429	2491.0455	R	D	60	79
PSM	QNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGK	915	sp|P17844|DDX5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41	1-UNIMOD:28	ms_run[1]:scan=1117	6.0421104	3	3340.6414	3340.6393	R	T	112	145
PSM	HRDDALPFAHVAIAVEGPGWASPDNVALQVANAIIGHYDCTYGGGVHLSSPLASGAVANK	916	sp|P31930|QCR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41	40-UNIMOD:4	ms_run[1]:scan=5487	29.920607	7	6133.0347	6133.0288	R	L	277	337
PSM	QLTEMLPSILNQLGADSLTSLR	917	sp|P20290|BTF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41		ms_run[1]:scan=3646	19.801544	2	2399.268175	2399.273011	K	R	142	164
PSM	AFADAMEVIPSTLAENAGLNPISTVTELR	918	sp|P50991|TCPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41		ms_run[1]:scan=1330	7.2191797	3	3029.542856	3029.537953	R	N	453	482
PSM	NQLDQEVEFLSTSIAQLK	919	sp|Q99471|PFD5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41		ms_run[1]:scan=15	0.062634467	2	2063.066502	2062.058250	K	V	20	38
PSM	IPVTDEEQTNVPYIYAIGDILEDKVELTPVAIQAGR	920	sp|Q16881|TRXR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41		ms_run[1]:scan=3057	16.584568	4	3969.069752	3969.062280	K	L	466	502
PSM	ELNEYLEQFVGDQEAWHELAELYINEHDYAK	921	sp|Q15006|EMC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41		ms_run[1]:scan=4025	21.885935	4	3796.725215	3794.737651	R	A	143	174
PSM	ASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGK	922	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41	45-UNIMOD:4,48-UNIMOD:4	ms_run[1]:scan=4491	24.431894	4	5806.8709	5806.8792	R	I	13	68
PSM	LMSANASDLPLSIECFMNDVDVSGTMNR	923	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41	15-UNIMOD:4,17-UNIMOD:35	ms_run[1]:scan=3090	16.766474	3	3104.407357	3102.376643	K	G	276	304
PSM	KLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTALPDEDDDL	924	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41		ms_run[1]:scan=6294	34.392153	4	5386.6133	5386.6148	R	-	167	217
PSM	VMIPQDEYPEINFVGLLIGPR	925	sp|Q15637|SF01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41		ms_run[1]:scan=3567	19.37354	3	2399.269545	2399.255904	K	G	140	161
PSM	EAALPILEPVLGQEQPAAPDQPCVLFADAPEPGQALPVEEEAVTLAR	926	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41	23-UNIMOD:4	ms_run[1]:scan=3058	16.59254	4	4945.508951	4945.505932	R	A	609	656
PSM	DPSQELEFIADILNQDAK	927	sp|P49354|FNTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41		ms_run[1]:scan=7370	40.422704	2	2043.987729	2044.995316	R	N	181	199
PSM	AGATSEGVLANFFNSLLSK	928	sp|Q9Y6G9|DC1L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=3876	21.058	2	1924.9894	1924.9894	K	K	436	455
PSM	ALINADELASDVAGAEALLDR	929	sp|Q13813-3|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=1889	10.229	3	2126.0855	2126.0855	K	H	382	403
PSM	ALMLQGVDLLADAVAVTMGPK	930	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40	18-UNIMOD:35	ms_run[2]:scan=860	4.6635	3	2128.1272	2128.1272	R	G	38	59
PSM	ALSFLGFSAPTPIQALTLAPAIR	931	sp|Q9GZR7|DDX24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=3581	19.451	3	2354.3362	2354.3362	R	D	206	229
PSM	CDPAPFYLFDEIDQALDAQHR	932	sp|Q9UQE7|SMC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40	1-UNIMOD:4	ms_run[2]:scan=2299	12.466	3	2520.138	2520.1380	K	K	1134	1155
PSM	CFLAQPVTLLDIYTHWQQTSELGR	933	sp|Q13428-5|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40	1-UNIMOD:4	ms_run[2]:scan=731	3.9584	3	2875.4327	2875.4327	K	K	38	62
PSM	DLYANTVLSGGTTMYPGIADR	934	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=7365	40.392	2	2214.0627	2214.0627	K	M	292	313
PSM	DNTIEHLLPLFLAQLKDECPEVR	935	sp|P30153|2AAA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40	19-UNIMOD:4	ms_run[2]:scan=1004	5.4099	4	2749.4109	2749.4109	K	L	359	382
PSM	DTDAAVGDNIGYITFVLFPR	936	sp|O15144|ARPC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=4716	25.646	2	2183.0899	2183.0899	K	H	211	231
PSM	DTDAAVGDNIGYITFVLFPR	937	sp|O15144|ARPC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=4850	26.352	2	2183.0899	2183.0899	K	H	211	231
PSM	DVPFSVVYFPLFANLNQLGRPASEEK	938	sp|Q9H936|GHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=4694	25.526	3	2936.5072	2936.5072	R	S	197	223
PSM	EGFDALDPFIPILVSNYNPK	939	sp|P51398-2|RT29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=2917	15.811	2	2248.1416	2248.1416	K	E	291	311
PSM	EGGWDSVQDWMDVLSGGEK	940	sp|P28288-2|ABCD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=3115	16.909	2	2093.9	2093.9000	R	Q	448	467
PSM	ENFIPTIVNFSAEEISDAIR	941	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=6031	32.931	2	2264.1325	2264.1325	R	E	3345	3365
PSM	ESALFSTELSVLHNFFSPSPK	942	sp|Q8WX92|NELFB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=1551	8.4026	2	2336.1689	2336.1689	K	T	173	194
PSM	FLFPFFDSAYQGFASGNLER	943	sp|P17174-2|AATC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=3016	16.355	2	2312.0902	2312.0902	R	D	196	216
PSM	FMCAQLPNPVLDSISIIDTPGILSGEK	944	sp|Q9H4M9|EHD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40	3-UNIMOD:4	ms_run[2]:scan=2886	15.642	3	2914.482	2914.4820	R	Q	136	163
PSM	FQDTAEALAAFTALMEGK	945	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=1447	7.8412	2	1912.9241	1912.9241	K	I	50	68
PSM	FQDTAEALAAFTALMEGK	946	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=1553	8.4142	2	1912.9241	1912.9241	K	I	50	68
PSM	FTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGK	947	sp|Q9Y3C6|PPIL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=4048	22.01	3	3495.7133	3495.7133	K	H	92	126
PSM	GDIPDLSQAPSSLLDALEQHLASLEGKK	948	sp|Q13492-4|PICAL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=4114	22.353	4	2931.5189	2931.5189	R	I	211	239
PSM	GDLENAFLNLVQCIQNKPLYFADR	949	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40	13-UNIMOD:4	ms_run[2]:scan=7475	41.011	4	2837.417	2837.4170	K	L	250	274
PSM	GEGILITSHGELQYYLSLLNQQLPIESQMVSK	950	sp|O75643|U520_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=2549	13.811	3	3587.8545	3587.8545	K	L	865	897
PSM	GFDPSSPVLHELTFQAMSYDLLPIENDVYK	951	sp|P61764|STXB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=2681	14.519	3	3424.6537	3424.6537	R	Y	236	266
PSM	GFQQILAGEYDHLPEQAFYMVGPIEEAVAK	952	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=2533	13.718	4	3349.6329	3349.6329	K	A	490	520
PSM	GVGAAATAVTQALNELLQHVK	953	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=3520	19.114	2	2090.1484	2090.1484	R	A	766	787
PSM	HGWEELVYYTVPLIQEMESR	954	sp|O75323-2|NIPS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=5715	31.164	3	2478.1889	2478.1889	K	I	217	237
PSM	HLLAFLLAELGTSGSIDGNNQLVIK	955	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=1867	10.116	3	2622.4381	2622.4381	K	G	235	260
PSM	HNAVNATLIDSWVDIAIFQLK	956	sp|Q13155-2|AIMP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=4032	21.924	3	2367.2587	2367.2587	K	E	156	177
PSM	HSQDLAFLSMLNDIAAVPATAMPFR	957	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=5313	28.951	2	2715.3513	2715.3513	R	G	444	469
PSM	HSTIYPSPEELEAVQNMVSTVECALK	958	sp|Q96SI9-2|STRBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40	23-UNIMOD:4	ms_run[2]:scan=5582	30.445	3	2931.3994	2931.3994	K	H	4	30
PSM	IATLDMSSDQIAANLQAVINEVCR	959	sp|Q9BYD6|RM01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40	23-UNIMOD:4	ms_run[2]:scan=5078	27.65	3	2631.2996	2631.2996	K	H	257	281
PSM	IETELRDICNDVLSLLEK	960	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40	9-UNIMOD:4	ms_run[2]:scan=2763	14.977	3	2159.1144	2159.1144	K	F	86	104
PSM	IPCVDAGLISPLVQLLNSK	961	sp|P52306-6|GDS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40	3-UNIMOD:4	ms_run[2]:scan=1813	9.8432	2	2036.134	2036.1340	R	D	84	103
PSM	IPNFWVTTFVNHPQVSALLGEEDEEALHYLTR	962	sp|Q01105-3|SET_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=642	3.4662	4	3724.8526	3724.8526	K	V	66	98
PSM	IQDLPPVDLSLVNKDENAIYFLGNSLGLQPK	963	sp|Q16719-2|KYNU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=205	1.1247	3	3409.8133	3409.8133	K	M	51	82
PSM	IQHPSNVLHFFNAPLEVTEENFFEICDELGVK	964	sp|P14866-2|HNRPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40	26-UNIMOD:4	ms_run[2]:scan=2794	15.153	4	3771.8243	3771.8243	R	R	363	395
PSM	ISLTQAGLEALFESNLLDDLK	965	sp|Q16401|PSMD5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=7397	40.575	2	2289.2104	2289.2104	R	S	152	173
PSM	IWHPNISSVTGAICLDILKDQWAAAMTLR	966	sp|P61086-2|UBE2K_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40	14-UNIMOD:4	ms_run[2]:scan=275	1.5129	4	3279.6897	3279.6897	K	T	28	57
PSM	KLGLCEFPDNDQFSNLEALLIQIGPK	967	sp|P43246-2|MSH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40	5-UNIMOD:4	ms_run[2]:scan=2130	11.539	3	2958.5161	2958.5161	R	E	106	132
PSM	LAIIHCAGYSDPILVQTLWQDIIEK	968	sp|O75694-2|NU155_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40	6-UNIMOD:4	ms_run[2]:scan=1375	7.4707	3	2895.5205	2895.5205	K	E	1144	1169
PSM	LGAGYPMGPFELLDYVGLDTTK	969	sp|Q16836|HCDH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=5615	30.622	2	2356.1661	2356.1661	K	F	250	272
PSM	LSVGLEDEEDLLEDLDQALK	970	sp|P32929-2|CGL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=4513	24.548	2	2243.1057	2243.1057	R	A	332	352
PSM	LVLEQVVTSIASVADTAEEK	971	sp|O00410-2|IPO5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=322	1.7774	2	2101.1154	2101.1154	K	F	447	467
PSM	MNLASSFVNGFVNAAFGQDK	972	sp|Q13200|PSMD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=1494	8.0876	3	2116.0048	2116.0048	R	L	370	390
PSM	NAPAIIFIDELDAIAPK	973	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=851	4.6205	2	1809.9877	1809.9877	K	R	296	313
PSM	NAVTQFVSSMSASADVLALAK	974	sp|P47985|UCRI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=534	2.8752	3	2109.0776	2109.0776	K	I	131	152
PSM	NAVTQFVSSMSASADVLALAK	975	sp|P47985|UCRI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=630	3.3971	3	2109.0776	2109.0776	K	I	131	152
PSM	NDVLDSLGISPDLLPEDFVR	976	sp|Q9UBE0|SAE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=580	3.1241	3	2213.1216	2213.1216	R	Y	274	294
PSM	NFLTQDSADLDSIEAVANEVLK	977	sp|P07942|LAMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=5387	29.359	3	2391.1805	2391.1805	R	M	1509	1531
PSM	NLNPEDIDQLITISGMVIR	978	sp|P33991|MCM4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=168	0.92076	3	2140.1198	2140.1198	R	T	273	292
PSM	NPILWNVADVVIKFPEEEAPSTVLSQNLFTPK	979	sp|P04844|RPN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=5158	28.104	4	3594.8974	3594.8974	K	Q	492	524
PSM	NQEDLLSEFGQFLPDANSSVLLSK	980	sp|Q96ST3|SIN3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=2072	11.219	3	2650.3126	2650.3126	K	T	368	392
PSM	NSSLAEFVQSLSQTMGFPQDQIR	981	sp|Q93009-3|UBP7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=7068	38.735	3	2582.2435	2582.2435	K	L	583	606
PSM	QEAFLLNEDLGDSLDSVEALLK	982	sp|Q13813-3|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=6215	33.962	3	2418.2166	2418.2166	K	K	486	508
PSM	QWIVFDGDVDPEWVENLNSVLDDNK	983	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=4529	24.638	3	2945.3719	2945.3719	R	L	2299	2324
PSM	SFAPILPHLAEEVFQHIPYIK	984	sp|Q9NSE4|SYIM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=2070	11.208	3	2448.3206	2448.3206	R	E	833	854
PSM	SFFQAATEHLLPMGTALPLLEAQAATHTLVDPITGQR	985	sp|P58107|EPIPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=2957	16.03	4	3945.0459	3945.0459	K	L	300	337
PSM	SGETEDTFIADLVVGLCTGQIK	986	sp|P06733-2|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40	17-UNIMOD:4	ms_run[2]:scan=3656	19.849	3	2352.1519	2352.1519	R	T	280	302
PSM	SGETEDTFIADLVVGLCTGQIK	987	sp|P06733-2|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40	17-UNIMOD:4	ms_run[2]:scan=4050	22.021	3	2352.1519	2352.1519	R	T	280	302
PSM	SGTIFDNFLITNDEAYAEEFGNETWGVTK	988	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=3490	18.944	3	3267.4884	3267.4884	K	A	323	352
PSM	SIATTLIDDTSSEVLDELYR	989	sp|O95379-3|TFIP8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=4388	23.882	2	2240.106	2240.1060	K	V	27	47
PSM	SKDDQVTVIGAGVTLHEALAAAELLK	990	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=7322	40.156	4	2648.4385	2648.4385	K	K	498	524
PSM	SLLSMLSDLQIYQDSFEQR	991	sp|Q13620-3|CUL4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=4875	26.495	2	2272.1045	2272.1045	R	F	174	193
PSM	SLSALGNVISALAEGSTYVPYR	992	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=1344	7.2953	3	2267.1798	2267.1798	K	D	257	279
PSM	STAISLFYELSENDLNFIK	993	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=3258	17.664	2	2203.1049	2203.1049	K	Q	72	91
PSM	SVENLATATTTLTSLAQLLGK	994	sp|Q96S52-2|PIGS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=1446	7.8356	3	2131.1736	2131.1736	R	I	423	444
PSM	SYPGSQLDILIDQGKDDQFLLDGQLLPDNFIAACTEK	995	sp|P10768|ESTD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40	34-UNIMOD:4	ms_run[2]:scan=664	3.5852	3	4137.0252	4137.0252	K	K	210	247
PSM	SYPGSQLDILIDQGKDDQFLLDGQLLPDNFIAACTEK	996	sp|P10768|ESTD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40	34-UNIMOD:4	ms_run[2]:scan=763	4.1337	3	4137.0252	4137.0252	K	K	210	247
PSM	TLESVDPLGGLNTIDILTAIR	997	sp|O00429-4|DNM1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=372	2.0497	3	2210.2158	2210.2158	R	N	377	398
PSM	TLLEGSGLESIISIIHSSLAEPR	998	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=7165	39.277	3	2421.3115	2421.3115	R	V	2483	2506
PSM	TQTSDPAMLPTMIGLLAEAGVR	999	sp|O43175|SERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=3005	16.295	3	2271.1603	2271.1603	R	L	470	492
PSM	TVASPGVTVEEAVEQIDIGGVTLLR	1000	sp|P31939-2|PUR9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=964	5.2039	2	2552.3697	2552.3697	K	A	108	133
PSM	TVPPAVTGITFLSGGQSEEEASINLNAINK	1001	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=7126	39.062	3	3056.5666	3056.5666	R	C	260	290
PSM	TVPPAVTGITFLSGGQSEEEASINLNAINK	1002	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=7226	39.623	3	3056.5666	3056.5666	R	C	260	290
PSM	TWYVQATCATQGTGLYEGLDWLSNELSK	1003	sp|P18085|ARF4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40	8-UNIMOD:4	ms_run[2]:scan=4123	22.403	3	3190.4917	3190.4917	R	R	152	180
PSM	VGCLQLINALITPAEELDFR	1004	sp|O60610-2|DIAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40	3-UNIMOD:4	ms_run[2]:scan=1744	9.4839	2	2271.1933	2271.1933	K	V	303	323
PSM	VIHDNFGIVEGLMTTVHAITATQK	1005	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=7410	40.65	4	2594.3527	2594.3527	K	T	163	187
PSM	VLELPYQGEELSMVILLPDDIEDESTGLK	1006	sp|P30740-2|ILEU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=5037	27.414	3	3244.6312	3244.6312	R	K	65	94
PSM	WLPAGDALLQMITIHLPSPVTAQK	1007	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=5579	30.428	3	2599.4196	2599.4196	R	Y	343	367
PSM	WLQDVFNVPLVIQMTDDEK	1008	sp|P23381-2|SYWC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=1313	7.1307	2	2289.1351	2289.1351	K	Y	141	160
PSM	YHPTFFNDVFSTLFLDQPGGCHVTCLV	1009	sp|Q14166|TTL12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40	21-UNIMOD:4,25-UNIMOD:4	ms_run[2]:scan=4326	23.535	3	3170.463	3170.4630	R	-	618	645
PSM	LCYVALDFEQEMATAASSSSLEK	1010	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40	2-UNIMOD:4	ms_run[1]:scan=8368	46.004263	2	2549.150018	2549.166557	K	S	216	239
PSM	LCYVALDFEQEMATAASSSSLEK	1011	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40	2-UNIMOD:4	ms_run[1]:scan=8169	44.874652	2	2549.150864	2549.166557	K	S	216	239
PSM	LCYVALDFEQEMATAASSSSLEK	1012	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40	2-UNIMOD:4	ms_run[1]:scan=208	1.1416684	2	2550.168797	2549.166557	K	S	216	239
PSM	YAPTEAQLNAVDALIDSMSLAK	1013	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40		ms_run[1]:scan=9	0.034528167	3	2321.167746	2320.162064	K	K	444	466
PSM	VLQEGLLQLDSILSSLEPLHRPIESPGGSVLLR	1014	sp|Q7Z6Z7|HUWE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40		ms_run[1]:scan=3327	18.04347	3	3566.993987	3564.987933	K	E	840	873
PSM	DMAIATGGAVFGEEGLTLNLEDVQPHDLGK	1015	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40		ms_run[1]:scan=9384	51.299066	3	3098.517477	3096.507381	K	V	315	345
PSM	QEGCQDIATQLISNMDIDVILGGGRK	1016	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40	1-UNIMOD:28,4-UNIMOD:4	ms_run[1]:scan=4807	26.137387	2	2813.3646	2813.3683	R	Y	199	225
PSM	LDRDPASGTALQEISFWLNLER	1017	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40		ms_run[1]:scan=1081	5.8372582	3	2530.275467	2530.281602	K	A	262	284
PSM	SKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICR	1018	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40	36-UNIMOD:4,49-UNIMOD:4	ms_run[1]:scan=7236	39.677716	5	5731.7102	5731.7156	K	R	165	215
PSM	SLQDIIAILGMDELSEEDKLTVSR	1019	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40	11-UNIMOD:35	ms_run[1]:scan=1555	8.4253781	3	2692.356866	2690.368428	K	A	433	457
PSM	ALDLFSDNAPPPELLEIINEDIAKR	1020	sp|Q15084|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40		ms_run[1]:scan=1214	6.585094	3	2792.467119	2792.459626	R	T	265	290
PSM	AGWNAYIDNLMADGTCQDAAIVGYK	1021	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=3632	19.724106	3	2758.2397	2758.2362	M	D	2	27
PSM	MVNPTVFFDIAVDGEPLGR	1022	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=5121	27.893869	2	2134.0403	2134.0400	-	V	1	20
PSM	QVEHPLLSGLLYPGLQALDEEYLK	1023	sp|P54577|SYYC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40	1-UNIMOD:28	ms_run[1]:scan=3503	19.019731	3	2707.4138	2707.4104	K	V	155	179
PSM	CSLEMIDHIVGNQPDQEMVSASEWYLK	1024	sp|P32754|HPPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=732	3.964026	3	3161.4182	3161.4139	K	N	176	203
PSM	IEGCIIGFDEYMNLVLDDAEEIHSK	1025	sp|P62304|RUXE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40	4-UNIMOD:4	ms_run[1]:scan=2183	11.824994	3	2909.348748	2909.346312	R	T	43	68
PSM	ASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGK	1026	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40	45-UNIMOD:4,48-UNIMOD:4	ms_run[1]:scan=4553	24.764209	7	5806.8857	5806.8792	R	I	13	68
PSM	ASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGK	1027	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40	45-UNIMOD:4,48-UNIMOD:4	ms_run[1]:scan=4688	25.495849	4	5806.8709	5806.8792	R	I	13	68
PSM	QFGFIVLTTSAGIMDHEEAR	1028	sp|P62244|RS15A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40	1-UNIMOD:28	ms_run[1]:scan=209	1.1473185	2	2205.0562	2204.0562	R	R	98	118
PSM	QFGFIVLTTSAGIMDHEEAR	1029	sp|P62244|RS15A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40	1-UNIMOD:28	ms_run[1]:scan=71	0.38222432	2	2205.0562	2204.0562	R	R	98	118
PSM	HRDDALPFAHVAIAVEGPGWASPDNVALQVANAIIGHYDCTYGGGVHLSSPLASGAVANK	1030	sp|P31930|QCR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40	40-UNIMOD:4	ms_run[1]:scan=5445	29.689666	6	6133.0374	6133.0288	R	L	277	337
PSM	IEGCIIGFDEYMNLVLDDAEEIHSK	1031	sp|P62304|RUXE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40	4-UNIMOD:4	ms_run[1]:scan=2583	13.983618	3	2909.348748	2909.346312	R	T	43	68
PSM	GDFLASLENDIKPAFGTNQEDYASYIMNGIIK	1032	sp|P46459|NSF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40		ms_run[1]:scan=5811	31.711871	3	3535.705961	3533.702452	R	W	478	510
PSM	ALHSPQYIFGDFSPDEFNQFFVTPR	1033	sp|Q14694|UBP10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40	1-UNIMOD:1	ms_run[1]:scan=4305	23.415533	3	3000.4120	3000.4077	M	S	2	27
PSM	IPVIENLGATLDQFDAIDFSDNEIR	1034	sp|P09661|RU2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40		ms_run[1]:scan=1976	10.688767	3	2803.405289	2804.386855	K	K	31	56
PSM	LLGSDGSPLMDMLQLAEEPVPQAGQELR	1035	sp|Q6XQN6|PNCB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40	12-UNIMOD:35	ms_run[1]:scan=4982	27.101131	3	3012.503038	3009.478724	R	V	426	454
PSM	AAISNKITSCIFQLLQEAGIK	1036	sp|P22234|PUR6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39	10-UNIMOD:4	ms_run[2]:scan=5034	27.397	3	2304.2512	2304.2512	K	T	54	75
PSM	AGAAPYVQAFDSLLAGPVAEYLK	1037	sp|Q01518|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=7125	39.057	3	2350.2209	2350.2209	K	I	38	61
PSM	AGQLTSEEDTLTLVTADHSHVFSFGGYTLR	1038	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=7224	39.611	4	3251.5735	3251.5735	R	G	360	390
PSM	ALDLFSDNAPPPELLEIINEDIAK	1039	sp|Q15084-3|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=6143	33.563	3	2636.3585	2636.3585	R	R	262	286
PSM	ALMLQGVDLLADAVAVTMGPK	1040	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39	18-UNIMOD:35	ms_run[2]:scan=764	4.1391	3	2128.1272	2128.1272	R	G	38	59
PSM	AVDEAVILLQEIGVLDQR	1041	sp|Q7L2E3-3|DHX30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=1798	9.768	2	1980.0892	1980.0892	K	E	808	826
PSM	DHVFPVNDGFQALQGIIHSILKK	1042	sp|Q9H6X2-3|ANTR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=3846	20.89	4	2575.3911	2575.3911	K	S	196	219
PSM	DLADELALVDVIEDKLK	1043	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=1148	6.2153	2	1898.0248	1898.0248	K	G	43	60
PSM	DLYANTVLSGGTTMYPGIADR	1044	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=7267	39.844	2	2214.0627	2214.0627	K	M	292	313
PSM	DMAIATGGAVFGEEGLTLNLEDVQPHDLGK	1045	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=8063	44.286	3	3096.5074	3096.5074	K	V	315	345
PSM	DSWNAGIMTVMSALSVAPSK	1046	sp|Q5XKP0|MIC13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=3084	16.733	2	2064.002	2064.0020	R	A	82	102
PSM	DVLIQGLIDENPGLQLIIR	1047	sp|P78527-2|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=3041	16.495	2	2118.2049	2118.2049	K	N	2504	2523
PSM	DVLIQGLIDENPGLQLIIR	1048	sp|P78527-2|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=3237	17.55	2	2118.2049	2118.2049	K	N	2504	2523
PSM	DVQNTFYDIVAELGAMEHAQAVDYIKK	1049	sp|P16435|NCPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=6099	33.314	4	3067.4961	3067.4961	R	L	638	665
PSM	EALAQTVLAEVPTQLVSYFR	1050	sp|Q99829|CPNE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=3963	21.55	2	2234.1947	2234.1947	R	A	495	515
PSM	EAVQCVQELASPSLLFIFVR	1051	sp|Q04637-6|IF4G1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39	5-UNIMOD:4	ms_run[2]:scan=3556	19.313	3	2305.214	2305.2140	K	H	1065	1085
PSM	ELLMGIFEMGWEKPSPIQEESIPIALSGR	1052	sp|P26196|DDX6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=544	2.9302	3	3256.6512	3256.6512	R	D	106	135
PSM	ENFIPTIVNFSAEEISDAIR	1053	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=6054	33.062	3	2264.1325	2264.1325	R	E	3345	3365
PSM	ENPVVPIGCLATAAALTYGLYSFHR	1054	sp|Q9BW72|HIG2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39	9-UNIMOD:4	ms_run[2]:scan=974	5.2475	3	2719.3792	2719.3792	R	G	45	70
PSM	EQPLDEELKDAFQNAYLELGGLGER	1055	sp|P05023-3|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=5394	29.396	3	2833.377	2833.3770	K	V	496	521
PSM	EQYEQILAFVQGTVAEGAPIIPISAQLK	1056	sp|Q2VIR3-2|IF2GL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=7299	40.024	3	3012.6172	3012.6172	K	Y	202	230
PSM	FANSLPINDPLQTVYQLMSGR	1057	sp|O15027-2|SC16A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=6290	34.371	2	2363.1944	2363.1944	R	M	1665	1686
PSM	FDGALNVDLTEFQTNLVPYPR	1058	sp|P68363-2|TBA1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=7301	40.036	2	2408.2012	2408.2012	R	I	128	149
PSM	FDLGQDVIDFTGHALALYR	1059	sp|P50395|GDIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=2665	14.432	3	2150.0797	2150.0797	K	T	175	194
PSM	FDLGQDVIDFTGHALALYR	1060	sp|P50395|GDIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=2584	13.989	2	2150.0797	2150.0797	K	T	175	194
PSM	FIDQVVEKIEDLLQSEENK	1061	sp|O95453-2|PARN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=4660	25.34	3	2275.1584	2275.1584	K	N	119	138
PSM	GAIDDLQQGELEAFIQNLNLAK	1062	sp|Q03701|CEBPZ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=1879	10.177	2	2399.2333	2399.2333	K	Y	74	96
PSM	GFGGAMTDAAALNILALSPPAQNLLLK	1063	sp|P04062-4|GLCM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=820	4.4511	3	2666.4466	2666.4466	K	S	32	59
PSM	GHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYK	1064	sp|P04179-4|SODM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39	8-UNIMOD:4	ms_run[2]:scan=5289	28.813	5	4292.1728	4292.1728	R	N	111	149
PSM	GISNMLDVNGLFTLSHITQLVLSHNK	1065	sp|Q15404|RSU1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=4037	21.952	4	2850.5062	2850.5062	R	L	26	52
PSM	GLIAEAAQLGPVGGVFNLAVVLR	1066	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=4296	23.367	3	2263.3052	2263.3052	R	D	1954	1977
PSM	GMYGIENEVFLSLPCILNAR	1067	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39	15-UNIMOD:4	ms_run[2]:scan=1876	10.16	3	2295.1392	2295.1392	K	G	280	300
PSM	HSQDLAFLSMLNDIAAVPATAMPFR	1068	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=5243	28.553	3	2715.3513	2715.3513	R	G	444	469
PSM	ICPVETLVEEAIQCAEK	1069	sp|P30084|ECHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39	2-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=366	2.0159	2	1987.9595	1987.9595	K	I	212	229
PSM	IGYNPDTVAFVPISGWNGDNMLEPSANMPWFK	1070	sp|P68104-2|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=2283	12.377	3	3566.6639	3566.6639	K	G	160	192
PSM	IHHELNQFCSAHTLQEVYIELFDQIDENLK	1071	sp|O75477|ERLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39	9-UNIMOD:4	ms_run[2]:scan=1034	5.5748	4	3682.7726	3682.7726	K	Q	122	152
PSM	INEAFIEMATTEDAQAAVDYYTTTPALVFGKPVR	1072	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=1282	6.9633	3	3731.8393	3731.8393	K	V	434	468
PSM	IQHPSNVLHFFNAPLEVTEENFFEICDELGVK	1073	sp|P14866-2|HNRPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39	26-UNIMOD:4	ms_run[2]:scan=2852	15.448	3	3771.8243	3771.8243	R	R	363	395
PSM	IQVTPPGFQLVFLPFADDK	1074	sp|P12956-2|XRCC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=708	3.827	3	2131.1354	2131.1354	K	R	384	403
PSM	IYKVPSTEAEALASSLMGLFEK	1075	sp|P50395|GDIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=2578	13.956	3	2383.2345	2383.2345	K	R	116	138
PSM	LCYVALDFEQEMATAASSSSLEK	1076	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39	2-UNIMOD:4	ms_run[2]:scan=1649	8.9555	2	2549.1666	2549.1666	K	S	216	239
PSM	LCYVALDFEQEMATAASSSSLEK	1077	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39	2-UNIMOD:4	ms_run[2]:scan=7465	40.952	3	2549.1666	2549.1666	K	S	216	239
PSM	LDLQWVQVLSEGWATPLK	1078	sp|O95340|PAPS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=4849	26.347	2	2082.115	2082.1150	K	G	252	270
PSM	LEQLNQYPDFNNYLIFVLTK	1079	sp|Q92973-3|TNPO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=2125	11.511	3	2471.2737	2471.2737	K	L	45	65
PSM	LHEEEIQELQAQIQEQHVQIDVDVSKPDLTAALR	1080	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=7181	39.365	4	3922.0072	3922.0072	K	D	237	271
PSM	LMEPIYLVEIQCPEQVVGGIYGVLNR	1081	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39	12-UNIMOD:4	ms_run[2]:scan=6418	35.073	4	2988.5453	2988.5453	R	K	740	766
PSM	LPDFQDSIFEYFNTAPLAHDLTFR	1082	sp|Q9Y5S2|MRCKB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=6901	37.792	3	2856.3759	2856.3759	K	T	944	968
PSM	LSALALLSLLPSDNSVIQDK	1083	sp|Q9UI26|IPO11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=72	0.38786	2	2096.1729	2096.1729	K	F	847	867
PSM	LTAQVASLTSELTTLNATIQQQDQELAGLK	1084	sp|Q14980-4|NUMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=1071	5.7811	4	3184.6827	3184.6827	R	Q	496	526
PSM	LTEVKDELEPLLELVEQGIIPPGK	1085	sp|Q9NQZ2|SAS10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=4695	25.532	4	2658.4731	2658.4731	K	G	237	261
PSM	LTFSGLLNALDGVASTEAR	1086	sp|Q9Y276|BCS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=279	1.5356	2	1934.0109	1934.0109	R	I	307	326
PSM	MVYSTCSLNPIEDEAVIASLLEK	1087	sp|Q08J23-3|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39	6-UNIMOD:4	ms_run[2]:scan=1011	5.4493	2	2581.2655	2581.2655	R	S	80	103
PSM	NAAQELATLLLSLPAPASVQQQSK	1088	sp|Q5T4S7-3|UBR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=4538	24.686	3	2477.349	2477.3490	K	S	2514	2538
PSM	NAFGLHLIDFMSEILK	1089	sp|Q15003|CND2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=6891	37.735	2	1846.9651	1846.9651	K	Q	127	143
PSM	NDFQLIGIQDGYLSLLQDSGEVR	1090	sp|P63241|IF5A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=7513	41.233	3	2579.2867	2579.2867	R	E	87	110
PSM	NGQVELNEFLQLMSAIQK	1091	sp|P43304-2|GPDM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=1448	7.8468	2	2061.0565	2061.0565	K	G	550	568
PSM	NLHNMVFIVDPAHETTAELMNTAEMFLSNHIPLR	1092	sp|Q9NYU2-2|UGGG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=7005	38.386	5	3904.9063	3904.9063	K	I	471	505
PSM	NNAASEGVLASFFNSLLSK	1093	sp|O43237-2|DC1L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=4062	22.088	2	1967.9953	1967.9953	K	K	344	363
PSM	NQGATCYMNSLLQTLFFTNQLR	1094	sp|Q93009-3|UBP7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39	6-UNIMOD:4	ms_run[2]:scan=5284	28.785	3	2619.2574	2619.2574	K	K	202	224
PSM	NVEDIELWLYEVEGHLASDDYGK	1095	sp|Q13813-3|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=6547	35.806	3	2693.2497	2693.2497	R	D	686	709
PSM	PITEMLPGILSQLGADSLTSLR	1096	sp|Q96K17-2|BT3L4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=5532	30.168	3	2311.2457	2311.2457	K	K	35	57
PSM	QALQELTQNQVVLLDTLEQEISK	1097	sp|Q9UL45|BL1S6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=625	3.3714	3	2639.4018	2639.4018	K	F	69	92
PSM	QEAFLLNEDLGDSLDSVEALLK	1098	sp|Q13813-3|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=6190	33.828	2	2418.2166	2418.2166	K	K	486	508
PSM	QEGCQDIATQLISNMDIDVILGGGR	1099	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39	4-UNIMOD:4	ms_run[2]:scan=3823	20.76	3	2702.3004	2702.3004	R	K	199	224
PSM	QIFNVNNLNLPQVALSFGFK	1100	sp|Q9NVP1|DDX18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=1102	5.9579	2	2262.2161	2262.2161	K	V	597	617
PSM	QIIISEIISSLPSIVNDK	1101	sp|Q15397|PUM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=2808	15.23	2	1968.1143	1968.1143	K	Y	419	437
PSM	QNLLQAAGNVGQASGELLQQIGESDTDPHFQDALMQLAK	1102	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=4674	25.419	3	4135.028	4135.0280	R	A	635	674
PSM	SEDPLFVLEHSLPIDTQYYLEQQLAKPLLR	1103	sp|P28340|DPOD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=4628	25.166	4	3554.8661	3554.8661	K	I	939	969
PSM	SFAVGTLAETIQGLGAASAQFVSR	1104	sp|Q8TEX9|IPO4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=2706	14.662	3	2380.2387	2380.2387	K	L	876	900
PSM	SGETEDTFIADLVVGLCTGQIK	1105	sp|P06733-2|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39	17-UNIMOD:4	ms_run[2]:scan=4149	22.545	3	2352.1519	2352.1519	R	T	280	302
PSM	SGETEDTFIADLVVGLCTGQIK	1106	sp|P06733-2|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39	17-UNIMOD:4	ms_run[2]:scan=4248	23.096	3	2352.1519	2352.1519	R	T	280	302
PSM	SGETEDTFIADLVVGLCTGQIK	1107	sp|P06733-2|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39	17-UNIMOD:4	ms_run[2]:scan=4387	23.877	3	2352.1519	2352.1519	R	T	280	302
PSM	SLTGVVNAQALTSAFSPHTKPWIGLAEALGTLMR	1108	sp|O43175|SERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=6936	37.994	4	3536.8814	3536.8814	K	A	311	345
PSM	SPFDIVGSSDNPDQNTEDYLFQVILEK	1109	sp|P41743|KPCI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=3561	19.341	3	3069.4455	3069.4455	R	Q	451	478
PSM	SPLMSEFQSQISSNPELAAIFESIQK	1110	sp|Q86VP6-2|CAND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=5472	29.84	3	2880.4215	2880.4215	K	D	1024	1050
PSM	STTTIGLVQALGAHLYQNVFACVR	1111	sp|P11586|C1TC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39	22-UNIMOD:4	ms_run[2]:scan=3183	17.274	3	2618.3639	2618.3639	K	Q	387	411
PSM	SVVPGGGAVEAALSIYLENYATSMGSR	1112	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=5348	29.143	2	2698.3272	2698.3272	K	E	407	434
PSM	SYYEANDVTSAINIIDEAFSK	1113	sp|Q9Y5Q9-2|TF3C3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=2877	15.589	2	2349.1012	2349.1012	K	H	299	320
PSM	TAAFLLPILSQIYSDGPGEALR	1114	sp|O00571-2|DDX3X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=6438	35.185	2	2331.2474	2331.2474	K	A	215	237
PSM	TIVAINKDPEAPIFQVADYGIVADLFK	1115	sp|P13804-2|ETFA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=1655	8.9892	4	2946.5743	2946.5743	K	V	246	273
PSM	TLRDPSLPLLELQDIMTSVSGR	1116	sp|Q13085-3|ACACA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=473	2.5688	3	2440.2996	2440.2996	K	I	810	832
PSM	TQTSDPAMLPTMIGLLAEAGVR	1117	sp|O43175|SERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=3104	16.848	3	2271.1603	2271.1603	R	L	470	492
PSM	TSTILGDITSIPELADYIK	1118	sp|Q96AC1-2|FERM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=520	2.799	2	2049.0882	2049.0882	K	V	362	381
PSM	TVDLQDAEEAVELVQYAYFK	1119	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=4668	25.385	3	2330.1318	2330.1318	K	K	636	656
PSM	VADNLAIQLAAVTEDKYEILQSVDDAAIVIK	1120	sp|Q12906-5|ILF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=2536	13.735	4	3327.7814	3327.7814	K	N	128	159
PSM	VGETAPPNAYTVTDLVEYSIVIQQLSNGK	1121	sp|P39656-2|OST48_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=1242	6.736	3	3105.587	3105.5870	R	W	279	308
PSM	VTDPVGDIVSFMHSFEEK	1122	sp|Q96CS3|FAF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=1176	6.3724	2	2035.9561	2035.9561	R	Y	129	147
PSM	VWSMLADLEESLGTFQSTK	1123	sp|Q9HCS7|SYF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=4946	26.896	2	2141.0351	2141.0351	K	A	486	505
PSM	WGDAGAEYVVESTGVFTTMEK	1124	sp|P04406|G3P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=7417	40.69	2	2276.0307	2276.0307	K	A	87	108
PSM	WLPAGDALLQMITIHLPSPVTAQK	1125	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=5678	30.963	3	2599.4196	2599.4196	R	Y	343	367
PSM	YLPPATQVVLISATLPHEILEMTNK	1126	sp|P38919|IF4A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=3259	17.67	3	2777.5037	2777.5037	R	F	207	232
PSM	YRAGTLTVEELGATLTSLLAQAQAQAR	1127	sp|P58107|EPIPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=6963	38.151	3	2831.5141	2831.5141	R	A	2475	2502
PSM	LCYVALDFEQEMATAASSSSLEK	1128	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39	2-UNIMOD:4	ms_run[1]:scan=8276	45.479034	2	2549.150018	2549.166557	K	S	216	239
PSM	LCYVALDFEQEMATAASSSSLEK	1129	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39	2-UNIMOD:4	ms_run[1]:scan=7972	43.77601	2	2550.152676	2549.166557	K	S	216	239
PSM	LCYVALDFEQEMATAASSSSLEK	1130	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39	2-UNIMOD:4	ms_run[1]:scan=9115	49.978809	2	2550.173660	2549.166557	K	S	216	239
PSM	LCYVALDFEQEMATAASSSSLEK	1131	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39	2-UNIMOD:4	ms_run[1]:scan=8671	47.734412	2	2549.166655	2549.166557	K	S	216	239
PSM	DMAIATGGAVFGEEGLTLNLEDVQPHDLGK	1132	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39		ms_run[1]:scan=8356	45.936823	3	3096.490847	3096.507381	K	V	315	345
PSM	QEGCQDIATQLISNMDIDVILGGGRK	1133	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39	1-UNIMOD:28,4-UNIMOD:4	ms_run[1]:scan=4867	26.450329	3	2813.3725	2813.3683	R	Y	199	225
PSM	SLQDIIAILGMDELSEEDKLTVSR	1134	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39	11-UNIMOD:35	ms_run[1]:scan=1450	7.8580758	3	2691.375393	2690.368428	K	A	433	457
PSM	NLHNMVFIVDPAHETTAELMNTAEMFLSNHIPLR	1135	sp|Q9NYU2|UGGG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39		ms_run[1]:scan=6977	38.229788	4	3905.913246	3904.906271	K	I	495	529
PSM	AGWNAYIDNLMADGTCQDAAIVGYK	1136	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39	1-UNIMOD:1,11-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=3516	19.091487	3	2776.2512	2774.2312	M	D	2	27
PSM	SADFVVEAIGDDVGTLGFSVEGPSQAK	1137	sp|P21333|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39		ms_run[1]:scan=7447	40.853954	3	2695.293499	2694.302456	K	I	594	621
PSM	EVAAFAQFGSDLDAATQQLLSR	1138	sp|P25705|ATPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39		ms_run[1]:scan=2214	12.001374	3	2337.162696	2337.160090	R	G	442	464
PSM	EVAAFAQFGSDLDAATQQLLSR	1139	sp|P25705|ATPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39		ms_run[1]:scan=2326	12.609605	3	2337.162696	2337.160090	R	G	442	464
PSM	NLEALALDLMEPEQAVDLTLPK	1140	sp|P12956|XRCC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39		ms_run[1]:scan=4624	25.143938	3	2422.266795	2422.266529	R	V	489	511
PSM	GQNDLMGTAEDFADQFLR	1141	sp|O15260|SURF4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39		ms_run[1]:scan=2609	14.121989	2	2026.9074	2026.9049	M	V	2	20
PSM	LNLIHSEISNLAGFEVEAIINPTNADIDLKDDLGNTLEK	1142	sp|O75367|H2AY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39		ms_run[1]:scan=1050	5.6638102	4	4248.185858	4248.180164	K	K	197	236
PSM	IEGCIIGFDEYMNLVLDDAEEIHSK	1143	sp|P62304|RUXE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39	4-UNIMOD:4	ms_run[1]:scan=2483	13.434874	3	2909.348748	2909.346312	R	T	43	68
PSM	AEEGIAAGGVMDVNTALQEVLK	1144	sp|P25398|RS12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39	1-UNIMOD:1	ms_run[1]:scan=4919	26.742308	2	2256.1309	2256.1302	M	T	2	24
PSM	EFVEEFIWPAIQSSALYEDR	1145	sp|P00966|ASSY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39		ms_run[1]:scan=182	0.99819752	3	2430.168763	2428.158693	R	Y	67	87
PSM	ASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGK	1146	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39	36-UNIMOD:35,45-UNIMOD:4,48-UNIMOD:4	ms_run[1]:scan=1664	9.0423909	5	5822.8757	5822.8741	R	I	13	68
PSM	PVFAFHHANFPQYVMDVLMDQHFTEPTPIQCQGFPLALSGR	1147	sp|Q92841|DDX17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39	31-UNIMOD:4	ms_run[1]:scan=1270	6.8959378	5	4742.275502	4742.266116	K	D	169	210
PSM	QFTTVVADTGDFHAIDEYKPQDATTNPSLILAAAQMPAYQELVEEAIAYGR	1148	sp|P37837|TALDO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39		ms_run[1]:scan=4879	26.517047	4	5568.7004	5568.7030	K	K	20	71
PSM	ASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGK	1149	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39	45-UNIMOD:4,48-UNIMOD:4	ms_run[1]:scan=4743	25.788726	5	5806.8802	5806.8792	R	I	13	68
PSM	EFVEEFIWPAIQSSALYEDR	1150	sp|P00966|ASSY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39		ms_run[1]:scan=277	1.5243832	3	2430.168763	2428.158693	R	Y	67	87
PSM	LMSANASDLPLSIECFMNDVDVSGTMNR	1151	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39	15-UNIMOD:4	ms_run[1]:scan=3074	16.680147	3	3085.383875	3086.381728	K	G	276	304
PSM	DADISDVAFLVVGDPFGATTHSDLVLR	1152	sp|Q9H2P9|DPH5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39		ms_run[1]:scan=450	2.4587233	3	2828.419849	2829.418489	K	A	71	98
PSM	KLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTALPDEDDDL	1153	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39	23-UNIMOD:35	ms_run[1]:scan=6267	34.239299	5	5403.6412	5402.6092	R	-	167	217
PSM	HLLAFLLAELGTSGSIDGNNQLVIK	1154	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39		ms_run[1]:scan=2000	10.816671	3	2622.440122	2622.438103	K	G	235	260
PSM	AVADLALIPDVDIDSDGVFK	1155	sp|Q9NRX4|PHP14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39	1-UNIMOD:1	ms_run[1]:scan=4087	22.214264	2	2114.0808	2114.0778	M	Y	2	22
PSM	AVADLALIPDVDIDSDGVFK	1156	sp|Q9NRX4|PHP14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39	1-UNIMOD:1	ms_run[1]:scan=3979	21.639826	2	2114.0808	2114.0778	M	Y	2	22
PSM	ADLNIILSSPEQLELFLLAQQK	1157	sp|Q9BQG0|MBB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=5106	27.81	3	2482.3683	2482.3683	K	V	203	225
PSM	ADSIFTEEGETPAWLEQMIAHTTWR	1158	sp|Q8IXH7-4|NELFD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=543	2.9246	3	2918.3545	2918.3545	K	D	123	148
PSM	AFMTADLPNELIELLEK	1159	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=7441	40.82	2	1946.0071	1946.0071	K	I	994	1011
PSM	AIDVPGQVQVYELQPSNLEADQPLQAIMEMGAVAADK	1160	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=4961	26.983	3	3937.9442	3937.9442	K	G	498	535
PSM	AIENIDTLTNLESLFLGK	1161	sp|Q15435-5|PP1R7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=3141	17.044	2	1990.0623	1990.0623	R	N	141	159
PSM	AVGNIVTGDDIQTQVILNCSALPCLLHLLSSPK	1162	sp|O60684|IMA7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38	19-UNIMOD:4,24-UNIMOD:4	ms_run[2]:scan=5296	28.852	3	3545.8586	3545.8586	R	E	317	350
PSM	AVMDHVSDSFLETNVPLLVLIEAAK	1163	sp|P35221-3|CTNA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=5141	28.009	3	2710.4252	2710.4252	K	N	15	40
PSM	CAVSDVEMQEHYDEFFEEVFTEMEEK	1164	sp|Q01081|U2AF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38	1-UNIMOD:4	ms_run[2]:scan=2611	14.13	3	3256.3199	3256.3199	R	Y	67	93
PSM	DALEFWLQAGVDGFQVR	1165	sp|P08195-2|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=4744	25.794	2	1949.9636	1949.9636	K	D	231	248
PSM	DGHNLISLLEVLSGDSLPR	1166	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=5340	29.101	2	2034.0746	2034.0746	R	E	40	59
PSM	DKPSGDTAAVFEEGGDVDDLLDMI	1167	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=3489	18.938	2	2508.1214	2508.1214	K	-	709	733
PSM	DLYANTVLSGGTTMYPGIADR	1168	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=7157	39.232	2	2214.0627	2214.0627	K	M	292	313
PSM	DVLNLVYLCEALNLPEVAR	1169	sp|O60701-3|UGDH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38	9-UNIMOD:4	ms_run[2]:scan=5175	28.198	3	2200.1562	2200.1562	K	Y	183	202
PSM	DWNPKPLDTFLEELAENCVGYCGADIK	1170	sp|Q6PL18|ATAD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38	18-UNIMOD:4,22-UNIMOD:4	ms_run[2]:scan=4228	22.983	3	3153.4423	3153.4423	R	S	614	641
PSM	EAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPK	1171	sp|O75369-5|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=4341	23.62	4	4592.188	4592.1880	R	A	200	240
PSM	EASDPFSLNELLDELSR	1172	sp|Q86XI2|CNDG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=3953	21.491	2	1933.9269	1933.9269	K	K	28	45
PSM	ELPTEPPYTAYVGNLPFNTVQGDIDAIFK	1173	sp|Q15056-2|IF4H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=7290	39.974	3	3208.5968	3208.5968	K	D	35	64
PSM	ENILFGMGNPLLDISAVVDK	1174	sp|P55263-3|ADK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=5887	32.142	2	2144.1187	2144.1187	R	D	23	43
PSM	ENILHVSENVIFTDVNSILR	1175	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=1609	8.7332	3	2311.2172	2311.2172	K	Y	37	57
PSM	EPDVLILDEPTNNLDIESIDALGEAINEYK	1176	sp|Q8NE71-2|ABCF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=4652	25.297	3	3341.6402	3341.6402	R	G	722	752
PSM	ESALFSTELSVLHNFFSPSPK	1177	sp|Q8WX92|NELFB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=1575	8.5377	3	2336.1689	2336.1689	K	T	173	194
PSM	ESLNASIVDAINQAADCWGIR	1178	sp|Q9UJZ1|STML2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38	17-UNIMOD:4	ms_run[2]:scan=5859	31.984	3	2302.1012	2302.1012	R	C	151	172
PSM	ETEEEKEIADFDIFDDPESPFSTFNFQYPNQAFK	1179	sp|P47712|PA24A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=3014	16.346	3	4073.8007	4073.8007	R	R	658	692
PSM	EVFPFPEVSQDELNEINQFLGPVEK	1180	sp|Q9H845|ACAD9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=6877	37.654	3	2903.4229	2903.4229	K	F	52	77
PSM	EVGDGTTSVVIIAAELLK	1181	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=234	1.2859	2	1814.0037	1814.0037	K	N	85	103
PSM	FLNGEDWKPGALDDALSDILINFK	1182	sp|Q96S66|CLCC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=7087	38.844	3	2690.3592	2690.3592	K	F	140	164
PSM	FTASAGIQVVGDDLTVTNPK	1183	sp|P06733-2|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=7103	38.933	2	2032.0477	2032.0477	K	R	214	234
PSM	FTASAGIQVVGDDLTVTNPK	1184	sp|P06733-2|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=7197	39.457	2	2032.0477	2032.0477	K	R	214	234
PSM	GAIDDLQQGELEAFIQNLNLAK	1185	sp|Q03701|CEBPZ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=1886	10.213	3	2399.2333	2399.2333	K	Y	74	96
PSM	GFTQLQTLILPQHVNCPGGINAWNTITSYIDNQICQGQK	1186	sp|Q6UW56-2|ARAID_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38	16-UNIMOD:4,35-UNIMOD:4	ms_run[2]:scan=4372	23.797	4	4427.1791	4427.1791	R	N	57	96
PSM	GGAAGGGYAQVIPMEEFNLHLTGDIHAITAANNLLAAAIDTR	1187	sp|Q6UB35|C1TM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=5156	28.093	4	4233.1277	4233.1277	K	I	465	507
PSM	GGLRPGSLDAEIDLLSSTLAELNGGR	1188	sp|Q15654|TRIP6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=4354	23.693	3	2610.3613	2610.3613	R	G	86	112
PSM	GGLRPGSLDAEIDLLSSTLAELNGGR	1189	sp|Q15654|TRIP6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=4463	24.288	3	2610.3613	2610.3613	R	G	86	112
PSM	GLIAEAAQLGPVGGVFNLAVVLR	1190	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=4111	22.336	2	2263.3052	2263.3052	R	D	1954	1977
PSM	GLIAEAAQLGPVGGVFNLAVVLR	1191	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=4207	22.866	2	2263.3052	2263.3052	R	D	1954	1977
PSM	GLNNLLDENRIQDLSLLYQLFSR	1192	sp|Q13620-3|CUL4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=6847	37.482	3	2733.445	2733.4450	K	V	264	287
PSM	GLTLIELWEGLTVDDVQK	1193	sp|P55809|SCOT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=7387	40.518	2	2028.0779	2028.0779	K	S	483	501
PSM	GMYGIENEVFLSLPCILNAR	1194	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38	15-UNIMOD:4	ms_run[2]:scan=1762	9.5836	3	2295.1392	2295.1392	K	G	280	300
PSM	GNFTLPEVAECFDEITYVELQK	1195	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38	11-UNIMOD:4	ms_run[2]:scan=1875	10.154	2	2601.2309	2601.2309	K	E	619	641
PSM	GNFTLPEVAECFDEITYVELQK	1196	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38	11-UNIMOD:4	ms_run[2]:scan=2081	11.272	2	2601.2309	2601.2309	K	E	619	641
PSM	GNFTLPEVAECFDEITYVELQK	1197	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38	11-UNIMOD:4	ms_run[2]:scan=1982	10.722	3	2601.2309	2601.2309	K	E	619	641
PSM	GPQLAAQNLGISLANLLLSK	1198	sp|P08397-4|HEM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=1888	10.224	3	2020.1681	2020.1681	R	G	269	289
PSM	GQNLLLTNLQTIQGILER	1199	sp|P12270|TPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=3590	19.498	2	2023.1426	2023.1426	R	S	811	829
PSM	GQNLLLTNLQTIQGILER	1200	sp|P12270|TPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=3623	19.676	3	2023.1426	2023.1426	R	S	811	829
PSM	GSCVTQVGLLESVYEMFR	1201	sp|P78527-2|PRKDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38	3-UNIMOD:4	ms_run[2]:scan=3844	20.879	2	2073.9863	2073.9863	R	K	1789	1807
PSM	GVGAAATAVTQALNELLQHVK	1202	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=3588	19.487	3	2090.1484	2090.1484	R	A	766	787
PSM	HEWVTTENGIGTVGISNFAQEALGDVVYCSLPEVGTK	1203	sp|P23434|GCSH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38	29-UNIMOD:4	ms_run[2]:scan=693	3.7472	3	3976.9153	3976.9153	K	L	57	94
PSM	HLPNLLDETQIFSYFSQFGTVTR	1204	sp|Q9BYG3|MK67I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=3387	18.371	3	2712.3548	2712.3548	R	F	51	74
PSM	HLVMGDIPAAVNAFQEAASLLGK	1205	sp|P49321-2|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=1657	9.0004	3	2351.2308	2351.2308	K	K	53	76
PSM	ICPVETLVEEAIQCAEK	1206	sp|P30084|ECHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38	2-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=476	2.5792	2	1987.9595	1987.9595	K	I	212	229
PSM	ILQMEEEYIQQLCEDIIQLKPDVVITEK	1207	sp|P49368-2|TCPG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38	13-UNIMOD:4	ms_run[2]:scan=6111	33.384	3	3416.7459	3416.7459	R	G	229	257
PSM	IQVLTDKIDVLLQQIEELGSEGK	1208	sp|O95232|LC7L3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=5356	29.188	3	2567.4058	2567.4058	K	V	129	152
PSM	IQVTPPGFQLVFLPFADDK	1209	sp|P12956-2|XRCC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=582	3.1354	2	2131.1354	2131.1354	K	R	384	403
PSM	IVAFADAAVEPIDFPIAPVYAASMVLK	1210	sp|P24752|THIL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=6580	35.994	3	2817.5027	2817.5027	R	D	312	339
PSM	KPLVIIAEDVDGEALSTLVLNR	1211	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=6034	32.948	3	2364.3264	2364.3264	R	L	269	291
PSM	LFADAGLVCITSFISPFAK	1212	sp|O95340|PAPS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38	9-UNIMOD:4	ms_run[2]:scan=3611	19.612	2	2056.0703	2056.0703	K	D	109	128
PSM	LFAQLAGDDMEVSATELMNILNK	1213	sp|P04632|CPNS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=7281	39.921	3	2522.2397	2522.2397	R	V	104	127
PSM	LIHEQDLEWLQQADVVVAEVTQPSLGVGYELGR	1214	sp|O43598-2|DNPH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=5896	32.195	4	3690.8893	3690.8893	R	A	75	108
PSM	LVETLQADSGLLLDALLAR	1215	sp|O60936|NOL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=3493	18.961	2	2010.1361	2010.1361	R	G	19	38
PSM	LVLEQVVTSIASVADTAEEK	1216	sp|O00410-2|IPO5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=228	1.254	2	2101.1154	2101.1154	K	F	447	467
PSM	NAPAIIFIDELDAIAPK	1217	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=1058	5.7077	2	1809.9877	1809.9877	K	R	296	313
PSM	NHLQMDDITCYWENLLSEYSK	1218	sp|Q8NBL1|PGLT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38	10-UNIMOD:4	ms_run[2]:scan=2803	15.201	3	2658.173	2658.1730	R	F	348	369
PSM	NIAELAALSQDELTSILGNAANAK	1219	sp|Q92889|XPF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=6179	33.767	3	2426.2653	2426.2653	K	Q	872	896
PSM	NINENFGPNTEMHLVPILATAIQEELEK	1220	sp|Q9ULA0|DNPEP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=3580	19.445	3	3163.586	3163.5860	R	G	174	202
PSM	NLSPYVSNELLEEAFSQFGPIER	1221	sp|P23246-2|SFPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=1734	9.4278	3	2638.2915	2638.2915	R	A	377	400
PSM	NNNIDAAIENIENMLTSENK	1222	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=2335	12.656	3	2246.0485	2246.0485	K	V	1190	1210
PSM	NSEVYQEVQAMFDTLGIPK	1223	sp|Q52LJ0-1|FA98B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=3775	20.488	2	2168.046	2168.0460	K	S	143	162
PSM	NTVLCNVVEQFLQADLAR	1224	sp|Q14258|TRI25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38	5-UNIMOD:4	ms_run[2]:scan=6288	34.36	2	2089.0626	2089.0626	K	E	66	84
PSM	QEGCQDIATQLISNMDIDVILGGGR	1225	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38	4-UNIMOD:4	ms_run[2]:scan=4141	22.5	3	2702.3004	2702.3004	R	K	199	224
PSM	QEGLDGGLPEEVLFGNLDLLPPPGK	1226	sp|Q8N163-2|CCAR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=741	4.0134	3	2603.3483	2603.3483	R	S	764	789
PSM	QLGVAESESSGAPIDLLYELVK	1227	sp|O95785-4|WIZ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=435	2.3785	2	2317.2053	2317.2053	R	Q	79	101
PSM	RQITASELLSSAIITEEMLQDLETGR	1228	sp|P58107|EPIPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=5950	32.492	3	2903.491	2903.4910	R	S	2179	2205
PSM	RYADTLFDILVAGSMLAPGGTR	1229	sp|Q9Y6E2-2|BZW2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=1782	9.6922	3	2323.1995	2323.1995	R	I	63	85
PSM	SENLDNPIQTVSLGQSLFFHFPPLLR	1230	sp|Q5JPE7-3|NOMO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=4033	21.93	3	2968.5447	2968.5447	K	D	913	939
PSM	SLQDIIAILGMDELSEEDK	1231	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=6922	37.913	2	2118.0402	2118.0402	K	L	433	452
PSM	SLSALGNVISALAEGSTYVPYR	1232	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=1248	6.7696	3	2267.1798	2267.1798	K	D	257	279
PSM	SQVVIPILQWAIASTTLDHR	1233	sp|Q9Y5L0-5|TNPO3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=3909	21.246	3	2247.2376	2247.2376	R	D	706	726
PSM	SQVVIPILQWAIASTTLDHR	1234	sp|Q9Y5L0-5|TNPO3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=4009	21.799	3	2247.2376	2247.2376	R	D	706	726
PSM	SVFVGNIPYEATEEQLKDIFSEVGPVVSFR	1235	sp|P33240-2|CSTF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=6357	34.73	3	3355.6976	3355.6976	R	L	17	47
PSM	TAFDEAIAELDTLSEESYK	1236	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=519	2.7934	3	2130.9845	2130.9845	K	D	194	213
PSM	TEPATGFIDGDLIESFLDISRPK	1237	sp|Q16531-2|DDB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=3083	16.727	3	2520.2748	2520.2748	K	M	393	416
PSM	TISPEHVIQALESLGFGSYISEVK	1238	sp|Q01658|NC2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=7479	41.034	3	2603.3483	2603.3483	K	E	65	89
PSM	TMADSSYNLEVQNILSFLK	1239	sp|Q96AC1-2|FERM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=2529	13.693	2	2172.0773	2172.0773	K	M	479	498
PSM	TVDLQDAEEAVELVQYAYFK	1240	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=4765	25.903	3	2330.1318	2330.1318	K	K	636	656
PSM	TVPFLPLLGGCIDDTILSR	1241	sp|Q7Z7H8|RM10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38	11-UNIMOD:4	ms_run[2]:scan=1107	5.986	2	2086.1133	2086.1133	R	Q	170	189
PSM	TVSLGAGAKDELHIVEAEAMNYEGSPIK	1242	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=7227	39.631	4	2928.4539	2928.4539	R	V	46	74
PSM	TVSLGAGAKDELHIVEAEAMNYEGSPIK	1243	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=6977	38.23	3	2928.4539	2928.4539	R	V	46	74
PSM	TVSLGAGAKDELHIVEAEAMNYEGSPIK	1244	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=7075	38.777	3	2928.4539	2928.4539	R	V	46	74
PSM	VADNLAIQLAAVTEDKYEILQSVDDAAIVIK	1245	sp|Q12906-5|ILF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=2620	14.178	3	3327.7814	3327.7814	K	N	128	159
PSM	VETELQGVCDTVLGLLDSHLIK	1246	sp|P31947|1433S_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38	9-UNIMOD:4	ms_run[2]:scan=6141	33.552	2	2438.2727	2438.2727	K	E	88	110
PSM	VFIMDNCEELIPEYLNFIR	1247	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38	7-UNIMOD:4	ms_run[2]:scan=1225	6.6401	3	2414.165	2414.1650	R	G	368	387
PSM	VGQTAFDVADEDILGYLEELQKK	1248	sp|O14974-5|MYPT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=3196	17.347	3	2580.2959	2580.2959	K	Q	177	200
PSM	VSEPLLWELFLQAGPVVNTHMPK	1249	sp|Q15427|SF3B4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=2039	11.031	3	2604.3774	2604.3774	K	D	24	47
PSM	VSGYLNLAADLAHNFTDGLAIGASFR	1250	sp|Q92504|S39A7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=6672	36.486	3	2692.3609	2692.3609	R	G	317	343
PSM	VTGQHPEVPPAFWNNAFTLLSAVSLPR	1251	sp|Q9BVI4|NOC4L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=3289	17.827	3	2947.5345	2947.5345	R	R	195	222
PSM	VTGQHPEVPPAFWNNAFTLLSAVSLPR	1252	sp|Q9BVI4|NOC4L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=3406	18.475	3	2947.5345	2947.5345	R	R	195	222
PSM	VTPQSLFILFGVYGDVQR	1253	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=772	4.1838	2	2038.0888	2038.0888	R	V	349	367
PSM	YCTFNDDIQGTAAVALAGLLAAQK	1254	sp|P23368-2|MAOM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38	2-UNIMOD:4	ms_run[2]:scan=877	4.7528	3	2510.2475	2510.2475	K	V	273	297
PSM	YHPTFFNDVFSTLFLDQPGGCHVTCLV	1255	sp|Q14166|TTL12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38	21-UNIMOD:4,25-UNIMOD:4	ms_run[2]:scan=4223	22.956	3	3170.463	3170.4630	R	-	618	645
PSM	YILEQFLQQELLINITEHELVPEHVVMTK	1256	sp|P19388|RPAB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=1622	8.8063	4	3505.8531	3505.8531	K	E	125	154
PSM	YPDSHQLFVGNLPHDIDENELKEFFMSFGNVVELR	1257	sp|Q9UN86-2|G3BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=5698	31.074	4	4134.9786	4134.9786	R	I	294	329
PSM	DGAGFLINLIDSPGHVDFSSEVTAALR	1258	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=7968	43.752045	3	2801.388298	2800.403174	K	V	94	121
PSM	DLVVLLFETALLSSGFSLEDPQTHSNR	1259	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=8269	45.439836	3	2989.516881	2987.524017	K	I	653	680
PSM	LEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICR	1260	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38	34-UNIMOD:4,47-UNIMOD:4	ms_run[1]:scan=7123	39.045364	4	5516.5806	5516.5886	K	R	167	215
PSM	QGGLLVNFHPSILTCLLPQLTSPR	1261	sp|Q86VP6|CAND1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38	1-UNIMOD:28,15-UNIMOD:4	ms_run[1]:scan=6793	37.17559	3	2643.4239	2643.4202	R	L	165	189
PSM	NVGCLQEALQLATSFAQLR	1262	sp|P49588|SYAC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38	4-UNIMOD:4	ms_run[1]:scan=4413	24.0208	3	2118.089659	2118.089174	K	L	944	963
PSM	AGWNAYIDNLMADGTCQDAAIVGYK	1263	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38	1-UNIMOD:1,11-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=3573	19.407288	2	2775.2612	2774.2312	M	D	2	27
PSM	GIEGVQVIPLIPGAGEIIIADNIIK	1264	sp|P28288|ABCD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=2919	15.821786	2	2542.479701	2541.478176	K	F	417	442
PSM	IIYLNQLLQEDSLNVADLTSLR	1265	sp|Q9UL46|PSME2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=1105	5.9747624	3	2530.372786	2530.364269	K	A	40	62
PSM	LQLETEIEALKEELLFMK	1266	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=1847	10.018108	2	2176.171206	2176.170109	R	K	197	215
PSM	MFTAGIDLMDMASDILQPK	1267	sp|Q13011|ECH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38	1-UNIMOD:35	ms_run[1]:scan=5147	28.042565	2	2111.998557	2111.994136	K	G	113	132
PSM	NLEALALDLMEPEQAVDLTLPK	1268	sp|P12956|XRCC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=4415	24.032017	3	2422.266795	2422.266529	R	V	489	511
PSM	YWGTPIPIVHCPVCGPTPVPLEDLPVTLPNIASFTGK	1269	sp|Q15031|SYLM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38	11-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=35	0.17749907	3	4044.078879	4042.073654	R	G	454	491
PSM	AEEGIAAGGVMDVNTALQEVLK	1270	sp|P25398|RS12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38	1-UNIMOD:1	ms_run[1]:scan=4552	24.758676	3	2256.1318	2256.1302	M	T	2	24
PSM	ASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGK	1271	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38	45-UNIMOD:4,48-UNIMOD:4	ms_run[1]:scan=4657	25.323178	7	5806.8857	5806.8792	R	I	13	68
PSM	IPVTDEEQTNVPYIYAIGDILEDKVELTPVAIQAGR	1272	sp|Q16881|TRXR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=3360	18.224116	4	3969.069752	3969.062280	K	L	466	502
PSM	QLTEMLPSILNQLGADSLTSLR	1273	sp|P20290|BTF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=3863	20.982438	3	2399.269545	2399.273011	K	R	142	164
PSM	DDLFNTNATIVATLTAACAQHCPEAMICVIANPVNSTIPITAEVFKK	1274	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38	18-UNIMOD:4,22-UNIMOD:4,28-UNIMOD:4	ms_run[1]:scan=7313	40.103062	4	5130.5342	5129.5332	R	H	111	158
PSM	HRDDALPFAHVAIAVEGPGWASPDNVALQVANAIIGHYDCTYGGGVHLSSPLASGAVANK	1275	sp|P31930|QCR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38	40-UNIMOD:4	ms_run[1]:scan=5598	30.530333	7	6133.0347	6133.0288	R	L	277	337
PSM	EFVEEFIWPAIQSSALYEDR	1276	sp|P00966|ASSY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=380	2.0921314	3	2429.166281	2428.158693	R	Y	67	87
PSM	AVANSSPVNPVVFFDVSIGGQEVGR	1277	sp|O43447|PPIH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38	1-UNIMOD:1	ms_run[1]:scan=2527	13.681972	3	2586.2962	2586.3072	M	M	2	27
PSM	EFVEEFIWPAIQSSALYEDR	1278	sp|P00966|ASSY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=44	0.23042187	2	2429.164646	2428.158693	R	Y	67	87
PSM	QIPVLQTNNGPSLTGLTTIAAHLVK	1279	sp|O43324|MCA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38	1-UNIMOD:28	ms_run[1]:scan=220	1.2117663	2	2568.4247	2568.4270	R	Q	29	54
PSM	GHVISQIAQEAGHDLMDIFLCDVDIR	1280	sp|O75616|ERAL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38	21-UNIMOD:4	ms_run[1]:scan=5041	27.436825	3	2950.429603	2951.426963	K	L	405	431
PSM	FNVGEDCPVFDGLFEFCQLSTGGSVASAVK	1281	sp|Q13547|HDAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38	7-UNIMOD:4,17-UNIMOD:4	ms_run[1]:scan=2295	12.443753	3	3236.479142	3236.479452	R	L	94	124
PSM	ALHSPQYIFGDFSPDEFNQFFVTPR	1282	sp|Q14694|UBP10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38	1-UNIMOD:1	ms_run[1]:scan=4201	22.835818	3	3000.4120	3000.4077	M	S	2	27
PSM	QAALGIMQMVEDTLIEHAHTKPLLPSQLVR	1283	sp|P14735|IDE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38	1-UNIMOD:28	ms_run[1]:scan=6762	36.99869	4	3321.7635	3321.7572	K	Y	736	766
PSM	FGVEQDVDMVFASFIR	1284	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=6065	33.124221	2	1858.891849	1858.892371	K	K	231	247
PSM	GGFNKPGGPMDEGPDLDLGPPVDPDEDSDNSAIYVQGLNDSVTLDDLADFFK	1285	sp|Q01844|EWS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38		ms_run[1]:scan=7259	39.803837	4	5464.4630	5464.4724	R	Q	331	383
PSM	LSPHFPHTAALDQAVGAAVTSMGPEVVLQAVPLEIDGSEETLDFPR	1286	sp|Q5JTH9|RRP12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=1620	8.7950053	4	4810.409165	4811.411637	R	S	521	567
PSM	AASQSTQVPTITEGVAAALLLLK	1287	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=5395	29.401	3	2281.2893	2281.2893	K	L	476	499
PSM	AEDDQPLPGVLLSLSGGLFR	1288	sp|Q5JPE7-3|NOMO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=4569	24.849	2	2083.095	2083.0950	K	S	717	737
PSM	AFADAMEVIPSTLAENAGLNPISTVTELR	1289	sp|P50991-2|TCPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=1610	8.7388	4	3029.538	3029.5380	R	N	423	452
PSM	ALADILSESLHSLATSLPR	1290	sp|O43156|TTI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=4319	23.497	3	1993.0844	1993.0844	K	L	369	388
PSM	APELLFRPDLIGEESEGIHEVLVFAIQK	1291	sp|P61163|ACTZ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=3403	18.458	4	3148.6809	3148.6809	R	S	258	286
PSM	AVDEAVILLQEIGVLDQR	1292	sp|Q7L2E3-3|DHX30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=1790	9.7287	3	1980.0892	1980.0892	K	E	808	826
PSM	CFLAQPVTLLDIYTHWQQTSELGR	1293	sp|Q13428-5|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:4	ms_run[2]:scan=827	4.4929	3	2875.4327	2875.4327	K	K	38	62
PSM	DALEFWLQAGVDGFQVR	1294	sp|P08195-2|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=4846	26.33	2	1949.9636	1949.9636	K	D	231	248
PSM	DGTVLCELINALYPEGQAPVK	1295	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37	6-UNIMOD:4	ms_run[2]:scan=6983	38.263	2	2286.1566	2286.1566	K	K	58	79
PSM	DIEEVSQGLLSLLGANR	1296	sp|Q8NBT2-2|SPC24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=6100	33.32	2	1812.9581	1812.9581	R	A	6	23
PSM	DQFPEVYVPTVFENYVADIEVDGK	1297	sp|P61586|RHOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=6343	34.654	3	2772.317	2772.3170	K	Q	28	52
PSM	DSGTLTLGLLLRPEGLTSVLELGPEADQPEAAK	1298	sp|Q9H6R4-3|NOL6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=2441	13.211	3	3389.793	3389.7930	K	F	546	579
PSM	DVLIQGLIDENPGLQLIIR	1299	sp|P78527-2|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=3148	17.085	3	2118.2049	2118.2049	K	N	2504	2523
PSM	EALDHMVEYVAQNTPVTWLVGPFAPGITEK	1300	sp|O60664-2|PLIN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=7059	38.684	3	3311.6537	3311.6537	R	A	216	246
PSM	EEIVQFFSGLEIVPNGMTLPVDFQGR	1301	sp|P55795|HNRH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=6618	36.192	3	2921.4633	2921.4633	K	S	125	151
PSM	EGGWDSVQDWMDVLSGGEK	1302	sp|P28288-2|ABCD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=3018	16.366	2	2093.9	2093.9000	R	Q	448	467
PSM	EIWDMFGVFFANHPDLR	1303	sp|O75489|NDUS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=4482	24.383	2	2092.9829	2092.9829	R	R	169	186
PSM	EMYTLGITNFPIPGEPGFPLNAIYAK	1304	sp|O15145|ARPC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=1564	8.4759	3	2852.4459	2852.4459	K	P	94	120
PSM	EQLPPMSEDFLLDALSEDFSGPQNASSLK	1305	sp|P20810-3|ICAL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=3751	20.364	3	3164.486	3164.4860	K	F	383	412
PSM	FDLGQDVIDFTGHALALYR	1306	sp|P50395|GDIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=2567	13.901	3	2150.0797	2150.0797	K	T	175	194
PSM	FKPFTVEIVDSVEAYATMLR	1307	sp|P36871|PGM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=7128	39.076	3	2315.1872	2315.1872	K	S	181	201
PSM	FSDPGQPMSFVLEFHFEPNDYFTNSVLTK	1308	sp|Q99733|NP1L4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=196	1.0772	3	3392.57	3392.5700	K	T	195	224
PSM	FVIPDFMSFTSHIDELYESAK	1309	sp|O94925-3|GLSK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=4019	21.852	3	2475.1668	2475.1668	K	K	219	240
PSM	GGLTGLTLTSLYALYNNWEHMK	1310	sp|O14925|TIM23_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=4078	22.174	2	2481.2362	2481.2362	R	G	180	202
PSM	GIALPANTAEGLLNVIGMDKPLTLPDFLAK	1311	sp|P00813|ADA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=7077	38.788	3	3091.6991	3091.6991	R	F	35	65
PSM	GIEAGSEDIDILPNGLAFFSVGLK	1312	sp|Q15165-1|PON2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=1614	8.7613	3	2461.2741	2461.2741	K	F	47	71
PSM	GRPVSLWELLFSEAISSEQR	1313	sp|P58107|EPIPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=978	5.27	3	2303.191	2303.1910	R	A	505	525
PSM	GSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHNK	1314	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=7526	41.302	5	4290.1208	4290.1208	R	Q	86	126
PSM	GVGAAATAVTQALNELLQHVK	1315	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=3487	18.93	3	2090.1484	2090.1484	R	A	766	787
PSM	HFYWYLTNEGIQYLRDYLHLPPEIVPATLR	1316	sp|P46783|RS10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=5308	28.921	4	3716.9144	3716.9144	R	R	66	96
PSM	HGWEELVYYTVPLIQEMESR	1317	sp|O75323-2|NIPS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=5420	29.544	3	2478.1889	2478.1889	K	I	217	237
PSM	ILLDQVEEAVADFDECIR	1318	sp|O94826|TOM70_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37	16-UNIMOD:4	ms_run[2]:scan=5702	31.093	3	2134.0252	2134.0252	K	L	412	430
PSM	ILTNSNLPEEELDFFEILR	1319	sp|Q9UIV1-2|CNOT7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=691	3.7359	2	2291.1685	2291.1685	K	L	168	187
PSM	IMEDLLSSYPDLAEVHALEALIHFTK	1320	sp|Q6PGP7|TTC37_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=3903	21.213	4	2954.5099	2954.5099	K	K	408	434
PSM	IQDLPPVDLSLVNKDENAIYFLGNSLGLQPK	1321	sp|Q16719-2|KYNU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=272	1.4937	4	3409.8133	3409.8133	K	M	51	82
PSM	ISIPVDISDSDMMLNIINSSITTK	1322	sp|P49368-2|TCPG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=2281	12.365	3	2606.3183	2606.3183	K	A	102	126
PSM	ITGMLLEIDNSELLHMLESPESLR	1323	sp|P11940-2|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=560	3.015	2	2739.3823	2739.3823	K	S	492	516
PSM	IVAFADAAVEPIDFPIAPVYAASMVLK	1324	sp|P24752|THIL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=6483	35.44	2	2817.5027	2817.5027	R	D	312	339
PSM	IVQDIFNYIYSMDENLEFHIK	1325	sp|P33176|KINH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=5291	28.826	3	2630.2727	2630.2727	R	V	111	132
PSM	KYGDIPEYVLAYIDYLSHLNEDNNTR	1326	sp|Q12996|CSTF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=6309	34.473	4	3114.4934	3114.4934	K	V	439	465
PSM	LASEILMQNWDAAMEDLTR	1327	sp|P60228|EIF3E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=532	2.864	3	2206.0398	2206.0398	K	L	173	192
PSM	LCYVALDFEQEMATAASSSSLEK	1328	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37	2-UNIMOD:4	ms_run[2]:scan=1096	5.9242	2	2549.1666	2549.1666	K	S	216	239
PSM	LCYVALDFEQEMATAASSSSLEK	1329	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37	2-UNIMOD:4	ms_run[2]:scan=1586	8.6011	3	2549.1666	2549.1666	K	S	216	239
PSM	LEQFVSILMASIPLPDK	1330	sp|P00491|PNPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=5898	32.206	2	1900.038	1900.0380	K	A	271	288
PSM	LEQFVSILMASIPLPDK	1331	sp|P00491|PNPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=5997	32.737	2	1900.038	1900.0380	K	A	271	288
PSM	LFNDSSPVVLEESWDALNAITK	1332	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=1269	6.8903	3	2447.222	2447.2220	R	K	2200	2222
PSM	LFNDSSPVVLEESWDALNAITK	1333	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=1272	6.9072	2	2447.222	2447.2220	R	K	2200	2222
PSM	LFNDSSPVVLEESWDALNAITK	1334	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=1378	7.484	2	2447.222	2447.2220	R	K	2200	2222
PSM	LHEEEIQELQAQIQEQHVQIDVDVSKPDLTAALR	1335	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=6905	37.814	4	3922.0072	3922.0072	K	D	237	271
PSM	LSGDWNPLHIDPNFASLAGFDKPILHGLCTFGFSAR	1336	sp|P51659-3|DHB4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37	29-UNIMOD:4	ms_run[2]:scan=2116	11.464	5	3969.9625	3969.9625	R	R	489	525
PSM	LSIAEVVHQLQEIAAAR	1337	sp|O14976-2|GAK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=2755	14.936	3	1847.0265	1847.0265	R	N	225	242
PSM	LTTVLNSGFLDEWLTLEDVPSGR	1338	sp|Q9BSJ8|ESYT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=3878	21.07	2	2561.3013	2561.3013	R	L	738	761
PSM	LVLEQVVTSIASVADTAEEK	1339	sp|O00410-2|IPO5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=226	1.2428	3	2101.1154	2101.1154	K	F	447	467
PSM	LYNNITFEELGALLEIPAAK	1340	sp|Q9BT78-2|CSN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=3414	18.52	2	2218.1885	2218.1885	K	H	315	335
PSM	MFTAGIDLMDMASDILQPK	1341	sp|Q13011|ECH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:35	ms_run[2]:scan=4994	27.174	2	2111.9941	2111.9941	K	G	113	132
PSM	MNYIGQFLPGYEAPAFMDPLLPK	1342	sp|P32754-2|HPPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=1477	7.9961	2	2611.2855	2611.2855	K	L	111	134
PSM	NAPAIIFIDELDAIAPK	1343	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=949	5.1351	2	1809.9877	1809.9877	K	R	296	313
PSM	NAPAIIFIDELDAIAPK	1344	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=1157	6.2658	2	1809.9877	1809.9877	K	R	296	313
PSM	NITDYLIEEVSAEEEELLGSSGGAPPEEPPKEGNPAEINVER	1345	sp|Q9BXP5-5|SRRT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=6082	33.222	4	4507.1402	4507.1402	K	D	523	565
PSM	NWYIQATCATSGDGLYEGLDWLSNQLR	1346	sp|P84077|ARF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37	8-UNIMOD:4	ms_run[2]:scan=5097	27.757	3	3130.4454	3130.4454	R	N	152	179
PSM	QPMVPESLADYITAAYVEMR	1347	sp|P33993-3|MCM7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=3212	17.436	2	2283.0915	2283.0915	K	R	394	414
PSM	RDFIATLEAEAFDDVVGETVGK	1348	sp|P27816-7|MAP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=3770	20.46	3	2381.1751	2381.1751	K	T	23	45
PSM	RSVFQTINQFLDLTLFTHR	1349	sp|P53985|MOT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=4801	26.101	3	2335.2437	2335.2437	K	G	243	262
PSM	SGSFINSLLQLEELGFR	1350	sp|Q5UIP0-2|RIF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=3262	17.684	2	1908.9945	1908.9945	R	S	267	284
PSM	SLGYDLPMVEEGEPDPEFEAILDTVDPNR	1351	sp|Q13813-3|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=3871	21.027	3	3246.4915	3246.4915	R	D	2334	2363
PSM	SLLSIPNTDYIQLLSEIAK	1352	sp|O75569-3|PRKRA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=2543	13.777	2	2117.162	2117.1620	R	E	207	226
PSM	SLPIVFDEFVDMDFGTGAVK	1353	sp|P26640|SYVC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=1304	7.0848	2	2186.0606	2186.0606	R	I	572	592
PSM	SLTAGWHVELDPFTASTPLGPVDFGNVVATLDPR	1354	sp|Q9NXS2|QPCTL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=6203	33.897	3	3578.8045	3578.8045	R	A	125	159
PSM	SQEPLPDDDEEFELPEFVEPFLK	1355	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=1104	5.9691	3	2748.2694	2748.2694	K	D	367	390
PSM	STAISLFYELSENDLNFIK	1356	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=3151	17.102	2	2203.1049	2203.1049	K	Q	72	91
PSM	TASPLEHILQTLFGK	1357	sp|Q9BTC0|DIDO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=4789	26.034	2	1653.909	1653.9090	K	K	1310	1325
PSM	TIESILEPVAQQISHLVIMHEEGEVDGK	1358	sp|P18206-2|VINC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=4442	24.18	3	3100.5751	3100.5751	R	A	8	36
PSM	TPIIIIPAATTSLITMLNAK	1359	sp|Q6P1J9|CDC73_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=1818	9.8676	2	2081.217	2081.2170	R	D	359	379
PSM	TPIIIIPAATTSLITMLNAK	1360	sp|Q6P1J9|CDC73_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=1735	9.4334	3	2081.217	2081.2170	R	D	359	379
PSM	TVASPGVTVEEAVEQIDIGGVTLLR	1361	sp|P31939-2|PUR9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=1070	5.7755	2	2552.3697	2552.3697	K	A	108	133
PSM	TVSLGAGAKDELHIVEAEAMNYEGSPIK	1362	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=7048	38.622	4	2928.4539	2928.4539	R	V	46	74
PSM	VIFDIVDLCTTWEAMEK	1363	sp|P42330-2|AK1C3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37	9-UNIMOD:4	ms_run[2]:scan=1774	9.6449	2	2068.985	2068.9850	K	C	18	35
PSM	VTNLLQLPQYFDLEIYTTGR	1364	sp|Q8N3U4|STAG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=351	1.9395	2	2383.2424	2383.2424	K	L	585	605
PSM	VTPQSLFILFGVYGDVQR	1365	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=871	4.7227	2	2038.0888	2038.0888	R	V	349	367
PSM	WLLAEMLGDLSDSQLK	1366	sp|Q9UBQ5-2|EIF3K_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=3276	17.759	2	1817.9233	1817.9233	R	V	156	172
PSM	GPSIALDTACSSSLMALQNAYQAIHSGQCPAAIVGGINVLLKPNTSVQFLR	1367	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37	10-UNIMOD:4,29-UNIMOD:4	ms_run[1]:scan=5810	31.70622	4	5338.7218	5338.7259	R	L	152	203
PSM	LMEPIYLVEIQCPEQVVGGIYGVLNR	1368	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37	12-UNIMOD:4	ms_run[1]:scan=6423	35.101003	2	2989.541522	2988.545287	R	K	740	766
PSM	MEEEIAALVIDNGSGMCK	1369	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37	1-UNIMOD:1,17-UNIMOD:4	ms_run[1]:scan=2242	12.161332	2	2007.8950	2007.8946	-	A	1	19
PSM	LCYVALDFEQEMATAASSSSLEK	1370	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37	2-UNIMOD:4	ms_run[1]:scan=8468	46.573424	2	2549.164934	2549.166557	K	S	216	239
PSM	LCYVALDFEQEMATAASSSSLEK	1371	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37	2-UNIMOD:4	ms_run[1]:scan=1182	6.4062085	3	2549.174646	2549.166557	K	S	216	239
PSM	KPLVIIAEDVDGEALSTLVLNR	1372	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=6169	33.70837	3	2365.328901	2364.326427	R	L	269	291
PSM	GILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVK	1373	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=6933	37.977382	5	4034.893974	4035.887504	K	L	272	310
PSM	DCDPTTGETDDEGYEDEYVLEDLEVTVADHIQK	1374	sp|Q9Y678|COPG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37	2-UNIMOD:4	ms_run[1]:scan=1056	5.6976748	3	3799.582633	3799.605436	K	V	734	767
PSM	NVGCLQEALQLATSFAQLR	1375	sp|P49588|SYAC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37	4-UNIMOD:4	ms_run[1]:scan=4321	23.50815	3	2118.089659	2118.089174	K	L	944	963
PSM	IGYNPDTVAFVPISGWNGDNMLEPSANMPWFK	1376	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=4340	23.614306	3	3567.647572	3566.663898	K	G	181	213
PSM	AGWNAYIDNLMADGTCQDAAIVGYK	1377	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=130	0.70559725	3	2758.2371	2758.2362	M	D	2	27
PSM	AGWNAYIDNLMADGTCQDAAIVGYK	1378	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=3732	20.25828	3	2758.2397	2758.2362	M	D	2	27
PSM	AGWNAYIDNLMADGTCQDAAIVGYK	1379	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=3432	18.622943	3	2758.2397	2758.2362	M	D	2	27
PSM	DNTIEHLLPLFLAQLKDECPEVR	1380	sp|P30153|2AAA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37	19-UNIMOD:4	ms_run[1]:scan=1104	5.9691395	3	2749.415238	2749.410902	K	L	359	382
PSM	QGQYSPMAIEEQVAVIYAGVR	1381	sp|P25705|ATPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37	1-UNIMOD:28	ms_run[1]:scan=3616	19.639892	2	2291.1253	2291.1251	K	G	473	494
PSM	GTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVK	1382	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=4426	24.091496	3	4147.984029	4147.984364	K	S	287	323
PSM	MVNPTVFFDIAVDGEPLGR	1383	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=5418	29.532934	2	2134.0403	2134.0400	-	V	1	20
PSM	ADAFGDELFSVFEGDSTTAAGTKK	1384	sp|P42285|MTREX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37	1-UNIMOD:1	ms_run[1]:scan=80	0.43271795	2	2505.1541	2505.1542	M	D	2	26
PSM	GQNDLMGTAEDFADQFLR	1385	sp|O15260|SURF4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37		ms_run[1]:scan=2505	13.558706	2	2026.9074	2026.9049	M	V	2	20
PSM	EFVEEFIWPAIQSSALYEDR	1386	sp|P00966|ASSY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=344	1.9001459	2	2429.159031	2428.158693	R	Y	67	87
PSM	QGLNGVPILSEEELSLLDEFYK	1387	sp|Q14444|CAPR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=5546	30.246516	2	2493.252529	2492.268637	K	L	170	192
PSM	QFTTVVADTGDFHAIDEYKPQDATTNPSLILAAAQMPAYQELVEEAIAYGR	1388	sp|P37837|TALDO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37		ms_run[1]:scan=7534	41.345021	4	5569.7082	5568.7032	K	K	20	71
PSM	QLTEMLPSILNQLGADSLTSLR	1389	sp|P20290|BTF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=3845	20.884634	2	2399.268175	2399.273011	K	R	142	164
PSM	IPNFWVTTFVNHPQVSALLGEEDEEALHYLTR	1390	sp|Q01105|SET_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=1214	6.585094	4	3724.858124	3724.852562	K	V	91	123
PSM	DGLEDPLEDTGLVQQQLDQLSTIGR	1391	sp|Q9UIA9|XPO7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=46	0.23917635	3	2740.368307	2739.356283	R	C	427	452
PSM	AFADAMEVIPSTLAENAGLNPISTVTELR	1392	sp|P50991|TCPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37	6-UNIMOD:35	ms_run[1]:scan=1428	7.7355612	3	3048.516194	3045.532868	R	N	453	482
PSM	DSVNPGVMVLLGCGALSSTCGQLASYPLALVR	1393	sp|Q6NUK1|SCMC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37	8-UNIMOD:35,13-UNIMOD:4,20-UNIMOD:4	ms_run[1]:scan=4494	24.444692	3	3321.689162	3320.656705	K	T	379	411
PSM	GQGVYLGMPGCLPVYDALAGEFIR	1394	sp|P30040|ERP29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37	8-UNIMOD:35,11-UNIMOD:4	ms_run[1]:scan=36	0.1831156	3	2600.3012	2598.2602	K	A	147	171
PSM	FGVEQDVDMVFASFIR	1395	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=5856	31.967044	2	1858.891849	1858.892371	K	K	231	247
PSM	KLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTALPDEDDDL	1396	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37	23-UNIMOD:35	ms_run[1]:scan=6305	34.450372	4	5403.6362	5402.6092	R	-	167	217
PSM	GGFNKPGGPMDEGPDLDLGPPVDPDEDSDNSAIYVQGLNDSVTLDDLADFFK	1397	sp|Q01844|EWS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37		ms_run[1]:scan=7158	39.237493	4	5464.4630	5464.4724	R	Q	331	383
PSM	MELSDANLQTLTEYLK	1398	sp|P55060|XPO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37	1-UNIMOD:1	ms_run[1]:scan=1905	10.304035	2	1909.9359	1909.9338	-	K	1	17
PSM	MELSDANLQTLTEYLK	1399	sp|P55060|XPO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37	1-UNIMOD:1	ms_run[1]:scan=1799	9.7736246	2	1909.9359	1909.9338	-	K	1	17
PSM	LGDPAEYAHLVQAIIENPFLNGEVIR	1400	sp|Q99714|HCD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=7578	41.577228	3	2879.516975	2877.502494	R	L	227	253
PSM	KPPTFGDASVIALELLNSGYEFDEGSIIFNK	1401	sp|P36542|ATPG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=7570	41.533619	3	3371.710294	3370.697290	R	F	159	190
PSM	GILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVK	1402	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=2680	14.513485	4	4038.910857	4035.887504	K	L	272	310
PSM	AADHLEALAAIEDFFLEHEALGISMAK	1403	sp|Q13144|EI2BE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=5388	29.364	4	2911.4426	2911.4426	R	V	639	666
PSM	AASQSTQVPTITEGVAAALLLLK	1404	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=5493	29.95	3	2281.2893	2281.2893	K	L	476	499
PSM	AFAFVTFADDQIAQSLCGEDLIIK	1405	sp|Q13148-4|TADBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36	17-UNIMOD:4	ms_run[2]:scan=3944	21.44	3	2671.3204	2671.3204	R	G	112	136
PSM	AHQNTLEVYPPFLFFLAVGGVYHPR	1406	sp|O14880|MGST3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=3124	16.957	3	2871.4861	2871.4861	R	I	60	85
PSM	ALDLFSDNAPPPELLEIINEDIAK	1407	sp|Q15084-3|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=6459	35.305	2	2636.3585	2636.3585	R	R	262	286
PSM	ALDLFSDNAPPPELLEIINEDIAKR	1408	sp|Q15084-3|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=1470	7.9603	4	2792.4596	2792.4596	R	T	262	287
PSM	ALMLQGVDLLADAVAVTMGPK	1409	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36	18-UNIMOD:35	ms_run[2]:scan=893	4.8379	2	2128.1272	2128.1272	R	G	38	59
PSM	AVRPWQWAWRPPPFDTLTTSPWLQLFINAR	1410	sp|O15067|PUR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=7409	40.645	4	3649.9099	3649.9099	R	N	1301	1331
PSM	CDAIVDLIHDIQIVSTTR	1411	sp|Q8TEM1-2|PO210_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:4	ms_run[2]:scan=3495	18.972	2	2068.0623	2068.0623	R	E	109	127
PSM	DELILEGNDIELVSNSAALIQQATTVK	1412	sp|P32969|RL9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=2409	13.036	3	2883.5077	2883.5077	K	N	142	169
PSM	DGIEFAFKEPNPQGESHPPLNLAFLDILSEFSSK	1413	sp|Q8N3U4|STAG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=6778	37.091	4	3772.8625	3772.8625	K	L	976	1010
PSM	DGTVLCELINALYPEGQAPVK	1414	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36	6-UNIMOD:4	ms_run[2]:scan=6783	37.119	2	2286.1566	2286.1566	K	K	58	79
PSM	DLVEISPNPAVTLENFLHWR	1415	sp|Q13444-13|ADA15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=6574	35.96	3	2349.2117	2349.2117	R	R	253	273
PSM	DLVEISPNPAVTLENFLHWR	1416	sp|Q13444-13|ADA15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=6679	36.528	3	2349.2117	2349.2117	R	R	253	273
PSM	DMAIATGGAVFGEEGLTLNLEDVQPHDLGK	1417	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=82	0.44398	3	3096.5074	3096.5074	K	V	315	345
PSM	DQFPEVYVPTVFENYVADIEVDGK	1418	sp|P61586|RHOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=6243	34.107	3	2772.317	2772.3170	K	Q	28	52
PSM	DVLGMAQDEMAQAFEDWNK	1419	sp|P52209-2|6PGD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=6703	36.664	3	2196.9456	2196.9456	K	T	194	213
PSM	DVQNTFYDIVAELGAMEHAQAVDYIKK	1420	sp|P16435|NCPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=6089	33.26	3	3067.4961	3067.4961	R	L	638	665
PSM	ECFGACLFTCYDLLRPDVVLETAWR	1421	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36	2-UNIMOD:4,6-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=4152	22.562	3	3090.4402	3090.4402	R	H	1564	1589
PSM	EEIVQFFSGLEIVPNGITLPVDPEGK	1422	sp|P52597|HNRPF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=5239	28.531	3	2826.4691	2826.4691	K	I	125	151
PSM	EGFDALDPFIPILVSNYNPK	1423	sp|P51398-2|RT29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=2810	15.238	2	2248.1416	2248.1416	K	E	291	311
PSM	EIIDTNGAGDAFVGGFLSQLVSDKPLTECIR	1424	sp|P55263-3|ADK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36	29-UNIMOD:4	ms_run[2]:scan=1316	7.1456	3	3321.6551	3321.6551	K	A	251	282
PSM	EILQEEEDLAEIVQLVGK	1425	sp|P38606-2|VATA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=317	1.7504	2	2054.0783	2054.0783	K	A	448	466
PSM	EISYLESEMYQLSHLLTEQK	1426	sp|Q8IYI6|EXOC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=506	2.7291	3	2440.1832	2440.1832	R	S	76	96
PSM	EITFENGEELTEEGLPFLILFHMK	1427	sp|Q9BS26|ERP44_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=7343	40.274	3	2835.4041	2835.4041	R	E	247	271
PSM	ENAPAIIFIDEIDAIATK	1428	sp|P43686-2|PRS6B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=7012	38.428	2	1943.0252	1943.0252	K	R	225	243
PSM	ENAPAIIFIDEIDAIATK	1429	sp|P43686-2|PRS6B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=7108	38.961	2	1943.0252	1943.0252	K	R	225	243
PSM	EPDVLILDEPTNNLDIESIDALGEAINEYK	1430	sp|Q8NE71-2|ABCF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=4757	25.86	3	3341.6402	3341.6402	R	G	722	752
PSM	EVVPGDSVNSLLSILDVITGHQHPQR	1431	sp|Q8IY17-5|PLPL6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=4197	22.813	4	2809.4723	2809.4723	K	T	208	234
PSM	EVVPGDSVNSLLSILDVITGHQHPQR	1432	sp|Q8IY17-5|PLPL6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=4308	23.432	4	2809.4723	2809.4723	K	T	208	234
PSM	FDAVSGDYYPIIYFNDYWNLQK	1433	sp|O96005-3|CLPT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=2699	14.62	3	2730.2642	2730.2642	K	D	166	188
PSM	FIEAEQVPELEAVLHLVIASSDTR	1434	sp|Q5VYK3|ECM29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=6862	37.57	3	2665.3963	2665.3963	K	H	250	274
PSM	FSDPGQPMSFVLEFHFEPNDYFTNSVLTK	1435	sp|Q99733|NP1L4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=304	1.6746	3	3392.57	3392.5700	K	T	195	224
PSM	FYLLYIRPEGQDSAFSWTDLLLK	1436	sp|P56192|SYMC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=3723	20.208	3	2774.432	2774.4320	R	N	619	642
PSM	GANQHATDEEGKDPLSIAVEAANADIVTLLR	1437	sp|Q15057|ACAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=4474	24.344	4	3217.6215	3217.6215	R	L	697	728
PSM	GEPGAAPLSAPAFSLVFPFLK	1438	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=4909	26.689	2	2115.1405	2115.1405	K	M	966	987
PSM	GFQQILAGEYDHLPEQAFYMVGPIEEAVAK	1439	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=2631	14.243	4	3349.6329	3349.6329	K	A	490	520
PSM	GFTQLQTLILPQHVNCPGGINAWNTITSYIDNQICQGQK	1440	sp|Q6UW56-2|ARAID_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36	16-UNIMOD:4,35-UNIMOD:4	ms_run[2]:scan=4278	23.265	4	4427.1791	4427.1791	R	N	57	96
PSM	GILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVK	1441	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=942	5.1023	4	4035.8875	4035.8875	K	L	272	310
PSM	GLDIPLLDNVINYSFPAK	1442	sp|Q8TDD1|DDX54_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=5125	27.916	2	1988.0619	1988.0619	R	G	401	419
PSM	GLDYYTGVIYEAVLLQTPAQAGEEPLGVGSVAAGGR	1443	sp|P12081-3|HARS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=1550	8.3946	3	3620.8362	3620.8362	R	Y	267	303
PSM	GNFTLPEVAECFDEITYVELQK	1444	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36	11-UNIMOD:4	ms_run[2]:scan=1885	10.207	3	2601.2309	2601.2309	K	E	619	641
PSM	GPQLAAQNLGISLANLLLSK	1445	sp|P08397-4|HEM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=1999	10.811	3	2020.1681	2020.1681	R	G	269	289
PSM	GRPVSLWELLFSEAISSEQR	1446	sp|P58107|EPIPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=968	5.2207	3	2303.191	2303.1910	R	A	505	525
PSM	GSDWLGDQDAIHYMTEQAPAAVVELENYGMPFSR	1447	sp|P31040|SDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=3924	21.327	4	3796.7138	3796.7138	K	T	129	163
PSM	GVPQIEVTFDIDANGILNVSAVDK	1448	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=8255	45.364	2	2513.3013	2513.3013	R	S	470	494
PSM	GVPQIEVTFEIDVNGILR	1449	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=7507	41.197	2	1998.0786	1998.0786	R	V	493	511
PSM	HNDDEQYAWESSAGGSFTVR	1450	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=7285	39.946	3	2254.9516	2254.9516	K	T	154	174
PSM	HYLPLSSILDTLDVMAYNK	1451	sp|P06865|HEXA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=310	1.711	3	2192.1187	2192.1187	R	L	179	198
PSM	IMLSFHEEQEVLPETFLANFPSLIK	1452	sp|O60502-2|OGA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=1518	8.2204	3	2931.5092	2931.5092	K	M	753	778
PSM	IQDLPPVDLSLVNKDENAIYFLGNSLGLQPK	1453	sp|Q16719-2|KYNU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=415	2.2798	4	3409.8133	3409.8133	K	M	51	82
PSM	ITVVGVGQVGMACAISILGK	1454	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36	13-UNIMOD:4	ms_run[2]:scan=7412	40.662	2	1972.0849	1972.0849	K	S	24	44
PSM	KEEQVISLGPQVAEGENVFGVCHIFASFNDTFVHVTDLSGK	1455	sp|P62263|RS14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36	22-UNIMOD:4	ms_run[2]:scan=542	2.919	5	4504.2009	4504.2009	K	E	10	51
PSM	KGDLSPAELMMLTIGDVIK	1456	sp|Q9H9T3|ELP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=3022	16.389	3	2030.0792	2030.0792	R	Q	6	25
PSM	KLPLTALAQNMQEASTQLEDSLLGK	1457	sp|Q68EM7-4|RHG17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=2232	12.105	3	2698.4211	2698.4211	K	M	68	93
PSM	KNIVSLLLSMLGHDEDNTR	1458	sp|Q92616|GCN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=918	4.9766	3	2154.1103	2154.1103	R	I	2425	2444
PSM	KPLVIIAEDVDGEALSTLVLNR	1459	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=8995	49.4	3	2364.3264	2364.3264	R	L	269	291
PSM	LCYVALDFEQEMATAASSSSLEK	1460	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36	2-UNIMOD:4	ms_run[2]:scan=549	2.9583	2	2549.1666	2549.1666	K	S	216	239
PSM	LDGAIDQLLTQSPGDYIPISYEQIYSCVYK	1461	sp|Q86Y37-4|CACL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36	27-UNIMOD:4	ms_run[2]:scan=2034	11.003	3	3448.6748	3448.6748	K	C	17	47
PSM	LFIGGLPNYLNDDQVKELLTSFGPLK	1462	sp|P26368-2|U2AF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=5330	29.044	3	2890.548	2890.5480	K	A	261	287
PSM	LFIGGLPNYLNDDQVKELLTSFGPLK	1463	sp|P26368-2|U2AF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=5425	29.572	3	2890.548	2890.5480	K	A	261	287
PSM	LGAGYPMGPFELLDYVGLDTTK	1464	sp|Q16836|HCDH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=5713	31.153	2	2356.1661	2356.1661	K	F	250	272
PSM	LLAYVEGFQEDLNTTFNQLTQSASEQGLAK	1465	sp|P57678|GEMI4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=4749	25.819	3	3314.6307	3314.6307	K	A	515	545
PSM	LLIVSNPVDILTYVAWK	1466	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=4787	26.025	3	1943.1132	1943.1132	K	I	133	150
PSM	LLIVSNPVDILTYVAWK	1467	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=4613	25.086	2	1943.1132	1943.1132	K	I	133	150
PSM	LLIVSNPVDILTYVAWK	1468	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=4710	25.612	2	1943.1132	1943.1132	K	I	133	150
PSM	LLQDSVDFSLADAINTEFK	1469	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=7377	40.46	2	2125.0579	2125.0579	R	N	79	98
PSM	LLQDSVDFSLADAINTEFK	1470	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=7398	40.58	3	2125.0579	2125.0579	R	N	79	98
PSM	LTEVKDELEPLLELVEQGIIPPGK	1471	sp|Q9NQZ2|SAS10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=4776	25.964	3	2658.4731	2658.4731	K	G	237	261
PSM	LWISNGGLADIFTVFAK	1472	sp|P49748-2|ACADV_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=6076	33.189	2	1850.9931	1850.9931	K	T	226	243
PSM	NLEALALDLMEPEQAVDLTLPK	1473	sp|P12956-2|XRCC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=4666	25.374	2	2422.2665	2422.2665	R	V	448	470
PSM	NMAEQIIQEIYSQIQSK	1474	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=7341	40.263	3	2022.0092	2022.0092	K	K	265	282
PSM	NNNIDAAIENIENMLTSENK	1475	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=2230	12.094	3	2246.0485	2246.0485	K	V	1190	1210
PSM	NQEDLLSEFGQFLPDANSSVLLSK	1476	sp|Q96ST3|SIN3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=2203	11.94	3	2650.3126	2650.3126	K	T	368	392
PSM	NSVMELIANGTLNILEEENHIK	1477	sp|Q9HAV4|XPO5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=2037	11.02	3	2480.2581	2480.2581	K	D	92	114
PSM	NTVLCNVVEQFLQADLAR	1478	sp|Q14258|TRI25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36	5-UNIMOD:4	ms_run[2]:scan=6279	34.306	3	2089.0626	2089.0626	K	E	66	84
PSM	NVEDIELWLYEVEGHLASDDYGK	1479	sp|Q13813-3|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=6451	35.258	3	2693.2497	2693.2497	R	D	686	709
PSM	QDDPFELFIAATNIR	1480	sp|Q9H0A0-2|NAT10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=109	0.58731	2	1748.8733	1748.8733	K	Y	17	32
PSM	QEGCQDIATQLISNMDIDVILGGGR	1481	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36	4-UNIMOD:4	ms_run[2]:scan=3813	20.703	2	2702.3004	2702.3004	R	K	199	224
PSM	QFVQWDELLCQLEAATQVKPAEE	1482	sp|O75935-3|DCTN3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36	10-UNIMOD:4	ms_run[2]:scan=7249	39.747	3	2731.3163	2731.3163	K	-	136	159
PSM	QGLNGVPILSEEELSLLDEFYK	1483	sp|Q14444-2|CAPR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=3207	17.408	3	2492.2686	2492.2686	K	L	170	192
PSM	QIFNVNNLNLPQVALSFGFK	1484	sp|Q9NVP1|DDX18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=1006	5.4212	3	2262.2161	2262.2161	K	V	597	617
PSM	QIFNVNNLNLPQVALSFGFK	1485	sp|Q9NVP1|DDX18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=1106	5.9804	3	2262.2161	2262.2161	K	V	597	617
PSM	RCPHPLTFDVNNPLHLDYVMAAANLFAQTYGLTGSQDR	1486	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36	2-UNIMOD:4	ms_run[2]:scan=4307	23.427	5	4302.0739	4302.0739	K	A	707	745
PSM	RDGADIHSDLFISIAQALLGGTAR	1487	sp|Q96EY1-3|DNJA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=4793	26.056	4	2496.3085	2496.3085	R	A	188	212
PSM	RPGAFAIYLEPWHLDIFEFLDLKK	1488	sp|P23921|RIR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=4906	26.674	4	2917.5531	2917.5531	K	N	293	317
PSM	SCTDSELLLHPELLSQEFLLLTLEQK	1489	sp|Q9BVC5-2|ASHWN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36	2-UNIMOD:4	ms_run[2]:scan=5473	29.846	3	3055.5788	3055.5788	R	N	47	73
PSM	SFEADAFQDLLATYGPLDNVR	1490	sp|Q9Y303|NAGA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=571	3.0732	2	2341.1226	2341.1226	R	I	162	183
PSM	SGETEDTFIADLVVGLCTGQIK	1491	sp|P06733-2|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36	17-UNIMOD:4	ms_run[2]:scan=4571	24.86	3	2352.1519	2352.1519	R	T	280	302
PSM	SGETEDTFIADLVVGLCTGQIK	1492	sp|P06733-2|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36	17-UNIMOD:4	ms_run[2]:scan=4851	26.358	3	2352.1519	2352.1519	R	T	280	302
PSM	SGETEDTFIADLVVGLCTGQIK	1493	sp|P06733-2|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36	17-UNIMOD:4	ms_run[2]:scan=6317	34.518	2	2352.1519	2352.1519	R	T	280	302
PSM	SLLSMLSDLQIYQDSFEQR	1494	sp|Q13620-3|CUL4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=4882	26.534	3	2272.1045	2272.1045	R	F	174	193
PSM	SMGEGTINGLLDELLQTR	1495	sp|P29466-2|CASP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=1962	10.607	2	1945.9779	1945.9779	R	V	16	34
PSM	SNEYQLIDCAQYFLDKIDVIK	1496	sp|P63092-3|GNAS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36	9-UNIMOD:4	ms_run[2]:scan=2593	14.038	3	2574.2676	2574.2676	R	Q	151	172
PSM	STQVPHFLLEDLLLNEWEASK	1497	sp|Q7Z478|DHX29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=1074	5.7979	3	2468.2587	2468.2587	K	C	602	623
PSM	SVLVTTVLNLEPLDEDLFR	1498	sp|O14734|ACOT8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=799	4.3344	2	2172.1678	2172.1678	R	G	25	44
PSM	TAFDEAIAELDTLSEESYK	1499	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=406	2.2307	3	2130.9845	2130.9845	K	D	194	213
PSM	TASPLEHILQTLFGK	1500	sp|Q9BTC0|DIDO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=4692	25.515	2	1653.909	1653.9090	K	K	1310	1325
PSM	TDVNKIEEFLEEVLCPPK	1501	sp|Q9Y696|CLIC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36	15-UNIMOD:4	ms_run[2]:scan=5768	31.468	3	2159.082	2159.0820	K	Y	86	104
PSM	TFDFWKDIVAAIQHNYK	1502	sp|Q5TFE4|NT5D1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=1262	6.8483	3	2095.0527	2095.0527	K	M	155	172
PSM	TITDVINIGIGGSDLGPLMVTEALKPYSSGGPR	1503	sp|P06744|G6PI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=292	1.6081	3	3327.7384	3327.7384	K	V	148	181
PSM	TSTILGDITSIPELADYIK	1504	sp|Q96AC1-2|FERM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=414	2.2742	2	2049.0882	2049.0882	K	V	362	381
PSM	TTNSFHLPDDPSIPIIMVGPGTGIAPFIGFLQHR	1505	sp|Q9UBK8|MTRR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=2563	13.885	4	3644.8814	3644.8814	R	E	526	560
PSM	TVASPGVTVEEAVEQIDIGGVTLLR	1506	sp|P31939-2|PUR9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=1133	6.1308	3	2552.3697	2552.3697	K	A	108	133
PSM	TVLLSIQALLSAPNPDDPLANDVAEQWK	1507	sp|P61088|UBE2N_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=3615	19.634	3	3017.571	3017.5710	R	T	103	131
PSM	TVLLSLQALLAAAEPDDPQDAVVANQYK	1508	sp|P61086-2|UBE2K_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=1271	6.9016	3	2952.5444	2952.5444	R	Q	57	85
PSM	TVPPAVTGITFLSGGQSEEEASINLNAINK	1509	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=7332	40.212	3	3056.5666	3056.5666	R	C	260	290
PSM	TVSLGAGAKDELHIVEAEAMNYEGSPIK	1510	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=7436	40.799	3	2928.4539	2928.4539	R	V	46	74
PSM	TWWNQFSVTALQLLQANR	1511	sp|Q99536-2|VAT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=5126	27.924	2	2175.1225	2175.1225	R	A	170	188
PSM	VADSSPFALELLISDDCFVLDNGLCGK	1512	sp|P40121-2|CAPG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36	17-UNIMOD:4,25-UNIMOD:4	ms_run[2]:scan=5676	30.954	3	2954.4042	2954.4042	K	I	251	278
PSM	VEEASPGRPSSVDTLLSPTALIDSILR	1513	sp|Q00613-2|HSF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=649	3.5078	3	2822.5026	2822.5026	R	E	310	337
PSM	VETELQGVCDTVLGLLDSHLIK	1514	sp|P31947|1433S_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36	9-UNIMOD:4	ms_run[2]:scan=6046	33.018	2	2438.2727	2438.2727	K	E	88	110
PSM	VFIMDNCEELIPEYLNFIR	1515	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36	7-UNIMOD:4	ms_run[2]:scan=1129	6.1083	3	2414.165	2414.1650	R	G	368	387
PSM	VFIMDNCEELIPEYLNFIR	1516	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36	7-UNIMOD:4	ms_run[2]:scan=1322	7.1793	3	2414.165	2414.1650	R	G	368	387
PSM	VFPDKEVMLDAALALAAEISSK	1517	sp|Q13011|ECH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=6297	34.409	3	2317.2239	2317.2239	R	S	246	268
PSM	VGCLQLINALITPAEELDFR	1518	sp|O60610-2|DIAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36	3-UNIMOD:4	ms_run[2]:scan=1757	9.5568	3	2271.1933	2271.1933	K	V	303	323
PSM	VGETAPPNAYTVTDLVEYSIVIQQLSNGK	1519	sp|P39656-2|OST48_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=1348	7.3178	3	3105.587	3105.5870	R	W	279	308
PSM	VGHFASQFLGYQQHDSQELLSFLLDGLHEDLNR	1520	sp|P51784|UBP11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=2912	15.78	5	3812.8547	3812.8547	K	V	386	419
PSM	VLCELADLQDKEVGDGTTSVVIIAAELLK	1521	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36	3-UNIMOD:4	ms_run[2]:scan=4066	22.11	3	3098.6421	3098.6421	K	N	74	103
PSM	VLCELADLQDKEVGDGTTSVVIIAAELLK	1522	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36	3-UNIMOD:4	ms_run[2]:scan=3902	21.207	4	3098.6421	3098.6421	K	N	74	103
PSM	VLLYGLGEIFPIENIYSATK	1523	sp|Q99504-2|EYA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=1832	9.9401	2	2239.214	2239.2140	K	I	367	387
PSM	VSVVPDEVATIAAEVTSFSNR	1524	sp|Q8NFF5-3|FAD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=212	1.1644	3	2190.1168	2190.1168	R	F	52	73
PSM	VTDPVGDIVSFMHSFEEK	1525	sp|Q96CS3|FAF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=1179	6.3894	3	2035.9561	2035.9561	R	Y	129	147
PSM	WLPAGDALLQMITIHLPSPVTAQK	1526	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=5355	29.183	2	2599.4196	2599.4196	R	Y	343	367
PSM	YLPPATQVVLISATLPHEILEMTNK	1527	sp|P38919|IF4A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=3357	18.207	3	2777.5037	2777.5037	R	F	207	232
PSM	DGAGFLINLIDSPGHVDFSSEVTAALR	1528	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=8283	45.520865	3	2800.390495	2800.403174	K	V	94	121
PSM	VFIMDSCDELIPEYLNFIR	1529	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36	7-UNIMOD:4	ms_run[1]:scan=1863	10.093719	3	2373.139087	2373.138492	R	G	360	379
PSM	DMAIATGGAVFGEEGLTLNLEDVQPHDLGK	1530	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=8240	45.274498	3	3096.490847	3096.507381	K	V	315	345
PSM	GILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVK	1531	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=8235	45.246469	4	4035.866354	4035.887504	K	L	272	310
PSM	GILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVK	1532	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=1188	6.4398355	4	4034.891709	4035.887504	K	L	272	310
PSM	SGETEDTFIADLVVGLCTGQIK	1533	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36	17-UNIMOD:4	ms_run[1]:scan=5197	28.318238	3	2353.152793	2352.151893	R	T	373	395
PSM	SKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICR	1534	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36	36-UNIMOD:4,49-UNIMOD:4	ms_run[1]:scan=6940	38.016668	5	5731.7102	5731.7156	K	R	165	215
PSM	QAPGQTQGGQPWTYHLVQFADLLLNHSHNVTTVTPFTAQQR	1535	sp|Q9BQG0|MBB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36	1-UNIMOD:28	ms_run[1]:scan=4991	27.154321	4	4569.2588	4569.2573	K	Q	530	571
PSM	NMAEQIIQEIYSQIQSK	1536	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=7342	40.268231	2	2022.011706	2022.009192	K	K	265	282
PSM	IGYNPDTVAFVPISGWNGDNMLEPSANMPWFK	1537	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=2412	13.05048	4	3566.666439	3566.663898	K	G	181	213
PSM	IGYNPDTVAFVPISGWNGDNMLEPSANMPWFK	1538	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36	21-UNIMOD:35	ms_run[1]:scan=2294	12.43812	3	3583.689601	3582.658813	K	G	181	213
PSM	IGYNPDTVAFVPISGWNGDNMLEPSANMPWFK	1539	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36		ms_run[1]:scan=3684	19.986211	3	3568.7052	3566.6632	K	G	181	213
PSM	MEYEWKPDEQGLQQILQLLK	1540	sp|Q92973-2|TNPO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=6296	34.403222	3	2546.2751	2546.2722	-	E	1	21
PSM	DGHNLISLLEVLSGDSLPR	1541	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=5382	29.33333	3	2034.077574	2034.074569	R	E	209	228
PSM	EDANVFASAMMHALEVLNSQETGPTLPR	1542	sp|Q8N8S7|ENAH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=7317	40.128206	3	3028.447526	3027.443006	K	Q	95	123
PSM	QADTVYFLPITPQFVTEVIK	1543	sp|P31327|CPSM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=8	0.030238636	3	2309.241354	2308.235486	K	A	478	498
PSM	AEEGIAAGGVMDVNTALQEVLK	1544	sp|P25398|RS12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36	1-UNIMOD:1	ms_run[1]:scan=5087	27.700637	2	2256.1309	2256.1302	M	T	2	24
PSM	QNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGK	1545	sp|P17844|DDX5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36	1-UNIMOD:28	ms_run[1]:scan=1018	5.4849705	3	3340.6414	3340.6393	R	T	112	145
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	1546	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=9214	50.464107	3	3587.702338	3585.694213	R	R	85	117
PSM	QIPVLQTNNGPSLTGLTTIAAHLVK	1547	sp|O43324|MCA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36	1-UNIMOD:28	ms_run[1]:scan=215	1.1812954	3	2568.4314	2568.4270	R	Q	29	54
PSM	TDVNKIEEFLEEVLCPPK	1548	sp|Q9Y696|CLIC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36	15-UNIMOD:4	ms_run[1]:scan=5893	32.175606	3	2159.085821	2159.082023	K	Y	86	104
PSM	FGVEQDVDMVFASFIR	1549	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=5953	32.505592	2	1858.891849	1858.892371	K	K	231	247
PSM	ATVVPVLAGVGPLDPQSLRPNSEEVDEVFALPLAHLLQTQNQGYTHFCR	1550	sp|Q8WV74|NUDT8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36	48-UNIMOD:4	ms_run[1]:scan=3870	21.021822	5	5382.7465	5382.7454	K	G	112	161
PSM	VMIPQDEYPEINFVGLLIGPR	1551	sp|Q15637|SF01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=3546	19.256617	2	2399.268175	2399.255904	K	G	140	161
PSM	FTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGK	1552	sp|Q9Y3C6|PPIL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36	9-UNIMOD:35	ms_run[1]:scan=4059	22.074324	3	3512.741218	3511.708206	K	H	92	126
PSM	QLLAEESLPTTPFYFILGK	1553	sp|Q8IWA0|WDR75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=16	0.068272085	2	2167.164646	2166.161259	K	H	683	702
PSM	TEFLSFMNTELAAFTK	1554	sp|P31949|S10AB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=4	0.013544869	2	1849.902317	1848.896788	K	N	37	53
PSM	LGIDDLVHFDFMDPPAPETLMR	1555	sp|O43143|DHX15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=1611	8.7443908	3	2528.209691	2528.207968	K	A	517	539
PSM	AAETTVVEVEEIVDIGAFAPEDIHIPQIYVHR	1556	sp|P55809|SCOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=1401	7.5974	4	3559.8199	3559.8199	K	L	237	269
PSM	AEAYLIEEMYDEAIQDYETAQEHNENDQQIR	1557	sp|Q13217|DNJC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=1099	5.941	4	3757.6326	3757.6326	R	E	347	378
PSM	AFMTADLPNELIELLEK	1558	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35	3-UNIMOD:35	ms_run[2]:scan=3194	17.336	2	1962.002	1962.0020	K	I	994	1011
PSM	ATEPQMVLFNLYDDWLK	1559	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=5536	30.19	2	2082.0132	2082.0132	K	T	1909	1926
PSM	DALEFWLQAGVDGFQVR	1560	sp|P08195-2|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=4942	26.874	2	1949.9636	1949.9636	K	D	231	248
PSM	DMAIATGGAVFGEEGLTLNLEDVQPHDLGK	1561	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=183	1.0038	3	3096.5074	3096.5074	K	V	315	345
PSM	DNTIEHLLPLFLAQLKDECPEVR	1562	sp|P30153|2AAA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35	19-UNIMOD:4	ms_run[2]:scan=1110	6.0029	4	2749.4109	2749.4109	K	L	359	382
PSM	DSSLEADHVISAIPASVLSELLPAEAAPLAR	1563	sp|P50336|PPOX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=5376	29.303	3	3141.6558	3141.6558	R	A	274	305
PSM	DSSLEADHVISAIPASVLSELLPAEAAPLAR	1564	sp|P50336|PPOX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=5470	29.829	3	3141.6558	3141.6558	R	A	274	305
PSM	DVLKEEGVSFLINTFEGGGCGQPSGILAQPTLLYLR	1565	sp|P78527-2|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35	20-UNIMOD:4	ms_run[2]:scan=6245	34.119	4	3877.9924	3877.9924	K	G	1210	1246
PSM	DVPWGVDSLITLAFQDQR	1566	sp|Q16658|FSCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=7445	40.843	3	2059.0375	2059.0375	R	Y	168	186
PSM	DYIYAVTPLLEDALMDR	1567	sp|O75533|SF3B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=1257	6.8202	2	1996.9816	1996.9816	K	D	1164	1181
PSM	DYQFTILDVRPALDSLSAVWDR	1568	sp|P53701|CCHL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=6714	36.724	3	2579.302	2579.3020	K	M	237	259
PSM	EILQEEEDLAEIVQLVGK	1569	sp|P38606-2|VATA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=335	1.8469	3	2054.0783	2054.0783	K	A	448	466
PSM	EIYPYVIQELRPTLNELGISTPEELGLDKV	1570	sp|P20674|COX5A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=4095	22.256	4	3427.8127	3427.8127	K	-	121	151
PSM	ENFIPTIVNFSAEEISDAIR	1571	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=5933	32.404	2	2264.1325	2264.1325	R	E	3345	3365
PSM	ENILHVSENVIFTDVNSILR	1572	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=1511	8.1787	3	2311.2172	2311.2172	K	Y	37	57
PSM	ESTITLQQAEYEFLSFVR	1573	sp|Q9Y3B8-2|ORN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=5132	27.956	2	2160.0739	2160.0739	K	Q	74	92
PSM	ETCLITFLLAGIECPR	1574	sp|Q7KZF4|SND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35	3-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=5723	31.211	2	1891.9536	1891.9536	K	G	547	563
PSM	EVLSFDVTQSPFFPVVLGVR	1575	sp|Q86TG7|PEG10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=2876	15.583	2	2235.194	2235.1940	R	W	428	448
PSM	FLDMPQSPLFTLNLNTPESWMVESVR	1576	sp|Q9NYU2-2|UGGG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=6488	35.468	3	3050.4882	3050.4882	K	T	1037	1063
PSM	FMCAQLPNQVLESISIIDTPGILSGAK	1577	sp|Q9NZN4|EHD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35	3-UNIMOD:4	ms_run[2]:scan=3079	16.708	3	2901.498	2901.4980	R	Q	136	163
PSM	FQSVPAQPGQTSPLLQYFGILLDQGQLNK	1578	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=7092	38.872	3	3186.6713	3186.6713	R	Y	401	430
PSM	FSGNLLVSLLGTWSDTSSGGPAR	1579	sp|P61619-3|S61A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=4011	21.81	3	2321.1652	2321.1652	R	A	192	215
PSM	GILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVK	1580	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=8536	46.963	4	4035.8875	4035.8875	K	L	272	310
PSM	GLAEDIENEVVQITWNR	1581	sp|Q15029-2|U5S1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=2833	15.348	2	1984.9854	1984.9854	K	K	660	677
PSM	GLAEDIENEVVQITWNR	1582	sp|Q15029-2|U5S1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=2835	15.359	3	1984.9854	1984.9854	K	K	660	677
PSM	GLAEDIENEVVQITWNR	1583	sp|Q15029-2|U5S1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=2928	15.871	3	1984.9854	1984.9854	K	K	660	677
PSM	GMYGIENEVFLSLPCILNAR	1584	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35	15-UNIMOD:4	ms_run[2]:scan=1666	9.0537	3	2295.1392	2295.1392	K	G	280	300
PSM	GMYGIENEVFLSLPCILNAR	1585	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35	15-UNIMOD:4	ms_run[2]:scan=1987	10.75	3	2295.1392	2295.1392	K	G	280	300
PSM	GNFTLPEVAECFDEITYVELQK	1586	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35	11-UNIMOD:4	ms_run[2]:scan=1985	10.738	2	2601.2309	2601.2309	K	E	619	641
PSM	GVPQIEVTFDIDANGILNVSAVDK	1587	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=8345	45.873	2	2513.3013	2513.3013	R	S	470	494
PSM	GVPQIEVTFEIDVNGILR	1588	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=7524	41.291	3	1998.0786	1998.0786	R	V	493	511
PSM	HLSCVLSGLIADLDALDVCGR	1589	sp|Q9UL15|BAG5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35	4-UNIMOD:4,19-UNIMOD:4	ms_run[2]:scan=2459	13.309	3	2283.1351	2283.1351	R	T	215	236
PSM	HLYTADMFTHGIQSAAHFVMFFAPWCGHCQR	1590	sp|Q8NBS9|TXND5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35	26-UNIMOD:4,29-UNIMOD:4	ms_run[2]:scan=3223	17.482	5	3722.6581	3722.6581	K	L	64	95
PSM	HSQDLAFLSMLNDIAAVPATAMPFR	1591	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=5430	29.6	2	2715.3513	2715.3513	R	G	444	469
PSM	HTDSLFPILLQTLSDESDEVILK	1592	sp|Q08AM6|VAC14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=5101	27.779	3	2612.3585	2612.3585	R	D	439	462
PSM	IGNILDLCTALSALSGIPADK	1593	sp|Q9Y4E8-2|UBP15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35	8-UNIMOD:4	ms_run[2]:scan=3008	16.312	2	2141.1402	2141.1402	K	M	470	491
PSM	ILGILALIDEGETDWK	1594	sp|Q9H2U2-3|IPYR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=2766	14.994	2	1784.956	1784.9560	K	L	159	175
PSM	ILSISADIETIGEILK	1595	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=2017	10.91	2	1713.9764	1713.9764	R	K	87	103
PSM	IMSLVDPNHSGLVTFQAFIDFMSR	1596	sp|O43707-3|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35	2-UNIMOD:35	ms_run[2]:scan=6726	36.791	3	2740.3353	2740.3353	R	E	424	448
PSM	INEAFIEMATTEDAQAAVDYYTTTPALVFGKPVR	1597	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=1152	6.2378	3	3731.8393	3731.8393	K	V	434	468
PSM	IPNFWVTTFVNHPQVSALLGEEDEEALHYLTR	1598	sp|Q01105-3|SET_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=2064	11.174	4	3724.8526	3724.8526	K	V	66	98
PSM	ISGSILNELIGLVR	1599	sp|Q86VP6-2|CAND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=497	2.6824	2	1482.877	1482.8770	K	S	562	576
PSM	IVLATNIAETSITINDIVHVVDSGLHKEER	1600	sp|Q7L2E3-3|DHX30_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=647	3.4943	5	3285.7569	3285.7569	K	Y	688	718
PSM	KPLVIIAEDVDGEALSTLVLNR	1601	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=5476	29.863	3	2364.3264	2364.3264	R	L	269	291
PSM	LCYVALDFEQEMATAASSSSLEK	1602	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35	2-UNIMOD:4	ms_run[2]:scan=384	2.1146	2	2549.1666	2549.1666	K	S	216	239
PSM	LCYVALDFEQEMATAASSSSLEK	1603	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35	2-UNIMOD:4	ms_run[2]:scan=1191	6.4543	2	2549.1666	2549.1666	K	S	216	239
PSM	LCYVALDFEQEMATAASSSSLEK	1604	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35	2-UNIMOD:4	ms_run[2]:scan=3133	17.001	2	2549.1666	2549.1666	K	S	216	239
PSM	LCYVALDFEQEMATAASSSSLEK	1605	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35	2-UNIMOD:4	ms_run[2]:scan=3343	18.133	2	2549.1666	2549.1666	K	S	216	239
PSM	LEQLNQYPDFNNYLIFVLTK	1606	sp|Q92973-3|TNPO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=2032	10.992	3	2471.2737	2471.2737	K	L	45	65
PSM	LGFSEVELVQMVVDGVK	1607	sp|P12277|KCRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=604	3.2544	2	1847.9703	1847.9703	R	L	342	359
PSM	LLFSAESFCWPEWGLAEQYPEVGTGK	1608	sp|O60568|PLOD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35	9-UNIMOD:4	ms_run[2]:scan=599	3.2264	3	3000.4004	3000.4004	R	R	136	162
PSM	LLFTVLGEPLIYSLSFPER	1609	sp|Q9NRG9-2|AAAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=7379	40.471	2	2193.2085	2193.2085	R	C	310	329
PSM	LLIVSNPVDILTYVAWK	1610	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=4810	26.147	2	1943.1132	1943.1132	K	I	133	150
PSM	LNDYLQIETIQALEELAAK	1611	sp|Q9C0B1|FTO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=1264	6.8596	2	2174.1471	2174.1471	K	E	142	161
PSM	LNHLLSVAPQQSLVLLEDVDAAFLSR	1612	sp|Q9Y276|BCS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=4861	26.414	3	2847.5494	2847.5494	R	D	266	292
PSM	LSDESIFSAFLSVVGK	1613	sp|Q15021|CND1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=6681	36.539	2	1697.8876	1697.8876	K	L	1254	1270
PSM	LSEEELLDKLEIFFGK	1614	sp|P80217|IN35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=2930	15.882	3	1909.0084	1909.0084	R	T	146	162
PSM	LVIGHNMLLDVMHTVHQFYCPLPADLSEFK	1615	sp|O95453-2|PARN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35	20-UNIMOD:4	ms_run[2]:scan=733	3.9696	4	3523.7455	3523.7455	K	E	222	252
PSM	NANELSVLKDEVLEVLEDGR	1616	sp|Q9H6S3-2|ES8L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=1567	8.4927	3	2241.1489	2241.1489	R	Q	119	139
PSM	NDEYENLFNMIVEIPR	1617	sp|Q9H2U2-3|IPYR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=817	4.4342	2	1994.9408	1994.9408	R	W	85	101
PSM	NGQVELNEFLQLMSAIQK	1618	sp|P43304-2|GPDM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=1458	7.8995	3	2061.0565	2061.0565	K	G	550	568
PSM	NLEVLNFFNNQIEELPTQISSLQK	1619	sp|Q15404|RSU1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=3138	17.027	3	2817.4549	2817.4549	K	L	64	88
PSM	NSEVYQEVQAMFDTLGIPK	1620	sp|Q52LJ0-1|FA98B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=3702	20.087	3	2168.046	2168.0460	K	S	143	162
PSM	NSEVYQEVQAMFDTLGIPK	1621	sp|Q52LJ0-1|FA98B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=3798	20.619	3	2168.046	2168.0460	K	S	143	162
PSM	NWYIQATCATSGDGLYEGLDWLSNQLR	1622	sp|P84077|ARF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35	8-UNIMOD:4	ms_run[2]:scan=5196	28.313	3	3130.4454	3130.4454	R	N	152	179
PSM	QIFNVNNLNLPQVALSFGFK	1623	sp|Q9NVP1|DDX18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=1005	5.4156	2	2262.2161	2262.2161	K	V	597	617
PSM	QLGNLGVLGITAPVQYGGSGLGYLEHVLVMEEISR	1624	sp|P26440-2|IVD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=5198	28.324	3	3668.9236	3668.9236	K	A	56	91
PSM	SGETEDTFIADLVVGLCTGQIK	1625	sp|P06733-2|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35	17-UNIMOD:4	ms_run[2]:scan=6188	33.816	2	2352.1519	2352.1519	R	T	280	302
PSM	SGETEDTFIADLVVGLCTGQIK	1626	sp|P06733-2|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35	17-UNIMOD:4	ms_run[2]:scan=4684	25.475	3	2352.1519	2352.1519	R	T	280	302
PSM	SILTQPHLYSPVLISQLVQMASQLR	1627	sp|O15027-2|SC16A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=5539	30.207	3	2821.5524	2821.5524	K	L	1832	1857
PSM	SISPFPELEQFLQDTIKR	1628	sp|Q8NFF5-3|FAD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=524	2.8215	3	2147.1263	2147.1263	R	Y	341	359
PSM	SLQDIIAILGMDELSEEDK	1629	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=6829	37.383	2	2118.0402	2118.0402	K	L	433	452
PSM	SLQDIIAILGMDELSEEDK	1630	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=6880	37.671	3	2118.0402	2118.0402	K	L	433	452
PSM	SLQDIIAILGMDELSEEDKLTVSR	1631	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=6068	33.141	3	2674.3735	2674.3735	K	A	433	457
PSM	SLSGLLPAQTSLEYALLDAVTQQEK	1632	sp|Q8NBF2|NHLC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=2634	14.259	2	2674.4065	2674.4065	R	D	10	35
PSM	SLYALFSQFGHVVDIVALK	1633	sp|P08579|RU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=5130	27.944	3	2106.1514	2106.1514	R	T	26	45
PSM	SNEYQLIDCAQYFLDKIDVIK	1634	sp|P63092-3|GNAS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35	9-UNIMOD:4	ms_run[2]:scan=2601	14.081	3	2574.2676	2574.2676	R	Q	151	172
PSM	SNFFYAIQFVLSDEFSHLRPEQR	1635	sp|Q9UQE7|SMC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=6589	36.046	4	2829.3875	2829.3875	K	L	39	62
PSM	SQEPLPDDDEEFELPEFVEPFLK	1636	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=1202	6.5188	3	2748.2694	2748.2694	K	D	367	390
PSM	STAISLFYELSENDLNFIK	1637	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=3370	18.278	2	2203.1049	2203.1049	K	Q	72	91
PSM	STAISLFYELSENDLNFIK	1638	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=3167	17.185	3	2203.1049	2203.1049	K	Q	72	91
PSM	STAISLFYELSENDLNFIK	1639	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=3270	17.725	3	2203.1049	2203.1049	K	Q	72	91
PSM	TGAFALPILNALLETPQR	1640	sp|Q9H0S4-2|DDX47_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=5756	31.399	2	1924.0782	1924.0782	K	L	75	93
PSM	TQTSDPAMLPTMIGLLAEAGVR	1641	sp|O43175|SERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=2903	15.732	3	2271.1603	2271.1603	R	L	470	492
PSM	TTYLEDLPPPPEYELAPSKLEEEVDDVFLIR	1642	sp|Q12849|GRSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=3943	21.435	4	3616.8076	3616.8076	K	A	123	154
PSM	TVSLGAGAKDELHIVEAEAMNYEGSPIK	1643	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=7175	39.331	3	2928.4539	2928.4539	R	V	46	74
PSM	VASNPYTWFTMEALEETWR	1644	sp|Q13813-3|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=1087	5.871	2	2330.0678	2330.0678	R	N	2142	2161
PSM	VDNMIIQSISLLDQLDK	1645	sp|O00567|NOP56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=4888	26.57	2	1944.0238	1944.0238	R	D	164	181
PSM	VETGVLKPGMVVTFAPVNVTTEVK	1646	sp|P68104-2|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=6987	38.286	3	2514.3767	2514.3767	R	S	246	270
PSM	VFDPSCGLPYYWNADTDLVSWLSPHDPNSVVTK	1647	sp|O60828-7|PQBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35	6-UNIMOD:4	ms_run[2]:scan=1665	9.048	3	3778.7614	3778.7614	K	S	55	88
PSM	VFPDKEVMLDAALALAAEISSK	1648	sp|Q13011|ECH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=6395	34.942	3	2317.2239	2317.2239	R	S	246	268
PSM	VFSGIQPTGILHLGNYLGAIESWVR	1649	sp|Q9UGM6-2|SYWM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=3724	20.213	3	2726.4544	2726.4544	R	L	37	62
PSM	VMATTGGMGMGPGGPGMITIPPSILNNPNIPNEIIHALQAGR	1650	sp|P52272|HNRPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=4992	27.16	4	4194.121	4194.1210	K	L	160	202
PSM	VNSEQEHFLIVPFGLLYSEVTASSLVK	1651	sp|P35611-5|ADDA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=5170	28.174	3	3005.575	3005.5750	R	I	173	200
PSM	VSVVPDEVATIAAEVTSFSNR	1652	sp|Q8NFF5-3|FAD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=115	0.61862	3	2190.1168	2190.1168	R	F	52	73
PSM	VTDPVGDIVSFMHSFEEK	1653	sp|Q96CS3|FAF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=1083	5.8485	3	2035.9561	2035.9561	R	Y	129	147
PSM	VYVPALIFGQLLTSSNYDDDEK	1654	sp|Q02880-2|TOP2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=1978	10.7	2	2486.2217	2486.2217	K	K	151	173
PSM	WLPAGDALLQMITIHLPSPVTAQK	1655	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=5580	30.433	4	2599.4196	2599.4196	R	Y	343	367
PSM	YALQMEQLNGILLHLESELAQTR	1656	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35	5-UNIMOD:35	ms_run[2]:scan=7204	39.497	3	2685.3796	2685.3796	R	A	331	354
PSM	YKEVYAAAAEVLGLILR	1657	sp|P78527-2|PRKDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=3513	19.075	3	1878.0615	1878.0615	R	Y	2312	2329
PSM	YLPPATQVVLISATLPHEILEMTNK	1658	sp|P38919|IF4A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=3061	16.607	3	2777.5037	2777.5037	R	F	207	232
PSM	YLPPATQVVLISATLPHEILEMTNK	1659	sp|P38919|IF4A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=3159	17.149	3	2777.5037	2777.5037	R	F	207	232
PSM	YSNVIFLEVDVDDCQDVASECEVK	1660	sp|P10599|THIO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35	14-UNIMOD:4,21-UNIMOD:4	ms_run[2]:scan=7148	39.181	3	2832.247	2832.2470	K	C	49	73
PSM	GLIAEAAQLGPVGGVFNLAVVLR	1661	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=4664	25.362551	3	2264.311222	2263.305238	R	D	1954	1977
PSM	LCYVALDFEQEMATAASSSSLEK	1662	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35	2-UNIMOD:4	ms_run[1]:scan=8772	48.309335	2	2549.166655	2549.166557	K	S	216	239
PSM	VFIMDSCDELIPEYLNFIR	1663	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35	7-UNIMOD:4	ms_run[1]:scan=1753	9.5343225	3	2373.139087	2373.138492	R	G	360	379
PSM	DMAIATGGAVFGEEGLTLNLEDVQPHDLGK	1664	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=8754	48.208214	3	3096.517093	3096.507381	K	V	315	345
PSM	GILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVK	1665	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=8336	45.822394	4	4035.866354	4035.887504	K	L	272	310
PSM	IGYNPDTVAFVPISGWNGDNMLEPSANMPWFK	1666	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35	21-UNIMOD:35	ms_run[1]:scan=2400	12.988324	3	3583.689601	3582.658813	K	G	181	213
PSM	IGYNPDTVAFVPISGWNGDNMLEPSANMPWFK	1667	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35	21-UNIMOD:35	ms_run[1]:scan=4447	24.207259	3	3584.673091	3582.658813	K	G	181	213
PSM	ALDLFSDNAPPPELLEIINEDIAK	1668	sp|Q15084|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=6761	36.993073	3	2636.345943	2636.358515	R	R	265	289
PSM	AGWNAYIDNLMADGTCQDAAIVGYK	1669	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=3443	18.687354	2	2758.2349	2758.2362	M	D	2	27
PSM	QGQYSPMAIEEQVAVIYAGVR	1670	sp|P25705|ATPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35	1-UNIMOD:28	ms_run[1]:scan=3492	18.955269	2	2291.1253	2291.1251	K	G	473	494
PSM	QGQYSPMAIEEQVAVIYAGVR	1671	sp|P25705|ATPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35	1-UNIMOD:28	ms_run[1]:scan=3486	18.923967	3	2291.1286	2291.1251	K	G	473	494
PSM	ISIPVDISDSDMMLNIINSSITTK	1672	sp|P49368|TCPG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35	13-UNIMOD:35	ms_run[1]:scan=2282	12.371028	3	2623.342357	2622.313221	K	A	140	164
PSM	VGSAADIPINISETDLSLLTATVVPPSGR	1673	sp|P21333|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=156	0.85337243	2	2893.548435	2892.544418	K	E	1965	1994
PSM	AAARPLLTDLYQATMALGYWR	1674	sp|Q6XQN6|PNCB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=49	0.25607842	3	2381.244101	2380.236172	R	A	11	32
PSM	AAARPLLTDLYQATMALGYWR	1675	sp|Q6XQN6|PNCB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=179	0.98133292	3	2381.241171	2380.236172	R	A	11	32
PSM	IGVGAPVYMAAVLEYLTAEILELAGNAAR	1676	sp|O75367|H2AY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35	9-UNIMOD:35	ms_run[1]:scan=7574	41.554692	3	2989.572320	2990.578696	R	D	41	70
PSM	NAVTQFVSSMSASADVLALAK	1677	sp|P0C7P4|UCRIL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=631	3.4026883	2	2109.079866	2109.077606	K	I	140	161
PSM	KQDEPIDLFMIEIMEMK	1678	sp|P40227|TCPZ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=849	4.6103826	3	2109.018489	2109.019622	K	H	181	198
PSM	QADTVYFLPITPQFVTEVIK	1679	sp|P31327|CPSM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=101	0.5519847	2	2309.239597	2308.235486	K	A	478	498
PSM	QADTVYFLPITPQFVTEVIK	1680	sp|P31327|CPSM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=103	0.55665977	3	2309.242087	2308.235486	K	A	478	498
PSM	AVANSSPVNPVVFFDVSIGGQEVGR	1681	sp|O43447|PPIH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35	1-UNIMOD:1	ms_run[1]:scan=2605	14.103054	3	2587.3112	2586.3072	M	M	2	27
PSM	QFTTVVADTGDFHAIDEYKPQDATTNPSLILAAAQMPAYQELVEEAIAYGR	1682	sp|P37837|TALDO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35		ms_run[1]:scan=4958	26.963677	5	5569.7102	5568.7032	K	K	20	71
PSM	YLNDLYILELRPGSGVVAWDIPITYGVLPPPR	1683	sp|P51610|HCFC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=3441	18.67375	3	3597.955540	3595.944278	R	E	169	201
PSM	ASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGK	1684	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35	45-UNIMOD:4,48-UNIMOD:4	ms_run[1]:scan=4338	23.603025	5	5806.8802	5806.8792	R	I	13	68
PSM	ASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGK	1685	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35	36-UNIMOD:35,45-UNIMOD:4,48-UNIMOD:4	ms_run[1]:scan=1853	10.047189	6	5822.8872	5822.8742	R	I	13	68
PSM	GQGVYLGMPGCLPVYDALAGEFIR	1686	sp|P30040|ERP29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35	8-UNIMOD:35,11-UNIMOD:4	ms_run[1]:scan=159	0.87020792	3	2600.2952	2598.2602	K	A	147	171
PSM	FGVEQDVDMVFASFIR	1687	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=6162	33.669024	2	1858.891849	1858.892371	K	K	231	247
PSM	QATTIIADNIIFLSDQTK	1688	sp|Q04837|SSBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35	1-UNIMOD:28	ms_run[1]:scan=2038	11.025634	2	1974.0323	1974.0304	R	E	128	146
PSM	QATTIIADNIIFLSDQTK	1689	sp|Q04837|SSBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35	1-UNIMOD:28	ms_run[1]:scan=1942	10.498733	2	1974.0323	1974.0304	R	E	128	146
PSM	DTDIIVWDVINESGLYR	1690	sp|Q9UNX4|WDR3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=1736	9.4390162	2	2007.991303	2006.994922	K	L	128	145
PSM	LLEETQLDMNEFDNLLQPIIDTCTK	1691	sp|Q8IWX8|CHERP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35	9-UNIMOD:35,23-UNIMOD:4	ms_run[1]:scan=3462	18.791723	3	3009.469063	3008.435856	K	D	146	171
PSM	AAPPPAAPPASAGAGNLLVDVFDGPAAQPSLGPTPEEAFLSPGPEDIGPPIPEADELLNK	1692	sp|O95782-2|AP2A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35		ms_run[1]:scan=6303	34.442126	5	5848.9408	5848.9358	R	F	665	725
PSM	GLYGIKDDVFLSVPCILGQNGISDLVK	1693	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35	15-UNIMOD:4	ms_run[1]:scan=29	0.1438742	2	2921.526707	2919.541582	K	V	279	306
PSM	ALEAFDLDPAQWGVNVQPYSGSPANLAVYTALLQPHDR	1694	sp|P34897|GLYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=2515	13.614743	5	4122.046645	4123.043945	R	I	123	161
PSM	AAAEIYEEFLAAFEGSDGNK	1695	sp|O15042-2|SR140_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=1161	6.2883	2	2130.9746	2130.9746	K	V	112	132
PSM	AAIGCGIVESILNWVK	1696	sp|P11388|TOP2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34	5-UNIMOD:4	ms_run[2]:scan=6791	37.164	2	1728.9233	1728.9233	K	F	401	417
PSM	AAPENPGGVLSVELPGLLAQLAR	1697	sp|A0FGR8-2|ESYT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=2364	12.807	3	2271.2587	2271.2587	R	S	68	91
PSM	ADLNIILSSPEQLELFLLAQQK	1698	sp|Q9BQG0|MBB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=5036	27.409	2	2482.3683	2482.3683	K	V	203	225
PSM	AEDDQPLPGVLLSLSGGLFR	1699	sp|Q5JPE7-3|NOMO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=4462	24.283	2	2083.095	2083.0950	K	S	717	737
PSM	AGNYEEALQLYQHAVQYFLHVVK	1700	sp|O75351|VPS4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=6521	35.655	4	2719.3758	2719.3758	K	Y	24	47
PSM	AKFYPEDVAEELIQDITQK	1701	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=728	3.9415	3	2236.1263	2236.1263	R	L	82	101
PSM	ALCHLNVPVTVVLDAAVGYIMEK	1702	sp|Q14232|EI2BA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34	3-UNIMOD:4	ms_run[2]:scan=5552	30.28	3	2511.3229	2511.3229	K	A	167	190
PSM	ALDLFSDNAPPPELLEIINEDIAKR	1703	sp|Q15084-3|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=1359	7.3808	4	2792.4596	2792.4596	R	T	262	287
PSM	ALHLSDLFSPLPILELTR	1704	sp|Q15345-3|LRC41_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=3200	17.369	3	2034.1514	2034.1514	R	A	524	542
PSM	AQHIVPCTISQLLSATLVDEVFR	1705	sp|P15927|RFA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34	7-UNIMOD:4	ms_run[2]:scan=2715	14.71	3	2596.3683	2596.3683	R	I	43	66
PSM	CDPAPFYLFDEIDQALDAQHR	1706	sp|Q9UQE7|SMC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:4	ms_run[2]:scan=2186	11.842	3	2520.138	2520.1380	K	K	1134	1155
PSM	DALEFWLQAGVDGFQVR	1707	sp|P08195-2|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=4647	25.269	2	1949.9636	1949.9636	K	D	231	248
PSM	DALEFWLQAGVDGFQVR	1708	sp|P08195-2|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=5040	27.431	2	1949.9636	1949.9636	K	D	231	248
PSM	DALEFWLQAGVDGFQVR	1709	sp|P08195-2|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=5165	28.143	2	1949.9636	1949.9636	K	D	231	248
PSM	DELILEGNDIELVSNSAALIQQATTVK	1710	sp|P32969|RL9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=2162	11.71	2	2883.5077	2883.5077	K	N	142	169
PSM	DGTVLCELINALYPEGQAPVK	1711	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34	6-UNIMOD:4	ms_run[2]:scan=6879	37.665	2	2286.1566	2286.1566	K	K	58	79
PSM	DKPSGDTAAVFEEGGDVDDLLDMI	1712	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=3394	18.407	2	2508.1214	2508.1214	K	-	709	733
PSM	DLVSSLTSGLLTIGDR	1713	sp|P53396-3|ACLY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=3511	19.063	2	1645.8887	1645.8887	K	F	648	664
PSM	DMAIATGGAVFGEEGLTLNLEDVQPHDLGK	1714	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=8457	46.51	3	3096.5074	3096.5074	K	V	315	345
PSM	EALAQTVLAEVPTQLVSYFR	1715	sp|Q99829|CPNE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=3859	20.962	3	2234.1947	2234.1947	R	A	495	515
PSM	EEQVISLGPQVAEGENVFGVCHIFASFNDTFVHVTDLSGK	1716	sp|P62263|RS14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34	21-UNIMOD:4	ms_run[2]:scan=4785	26.017	4	4376.106	4376.1060	K	E	11	51
PSM	EISQETAVNPVDIVSTLQALQMLK	1717	sp|O95251-3|KAT7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=6329	34.583	3	2626.3888	2626.3888	K	Y	374	398
PSM	EIYPYVIQELRPTLNELGISTPEELGLDKV	1718	sp|P20674|COX5A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=4425	24.086	3	3427.8127	3427.8127	K	-	121	151
PSM	ELNELVSAIEEHFFQPQK	1719	sp|Q96G03|PGM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=533	2.8696	2	2157.0742	2157.0742	K	Y	587	605
PSM	ENILFGMGNPLLDISAVVDK	1720	sp|P55263-3|ADK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=5792	31.602	2	2144.1187	2144.1187	R	D	23	43
PSM	EPNPQGESHPPLNLAFLDILSEFSSK	1721	sp|Q8N3U4|STAG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=4034	21.935	3	2865.4185	2865.4185	K	L	984	1010
PSM	ESTITLQQAEYEFLSFVR	1722	sp|Q9Y3B8-2|ORN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=5232	28.491	2	2160.0739	2160.0739	K	Q	74	92
PSM	EVGDGTTSVVIIAAELLK	1723	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=137	0.74483	2	1814.0037	1814.0037	K	N	85	103
PSM	FFLEEIQLGEELLAQGEYEK	1724	sp|Q15388|TOM20_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=6045	33.012	2	2384.1788	2384.1788	K	G	69	89
PSM	FFPEDVSEELIQEITQR	1725	sp|P35241-3|RADI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=3634	19.735	3	2079.0161	2079.0161	K	L	52	69
PSM	FGVEQDVDMVFASFIR	1726	sp|P14618-3|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34	9-UNIMOD:35	ms_run[2]:scan=1236	6.7022	2	1874.8873	1874.8873	K	K	216	232
PSM	FGVEQDVDMVFASFIR	1727	sp|P14618-3|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=6042	32.995	3	1858.8924	1858.8924	K	K	216	232
PSM	GEVLPEEITEESLEESVGKPLYLIFR	1728	sp|Q68E01-4|INT3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=2607	14.114	3	2975.5379	2975.5379	R	N	145	171
PSM	GFLFGPSLAQELGLGCVLIR	1729	sp|P07741-2|APT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34	16-UNIMOD:4	ms_run[2]:scan=4904	26.66	2	2146.1609	2146.1609	R	K	68	88
PSM	GFSDEDNTWEPEENLDCPDLIAEFLQSQK	1730	sp|P83916|CBX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34	17-UNIMOD:4	ms_run[2]:scan=574	3.0905	3	3425.4882	3425.4882	K	T	44	73
PSM	GHVISQIAQEAGHDLMDIFLCDVDIR	1731	sp|O75616|ERAL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34	21-UNIMOD:4	ms_run[2]:scan=5013	27.276	4	2951.427	2951.4270	K	L	405	431
PSM	GNFTLPEVAECFDEITYVELQK	1732	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34	11-UNIMOD:4	ms_run[2]:scan=1775	9.6505	3	2601.2309	2601.2309	K	E	619	641
PSM	GQNDLMGTAEDFADQFLR	1733	sp|O15260-2|SURF4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=2610	14.124	3	2026.9055	2026.9055	M	V	2	20
PSM	GSEYDDFLDEFMEAVSSK	1734	sp|P48163-2|MAOX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=7319	40.139	2	2067.8619	2067.8619	R	Y	143	161
PSM	GSTLPDVTEVSTFFPFHEYFANAPQPIFK	1735	sp|O60306|AQR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=1425	7.7187	3	3285.6023	3285.6023	K	G	955	984
PSM	GTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVK	1736	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=4249	23.101	4	4147.9844	4147.9844	K	S	287	323
PSM	GVEIEGPLSTETNWDIAHMISGFE	1737	sp|P28070|PSB4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=1691	9.1941	2	2631.2163	2631.2163	K	-	241	265
PSM	GYTLLSEGIDEMVGIIYKPK	1738	sp|O75643|U520_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=1456	7.8883	3	2225.1654	2225.1654	K	T	86	106
PSM	HFYWYLTNEGIQYLRDYLHLPPEIVPATLR	1739	sp|P46783|RS10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=5112	27.843	4	3716.9144	3716.9144	R	R	66	96
PSM	HFYWYLTNEGIQYLRDYLHLPPEIVPATLR	1740	sp|P46783|RS10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=5404	29.454	4	3716.9144	3716.9144	R	R	66	96
PSM	HNDDEQYAWESSAGGSFTVR	1741	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=7188	39.407	3	2254.9516	2254.9516	K	T	154	174
PSM	ICPVETLVEEAIQCAEK	1742	sp|P30084|ECHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34	2-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=271	1.4881	2	1987.9595	1987.9595	K	I	212	229
PSM	ICPVETLVEEAIQCAEK	1743	sp|P30084|ECHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34	2-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=555	2.9869	3	1987.9595	1987.9595	K	I	212	229
PSM	ILADLEDYLNELWEDK	1744	sp|Q99613|EIF3C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=6758	36.976	2	1977.9571	1977.9571	R	E	109	125
PSM	ILSISADIETIGEILK	1745	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=2114	11.453	2	1713.9764	1713.9764	R	K	87	103
PSM	ILSISADIETIGEILK	1746	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=2213	11.996	2	1713.9764	1713.9764	R	K	87	103
PSM	ILSISADIETIGEILK	1747	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=2313	12.536	2	1713.9764	1713.9764	R	K	87	103
PSM	IVAFADAAVEPIDFPIAPVYAASMVLK	1748	sp|P24752|THIL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=6461	35.316	4	2817.5027	2817.5027	R	D	312	339
PSM	IVLFDTLLEEYSVLNK	1749	sp|O75844|FACE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=3162	17.162	2	1895.0292	1895.0292	R	D	277	293
PSM	KIVSLLAASEAEVEQLLSER	1750	sp|Q99538|LGMN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=951	5.1431	3	2184.2002	2184.2002	R	A	351	371
PSM	LCYVALDFEQEMATAASSSSLEK	1751	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34	2-UNIMOD:4	ms_run[2]:scan=1294	7.0305	2	2549.1666	2549.1666	K	S	216	239
PSM	LDDIHPFYADLMNILYDK	1752	sp|Q9BZE4-2|NOG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=1714	9.3215	3	2195.0609	2195.0609	K	D	25	43
PSM	LEQLNQYPDFNNYLIFVLTK	1753	sp|Q92973-3|TNPO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=2126	11.517	2	2471.2737	2471.2737	K	L	45	65
PSM	LGAGYPMGPFELLDYVGLDTTK	1754	sp|Q16836|HCDH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=5518	30.09	3	2356.1661	2356.1661	K	F	250	272
PSM	LGFSEVELVQMVVDGVK	1755	sp|P12277|KCRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=707	3.8214	2	1847.9703	1847.9703	R	L	342	359
PSM	LIPEMDQIFTEVEMTTLEK	1756	sp|Q9Y4L1|HYOU1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=3819	20.737	2	2266.1113	2266.1113	R	V	841	860
PSM	LLCTVFETLSDFESGLK	1757	sp|O75691|UTP20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34	3-UNIMOD:4	ms_run[2]:scan=2031	10.986	2	1957.9707	1957.9707	K	Y	1409	1426
PSM	LLEELEDTWLPYLTPK	1758	sp|Q9C0B1|FTO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=2503	13.547	2	1959.0241	1959.0241	R	D	19	35
PSM	LSGDWNPLHIDPNFASLAGFDKPILHGLCTFGFSAR	1759	sp|P51659-3|DHB4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34	29-UNIMOD:4	ms_run[2]:scan=2019	10.921	5	3969.9625	3969.9625	R	R	489	525
PSM	LVDISYGGENGFNQAIELSTEVLSNVK	1760	sp|P62495-2|ERF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=5601	30.547	3	2895.4502	2895.4502	K	F	220	247
PSM	LWISNGGLADIFTVFAK	1761	sp|P49748-2|ACADV_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=6173	33.733	2	1850.9931	1850.9931	K	T	226	243
PSM	MNYIGQFLPGYEAPAFMDPLLPK	1762	sp|P32754-2|HPPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=1527	8.2684	3	2611.2855	2611.2855	K	L	111	134
PSM	MYVPALIFGQLLTSSNYDDDEK	1763	sp|P11388|TOP2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=3494	18.967	2	2518.1938	2518.1938	K	K	135	157
PSM	NDEYENLFNMIVEIPR	1764	sp|Q9H2U2-3|IPYR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=724	3.9164	2	1994.9408	1994.9408	R	W	85	101
PSM	NGLSAWELIELIGNGQFSK	1765	sp|Q9UH65|SWP70_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=3000	16.27	2	2075.0688	2075.0688	K	G	171	190
PSM	NLLPATLQLIDTYASFTR	1766	sp|Q5T4S7-3|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=2342	12.696	2	2036.0942	2036.0942	K	A	1157	1175
PSM	NLNPEDIDQLITISGMVIR	1767	sp|P33991|MCM4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=74	0.39909	3	2140.1198	2140.1198	R	T	273	292
PSM	PAPEIFENEVMALLR	1768	sp|Q9NX18|SDHF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=568	3.0564	2	1727.8916	1727.8916	K	D	127	142
PSM	QDQIQQVVNHGLVPFLVSVLSK	1769	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=5690	31.029	3	2447.3536	2447.3536	R	A	367	389
PSM	QEAFLLNEDLGDSLDSVEALLK	1770	sp|Q13813-3|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=6302	34.436	2	2418.2166	2418.2166	K	K	486	508
PSM	QGLNGVPILSEEELSLLDEFYK	1771	sp|Q14444-2|CAPR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=3314	17.968	3	2492.2686	2492.2686	K	L	170	192
PSM	QIIISEIISSLPSIVNDK	1772	sp|Q15397|PUM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=2713	14.699	2	1968.1143	1968.1143	K	Y	419	437
PSM	QITIIDSPSFIVSPLNSSSALALR	1773	sp|Q9BVP2-2|GNL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=2739	14.851	2	2528.385	2528.3850	K	S	288	312
PSM	QNLSQVPEADSVSFLQELLALR	1774	sp|Q96LD4-2|TRI47_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=5727	31.234	2	2456.2911	2456.2911	R	L	81	103
PSM	QQQDLVAFLQLVGCSLQGGCPGPEDAGSK	1775	sp|O60443-3|GSDME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34	14-UNIMOD:4,20-UNIMOD:4	ms_run[2]:scan=5608	30.587	3	3058.4488	3058.4488	R	Q	188	217
PSM	QTAVSVENFIAELLPDK	1776	sp|Q96M27-5|PRRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=3236	17.545	2	1872.9833	1872.9833	K	W	326	343
PSM	QYEQQTYQVIPEVIKNFIQYFHK	1777	sp|Q9Y262-2|EIF3L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=7209	39.527	4	2942.4967	2942.4967	R	T	39	62
PSM	RGDVTFLEDVLNEIQLR	1778	sp|Q5T160|SYRM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=1232	6.6795	3	2016.064	2016.0640	R	M	387	404
PSM	RSIVSELAGLLSAMEYVQK	1779	sp|P40763-3|STAT3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=5449	29.71	3	2093.1191	2093.1191	R	T	215	234
PSM	RTGPAATTLPDGAAAESLVESSEVAVIGFFK	1780	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=4989	27.143	4	3090.5873	3090.5873	K	D	132	163
PSM	SDPLCVLLQDVGGGSWAELGR	1781	sp|Q99829|CPNE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34	5-UNIMOD:4	ms_run[2]:scan=5961	32.545	2	2228.0896	2228.0896	K	T	26	47
PSM	SDPMVQCIIEESGEHIIAGAGELHLEICLK	1782	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34	7-UNIMOD:4,28-UNIMOD:4	ms_run[2]:scan=1513	8.1899	4	3347.62	3347.6200	K	D	530	560
PSM	SDPMVQCIIEESGEHIIAGAGELHLEICLK	1783	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34	7-UNIMOD:4,28-UNIMOD:4	ms_run[2]:scan=1715	9.3271	4	3347.62	3347.6200	K	D	530	560
PSM	SDPMVQCIIEESGEHIIAGAGELHLEICLK	1784	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34	7-UNIMOD:4,28-UNIMOD:4	ms_run[2]:scan=1703	9.2641	3	3347.62	3347.6200	K	D	530	560
PSM	SGETEDTFIADLVVGLCTGQIK	1785	sp|P06733-2|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34	17-UNIMOD:4	ms_run[2]:scan=5911	32.281	2	2352.1519	2352.1519	R	T	280	302
PSM	SGETEDTFIADLVVGLCTGQIK	1786	sp|P06733-2|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34	17-UNIMOD:4	ms_run[2]:scan=6026	32.903	2	2352.1519	2352.1519	R	T	280	302
PSM	SGTIFDNFLITNDEAYAEEFGNETWGVTK	1787	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=3699	20.071	3	3267.4884	3267.4884	K	A	323	352
PSM	SLEEFNDVYLVTHLMGADLNNIVK	1788	sp|Q16539-5|MK14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=2206	11.957	3	2733.3684	2733.3684	R	C	95	119
PSM	SLLSIPNTDYIQLLSEIAK	1789	sp|O75569-3|PRKRA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=2448	13.252	2	2117.162	2117.1620	R	E	207	226
PSM	SPLMSEFQSQISSNPELAAIFESIQK	1790	sp|Q86VP6-2|CAND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=5269	28.701	3	2880.4215	2880.4215	K	D	1024	1050
PSM	SPPYTAFLGNLPYDVTEESIKEFFR	1791	sp|P23588-2|IF4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=7207	39.516	3	2919.4331	2919.4331	K	G	93	118
PSM	STAISLFYELSENDLNFIK	1792	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=3470	18.838	2	2203.1049	2203.1049	K	Q	72	91
PSM	STTTIGLVQALGAHLYQNVFACVR	1793	sp|P11586|C1TC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34	22-UNIMOD:4	ms_run[2]:scan=3222	17.477	2	2618.3639	2618.3639	K	Q	387	411
PSM	SVVPGGGAVEAALSIYLENYATSMGSR	1794	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=5262	28.659	3	2698.3272	2698.3272	K	E	407	434
PSM	SYPGSQLDILIDQGKDDQFLLDGQLLPDNFIAACTEK	1795	sp|P10768|ESTD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34	34-UNIMOD:4	ms_run[2]:scan=720	3.894	4	4137.0252	4137.0252	K	K	210	247
PSM	TAAFLLPILSQIYSDGPGEALR	1796	sp|O00571-2|DDX3X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=6234	34.065	2	2331.2474	2331.2474	K	A	215	237
PSM	TDVCVFAAQEDLETMQAFAQVFNK	1797	sp|Q7L1Q6-2|BZW1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34	4-UNIMOD:4	ms_run[2]:scan=5103	27.791	3	2761.2728	2761.2728	R	L	93	117
PSM	TEAVREDLVPSESNAFLPSSVLWLSPSTALAADFR	1798	sp|Q96R06|SPAG5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=318	1.756	3	3774.9105	3774.9105	R	V	225	260
PSM	TEFLSFMNTELAAFTK	1799	sp|P31949|S10AB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=104	0.55922	2	1848.8968	1848.8968	K	N	37	53
PSM	TFLVIPELAQELHVWTDK	1800	sp|P49902-2|5NTC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=841	4.5691	3	2138.1412	2138.1412	R	S	339	357
PSM	TGAFALPILNALLETPQR	1801	sp|Q9H0S4-2|DDX47_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=5656	30.841	2	1924.0782	1924.0782	K	L	75	93
PSM	TGAFALPILNALLETPQR	1802	sp|Q9H0S4-2|DDX47_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=5703	31.099	3	1924.0782	1924.0782	K	L	75	93
PSM	TPIIIIPAATTSLITMLNAK	1803	sp|Q6P1J9|CDC73_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=1713	9.3159	2	2081.217	2081.2170	R	D	359	379
PSM	VDNMIIQSISLLDQLDK	1804	sp|O00567|NOP56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=4900	26.638	3	1944.0238	1944.0238	R	D	164	181
PSM	VFIMDNCEELIPEYLNFIR	1805	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34	4-UNIMOD:35,7-UNIMOD:4	ms_run[2]:scan=1251	6.7865	2	2430.16	2430.1600	R	G	368	387
PSM	VLDVSNSFAVPFDEDDKDDSVWFLDHDYLENMYGMFK	1806	sp|P51665|PSMD7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=5163	28.132	4	4401.9399	4401.9399	K	K	47	84
PSM	VPIPWVSGTSASTPVFGGILSLINEHR	1807	sp|O14773-2|TPP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=2606	14.109	3	2833.5127	2833.5127	R	I	223	250
PSM	VPSTEAEALASSLMGLFEK	1808	sp|P50395|GDIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=6615	36.175	3	1978.9921	1978.9921	K	R	119	138
PSM	VQALTTDISLIFAALK	1809	sp|Q6PKG0-3|LARP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=6844	37.466	2	1702.9869	1702.9869	R	D	370	386
PSM	VTLSALDTSESSFTPLVVIELAQDVKEETK	1810	sp|Q9NW15-2|ANO10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=2932	15.894	3	3248.6915	3248.6915	K	E	3	33
PSM	VWITNGGLANIFTVFAK	1811	sp|Q9H845|ACAD9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=2096	11.355	2	1850.0091	1850.0091	K	T	212	229
PSM	WLPAGDALLQMITIHLPSPVTAQK	1812	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=5548	30.258	2	2599.4196	2599.4196	R	Y	343	367
PSM	YAEDIFGELFTQANTFASR	1813	sp|Q9Y6W5-2|WASF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=152	0.82831	3	2179.0222	2179.0222	K	V	46	65
PSM	YCIGLNETQLGIIAPFWLK	1814	sp|P42126|ECI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34	2-UNIMOD:4	ms_run[2]:scan=116	0.62427	2	2235.1762	2235.1762	R	D	172	191
PSM	YCIGLNETQLGIIAPFWLK	1815	sp|P42126|ECI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34	2-UNIMOD:4	ms_run[2]:scan=239	1.314	3	2235.1762	2235.1762	R	D	172	191
PSM	YDPSIGIYGLDFYVVLGRPGFSIADK	1816	sp|P62913-2|RL11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=620	3.3433	3	2861.464	2861.4640	K	K	118	144
PSM	YMLLPNQVWDSIIQQATK	1817	sp|O14980|XPO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=2431	13.157	2	2147.1085	2147.1085	K	N	657	675
PSM	TLLEGSGLESIISIIHSSLAEPR	1818	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=7139	39.134028	3	2421.318279	2421.311505	R	V	2483	2506
PSM	DGAGFLINLIDSPGHVDFSSEVTAALR	1819	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=9317	50.968255	3	2801.408163	2800.403174	K	V	94	121
PSM	LCYVALDFEQEMATAASSSSLEK	1820	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34	2-UNIMOD:4	ms_run[1]:scan=8068	44.311808	2	2549.150864	2549.166557	K	S	216	239
PSM	CPEALFQPSFLGMESCGIHETTFNSIMK	1821	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34	1-UNIMOD:4,16-UNIMOD:4	ms_run[1]:scan=6984	38.269115	3	3230.447125	3230.454500	R	C	257	285
PSM	DLVVLLFETALLSSGFSLEDPQTHSNR	1822	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=9322	50.992811	3	2989.547384	2987.524017	K	I	653	680
PSM	KPLVIIAEDVDGEALSTLVLNR	1823	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=3319	17.995929	3	2364.329504	2364.326427	R	L	269	291
PSM	DMAIATGGAVFGEEGLTLNLEDVQPHDLGK	1824	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=8257	45.372506	3	3096.490847	3096.507381	K	V	315	345
PSM	GILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVK	1825	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=7139	39.134028	5	4034.893974	4035.887504	K	L	272	310
PSM	GILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVK	1826	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=7431	40.7684	5	4037.897798	4035.887504	K	L	272	310
PSM	GILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVK	1827	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=5632	30.709781	4	4035.889222	4035.887504	K	L	272	310
PSM	GILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVK	1828	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=6629	36.251708	4	4035.893340	4035.887504	K	L	272	310
PSM	GILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVK	1829	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=7033	38.53903	5	4034.893974	4035.887504	K	L	272	310
PSM	SGETEDTFIADLVVGLCTGQIK	1830	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34	17-UNIMOD:4	ms_run[1]:scan=4878	26.511399	3	2352.154190	2352.151893	R	T	373	395
PSM	ILLANFLAQTEALMR	1831	sp|P06744|G6PI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=2480	13.418024	2	1702.945611	1702.944012	K	G	424	439
PSM	CDPAPFYLFDEIDQALDAQHR	1832	sp|Q9UQE7|SMC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34	1-UNIMOD:4	ms_run[1]:scan=2196	11.900649	3	2520.140804	2520.137974	K	K	1134	1155
PSM	GIGTVTFEQSIEAVQAISMFNGQLLFDRPMHVK	1833	sp|P52272|HNRPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=4912	26.705395	4	3663.851159	3662.858910	R	M	245	278
PSM	LVDISYGGENGFNQAIELSTEVLSNVK	1834	sp|P62495|ERF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=7388	40.523946	3	2896.446947	2895.450183	K	F	253	280
PSM	AIGTEPDTDVLSEIMNSFAK	1835	sp|O60518|RNBP6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=2435	13.176947	2	2138.026748	2137.024901	K	S	764	784
PSM	QADTVYFLPITPQFVTEVIK	1836	sp|P31327|CPSM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=5	0.016644882	2	2309.239842	2308.235486	K	A	478	498
PSM	ASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGK	1837	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34	36-UNIMOD:35,45-UNIMOD:4,48-UNIMOD:4	ms_run[1]:scan=1965	10.624273	6	5822.8872	5822.8742	R	I	13	68
PSM	AEEGIAAGGVMDVNTALQEVLK	1838	sp|P25398|RS12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34	1-UNIMOD:1	ms_run[1]:scan=4443	24.186023	3	2256.1318	2256.1302	M	T	2	24
PSM	FLQPLLIGELAPEEPSQDGPLNAQLVEDFR	1839	sp|Q9Y5Q0|FADS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=284	1.5637622	3	3335.714894	3334.708523	K	A	87	117
PSM	ASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGK	1840	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34	45-UNIMOD:4,48-UNIMOD:4	ms_run[1]:scan=7488	41.087377	5	5807.8852	5806.8792	R	I	13	68
PSM	KLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTALPDEDDDL	1841	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34	23-UNIMOD:35	ms_run[1]:scan=1925	10.408212	4	5402.6081	5402.6097	R	-	167	217
PSM	AAAEGPVGDGELWQTWLPNHVVFLR	1842	sp|Q99567|NUP88_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34	1-UNIMOD:1	ms_run[1]:scan=1733	9.4221599	3	2803.4048	2803.4077	M	L	2	27
PSM	AVADLALIPDVDIDSDGVFK	1843	sp|Q9NRX4|PHP14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34	1-UNIMOD:1	ms_run[1]:scan=4012	21.815514	3	2114.0800	2114.0778	M	Y	2	22
PSM	FFGPNAEISQPPALSQLVNLYLGR	1844	sp|Q9BQ70|TCF25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=3955	21.502072	3	2630.406046	2630.385673	R	S	482	506
PSM	LKPTDVGLLAVIANNIITINK	1845	sp|O76094|SRP72_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=3347	18.15302	3	2220.330913	2219.325304	K	D	255	276
PSM	TEFLSFMNTELAAFTK	1846	sp|P31949|S10AB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=203	1.1134621	2	1849.902561	1848.896788	K	N	37	53
PSM	ECINFASFNFLGLLDNPR	1847	sp|O15269|SPTC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34	2-UNIMOD:4	ms_run[1]:scan=4625	25.149572	2	2127.037006	2126.025511	K	V	99	117
PSM	IPVIENLGATLDQFDAIDFSDNEIR	1848	sp|P09661|RU2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=1733	9.4221599	3	2803.405289	2804.386855	K	K	31	56
PSM	ADLNIILSSPEQLELFLLAQQK	1849	sp|Q9BQG0|MBB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=5010	27.26	3	2482.3683	2482.3683	K	V	203	225
PSM	ADMVIEAVFEDLSLK	1850	sp|P40939|ECHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=2983	16.179	2	1678.8488	1678.8488	K	H	441	456
PSM	AGEVVPPAMYQFSQYVCQQTGLQIPQLPAPPK	1851	sp|Q5XKP0|MIC13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33	17-UNIMOD:4	ms_run[2]:scan=222	1.2206	3	3541.7738	3541.7738	K	I	44	76
PSM	AGQLTSEEDTLTLVTADHSHVFSFGGYTLR	1852	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=7109	38.967	4	3251.5735	3251.5735	R	G	360	390
PSM	AILQNSWTEVMDLILKPR	1853	sp|Q96PZ0|PUS7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=3302	17.901	3	2126.1558	2126.1558	R	S	393	411
PSM	AIVDCIISIIEENSESK	1854	sp|Q9Y678|COPG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33	5-UNIMOD:4	ms_run[2]:scan=6565	35.907	2	1918.9558	1918.9558	R	E	416	433
PSM	AKFYPEDVAEELIQDITQK	1855	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=842	4.5747	3	2236.1263	2236.1263	R	L	82	101
PSM	ALDLFSDNAPPPELLEIINEDIAK	1856	sp|Q15084-3|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=6166	33.692	2	2636.3585	2636.3585	R	R	262	286
PSM	DAAWYQLLMAPLSEDQR	1857	sp|O15397-2|IPO8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=1658	9.006	2	2005.9568	2005.9568	R	T	767	784
PSM	DALVNAVIDSLSAYR	1858	sp|O95486|SC24A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=434	2.3729	2	1605.8362	1605.8362	R	S	865	880
PSM	DFSWSPGGNIIAFWVPEDK	1859	sp|P55884|EIF3B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=4281	23.284	2	2164.0266	2164.0266	K	D	469	488
PSM	DGALHMIGSLAEILLK	1860	sp|O95373|IPO7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=4304	23.41	3	1679.928	1679.9280	K	K	430	446
PSM	DGGTFISDADDVVSAMIVK	1861	sp|Q96ST2-2|IWS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=703	3.8012	3	1938.9245	1938.9245	R	M	223	242
PSM	DGIEFAFKEPNPQGESHPPLNLAFLDILSEFSSK	1862	sp|Q8N3U4|STAG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=6680	36.534	4	3772.8625	3772.8625	K	L	976	1010
PSM	DGTVLCELINALYPEGQAPVK	1863	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33	6-UNIMOD:4	ms_run[2]:scan=7094	38.883	2	2286.1566	2286.1566	K	K	58	79
PSM	DLVSSLTSGLLTIGDR	1864	sp|P53396-3|ACLY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=3415	18.525	2	1645.8887	1645.8887	K	F	648	664
PSM	DPSQELEFIADILNQDAK	1865	sp|P49354-2|FNTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=7335	40.229	3	2044.9953	2044.9953	R	N	114	132
PSM	DSEMGQQSLLFQIDYPEIAEGIMPR	1866	sp|Q15428|SF3A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=512	2.7594	3	2866.3517	2866.3517	R	H	124	149
PSM	DSWNAGIMTVMSALSVAPSK	1867	sp|Q5XKP0|MIC13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=3106	16.859	3	2064.002	2064.0020	R	A	82	102
PSM	DVLGMAQDEMAQAFEDWNK	1868	sp|P52209-2|6PGD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=6686	36.568	2	2196.9456	2196.9456	K	T	194	213
PSM	DVLIQGLIDENPGLQLIIR	1869	sp|P78527-2|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=3045	16.517	3	2118.2049	2118.2049	K	N	2504	2523
PSM	EDLATFIEELEAVEAK	1870	sp|P11388|TOP2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=4985	27.121	2	1805.8935	1805.8935	K	E	1169	1185
PSM	EIGLWFHPEELVDYTSCAQNWIYE	1871	sp|P15531|NDKA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33	17-UNIMOD:4	ms_run[2]:scan=6017	32.854	3	2998.3484	2998.3484	K	-	129	153
PSM	EMYTLGITNFPIPGEPGFPLNAIYAK	1872	sp|O15145|ARPC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=1366	7.4177	3	2852.4459	2852.4459	K	P	94	120
PSM	ESLNASIVDAINQAADCWGIR	1873	sp|Q9UJZ1|STML2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33	17-UNIMOD:4	ms_run[2]:scan=5816	31.74	2	2302.1012	2302.1012	R	C	151	172
PSM	EVQMNFLNQLTSVFNPR	1874	sp|Q5T4S7-3|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=410	2.2521	2	2036.0149	2036.0149	K	T	188	205
PSM	FFLEEIQLGEELLAQGEYEK	1875	sp|Q15388|TOM20_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=6016	32.846	3	2384.1788	2384.1788	K	G	69	89
PSM	FGVEQDVDMVFASFIR	1876	sp|P14618-3|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33	9-UNIMOD:35	ms_run[2]:scan=829	4.5042	2	1874.8873	1874.8873	K	K	216	232
PSM	FLVVLNFGDVGLSAGLQASDLPASASLPAK	1877	sp|P08195-2|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=3340	18.116	3	2956.591	2956.5910	R	A	462	492
PSM	FQDTAEALAAFTALMEGK	1878	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=1554	8.4198	3	1912.9241	1912.9241	K	I	50	68
PSM	GAGGEDLIMLDIYAIEELR	1879	sp|P49588|SYAC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=6136	33.523	2	2077.0402	2077.0402	K	A	456	475
PSM	GDTVIDGWQWLINDTLR	1880	sp|Q9BTW9-5|TBCD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=4537	24.68	2	2000.9956	2000.9956	R	H	679	696
PSM	GELSGHFEDLLLAIVNCVR	1881	sp|P12429|ANXA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33	17-UNIMOD:4	ms_run[2]:scan=6550	35.823	3	2141.0939	2141.0939	K	N	230	249
PSM	GFQQILAGEYDHLPEQAFYMVGPIEEAVAK	1882	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=2433	13.166	4	3349.6329	3349.6329	K	A	490	520
PSM	GGDCDGFSTFDVPIFTEEFLDQNK	1883	sp|Q9P0W2-2|HM20B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33	4-UNIMOD:4	ms_run[2]:scan=1403	7.6086	3	2737.1854	2737.1854	K	A	72	96
PSM	GGLGGGYGGASGMGGITAVTVNQSLLSPLVLEVDPNIQAVR	1884	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=698	3.7731	3	3924.0415	3924.0415	R	T	48	89
PSM	GILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVK	1885	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=780	4.2287	4	4035.8875	4035.8875	K	L	272	310
PSM	GILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVK	1886	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=1055	5.692	4	4035.8875	4035.8875	K	L	272	310
PSM	GILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVK	1887	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=2805	15.214	4	4035.8875	4035.8875	K	L	272	310
PSM	GMTLVTPLQLLLFASK	1888	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33	2-UNIMOD:35	ms_run[2]:scan=2666	14.438	2	1746.9954	1746.9954	K	K	1058	1074
PSM	GNFTLPEVAECFDEITYVELQK	1889	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33	11-UNIMOD:4	ms_run[2]:scan=1771	9.6306	2	2601.2309	2601.2309	K	E	619	641
PSM	GVPQIEVTFDIDANGILNVSAVDK	1890	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=8545	47.014	2	2513.3013	2513.3013	R	S	470	494
PSM	IDDILQTLLDATYK	1891	sp|Q16850-2|CP51A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=895	4.8492	2	1620.8611	1620.8611	K	D	179	193
PSM	IGYNPDTVAFVPISGWNGDNMLEPSANMPWFK	1892	sp|P68104-2|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=2491	13.477	3	3566.6639	3566.6639	K	G	160	192
PSM	ILGILALIDEGETDWK	1893	sp|Q9H2U2-3|IPYR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=2874	15.572	2	1784.956	1784.9560	K	L	159	175
PSM	ILSISADIETIGEILKK	1894	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=7457	40.907	2	1842.0714	1842.0714	R	I	87	104
PSM	IPNFWVTTFVNHPQVSALLGEEDEEALHYLTR	1895	sp|Q01105-3|SET_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=1947	10.529	4	3724.8526	3724.8526	K	V	66	98
PSM	IPTAKPELFAYPLDWSIVDSILMER	1896	sp|P49756|RBM25_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33	23-UNIMOD:35	ms_run[2]:scan=6319	34.529	3	2919.5092	2919.5092	K	R	745	770
PSM	IQVTPPGFQLVFLPFADDK	1897	sp|P12956-2|XRCC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=611	3.294	3	2131.1354	2131.1354	K	R	384	403
PSM	ISFDEFVYIFQEVK	1898	sp|P13797-3|PLST_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=3612	19.617	2	1762.8818	1762.8818	K	S	27	41
PSM	ITLAEALLHPFFAGLTPEER	1899	sp|P49761-3|CLK3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=3856	20.945	3	2224.1892	2224.1892	R	S	438	458
PSM	IYKVPSTEAEALASSLMGLFEK	1900	sp|P50395|GDIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=2482	13.429	3	2383.2345	2383.2345	K	R	116	138
PSM	KPLVIIAEDVDGEALSTLVLNR	1901	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=2704	14.648	3	2364.3264	2364.3264	R	L	269	291
PSM	LCYVALDFEQEMATAASSSSLEK	1902	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33	2-UNIMOD:4	ms_run[2]:scan=5981	32.653	3	2549.1666	2549.1666	K	S	216	239
PSM	LDLMDAGTDAMDVLMGR	1903	sp|O00429-4|DNM1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=5691	31.034	2	1822.8263	1822.8263	K	V	217	234
PSM	LGAGYPMGPFELLDYVGLDTTK	1904	sp|Q16836|HCDH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=5416	29.522	2	2356.1661	2356.1661	K	F	250	272
PSM	LLEETQLDMNEFDNLLQPIIDTCTK	1905	sp|Q8IWX8|CHERP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33	23-UNIMOD:4	ms_run[2]:scan=3416	18.531	3	2992.4409	2992.4409	K	D	146	171
PSM	LLIVSNPVDILTYVAWK	1906	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=4593	24.977	3	1943.1132	1943.1132	K	I	133	150
PSM	LLIVSNPVDILTYVAWK	1907	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=4689	25.498	3	1943.1132	1943.1132	K	I	133	150
PSM	LNDYLQIETIQALEELAAK	1908	sp|Q9C0B1|FTO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=1250	6.7809	3	2174.1471	2174.1471	K	E	142	161
PSM	LPPLPLTLALGAFLNHR	1909	sp|O96008|TOM40_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=4240	23.048	3	1842.088	1842.0880	K	K	332	349
PSM	LQDFNVGDYIEAVLDR	1910	sp|P11216|PYGB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=3271	17.731	2	1865.9159	1865.9159	K	N	255	271
PSM	LSVGLEDEEDLLEDLDQALK	1911	sp|P32929-2|CGL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=4612	25.083	2	2243.1057	2243.1057	R	A	332	352
PSM	LTTVLNSGFLDEWLTLEDVPSGR	1912	sp|Q9BSJ8|ESYT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=3974	21.612	2	2561.3013	2561.3013	R	L	738	761
PSM	MILELFSKVPSLVGSFIR	1913	sp|P78417-3|GSTO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=6047	33.023	3	2035.154	2035.1540	K	S	87	105
PSM	MNYIGQFLPGYEAPAFMDPLLPK	1914	sp|P32754-2|HPPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=1393	7.5576	3	2611.2855	2611.2855	K	L	111	134
PSM	NDFAFMLHLIDQYDPLYSKR	1915	sp|Q8IWT6|LRC8A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=1661	9.0252	3	2485.21	2485.2100	K	F	370	390
PSM	NHLVTLPEAIHFLTEIEVLDVR	1916	sp|Q13045-2|FLII_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=5185	28.251	3	2557.3904	2557.3904	K	E	296	318
PSM	NMAEQIIQEIYSQIQSK	1917	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=7438	40.807	3	2022.0092	2022.0092	K	K	265	282
PSM	NSSLAGAAFLLLCLLHK	1918	sp|P28288-2|ABCD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33	13-UNIMOD:4	ms_run[2]:scan=4265	23.191	2	1827.0077	1827.0077	R	R	12	29
PSM	NTPWPEAEAIAPQVGNDAVFLILYK	1919	sp|Q9Y262-2|EIF3L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=830	4.5098	3	2755.4221	2755.4221	K	E	109	134
PSM	NVALITGITGQDGSYLAEFLLEK	1920	sp|O60547|GMDS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=1671	9.0817	3	2451.2897	2451.2897	R	G	24	47
PSM	QEGLDGGLPEEVLFGNLDLLPPPGK	1921	sp|Q8N163-2|CCAR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=546	2.9414	3	2603.3483	2603.3483	R	S	764	789
PSM	QIKPYTLMSMVANLLYEK	1922	sp|P49720|PSB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=3193	17.33	3	2141.1265	2141.1265	R	R	81	99
PSM	QTAVSVENFIAELLPDK	1923	sp|Q96M27-5|PRRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=3130	16.984	2	1872.9833	1872.9833	K	W	326	343
PSM	QWIVFDGDVDPEWVENLNSVLDDNK	1924	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=4549	24.742	2	2945.3719	2945.3719	R	L	2299	2324
PSM	RPGAFAIYLEPWHLDIFEFLDLKK	1925	sp|P23921|RIR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=4948	26.908	5	2917.5531	2917.5531	K	N	293	317
PSM	SIFGDALLIEPLDKYPLAPGVPLPSPQDLMGR	1926	sp|Q01970-2|PLCB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=3252	17.632	3	3418.821	3418.8211	R	I	364	396
PSM	SLLVPSDFLSVHLSWLSAFPLSQPFSLHHPSR	1927	sp|Q8N163-2|CCAR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=4584	24.931	4	3600.8882	3600.8882	R	I	249	281
PSM	SPLLFTLAENCIDQVMK	1928	sp|Q6P3X3|TTC27_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33	11-UNIMOD:4	ms_run[2]:scan=2975	16.134	2	1977.9904	1977.9904	R	L	200	217
PSM	STQVPHFLLEDLLLNEWEASK	1929	sp|Q7Z478|DHX29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=1170	6.3388	3	2468.2587	2468.2587	K	C	602	623
PSM	STTTIGLVQALGAHLYQNVFACVR	1930	sp|P11586|C1TC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33	22-UNIMOD:4	ms_run[2]:scan=3405	18.469	3	2618.3639	2618.3639	K	Q	387	411
PSM	TIYDIAWCQLTGALATACGDDAIR	1931	sp|O76071|CIAO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33	8-UNIMOD:4,18-UNIMOD:4	ms_run[2]:scan=4949	26.913	2	2654.2469	2654.2469	R	V	254	278
PSM	TSTILGDITSIPELADYIK	1932	sp|Q96AC1-2|FERM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=621	3.3489	2	2049.0882	2049.0882	K	V	362	381
PSM	TVLLSLQALLAAAEPDDPQDAVVANQYK	1933	sp|P61086-2|UBE2K_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=1368	7.429	3	2952.5444	2952.5444	R	Q	57	85
PSM	TVSLGAGAKDELHIVEAEAMNYEGSPIK	1934	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=6881	37.676	3	2928.4539	2928.4539	R	V	46	74
PSM	VFIMDSCDELIPEYLNFIR	1935	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33	4-UNIMOD:35,7-UNIMOD:4	ms_run[2]:scan=1852	10.042	2	2389.1334	2389.1334	R	G	360	379
PSM	VFPDKEVMLDAALALAAEISSK	1936	sp|Q13011|ECH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=6500	35.538	3	2317.2239	2317.2239	R	S	246	268
PSM	VHGSSEAFWILVEDVDSEVILHHEYFLLK	1937	sp|O75643|U520_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=5584	30.456	4	3410.7187	3410.7187	K	A	1214	1243
PSM	VQALTTDISLIFAALK	1938	sp|Q6PKG0-3|LARP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=6748	36.917	2	1702.9869	1702.9869	R	D	370	386
PSM	VTPQSLFILFGVYGDVQR	1939	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=982	5.2901	2	2038.0888	2038.0888	R	V	349	367
PSM	VWAEPCLIDAAKEEYNGVIEEFLATGEK	1940	sp|Q9H4A4|AMPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33	6-UNIMOD:4	ms_run[2]:scan=6387	34.898	4	3180.5325	3180.5325	R	L	249	277
PSM	WLPAGDALLQMITIHLPSPVTAQK	1941	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=5285	28.79	4	2599.4196	2599.4196	R	Y	343	367
PSM	WYQADSPPADLLLTEEEFLSFLHPEHSR	1942	sp|Q9BRK5-2|CAB45_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=6362	34.758	4	3326.5884	3326.5884	R	G	101	129
PSM	LFNDSSPVVLEESWDALNAITK	1943	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1379	7.4891944	3	2447.225490	2447.222021	R	K	2200	2222
PSM	FLSDFRDLMSWINGIR	1944	sp|Q13813|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=5823	31.779148	3	1969.992289	1968.988003	R	G	1344	1360
PSM	DGAGFLINLIDSPGHVDFSSEVTAALR	1945	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=8275	45.473384	3	2800.390495	2800.403174	K	V	94	121
PSM	LMEPIYLVEIQCPEQVVGGIYGVLNR	1946	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33	2-UNIMOD:35,12-UNIMOD:4	ms_run[1]:scan=6453	35.268843	3	3005.569978	3004.540202	R	K	740	766
PSM	LMEPIYLVEIQCPEQVVGGIYGVLNR	1947	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33	2-UNIMOD:35,12-UNIMOD:4	ms_run[1]:scan=6554	35.844946	3	3005.569978	3004.540202	R	K	740	766
PSM	GILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVK	1948	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=8633	47.516487	4	4034.893995	4035.887504	K	L	272	310
PSM	GILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVK	1949	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=8007	43.971158	4	4035.860320	4035.887504	K	L	272	310
PSM	SGETEDTFIADLVVGLCTGQIK	1950	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33	17-UNIMOD:4	ms_run[1]:scan=6669	36.469038	2	2353.152923	2352.151893	R	T	373	395
PSM	GLYGIKDDVFLSVPCILGQNGISDLVK	1951	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33	15-UNIMOD:4	ms_run[1]:scan=303	1.6690083	3	2921.534506	2919.541582	K	V	279	306
PSM	GLYGIKDDVFLSVPCILGQNGISDLVK	1952	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33	15-UNIMOD:4	ms_run[1]:scan=413	2.2685752	3	2920.530832	2919.541582	K	V	279	306
PSM	GLYGIKDDVFLSVPCILGQNGISDLVK	1953	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33	15-UNIMOD:4	ms_run[1]:scan=202	1.1078289	3	2921.531576	2919.541582	K	V	279	306
PSM	GLYGIKDDVFLSVPCILGQNGISDLVK	1954	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33	15-UNIMOD:4	ms_run[1]:scan=619	3.3376737	3	2920.530832	2919.541582	K	V	279	306
PSM	GLYGIKDDVFLSVPCILGQNGISDLVK	1955	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33	15-UNIMOD:4	ms_run[1]:scan=2	0.0088677676	3	2921.533224	2919.541582	K	V	279	306
PSM	GPAVGIDLGTTYSCVGVFQHGK	1956	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33	14-UNIMOD:4	ms_run[1]:scan=7116	39.006083	3	2263.115606	2262.110303	K	V	4	26
PSM	ILLANFLAQTEALMR	1957	sp|P06744|G6PI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=2577	13.949923	2	1702.945611	1702.944012	K	G	424	439
PSM	TDALQPPHEYVPWVTVNGKPLEDQTQLLTLVCQLYQGK	1958	sp|P13284|GILT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33	32-UNIMOD:4	ms_run[1]:scan=2215	12.007005	4	4379.218027	4378.230760	R	K	195	233
PSM	QNQVGVVPWSPPQSNWNPWTSSNIDEGPLAFATPEQISMDLK	1959	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=3639	19.763436	4	4664.230072	4664.228193	R	N	324	366
PSM	DGHNLISLLEVLSGDSLPR	1960	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=5286	28.795786	3	2034.077574	2034.074569	R	E	209	228
PSM	APALGGSFAGLEPMGLLWALEPEKPLVR	1961	sp|Q86TX2|ACOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=2689	14.563835	3	2918.575229	2918.572822	R	L	65	93
PSM	QLLQANPILEAFGNAK	1962	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33	1-UNIMOD:28	ms_run[1]:scan=18	0.079503301	2	1708.9168	1708.9143	R	T	210	226
PSM	QDVEALWENMAVIDCFASDHAPHTLEEK	1963	sp|P27708|PYR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33	1-UNIMOD:28,15-UNIMOD:4	ms_run[1]:scan=1968	10.64119	3	3238.4542	3237.4382	R	C	1668	1696
PSM	HTDSLFPILLQTLSDESDEVILK	1964	sp|Q08AM6|VAC14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=4993	27.165569	3	2612.362986	2612.358515	R	D	439	462
PSM	QNRDEVLDNLLAFVCDIRPEIHENYR	1965	sp|O75348|VATG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33	1-UNIMOD:28,15-UNIMOD:4	ms_run[1]:scan=4329	23.552073	4	3210.5534	3210.5511	R	I	90	116
PSM	EALKDEYDDLSDLTAAQQETLSDWESQFTFK	1966	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1550	8.394622	3	3622.646591	3622.647499	K	Y	133	164
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	1967	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33	27-UNIMOD:4	ms_run[1]:scan=9095	49.876688	3	3513.697043	3512.695593	R	R	85	117
PSM	AEEGIAAGGVMDVNTALQEVLK	1968	sp|P25398|RS12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33	1-UNIMOD:1	ms_run[1]:scan=5399	29.423634	2	2256.1309	2256.1302	M	T	2	24
PSM	AAEPLTELEESIETVVTTFFTFAR	1969	sp|Q99584|S10AD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33	1-UNIMOD:1	ms_run[1]:scan=7977	43.801562	3	2743.3652	2742.3632	M	Q	2	26
PSM	QIIQQNPSLLPALLQQIGR	1970	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33	1-UNIMOD:28	ms_run[1]:scan=2952	16.002217	3	2112.2109	2112.2050	R	E	290	309
PSM	LSAVEAIANAISVVSSNGPGNR	1971	sp|O95071|UBR5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1045	5.639206	3	2126.136866	2125.112745	R	A	956	978
PSM	KLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTALPDEDDDL	1972	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33		ms_run[1]:scan=6263	34.217164	5	5386.6181	5386.6148	R	-	167	217
PSM	AAAEGPVGDGELWQTWLPNHVVFLR	1973	sp|Q99567|NUP88_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33	1-UNIMOD:1	ms_run[1]:scan=1636	8.8857908	3	2803.4048	2803.4077	M	L	2	27
PSM	NIAPHTVVDSIMTALSPYASLAVNNIR	1974	sp|P52756|RBM5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=6606	36.132464	3	2866.506052	2866.501114	R	L	237	264
PSM	ERPPNPIEFLASYLLK	1975	sp|Q9C005|DPY30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=5968	32.581079	2	1886.037369	1886.030185	K	N	75	91
PSM	QITIIDSPSFIVSPLNSSSALALR	1976	sp|Q9BVP2|GNL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33	1-UNIMOD:28	ms_run[1]:scan=2730	14.799571	2	2511.3570	2511.3579	K	S	300	324
PSM	KAENPQCLLGDFVTEFFK	1977	sp|Q15042|RB3GP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33	7-UNIMOD:4	ms_run[1]:scan=3698	20.064986	3	2144.052361	2142.045577	R	I	316	334
PSM	YQDQLEAEIEETYANFIK	1978	sp|Q8NHH9|ATLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=371	2.0440709	2	2204.046615	2203.032095	R	H	444	462
PSM	QGFGELLQAVPLADSFR	1979	sp|P27695|APEX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33	1-UNIMOD:28	ms_run[1]:scan=6109	33.373049	2	1829.9338	1829.9307	R	H	238	255
PSM	LGIDDLVHFDFMDPPAPETLMR	1980	sp|O43143|DHX15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1709	9.2933265	3	2528.209691	2528.207968	K	A	517	539
PSM	DTPALFNFTTQELSSNPPLATILIPPHAR	1981	sp|P49841|GSK3B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=216	1.1869287	3	3161.662863	3160.655700	R	I	355	384
PSM	SPPYTAFLGNLPYDVTEESIKEFFR	1982	sp|P23588|IF4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=7441	40.820225	3	2919.434339	2919.433077	K	G	93	118
PSM	AAGVCLMLLATCCEDDIVPHVLPFIK	1983	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32	5-UNIMOD:4,12-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=754	4.0828	3	2941.4574	2941.4574	K	E	202	228
PSM	ADIWSLGITAIELAK	1984	sp|O00506-3|STK25_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=1016	5.4737	2	1599.8872	1599.8872	K	G	102	117
PSM	ADTNLGNILLNVLIPPNMPCTR	1985	sp|Q9UKX7-2|NUP50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32	20-UNIMOD:4	ms_run[2]:scan=3585	19.473	3	2435.2665	2435.2665	R	T	369	391
PSM	AHPDVLTIMLQLFDEGR	1986	sp|Q9H078-5|CLPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=7346	40.291	3	1953.9982	1953.9982	K	L	258	275
PSM	AILQNSWTEVMDLILKPR	1987	sp|Q96PZ0|PUS7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=3195	17.341	3	2126.1558	2126.1558	R	S	393	411
PSM	AKGGEEPLPEGLFWLLVTGHIPTEEQVSWLSK	1988	sp|O75390|CISY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=7336	40.235	4	3546.8399	3546.8399	K	E	108	140
PSM	ALDLFSDNAPPPELLEIINEDIAKR	1989	sp|Q15084-3|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=1565	8.4815	4	2792.4596	2792.4596	R	T	262	287
PSM	ALEFLDQLLLQNIR	1990	sp|P42695|CNDD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=54	0.28415	2	1684.9512	1684.9512	K	H	639	653
PSM	AQLGVQAFADALLIIPK	1991	sp|P40227-2|TCPZ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=186	1.0207	2	1767.0295	1767.0295	R	V	388	405
PSM	AREFGAGPLFNQILPLLMSPTLEDQER	1992	sp|O75533|SF3B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=2756	14.941	3	3041.5644	3041.5644	K	H	523	550
PSM	AVLAPLIALVYSVPR	1993	sp|Q9Y320-2|TMX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=1814	9.8488	3	1580.9654	1580.9654	M	L	2	17
PSM	AVLAPLIALVYSVPR	1994	sp|Q9Y320-2|TMX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=1918	10.371	3	1580.9654	1580.9654	M	L	2	17
PSM	DALEFWLQAGVDGFQVR	1995	sp|P08195-2|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=4727	25.704	3	1949.9636	1949.9636	K	D	231	248
PSM	DFSSVFQFLREEETF	1996	sp|P31937|3HIDH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6869	37.609	2	1879.8628	1879.8628	K	-	322	337
PSM	DFSSVFQFLREEETF	1997	sp|P31937|3HIDH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6966	38.165	2	1879.8628	1879.8628	K	-	322	337
PSM	DFVSEQLTSLLVNGVQLPALGENKK	1998	sp|P54136-2|SYRC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=2864	15.516	3	2698.4541	2698.4541	K	V	97	122
PSM	DGAGFLINLIDSPGHVDFSSEVTAALR	1999	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=4802	26.107	2	2800.4032	2800.4032	K	V	94	121
PSM	DILCGAADEVLAVLK	2000	sp|O75643|U520_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32	4-UNIMOD:4	ms_run[2]:scan=1124	6.0802	2	1585.8385	1585.8385	R	N	130	145
PSM	DLMHGLITLMLDSR	2001	sp|Q14008-2|CKAP5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=5847	31.917	2	1613.8269	1613.8269	K	I	1581	1595
PSM	DMAIATGGAVFGEEGLTLNLEDVQPHDLGK	2002	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=5959	32.533	3	3096.5074	3096.5074	K	V	315	345
PSM	DNTIEHLLPLFLAQLKDECPEVR	2003	sp|P30153|2AAA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32	19-UNIMOD:4	ms_run[2]:scan=899	4.8716	4	2749.4109	2749.4109	K	L	359	382
PSM	DVLETPVDLAGFPVLLSDTAGLR	2004	sp|Q969Y2-3|GTPB3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=4772	25.942	2	2397.2791	2397.2791	R	E	286	309
PSM	EAWEEEQEVAELLKEEFPAWYEK	2005	sp|Q9UIG0-2|BAZ1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=1085	5.8597	3	2881.3334	2881.3334	K	L	64	87
PSM	EDLATFIEELEAVEAK	2006	sp|P11388|TOP2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=4894	26.604	2	1805.8935	1805.8935	K	E	1169	1185
PSM	EDLATFIEELEAVEAK	2007	sp|P11388|TOP2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=4914	26.717	3	1805.8935	1805.8935	K	E	1169	1185
PSM	EEIVQFFSGLEIVPNGITLPVDPEGK	2008	sp|P52597|HNRPF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=5055	27.518	2	2826.4691	2826.4691	K	I	125	151
PSM	EGFDALDPFIPILVSNYNPK	2009	sp|P51398-2|RT29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=2856	15.471	3	2248.1416	2248.1416	K	E	291	311
PSM	EIVDSYLPVILDIIK	2010	sp|P07602|SAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=7025	38.499	2	1728.9913	1728.9913	K	G	108	123
PSM	EMQEVETNLQEVVFDYLHATAYQNTALGR	2011	sp|O75439|MPPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=3890	21.137	4	3368.5983	3368.5983	R	T	181	210
PSM	EMYTLGITNFPIPGEPGFPLNAIYAK	2012	sp|O15145|ARPC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=1667	9.0593	3	2852.4459	2852.4459	K	P	94	120
PSM	ENVNSLLPVFEEFLK	2013	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=2962	16.058	2	1776.9298	1776.9298	K	N	1290	1305
PSM	EQLIIPQVPLFNILAK	2014	sp|Q53GS9-2|SNUT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=499	2.6904	2	1835.0921	1835.0921	K	F	303	319
PSM	ESQPLLGTVIDGMLLLK	2015	sp|P23141|EST1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=3907	21.235	2	1826.0223	1826.0223	R	T	314	331
PSM	ESQPLLGTVIDGMLLLK	2016	sp|P23141|EST1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=4006	21.784	2	1826.0223	1826.0223	R	T	314	331
PSM	ETGQEHELIESMPLLEWFANNYK	2017	sp|P62495-2|ERF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=4901	26.643	3	2777.3007	2777.3007	K	K	328	351
PSM	EVQMNFLNQLTSVFNPR	2018	sp|Q5T4S7-3|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=308	1.6995	2	2036.0149	2036.0149	K	T	188	205
PSM	EYYTLDSILFLLNNVHLSHPVYVR	2019	sp|Q6P1J9|CDC73_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=3882	21.092	3	2904.5174	2904.5174	R	R	53	77
PSM	FFPEDVSEELIQEITQR	2020	sp|P35241-3|RADI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=3834	20.821	2	2079.0161	2079.0161	K	L	52	69
PSM	FGVEQDVDMVFASFIR	2021	sp|P14618-3|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=5846	31.911	3	1858.8924	1858.8924	K	K	216	232
PSM	FGVEQDVDMVFASFIR	2022	sp|P14618-3|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=5943	32.453	3	1858.8924	1858.8924	K	K	216	232
PSM	FGVEQDVDMVFASFIR	2023	sp|P14618-3|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6148	33.591	3	1858.8924	1858.8924	K	K	216	232
PSM	FGVEQDVDMVFASFIR	2024	sp|P14618-3|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6270	34.258	3	1858.8924	1858.8924	K	K	216	232
PSM	FGVEQDVDMVFASFIR	2025	sp|P14618-3|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6396	34.948	3	1858.8924	1858.8924	K	K	216	232
PSM	FLILGDIDGLMDEFSK	2026	sp|P57740-3|NU107_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6406	35.007	2	1811.9015	1811.9015	K	W	367	383
PSM	FQDTAEALAAFTALMEGK	2027	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=1457	7.8939	3	1912.9241	1912.9241	K	I	50	68
PSM	FSSVQLLGDLLFHISGVTGK	2028	sp|Q92616|GCN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6994	38.325	3	2117.1521	2117.1521	R	M	1833	1853
PSM	GAGGEDLIMLDIYAIEELR	2029	sp|P49588|SYAC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6246	34.124	2	2077.0402	2077.0402	K	A	456	475
PSM	GFGGAMTDAAALNILALSPPAQNLLLK	2030	sp|P04062-4|GLCM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=940	5.0911	3	2666.4466	2666.4466	K	S	32	59
PSM	GFNDDVLLQIVHFLLNRPKEEK	2031	sp|Q9NP92|RT30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6087	33.249	4	2623.4122	2623.4122	K	S	412	434
PSM	GFSDEDNTWEPEENLDCPDLIAEFLQSQK	2032	sp|P83916|CBX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32	17-UNIMOD:4	ms_run[2]:scan=471	2.5576	3	3425.4882	3425.4882	K	T	44	73
PSM	GGGEELAQLAGVPFLGSVPLDPALMR	2033	sp|Q9Y5Y2|NUBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=1637	8.8914	3	2593.3574	2593.3574	R	T	209	235
PSM	GIFVQSLIPFYVATSMTAPSNFLHR	2034	sp|Q3SXM5-2|HSDL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=3769	20.454	3	2795.4469	2795.4469	K	C	185	210
PSM	GILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVK	2035	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=535	2.8808	4	4035.8875	4035.8875	K	L	272	310
PSM	GILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVK	2036	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=646	3.4887	4	4035.8875	4035.8875	K	L	272	310
PSM	GILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVK	2037	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=4271	23.225	4	4035.8875	4035.8875	K	L	272	310
PSM	GLDIPLLDNVINYSFPAK	2038	sp|Q8TDD1|DDX54_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=5022	27.33	2	1988.0619	1988.0619	R	G	401	419
PSM	GMYGIENEVFLSLPCILNAR	2039	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32	15-UNIMOD:4	ms_run[2]:scan=2043	11.054	2	2295.1392	2295.1392	K	G	280	300
PSM	GQNDLMGTAEDFADQFLR	2040	sp|O15260-2|SURF4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=2506	13.564	3	2026.9055	2026.9055	M	V	2	20
PSM	GTLDALLAGERDPWTVSSEGVHTVDQVLSEVSR	2041	sp|P0DPD7|EFMT4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=1582	8.5759	4	3522.7591	3522.7591	K	V	131	164
PSM	GVESVFDIMEMEDEERNALLQLTDSQIADVAR	2042	sp|O75643|U520_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=5550	30.269	3	3622.7131	3622.7131	K	F	1978	2010
PSM	GYTLLSEGIDEMVGIIYKPK	2043	sp|O75643|U520_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=1381	7.5005	2	2225.1654	2225.1654	K	T	86	106
PSM	HFYWYLTNEGIQYLRDYLHLPPEIVPATLR	2044	sp|P46783|RS10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=5618	30.639	4	3716.9144	3716.9144	R	R	66	96
PSM	IDLRPVLGEGVPILASFLR	2045	sp|Q86VP6-2|CAND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=5371	29.275	3	2064.2095	2064.2095	K	K	474	493
PSM	IETELRDICNDVLSLLEK	2046	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32	9-UNIMOD:4	ms_run[2]:scan=2710	14.682	2	2159.1144	2159.1144	K	F	86	104
PSM	IHESAGLPFFEIFVDAPLNICESR	2047	sp|O95340|PAPS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32	21-UNIMOD:4	ms_run[2]:scan=2879	15.6	3	2760.3581	2760.3581	K	D	135	159
PSM	IHHELNQFCSAHTLQEVYIELFDQIDENLK	2048	sp|O75477|ERLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32	9-UNIMOD:4	ms_run[2]:scan=1078	5.8227	5	3682.7726	3682.7726	K	Q	122	152
PSM	ILNWEGVQYLWSFVLENHRR	2049	sp|Q9H568|ACTL8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=1186	6.4286	4	2558.3183	2558.3183	R	E	72	92
PSM	ILSISADIETIGEILK	2050	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=2544	13.783	2	1713.9764	1713.9764	R	K	87	103
PSM	IMCEILSGLQLGDFLIK	2051	sp|P49590-2|SYHM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32	3-UNIMOD:4	ms_run[2]:scan=2430	13.149	2	1949.0366	1949.0366	K	V	170	187
PSM	IMDATNILVSPLVYLYPDIPKEEAFGK	2052	sp|P40763-3|STAT3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=538	2.8977	3	3035.5929	3035.5929	K	Y	659	686
PSM	IPEEFNVFNLIQEMR	2053	sp|Q05209-2|PTN12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=3398	18.429	2	1877.9346	1877.9346	K	T	126	141
PSM	IQVIDISMILAEAIR	2054	sp|P60891-2|PRPS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6846	37.477	2	1683.9593	1683.9593	K	R	220	235
PSM	ISLTQAGLEALFESNLLDDLK	2055	sp|Q16401|PSMD5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=7399	40.586	3	2289.2104	2289.2104	R	S	152	173
PSM	IVAPELYIAVGISGAIQHLAGMK	2056	sp|P13804-2|ETFA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32	22-UNIMOD:35	ms_run[2]:scan=6276	34.29	3	2366.3032	2366.3032	K	D	220	243
PSM	KAEALAQISAAFEDLEQALQQR	2057	sp|O75382-4|TRIM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=3887	21.12	3	2429.2551	2429.2551	R	K	75	97
PSM	KHTILADIVISAAGIPNLITADMIK	2058	sp|P13995-2|MTDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=4244	23.071	3	2617.4877	2617.4877	K	E	140	165
PSM	KNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGK	2059	sp|Q09028-3|RBBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=4891	26.587	5	3953.0186	3953.0186	K	D	26	60
PSM	LCYVALDFEQEMATAASSSSLEK	2060	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32	2-UNIMOD:4	ms_run[2]:scan=1514	8.1956	2	2549.1666	2549.1666	K	S	216	239
PSM	LEQFVSILMASIPLPDK	2061	sp|P00491|PNPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=5806	31.684	2	1900.038	1900.0380	K	A	271	288
PSM	LEQFVSILMASIPLPDK	2062	sp|P00491|PNPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=5934	32.409	3	1900.038	1900.0380	K	A	271	288
PSM	LINNAITALLSQEGDVVASNAELESQFQAVR	2063	sp|O75165|DJC13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=3099	16.817	3	3299.6997	3299.6997	K	R	403	434
PSM	LLIVSNPVDILTYVAWK	2064	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=4977	27.073	2	1943.1132	1943.1132	K	I	133	150
PSM	LLIVSNPVDILTYVAWK	2065	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=5074	27.628	2	1943.1132	1943.1132	K	I	133	150
PSM	LLSPFMPFVTEELFQR	2066	sp|P26640|SYVC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=2875	15.577	2	1953.007	1953.0070	R	L	1059	1075
PSM	LSSQEESIGTLLDAIICR	2067	sp|Q9Y3C4-2|TPRKB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32	17-UNIMOD:4	ms_run[2]:scan=1822	9.888	2	2004.0198	2004.0198	K	M	118	136
PSM	MFTAGIDLMDMASDILQPK	2068	sp|Q13011|ECH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:35	ms_run[2]:scan=5007	27.243	3	2111.9941	2111.9941	K	G	113	132
PSM	MLAEDELRDAVLLVFANK	2069	sp|P84077|ARF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=3931	21.367	2	2046.082	2046.0820	R	Q	110	128
PSM	NAPAIIFIDELDAIAPK	2070	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=767	4.1559	3	1809.9877	1809.9877	K	R	296	313
PSM	NLALGGGLLLLLAESR	2071	sp|O15260-2|SURF4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=394	2.1699	2	1608.9563	1608.9563	R	S	120	136
PSM	NLALGGGLLLLLAESR	2072	sp|O15260-2|SURF4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=514	2.7706	2	1608.9563	1608.9563	R	S	120	136
PSM	NLEALALDLMEPEQAVDLTLPK	2073	sp|P12956-2|XRCC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=4366	23.76	2	2422.2665	2422.2665	R	V	448	470
PSM	NLLGELNPSIPLLPDDILSQIR	2074	sp|Q8WXH0|SYNE2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=5046	27.465	3	2429.353	2429.3530	K	K	2745	2767
PSM	NLNPEDIDQLITISGMVIR	2075	sp|P33991|MCM4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=48	0.25046	2	2140.1198	2140.1198	R	T	273	292
PSM	NTVLCNVVEQFLQADLAR	2076	sp|Q14258|TRI25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32	5-UNIMOD:4	ms_run[2]:scan=6383	34.875	2	2089.0626	2089.0626	K	E	66	84
PSM	QFQFMAWPDHGVPEYPTPILAFLR	2077	sp|P10586-2|PTPRF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=2330	12.631	3	2859.4207	2859.4207	R	R	1499	1523
PSM	QGLLEFVDITATNHTNEIQDYLQQLTGAR	2078	sp|P35754|GLRX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=5438	29.648	4	3287.6422	3287.6422	K	T	40	69
PSM	SCTDSELLLHPELLSQEFLLLTLEQK	2079	sp|Q9BVC5-2|ASHWN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32	2-UNIMOD:4	ms_run[2]:scan=5569	30.375	3	3055.5788	3055.5788	R	N	47	73
PSM	SGETEDTFIADLVVGLCTGQIK	2080	sp|P06733-2|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32	17-UNIMOD:4	ms_run[2]:scan=8503	46.773	2	2352.1519	2352.1519	R	T	280	302
PSM	SGETEDTFIADLVVGLCTGQIK	2081	sp|P06733-2|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32	17-UNIMOD:4	ms_run[2]:scan=8601	47.333	2	2352.1519	2352.1519	R	T	280	302
PSM	SISPFPELEQFLQDTIKR	2082	sp|Q8NFF5-3|FAD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=622	3.3545	3	2147.1263	2147.1263	R	Y	341	359
PSM	SLQDIIAILGMDELSEEDKLTVSR	2083	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=5804	31.672	3	2674.3735	2674.3735	K	A	433	457
PSM	SLQDIIAILGMDELSEEDKLTVSR	2084	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=5917	32.315	3	2674.3735	2674.3735	K	A	433	457
PSM	STAISLFYELSENDLNFIK	2085	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=3570	19.39	2	2203.1049	2203.1049	K	Q	72	91
PSM	TEFLSFMNTELAAFTK	2086	sp|P31949|S10AB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32	7-UNIMOD:35	ms_run[2]:scan=37	0.18875	2	1864.8917	1864.8917	K	N	37	53
PSM	TFLVIPELAQELHVWTDK	2087	sp|P49902-2|5NTC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=702	3.7956	3	2138.1412	2138.1412	R	S	339	357
PSM	TFSLFQQLIQSSFVVER	2088	sp|P42224-2|STAT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=3349	18.164	2	2028.068	2028.0680	R	Q	305	322
PSM	TGAFALPILNALLETPQR	2089	sp|Q9H0S4-2|DDX47_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=5558	30.314	2	1924.0782	1924.0782	K	L	75	93
PSM	TGAFALPILNALLETPQR	2090	sp|Q9H0S4-2|DDX47_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=5861	31.995	2	1924.0782	1924.0782	K	L	75	93
PSM	TLQAAAFLDFLWHNMKLPVPAAAPTPWETHK	2091	sp|Q12788|TBL3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6185	33.799	4	3500.8067	3500.8067	R	G	774	805
PSM	TNLYQDDAVTGEAAGLALGLVMLGSK	2092	sp|Q99460-2|PSMD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=4574	24.877	3	2606.3262	2606.3262	K	N	499	525
PSM	TVLLSIQALLSAPNPDDPLANDVAEQWK	2093	sp|P61088|UBE2N_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=3661	19.874	4	3017.571	3017.5710	R	T	103	131
PSM	TVSLGAGAKDELHIVEAEAMNYEGSPIK	2094	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6943	38.034	4	2928.4539	2928.4539	R	V	46	74
PSM	VAALTGLPFVTAPNKFEALAAHDALVELSGAMNTTACSLMK	2095	sp|P07954-2|FUMH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32	37-UNIMOD:4,40-UNIMOD:35	ms_run[2]:scan=6027	32.908	4	4246.1476	4246.1476	K	I	254	295
PSM	VEPIPWNQAEGDLTPDEVVALVGQGLQEGER	2096	sp|P00813|ADA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=2964	16.07	3	3344.6525	3344.6525	K	D	112	143
PSM	VFPDKEVMLDAALALAAEISSK	2097	sp|Q13011|ECH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6196	33.858	3	2317.2239	2317.2239	R	S	246	268
PSM	VKEFGIDPQNMFEFWDWVGGR	2098	sp|P06744|G6PI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=4926	26.782	3	2556.1896	2556.1896	K	Y	253	274
PSM	VLSAPELLEFLEDQGEEGATLAR	2099	sp|Q8N3E9|PLCD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=2373	12.857	3	2486.254	2486.2540	R	A	269	292
PSM	VPSTEAEALASSLMGLFEK	2100	sp|P50395|GDIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6519	35.644	3	1978.9921	1978.9921	K	R	119	138
PSM	VSEPLLWELFLQAGPVVNTHMPK	2101	sp|Q15427|SF3B4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=2140	11.593	4	2604.3774	2604.3774	K	D	24	47
PSM	VSITFDPFLYLPVPLPQK	2102	sp|O94966-4|UBP19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=5210	28.381	2	2073.1551	2073.1551	K	Q	649	667
PSM	VTPQSLFILFGVYGDVQR	2103	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=917	4.971	3	2038.0888	2038.0888	R	V	349	367
PSM	VVDPIVSNFLQSFETAIEHNK	2104	sp|O14802|RPC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=5026	27.352	3	2386.2169	2386.2169	K	E	185	206
PSM	WLQDVFNVPLVIQMTDDEK	2105	sp|P23381-2|SYWC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=1230	6.6683	3	2289.1351	2289.1351	K	Y	141	160
PSM	YAVDDVPFSIPAASEIADLSNIINK	2106	sp|Q9GZL7|WDR12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=3847	20.896	2	2661.3538	2661.3538	K	L	15	40
PSM	YDDPPDWQEILTYFR	2107	sp|P61221|ABCE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=1621	8.8006	2	1956.8894	1956.8894	K	G	134	149
PSM	YLPELMAEKDSLDPSFTHAMQLLTAEIEK	2108	sp|Q07666-3|KHDR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=915	4.9598	3	3319.6356	3319.6356	K	I	103	132
PSM	YMLLPNQVWDSIIQQATK	2109	sp|O14980|XPO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=2532	13.713	2	2147.1085	2147.1085	K	N	657	675
PSM	RFQSVPAQPGQTSPLLQYFGILLDQGQLNK	2110	sp|Q00610|CLH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=633	3.4139194	3	3343.755161	3342.772461	R	Y	400	430
PSM	KPLVIIAEDVDGEALSTLVLNR	2111	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=6772	37.054909	3	2365.336219	2364.326427	R	L	269	291
PSM	TALLDAAGVASLLTTAEVVVTEIPKEEK	2112	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=8405	46.215355	3	2868.558432	2867.574321	R	D	527	555
PSM	VIHDNFGIVEGLMTTVHAITATQK	2113	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1754	9.5399225	4	2595.339542	2594.352658	K	T	163	187
PSM	GILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVK	2114	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=3934	21.383922	4	4035.888558	4035.887504	K	L	272	310
PSM	GILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVK	2115	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=3825	20.77078	4	4035.888558	4035.887504	K	L	272	310
PSM	GILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVK	2116	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=8436	46.389065	4	4034.868098	4035.887504	K	L	272	310
PSM	GILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVK	2117	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=8733	48.086422	4	4034.893995	4035.887504	K	L	272	310
PSM	GILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVK	2118	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=3177	17.238497	4	4035.888558	4035.887504	K	L	272	310
PSM	GLYGIKDDVFLSVPCILGQNGISDLVK	2119	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32	15-UNIMOD:4	ms_run[1]:scan=718	3.8830884	3	2920.530832	2919.541582	K	V	279	306
PSM	GLYGIKDDVFLSVPCILGQNGISDLVK	2120	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32	15-UNIMOD:4	ms_run[1]:scan=102	0.55433068	3	2921.533407	2919.541582	K	V	279	306
PSM	GPAVGIDLGTTYSCVGVFQHGK	2121	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32	14-UNIMOD:4	ms_run[1]:scan=7221	39.594597	3	2263.115606	2262.110303	K	V	4	26
PSM	YNYHLDSSGSYVFENTVATVMALR	2122	sp|P49588|SYAC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=7409	40.644667	3	2738.298770	2736.285367	K	R	487	511
PSM	EQLPPMSEDFLLDALSEDFSGPQNASSLK	2123	sp|P20810|ICAL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32	6-UNIMOD:35	ms_run[1]:scan=3799	20.624245	3	3181.5192	3180.4802	K	F	501	530
PSM	AGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGK	2124	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32	1-UNIMOD:1,11-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=2492	13.483097	3	3969.8642	3968.8342	M	T	2	39
PSM	YLVSLGCIKPLCDLLTVMDSK	2125	sp|O60684|IMA7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32	7-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1245	6.7527459	3	2424.248998	2424.246662	R	I	416	437
PSM	DGHNLISLLEVLSGDSLPR	2126	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=5280	28.765634	3	2034.077574	2034.074569	R	E	209	228
PSM	CTASEETDHSDLLGTLHNLYLITFNPVGR	2127	sp|Q69YN4|VIR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=6223	34.004095	3	3256.5532	3255.5502	R	S	781	810
PSM	ADAFGDELFSVFEGDSTTAAGTKK	2128	sp|P42285|MTREX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32	1-UNIMOD:1	ms_run[1]:scan=128	0.69438278	3	2505.1578	2505.1542	M	D	2	26
PSM	SCQTALVEILDVIVR	2129	sp|Q9NSE4|SYIM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32	2-UNIMOD:4	ms_run[1]:scan=4601	25.020957	2	1714.917462	1714.928757	R	S	818	833
PSM	SCQTALVEILDVIVR	2130	sp|Q9NSE4|SYIM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32	2-UNIMOD:4	ms_run[1]:scan=4505	24.503896	2	1714.917462	1714.928757	R	S	818	833
PSM	NAVTQFVSSMSASADVLALAK	2131	sp|P0C7P4|UCRIL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=732	3.964026	2	2109.079866	2109.077606	K	I	140	161
PSM	AGEVVPPAMYQFSQYVCQQTGLQIPQLPAPPK	2132	sp|Q5XKP0|MIC13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32	17-UNIMOD:4	ms_run[1]:scan=20	0.090769866	3	3543.780173	3541.773783	K	I	44	76
PSM	CIYCIHALSLYLFK	2133	sp|P46940|IQGA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32	1-UNIMOD:385,1-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=4052	22.032589	2	1782.8848	1782.8832	R	L	148	162
PSM	KQDEPIDLFMIEIMEMK	2134	sp|P40227|TCPZ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=956	5.1691308	3	2109.018489	2109.019622	K	H	181	198
PSM	KQDEPIDLFMIEIMEMK	2135	sp|P40227|TCPZ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=753	4.077199	3	2109.018489	2109.019622	K	H	181	198
PSM	MKFDVFEDFISPTTAAQTLLFTACSK	2136	sp|O95373|IPO7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32	1-UNIMOD:35,24-UNIMOD:4	ms_run[1]:scan=685	3.7021301	3	2983.438483	2983.434734	R	R	378	404
PSM	QADTVYFLPITPQFVTEVIK	2137	sp|P31327|CPSM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=300	1.6521249	2	2309.239842	2308.235486	K	A	478	498
PSM	QADTVYFLPITPQFVTEVIK	2138	sp|P31327|CPSM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=200	1.0984122	2	2309.239597	2308.235486	K	A	478	498
PSM	QWADDWLVHLISPNVYR	2139	sp|Q9H7Z7|PGES2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32	1-UNIMOD:28	ms_run[1]:scan=7355	40.338471	2	2095.0422	2094.0322	R	T	236	253
PSM	DGLEDPLEDTGLVQQQLDQLSTIGR	2140	sp|Q9UIA9|XPO7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=61	0.32609097	2	2740.361179	2739.356283	R	C	427	452
PSM	ASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGK	2141	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32	36-UNIMOD:35,45-UNIMOD:4,48-UNIMOD:4	ms_run[1]:scan=4639	25.228109	7	5823.9072	5822.8742	R	I	13	68
PSM	AAEPLTELEESIETVVTTFFTFAR	2142	sp|Q99584|S10AD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32	1-UNIMOD:1	ms_run[1]:scan=7986	43.853997	2	2742.3492	2742.3632	M	Q	2	26
PSM	QIIQQNPSLLPALLQQIGR	2143	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32	1-UNIMOD:28	ms_run[1]:scan=2909	15.762978	2	2112.2081	2112.2050	R	E	290	309
PSM	QIIQQNPSLLPALLQQIGR	2144	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32	1-UNIMOD:28	ms_run[1]:scan=3006	16.301105	2	2112.2081	2112.2050	R	E	290	309
PSM	FGVEQDVDMVFASFIR	2145	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=6510	35.594281	2	1858.891849	1858.892371	K	K	231	247
PSM	KLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTALPDEDDDL	2146	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32		ms_run[1]:scan=6394	34.936876	4	5386.6133	5386.6148	R	-	167	217
PSM	LTDFVEFLWDPLSTSQTTSLITHCR	2147	sp|P16383|GCFC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32	24-UNIMOD:4	ms_run[1]:scan=957	5.174762	3	2967.449874	2966.448410	R	V	562	587
PSM	SHIQIPPGLTELLQGYTVEVLR	2148	sp|P13861|KAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32	1-UNIMOD:1	ms_run[1]:scan=7231	39.649589	3	2504.3692	2504.3634	M	Q	2	24
PSM	QLASGLLLVTGPLVLNR	2149	sp|Q02878|RL6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32	1-UNIMOD:28	ms_run[1]:scan=4838	26.288691	2	1746.0420	1746.0398	K	V	167	184
PSM	TFLVIPELAQELHVWTDK	2150	sp|P49902|5NTC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=674	3.6416468	3	2138.143743	2138.141192	R	S	368	386
PSM	QLGTAYVSATTGAVATALGLK	2151	sp|Q9BWM7|SFXN3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32	1-UNIMOD:28	ms_run[1]:scan=5926	32.365581	2	1975.0666	1975.0621	R	S	145	166
PSM	CEYLMELMTPAACPEPPPEAPTEDDHDEL	2152	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32	1-UNIMOD:385,1-UNIMOD:4,13-UNIMOD:4	ms_run[1]:scan=4837	26.283074	3	3339.3621	3339.3599	R	-	500	529
PSM	LGIDDLVHFDFMDPPAPETLMR	2153	sp|O43143|DHX15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1807	9.8160537	3	2528.209691	2528.207968	K	A	517	539
PSM	DGAGFLINLIDSPGHVDFSSEVTAALR	2154	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=8059	44.263523	3	2803.394939	2800.403174	K	V	94	121
PSM	GVPQIEVTFDIDANGILNVSAVDK	2155	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=8750	48.183158	2	2512.297548	2513.301334	R	S	470	494
PSM	AFADALEVIPMALSENSGMNPIQTMTEVR	2156	sp|P48643-2|TCPE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31	11-UNIMOD:35	ms_run[2]:scan=2760	14.963	3	3150.5036	3150.5036	R	A	357	386
PSM	AGLEPFFDFIVSINGSR	2157	sp|Q9H8Y8|GORS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=7001	38.364	2	1867.9468	1867.9468	R	L	31	48
PSM	AGNFIGWLHIDGANLSVLLVEHALSK	2158	sp|Q7KZF4|SND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=1656	8.9948	3	2773.4915	2773.4915	K	V	604	630
PSM	AKEGISINCGLLALGNVISALGDK	2159	sp|Q7Z4S6-6|KI21A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31	9-UNIMOD:4	ms_run[2]:scan=929	5.0362	3	2412.3046	2412.3046	R	S	291	315
PSM	ALADILSESLHSLATSLPR	2160	sp|O43156|TTI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=4414	24.026	3	1993.0844	1993.0844	K	L	369	388
PSM	ALEQQVEEMKTQLEELEDELQATEDAK	2161	sp|P35579-2|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=2199	11.918	3	3146.4813	3146.4813	R	L	951	978
PSM	ALNIPEQLPQWDMCNFLVNLQYR	2162	sp|P10619-2|PPGB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31	14-UNIMOD:4	ms_run[2]:scan=1922	10.394	3	2861.3993	2861.3993	K	R	332	355
PSM	AMGIMNSFVNDIFER	2163	sp|Q99880|H2B1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=7476	41.017	2	1742.812	1742.8120	K	I	59	74
PSM	ARFFHLADLFLSSSHLPAYLVAAFAK	2164	sp|Q9BVI4|NOC4L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=4857	26.392	4	2891.5487	2891.5487	R	R	345	371
PSM	ASYIIVPQDGIFSPTSNLLLLDLGHLK	2165	sp|Q96RL7-4|VP13A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=1012	5.4549	3	2923.6059	2923.6059	K	V	653	680
PSM	CDISLQFFLPFSLGK	2166	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:4	ms_run[2]:scan=2924	15.85	2	1770.9015	1770.9015	K	E	157	172
PSM	CDISLQFFLPFSLGK	2167	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:4	ms_run[2]:scan=3028	16.421	2	1770.9015	1770.9015	K	E	157	172
PSM	DALEFWLQAGVDGFQVR	2168	sp|P08195-2|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=5273	28.724	2	1949.9636	1949.9636	K	D	231	248
PSM	DALEFWLQAGVDGFQVR	2169	sp|P08195-2|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=5441	29.665	2	1949.9636	1949.9636	K	D	231	248
PSM	DFLLPFLEEPMDTEADLQFRPR	2170	sp|O43242|PSMD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=1159	6.277	3	2678.305	2678.3050	R	T	129	151
PSM	DILCGAADEVLAVLK	2171	sp|O75643|U520_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31	4-UNIMOD:4	ms_run[2]:scan=1063	5.7358	3	1585.8385	1585.8385	R	N	130	145
PSM	DKEQSSVLITLLLPFLHR	2172	sp|O75691|UTP20_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=3121	16.94	3	2108.1994	2108.1994	K	G	1345	1363
PSM	DLSILSYLSQLQPPMPK	2173	sp|Q5SY16|NOL9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=4472	24.333	2	1929.0281	1929.0281	R	P	521	538
PSM	DLVDDIFTVTEDEIK	2174	sp|Q9GZT4|SRR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=4868	26.456	2	1750.8513	1750.8513	R	C	254	269
PSM	DLVSSLTSGLLTIGDR	2175	sp|P53396-3|ACLY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=3523	19.128	3	1645.8887	1645.8887	K	F	648	664
PSM	DLVVLLFETALLSSGFSLEDPQTHSNR	2176	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=8389	46.124	3	2987.524	2987.5240	K	I	653	680
PSM	DMAIATGGAVFGEEGLTLNLEDVQPHDLGK	2177	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=1595	8.654	3	3096.5074	3096.5074	K	V	315	345
PSM	DSLIQSLATQLELDGFER	2178	sp|Q92878-3|RAD50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=6222	33.998	2	2034.0269	2034.0269	R	G	229	247
PSM	DVLAEIPEQFLSYMR	2179	sp|Q86YQ8-2|CPNE8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=2655	14.38	2	1809.8971	1809.8971	K	A	195	210
PSM	EDVLTLLLPVMGDSK	2180	sp|Q13200|PSMD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=39	0.19998	2	1628.8695	1628.8695	R	S	495	510
PSM	EESLEDVLGPPPDNDDVVNDFDIEDEVVEVENREENLLK	2181	sp|Q8WVY7|UBCP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=4169	22.663	3	4467.0613	4467.0613	R	I	79	118
PSM	ELEDLLSPLEELVK	2182	sp|P37198|NUP62_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=2253	12.217	2	1625.8764	1625.8764	K	E	402	416
PSM	ELEDLLSPLEELVK	2183	sp|P37198|NUP62_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=2357	12.768	2	1625.8764	1625.8764	K	E	402	416
PSM	ELNELVSAIEEHFFQPQK	2184	sp|Q96G03|PGM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=563	3.0283	3	2157.0742	2157.0742	K	Y	587	605
PSM	ENVNSLLPVFEEFLK	2185	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=3060	16.601	2	1776.9298	1776.9298	K	N	1290	1305
PSM	ETLISWLQAQMLNPQPEK	2186	sp|O43592|XPOT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=558	3.0037	2	2125.0878	2125.0878	R	T	81	99
PSM	EVGDGTTSVVIIAAELLK	2187	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=333	1.8357	2	1814.0037	1814.0037	K	N	85	103
PSM	FFPEDVSEELIQEITQR	2188	sp|P35241-3|RADI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=3534	19.189	3	2079.0161	2079.0161	K	L	52	69
PSM	FFPEDVSEELIQEITQR	2189	sp|P35241-3|RADI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=3855	20.94	3	2079.0161	2079.0161	K	L	52	69
PSM	FFPEDVSEELIQEITQR	2190	sp|P35241-3|RADI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=3617	19.646	2	2079.0161	2079.0161	K	L	52	69
PSM	FFPEDVSEELIQEITQR	2191	sp|P35241-3|RADI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=3728	20.236	2	2079.0161	2079.0161	K	L	52	69
PSM	FFPEDVSEELIQEITQR	2192	sp|P35241-3|RADI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=3958	21.519	2	2079.0161	2079.0161	K	L	52	69
PSM	FGVEQDVDMVFASFIR	2193	sp|P14618-3|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31	9-UNIMOD:35	ms_run[2]:scan=1231	6.6739	3	1874.8873	1874.8873	K	K	216	232
PSM	FGVEQDVDMVFASFIR	2194	sp|P14618-3|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=6495	35.51	3	1858.8924	1858.8924	K	K	216	232
PSM	FSMVLPEVEAALAEIPGVR	2195	sp|Q96CN7|ISOC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=5166	28.149	3	2027.0761	2027.0761	K	S	185	204
PSM	FTGSELATLVNNLNDAQDIIVYHELVQPSGK	2196	sp|P98155-2|VLDLR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=3618	19.651	3	3384.7201	3384.7201	K	N	673	704
PSM	GLALHDILTEIHLFVHRVDFPSSVR	2197	sp|P40937-2|RFC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=1128	6.1027	5	2870.5555	2870.5555	K	I	253	278
PSM	GLDIPLLDNVINYSFPAK	2198	sp|Q8TDD1|DDX54_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=4920	26.748	2	1988.0619	1988.0619	R	G	401	419
PSM	GLIAEAAQLGPVGGVFNLAVVLR	2199	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=4003	21.77	2	2263.3052	2263.3052	R	D	1954	1977
PSM	GPRPVQSVVPEMEESGAQLLLEMLTFNPHKR	2200	sp|P11802-2|CDK4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=3321	18.007	5	3488.7908	3488.7908	R	I	133	164
PSM	ICPVETLVEEAIQCAEK	2201	sp|P30084|ECHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31	2-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=447	2.4419	3	1987.9595	1987.9595	K	I	212	229
PSM	IDLRPVLGEGVPILASFLR	2202	sp|Q86VP6-2|CAND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=5469	29.823	3	2064.2095	2064.2095	K	K	474	493
PSM	IITIPPFLAYGEDGDGKDIPGQASLVFDVALLDLHNPK	2203	sp|O95302|FKBP9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=5733	31.268	4	4048.1197	4048.1197	R	D	220	258
PSM	ILLANFLAQTEALMR	2204	sp|P06744|G6PI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=2494	13.494	3	1702.944	1702.9440	K	G	424	439
PSM	IPDPSTWNLNPDASYVYYCANETVHGVEFDFIPDVK	2205	sp|Q9Y617-2|SERC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31	19-UNIMOD:4	ms_run[2]:scan=1969	10.649	3	4171.915	4171.9150	K	G	134	170
PSM	IWDVSVNSVVSTFPMGSTVLDQQLGCLWQK	2206	sp|O75083-3|WDR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31	26-UNIMOD:4	ms_run[2]:scan=6742	36.883	3	3393.6737	3393.6737	K	D	120	150
PSM	KASFEEASNQLINHIEQFLDTNETPYFMK	2207	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=6605	36.127	3	3443.6344	3443.6344	K	S	606	635
PSM	LEDQLQGGQLEEVILQAEHELNLAR	2208	sp|Q16718-2|NDUA5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=2626	14.212	3	2844.4618	2844.4618	K	K	68	93
PSM	LFLDFLEEFQSSDGEIK	2209	sp|Q14566|MCM6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=2867	15.532	2	2015.9728	2015.9728	K	Y	29	46
PSM	LGAGYPMGPFELLDYVGLDTTK	2210	sp|Q16836|HCDH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=5620	30.651	3	2356.1661	2356.1661	K	F	250	272
PSM	LGFFTTYFLPLANTLK	2211	sp|Q5JTH9-2|RRP12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=2974	16.129	2	1845.0077	1845.0077	R	S	482	498
PSM	LLLEQAANEIWESIK	2212	sp|O95352-3|ATG7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=1060	5.719	2	1755.9407	1755.9407	K	S	103	118
PSM	LPPLPLTLALGAFLNHR	2213	sp|O96008|TOM40_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=4142	22.506	3	1842.088	1842.0880	K	K	332	349
PSM	LQDFNVGDYIEAVLDR	2214	sp|P11216|PYGB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=3251	17.626	3	1865.9159	1865.9159	K	N	255	271
PSM	LSSQEESIGTLLDAIICR	2215	sp|Q9Y3C4-2|TPRKB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31	17-UNIMOD:4	ms_run[2]:scan=1812	9.8376	3	2004.0198	2004.0198	K	M	118	136
PSM	LTAQVASLTSELTTLNATIQQQDQELAGLK	2216	sp|Q14980-4|NUMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=1168	6.3275	4	3184.6827	3184.6827	R	Q	496	526
PSM	LVDISYGGENGFNQAIELSTEVLSNVK	2217	sp|P62495-2|ERF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=5701	31.088	3	2895.4502	2895.4502	K	F	220	247
PSM	NFLTFLEELSTPEGK	2218	sp|Q9UK61-2|TASOR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=4778	25.976	2	1723.8669	1723.8669	K	W	911	926
PSM	NSPLTVPMFLSLFSR	2219	sp|Q9BQG0|MBB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=3071	16.663	2	1707.9018	1707.9018	R	H	990	1005
PSM	QALPTEAAILTLAPHSSYFDAIPVTMTMSSIVMK	2220	sp|Q8NF37|PCAT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=2484	13.441	3	3633.8496	3633.8497	R	A	121	155
PSM	QDQIQQVVNHGLVPFLVSVLSK	2221	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=5298	28.863	3	2447.3536	2447.3536	R	A	367	389
PSM	QEGETSSMIFSIPYIISYVSK	2222	sp|Q6P587|FAHD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=5889	32.153	2	2378.1716	2378.1716	R	I	158	179
PSM	QEGETSSMIFSIPYIISYVSK	2223	sp|Q6P587|FAHD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=5987	32.684	2	2378.1716	2378.1716	R	I	158	179
PSM	QEIIEQLLSNIFHK	2224	sp|Q5H9R7-3|PP6R3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=2427	13.132	3	1710.9305	1710.9305	K	E	245	259
PSM	QSSLGMFHLLVAVDGINALWGR	2225	sp|P51398-2|RT29_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=1718	9.3415	3	2383.2471	2383.2471	R	T	209	231
PSM	SFSTAVTEQLQLLPLFFK	2226	sp|Q14997-3|PSME4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=6806	37.249	2	2068.1245	2068.1245	R	I	732	750
PSM	SGETEDTFIADLVVGLCTGQIK	2227	sp|P06733-2|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31	17-UNIMOD:4	ms_run[2]:scan=6064	33.119	3	2352.1519	2352.1519	R	T	280	302
PSM	SGTIFDNFLITNDEAYAEEFGNETWGVTK	2228	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=3945	21.446	3	3267.4884	3267.4884	K	A	323	352
PSM	SHIQSLPDLSLLPNVTGGLAPLPSAGDLFSTD	2229	sp|Q9NQG5|RPR1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=3051	16.551	3	3231.6663	3231.6663	K	-	295	327
PSM	SHIQSLPDLSLLPNVTGGLAPLPSAGDLFSTD	2230	sp|Q9NQG5|RPR1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=3149	17.09	3	3231.6663	3231.6663	K	-	295	327
PSM	SLLVPSDFLSVHLSWLSAFPLSQPFSLHHPSR	2231	sp|Q8N163-2|CCAR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=4570	24.854	5	3600.8882	3600.8882	R	I	249	281
PSM	SQVVIPILQWAIASTTLDHR	2232	sp|Q9Y5L0-5|TNPO3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=3812	20.698	3	2247.2376	2247.2376	R	D	706	726
PSM	STAISLFYELSENDLNFIK	2233	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=3368	18.267	3	2203.1049	2203.1049	K	Q	72	91
PSM	TALLDAAGVASLLTTAEVVVTEIPKEEK	2234	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=8547	47.025	3	2867.5743	2867.5743	R	D	527	555
PSM	TDALQPPHEYVPWVTVNGKPLEDQTQLLTLVCQLYQGK	2235	sp|P13284|GILT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31	32-UNIMOD:4	ms_run[2]:scan=316	1.7447	5	4378.2308	4378.2308	R	K	195	233
PSM	TELLQTLSSDVSELLK	2236	sp|P49454|CENPF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=4506	24.51	2	1774.9564	1774.9564	K	D	2013	2029
PSM	TLSAISSSTDPTSYDGFGPFMPGFDIIPYNDLPALER	2237	sp|P04181-2|OAT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=7295	40.002	3	3990.8874	3990.8874	R	A	43	80
PSM	TSGLASPQLVFSHWEIIPSDPFWVPTTEEEYLHFGEK	2238	sp|Q7Z2Z2-2|EFL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=1529	8.282	4	4273.0684	4273.0684	R	A	993	1030
PSM	TVLDLIVEDLQSTSEDK	2239	sp|Q69YN4-2|VIR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=3614	19.629	2	1903.9626	1903.9626	R	E	1198	1215
PSM	TVPFLPLLGGCIDDTILSR	2240	sp|Q7Z7H8|RM10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31	11-UNIMOD:4	ms_run[2]:scan=1205	6.5357	2	2086.1133	2086.1133	R	Q	170	189
PSM	TVSLGAGAKDELHIVEAEAMNYEGSPIK	2241	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=7345	40.285	4	2928.4539	2928.4539	R	V	46	74
PSM	VAALTGLPFVTAPNKFEALAAHDALVELSGAMNTTACSLMK	2242	sp|P07954-2|FUMH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31	37-UNIMOD:4,40-UNIMOD:35	ms_run[2]:scan=6200	33.88	4	4246.1476	4246.1476	K	I	254	295
PSM	VGTDLLEEEITKFEEHVQSVDIAAFNK	2243	sp|P29692-3|EF1D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=503	2.7122	4	3060.5292	3060.5292	K	I	230	257
PSM	VHNLITDFLALMPMK	2244	sp|Q92621|NU205_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=6617	36.187	3	1741.9259	1741.9259	R	V	392	407
PSM	VLLPDLEFYVNLGDWPLEHR	2245	sp|Q7Z4H8-3|PLGT3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=2645	14.321	3	2424.2478	2424.2478	K	K	173	193
PSM	VLVGGGTGFIGTALTQLLNAR	2246	sp|Q9NRG7|D39U1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=3613	19.623	3	2057.1633	2057.1633	R	G	3	24
PSM	VMIPQDEYPEINFVGLLIGPR	2247	sp|Q15637-4|SF01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31	2-UNIMOD:35	ms_run[2]:scan=1584	8.5894	3	2415.2508	2415.2508	K	G	140	161
PSM	VMYMGEEHLFSVEQITAMLLTK	2248	sp|Q92598-2|HS105_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=635	3.4252	3	2569.263	2569.2630	K	L	103	125
PSM	VPLLLEEQGVVDYFLR	2249	sp|P17812-2|PYRG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=616	3.3244	3	1889.0299	1889.0299	R	R	22	38
PSM	VSGDALQLMVELLK	2250	sp|A8MT69|CENPX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=390	2.1474	2	1514.8378	1514.8378	K	V	30	44
PSM	VTDPVGDIVSFMHSFEEK	2251	sp|Q96CS3|FAF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=1279	6.9464	3	2035.9561	2035.9561	R	Y	129	147
PSM	VYISLLPLGDGLTLAFK	2252	sp|Q86VU5|CMTD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=722	3.9052	2	1819.0495	1819.0495	R	I	245	262
PSM	WLQDVFNVPLVIQMTDDEK	2253	sp|P23381-2|SYWC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=1333	7.2335	3	2289.1351	2289.1351	K	Y	141	160
PSM	YDDPPDWQEILTYFR	2254	sp|P61221|ABCE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=1745	9.4896	2	1956.8894	1956.8894	K	G	134	149
PSM	YLPPATQVVLISATLPHEILEMTNK	2255	sp|P38919|IF4A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=2963	16.064	3	2777.5037	2777.5037	R	F	207	232
PSM	YNLEELYQAVENLCSYK	2256	sp|Q13620-3|CUL4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31	14-UNIMOD:4	ms_run[2]:scan=270	1.4825	2	2134.9881	2134.9881	K	I	39	56
PSM	YNLPESAPLIYNSFAQFLVK	2257	sp|Q5TFE4|NT5D1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=2785	15.1	3	2313.2045	2313.2045	R	E	24	44
PSM	YSNVIFLEVDVDDCQDVASECEVK	2258	sp|P10599|THIO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31	14-UNIMOD:4,21-UNIMOD:4	ms_run[2]:scan=7244	39.719	3	2832.247	2832.2470	K	C	49	73
PSM	SDPMVQCIIEESGEHIIAGAGELHLEICLK	2259	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31	7-UNIMOD:4,28-UNIMOD:4	ms_run[1]:scan=1571	8.5151802	3	3347.622776	3347.619985	K	D	530	560
PSM	LCYVALDFEQEMATAASSSSLEK	2260	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31	2-UNIMOD:4	ms_run[1]:scan=63	0.33733885	2	2550.169285	2549.166557	K	S	216	239
PSM	DMAIATGGAVFGEEGLTLNLEDVQPHDLGK	2261	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=2372	12.851382	3	3097.531691	3096.507381	K	V	315	345
PSM	DMAIATGGAVFGEEGLTLNLEDVQPHDLGK	2262	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=9116	49.984444	3	3098.507956	3096.507381	K	V	315	345
PSM	GILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVK	2263	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=5740	31.307025	4	4035.889222	4035.887504	K	L	272	310
PSM	ENFIPTIVNFSAEEISDAIR	2264	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=6009	32.807167	3	2264.135350	2264.132478	R	E	3345	3365
PSM	FGANAILGVSLAVCK	2265	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31	14-UNIMOD:4	ms_run[1]:scan=7273	39.875749	2	1518.826897	1518.822835	K	A	106	121
PSM	FGANAILGVSLAVCK	2266	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31	14-UNIMOD:4	ms_run[1]:scan=7174	39.325485	2	1518.826897	1518.822835	K	A	106	121
PSM	SGETEDTFIADLVVGLCTGQIK	2267	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31	17-UNIMOD:4	ms_run[1]:scan=6570	35.937454	2	2353.152923	2352.151893	R	T	373	395
PSM	LIIVSNPVDILTYVAWK	2268	sp|Q9BYZ2|LDH6B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=5176	28.203286	2	1943.115797	1943.113186	K	L	182	199
PSM	GLYGIKDDVFLSVPCILGQNGISDLVK	2269	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31	15-UNIMOD:4	ms_run[1]:scan=523	2.8158922	3	2920.530832	2919.541582	K	V	279	306
PSM	GFQQILAGEYDHLPEQAFYMVGPIEEAVAK	2270	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=2184	11.830628	3	3349.633691	3349.632916	K	A	490	520
PSM	EGIPVMRPLWVQYPQDVTTFNIDDQYLLGDALLVHPVSDSGAHGVQVYLPGQGEVWYDIQSYQK	2271	sp|Q14697|GANAB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31		ms_run[1]:scan=7501	41.160859	5	7244.5582	7243.5702	R	H	721	785
PSM	FPEELTQTFMSCNLITGMFQR	2272	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31	12-UNIMOD:4	ms_run[1]:scan=1294	7.0304901	2	2549.167985	2549.175288	R	L	328	349
PSM	ILLANFLAQTEALMR	2273	sp|P06744|G6PI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=2690	14.569452	2	1702.945611	1702.944012	K	G	424	439
PSM	LAYVAAGDLAPINAFIGGLAAQEVMK	2274	sp|P22314|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31	25-UNIMOD:35	ms_run[1]:scan=4125	22.416972	3	2620.408124	2618.377811	K	A	386	412
PSM	LQLETEIEALKEELLFMK	2275	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1795	9.7531058	3	2176.172064	2176.170109	R	K	197	215
PSM	LQLETEIEALKEELLFMK	2276	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1699	9.2416744	3	2176.172064	2176.170109	R	K	197	215
PSM	ISLHPIEDNPIEEISVLSPEDLEAIKNPDSITNQIALLEAR	2277	sp|Q9NTJ3|SMC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=974	5.2475184	5	4536.372243	4535.364670	K	C	1042	1083
PSM	VLLVSPELQAAVEEILPSLKK	2278	sp|O14975|S27A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=2227	12.077078	3	2276.347626	2275.340286	K	D	154	175
PSM	LAPPLVTLLSAEPELQYVALR	2279	sp|Q10567|AP1B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=4363	23.743419	3	2293.314654	2292.309320	K	N	284	305
PSM	ASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGK	2280	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31	45-UNIMOD:4,48-UNIMOD:4	ms_run[1]:scan=4755	25.848341	7	5806.8857	5806.8792	R	I	13	68
PSM	QGLNGVPILSEEELSLLDEFYK	2281	sp|Q14444|CAPR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=3174	17.221649	2	2492.268835	2492.268637	K	L	170	192
PSM	ASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGK	2282	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31	36-UNIMOD:35,45-UNIMOD:4,48-UNIMOD:4	ms_run[1]:scan=4752	25.835974	7	5823.9072	5822.8742	R	I	13	68
PSM	QGLNGVPILSEEELSLLDEFYK	2283	sp|Q14444|CAPR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=5452	29.726699	2	2493.252529	2492.268637	K	L	170	192
PSM	QDIVLTTYNILTHDYGTK	2284	sp|Q14527|HLTF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31	1-UNIMOD:28	ms_run[1]:scan=1208	6.5526294	2	2077.0379	2077.0363	K	G	524	542
PSM	EMQEVETNLQEVVFDYLHATAYQNTALGR	2285	sp|O75439|MPPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=3817	20.728113	3	3368.596981	3368.598321	R	T	181	210
PSM	QIPVLQTNNGPSLTGLTTIAAHLVK	2286	sp|O43324|MCA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31	1-UNIMOD:28	ms_run[1]:scan=314	1.7335125	3	2568.4314	2568.4270	R	Q	29	54
PSM	KLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTALPDEDDDL	2287	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31	23-UNIMOD:35	ms_run[1]:scan=6204	33.902693	4	5403.6362	5402.6092	R	-	167	217
PSM	VMIPQDEYPEINFVGLLIGPR	2288	sp|Q15637|SF01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=3464	18.802971	3	2399.269545	2399.255904	K	G	140	161
PSM	ALALAALAAVEPACGSR	2289	sp|Q9BT67|NFIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31	1-UNIMOD:1,14-UNIMOD:4	ms_run[1]:scan=4579	24.902407	2	1681.8842	1681.8816	M	Y	2	19
PSM	VALEMLFTGEPISAQEALLHGLLSK	2290	sp|Q96DC8|ECHD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1100	5.9489853	3	2666.448789	2666.435325	K	V	198	223
PSM	KHPSLIPLFVFIGTGATGATLYLLR	2291	sp|O00483|NDUA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=5684	30.996214	3	2685.546269	2684.541780	K	L	11	36
PSM	TEFLSFMNTELAAFTK	2292	sp|P31949|S10AB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=312	1.7222771	2	1849.901829	1848.896788	K	N	37	53
PSM	QLASGLLLVTGPLVLNR	2293	sp|Q02878|RL6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31	1-UNIMOD:28	ms_run[1]:scan=4930	26.803935	2	1746.0420	1746.0398	K	V	167	184
PSM	DQLSVLENGVDIVVGTPGRLDDLVSTGK	2294	sp|Q92499|DDX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=2204	11.945609	3	2894.519160	2895.518932	R	L	331	359
PSM	LVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLK	2295	sp|P60891|PRPS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=7040	38.578328	4	4635.375234	4636.370958	K	W	111	154
PSM	LSPHFPHTAALDQAVGAAVTSMGPEVVLQAVPLEIDGSEETLDFPR	2296	sp|Q5JTH9|RRP12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1528	8.2740718	4	4810.409165	4811.411637	R	S	521	567
PSM	ADMVIEAVFEDLSLK	2297	sp|P40939|ECHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=2889	15.659	2	1678.8488	1678.8488	K	H	441	456
PSM	ADMVIEAVFEDLSLK	2298	sp|P40939|ECHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=2910	15.769	3	1678.8488	1678.8488	K	H	441	456
PSM	ADMVIEAVFEDLSLK	2299	sp|P40939|ECHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=3007	16.307	3	1678.8488	1678.8488	K	H	441	456
PSM	AFIPLPSAVVQAVFGR	2300	sp|Q9NRG7|D39U1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=3947	21.457	2	1670.9508	1670.9508	R	Q	240	256
PSM	AFLDGFNEVAPLEWLR	2301	sp|O00308-3|WWP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=2073	11.225	2	1875.9519	1875.9519	K	Y	284	300
PSM	AFMTADLPNELIELLEK	2302	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:35	ms_run[2]:scan=2999	16.264	2	1962.002	1962.0020	K	I	994	1011
PSM	AGAAPYVQAFDSLLAGPVAEYLK	2303	sp|Q01518|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=7016	38.451	3	2350.2209	2350.2209	K	I	38	61
PSM	AIDVPGQVQVYELQPSNLEADQPLQAIMEMGAVAADK	2304	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5051	27.496	3	3937.9442	3937.9442	K	G	498	535
PSM	AIVDCIISIIEENSESK	2305	sp|Q9Y678|COPG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30	5-UNIMOD:4	ms_run[2]:scan=6583	36.01	3	1918.9558	1918.9558	R	E	416	433
PSM	ANTNEVLWAVVAAFTK	2306	sp|Q9H4A6|GOLP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=6725	36.785	2	1732.9148	1732.9148	K	-	283	299
PSM	ASPESQEPLIQLVQAFVR	2307	sp|Q5SRE5-2|NU188_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5912	32.287	2	2011.0738	2011.0738	K	H	1617	1635
PSM	CSSAFQNLLPFYSPVVEDFIK	2308	sp|Q96ER3|SAAL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:4	ms_run[2]:scan=5000	27.203	3	2460.2035	2460.2035	K	I	430	451
PSM	DCLTPVMAVNMLTQQEVPVVILAK	2309	sp|Q15031|SYLM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30	2-UNIMOD:4	ms_run[2]:scan=1295	7.0361	3	2668.4002	2668.4002	K	A	340	364
PSM	DFNVGDYIQAVLDR	2310	sp|P06737-2|PYGL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=2841	15.388	2	1623.7893	1623.7893	R	N	223	237
PSM	DFVSEQLTSLLVNGVQLPALGENKK	2311	sp|P54136-2|SYRC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=3062	16.613	3	2698.4541	2698.4541	K	V	97	122
PSM	DFVSEQLTSLLVNGVQLPALGENKK	2312	sp|P54136-2|SYRC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=2997	16.253	4	2698.4541	2698.4541	K	V	97	122
PSM	DGAGFLINLIDSPGHVDFSSEVTAALR	2313	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=8542	46.997	3	2800.4032	2800.4032	K	V	94	121
PSM	DIEEVSQGLLSLLGANR	2314	sp|Q8NBT2-2|SPC24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=6103	33.337	3	1812.9581	1812.9581	R	A	6	23
PSM	DILCGAADEVLAVLK	2315	sp|O75643|U520_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30	4-UNIMOD:4	ms_run[2]:scan=1028	5.5387	2	1585.8385	1585.8385	R	N	130	145
PSM	DIVTESNKFDLVSFIPLLR	2316	sp|Q08AM6|VAC14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=1627	8.8343	3	2205.2045	2205.2045	K	E	163	182
PSM	DNTIEHLLPLFLAQLK	2317	sp|P30153|2AAA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=4821	26.201	3	1864.0458	1864.0458	K	D	359	375
PSM	DNTYLVELSSLLVR	2318	sp|Q96JB5|CK5P3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=489	2.6412	2	1620.8723	1620.8723	K	N	107	121
PSM	EMSCIAEDVIIVTSSLTK	2319	sp|Q9Y678|COPG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30	4-UNIMOD:4	ms_run[2]:scan=4374	23.808	2	1994.9904	1994.9904	K	D	94	112
PSM	ESALFSTELSVLHNFFSPSPK	2320	sp|Q8WX92|NELFB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=1481	8.0186	3	2336.1689	2336.1689	K	T	173	194
PSM	ESEIIDFFLGASLK	2321	sp|P15880|RS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=1213	6.5795	2	1567.8134	1567.8134	K	D	90	104
PSM	ESQPLLGTVIDGMLLLK	2322	sp|P23141|EST1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=3810	20.686	2	1826.0223	1826.0223	R	T	314	331
PSM	ETGQEHELIESMPLLEWFANNYK	2323	sp|P62495-2|ERF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=4794	26.062	3	2777.3007	2777.3007	K	K	328	351
PSM	EVLSFDVTQSPFFPVVLGVR	2324	sp|Q86TG7|PEG10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=2823	15.301	3	2235.194	2235.1940	R	W	428	448
PSM	EYDWLQHLANDGYMLLAGR	2325	sp|Q9NU22|MDN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=4728	25.71	3	2264.0684	2264.0684	K	V	1291	1310
PSM	FFPEDVSEELIQEITQR	2326	sp|P35241-3|RADI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=3731	20.253	3	2079.0161	2079.0161	K	L	52	69
PSM	FFPEDVSEELIQEITQR	2327	sp|P35241-3|RADI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=3465	18.811	2	2079.0161	2079.0161	K	L	52	69
PSM	FPEELTQTFMSCNLITGMFQR	2328	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30	12-UNIMOD:4	ms_run[2]:scan=1182	6.4062	3	2549.1753	2549.1753	R	L	328	349
PSM	FSMVLPEVEAALAEIPGVR	2329	sp|Q96CN7|ISOC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5145	28.031	2	2027.0761	2027.0761	K	S	185	204
PSM	GAFGDMLDTPDPYVELFISTTPDSR	2330	sp|P47712|PA24A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=2075	11.236	2	2743.2687	2743.2687	K	K	33	58
PSM	GASELVAELSTLYQCIR	2331	sp|Q8IXH7-4|NELFD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30	15-UNIMOD:4	ms_run[2]:scan=121	0.65473	3	1908.9615	1908.9615	K	F	394	411
PSM	GELSIIPYEITLLSPCLHMLPHLHFGLK	2332	sp|Q15046|SYK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30	16-UNIMOD:4	ms_run[2]:scan=2252	12.212	4	3227.7239	3227.7239	K	D	194	222
PSM	GEPGAAPLSAPAFSLVFPFLK	2333	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=4813	26.159	2	2115.1405	2115.1405	K	M	966	987
PSM	GFDLASFNPHGISTFIDNDDTVYLFVVNHPEFK	2334	sp|Q15165-1|PON2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=2301	12.475	4	3754.7944	3754.7944	R	N	105	138
PSM	GFVENSYLAGLTPTEFFFHAMGGR	2335	sp|P24928|RPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=1459	7.9052	3	2647.2529	2647.2529	R	E	821	845
PSM	GGGEELAQLAGVPFLGSVPLDPALMR	2336	sp|Q9Y5Y2|NUBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=1648	8.9498	2	2593.3574	2593.3574	R	T	209	235
PSM	GGLTGLTLTSLYALYNNWEHMK	2337	sp|O14925|TIM23_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=4117	22.37	3	2481.2362	2481.2362	R	G	180	202
PSM	GHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYK	2338	sp|P04179-4|SODM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30	8-UNIMOD:4	ms_run[2]:scan=5453	29.732	4	4292.1728	4292.1728	R	N	111	149
PSM	GIGTVTFEQSIEAVQAISMFNGQLLFDRPMHVK	2339	sp|P52272|HNRPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30	30-UNIMOD:35	ms_run[2]:scan=4270	23.22	4	3678.8538	3678.8538	R	M	245	278
PSM	GILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVK	2340	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=4409	24	4	4035.8875	4035.8875	K	L	272	310
PSM	GLPFQANAQDIINFFAPLKPVR	2341	sp|Q12849|GRSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=3011	16.329	2	2455.3376	2455.3376	R	I	407	429
PSM	GLPFQANAQDIINFFAPLKPVR	2342	sp|Q12849|GRSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=3105	16.853	2	2455.3376	2455.3376	R	I	407	429
PSM	GSDWLGDQDAIHYMTEQAPAAVVELENYGMPFSR	2343	sp|P31040|SDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=3850	20.915	3	3796.7138	3796.7138	K	T	129	163
PSM	GSDWLGDQDAIHYMTEQAPAAVVELENYGMPFSR	2344	sp|P31040|SDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=4025	21.886	4	3796.7138	3796.7138	K	T	129	163
PSM	GSGTQLFDHIAECLANFMDK	2345	sp|P52789|HXK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30	13-UNIMOD:4	ms_run[2]:scan=6275	34.284	3	2253.0194	2253.0194	R	L	121	141
PSM	GYTLLSEGIDEMVGIIYKPK	2346	sp|O75643|U520_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=1346	7.3065	3	2225.1654	2225.1654	K	T	86	106
PSM	HFYWYLTNEGIQYLRDYLHLPPEIVPATLR	2347	sp|P46783|RS10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5510	30.045	4	3716.9144	3716.9144	R	R	66	96
PSM	IATLDMSSDQIAANLQAVINEVCR	2348	sp|Q9BYD6|RM01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30	23-UNIMOD:4	ms_run[2]:scan=5090	27.718	2	2631.2996	2631.2996	K	H	257	281
PSM	ICPVETLVEEAIQCAEK	2349	sp|P30084|ECHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30	2-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=653	3.5267	3	1987.9595	1987.9595	K	I	212	229
PSM	IDLRPVLGEGVPILASFLR	2350	sp|Q86VP6-2|CAND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5568	30.37	3	2064.2095	2064.2095	K	K	474	493
PSM	IDLRPVLGEGVPILASFLR	2351	sp|Q86VP6-2|CAND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5667	30.903	3	2064.2095	2064.2095	K	K	474	493
PSM	IDMESLLMCTVDDLK	2352	sp|Q9Y6Y8-2|S23IP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30	9-UNIMOD:4	ms_run[2]:scan=4255	23.135	2	1781.8249	1781.8249	K	E	670	685
PSM	ILLANFLAQTEALMR	2353	sp|P06744|G6PI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=2587	14.004	3	1702.944	1702.9440	K	G	424	439
PSM	ILSISADIETIGEILK	2354	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=2426	13.126	2	1713.9764	1713.9764	R	K	87	103
PSM	INALTAASEAACLIVSVDETIKNPR	2355	sp|Q99832-2|TCPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30	12-UNIMOD:4	ms_run[2]:scan=4333	23.575	3	2655.3902	2655.3902	R	S	296	321
PSM	IPCVDAGLISPLVQLLNSK	2356	sp|P52306-6|GDS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:4	ms_run[2]:scan=1844	10.001	3	2036.134	2036.1340	R	D	84	103
PSM	IQDLPPVDLSLVNKDENAIYFLGNSLGLQPK	2357	sp|Q16719-2|KYNU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=734	3.9753	3	3409.8133	3409.8133	K	M	51	82
PSM	IQVIDISMILAEAIR	2358	sp|P60891-2|PRPS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=6811	37.279	3	1683.9593	1683.9593	K	R	220	235
PSM	IVAFADAAVEPIDFPIAPVYAASMVLK	2359	sp|P24752|THIL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=6389	34.909	2	2817.5027	2817.5027	R	D	312	339
PSM	LCYVALDFEQEMATAASSSSLEK	2360	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30	2-UNIMOD:4	ms_run[2]:scan=1405	7.6199	2	2549.1666	2549.1666	K	S	216	239
PSM	LCYVALDFEQEMATAASSSSLEK	2361	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30	2-UNIMOD:4	ms_run[2]:scan=1489	8.0611	3	2549.1666	2549.1666	K	S	216	239
PSM	LCYVALDFEQEMATAASSSSLEK	2362	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30	2-UNIMOD:4	ms_run[2]:scan=2173	11.769	2	2549.1666	2549.1666	K	S	216	239
PSM	LCYVALDFEQEMATAASSSSLEK	2363	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30	2-UNIMOD:4	ms_run[2]:scan=2988	16.205	2	2549.1666	2549.1666	K	S	216	239
PSM	LCYVALDFEQEMATAASSSSLEK	2364	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30	2-UNIMOD:4	ms_run[2]:scan=4285	23.307	2	2549.1666	2549.1666	K	S	216	239
PSM	LEQFVSILMASIPLPDKAS	2365	sp|P00491|PNPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5619	30.645	2	2058.1071	2058.1071	K	-	271	290
PSM	LFIGGLSFETTEESLR	2366	sp|P22626-2|ROA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=7302	40.041	2	1797.9149	1797.9149	K	N	11	27
PSM	LIHEQDLEWLQQADVVVAEVTQPSLGVGYELGR	2367	sp|O43598-2|DNPH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5772	31.49	4	3690.8893	3690.8893	R	A	75	108
PSM	LIPEMDQIFTEVEMTTLEK	2368	sp|Q9Y4L1|HYOU1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=3726	20.225	2	2266.1113	2266.1113	R	V	841	860
PSM	LLFEYLTLFGIDDK	2369	sp|P12081-3|HARS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5520	30.102	2	1685.8916	1685.8916	K	I	244	258
PSM	LLSLLPEYVVPYTIHLLAHDPDYVK	2370	sp|Q9NTI5-2|PDS5B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=3096	16.8	4	2907.5786	2907.5786	K	V	983	1008
PSM	LQNIFLGLVNIIEEK	2371	sp|O15042-2|SR140_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=6804	37.237	2	1741.9978	1741.9978	K	E	670	685
PSM	LYNNITFEELGALLEIPAAK	2372	sp|Q9BT78-2|CSN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=3417	18.536	3	2218.1885	2218.1885	K	H	315	335
PSM	MVYSTCSLNPIEDEAVIASLLEK	2373	sp|Q08J23-3|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30	6-UNIMOD:4	ms_run[2]:scan=885	4.7935	3	2581.2655	2581.2655	R	S	80	103
PSM	NEILTAILASLTAR	2374	sp|Q9C0B1|FTO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=4158	22.598	2	1484.8562	1484.8562	R	Q	432	446
PSM	NPEILAIAPVLLDALTDPSRK	2375	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=3680	19.964	3	2245.2682	2245.2682	R	T	1571	1592
PSM	NPPEQLPIVLQVLLSQVHR	2376	sp|Q8N122-3|RPTOR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=2521	13.648	3	2179.2477	2179.2477	R	L	428	447
PSM	NSEVYQEVQAMFDTLGIPK	2377	sp|Q52LJ0-1|FA98B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=3672	19.928	2	2168.046	2168.0460	K	S	143	162
PSM	NVITEPIYPEVVHMFAVNMFR	2378	sp|Q13362-2|2A5G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=1092	5.9017	3	2505.2549	2505.2549	R	T	85	106
PSM	NYQFDFLRPQHSLFNYFTKLVEQYTK	2379	sp|Q15459-2|SF3A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5471	29.835	4	3325.656	3325.6560	R	I	127	153
PSM	QADCHINNLYNTVFWALIQQSGLTPVQAQGR	2380	sp|Q9NWX6|THG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30	4-UNIMOD:4	ms_run[2]:scan=3063	16.618	3	3541.7525	3541.7525	R	L	177	208
PSM	QAPGQTQGGQPWTYHLVQFADLLLNHSHNVTTVTPFTAQQR	2381	sp|Q9BQG0|MBB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=256	1.4062	5	4586.2843	4586.2843	K	Q	530	571
PSM	QCNEVEPGYYFATLDHYLYEAEEANLGPGVSIVER	2382	sp|P07942|LAMB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30	2-UNIMOD:4	ms_run[2]:scan=4475	24.35	3	4031.8524	4031.8524	R	Q	539	574
PSM	QEIIEQLLSNIFHK	2383	sp|Q5H9R7-3|PP6R3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=2446	13.24	2	1710.9305	1710.9305	K	E	245	259
PSM	QIKPYTLMSMVANLLYEK	2384	sp|P49720|PSB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=3097	16.806	3	2141.1265	2141.1265	R	R	81	99
PSM	QSILDMTAVLLACGINPEK	2385	sp|Q9UGM6-2|SYWM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30	13-UNIMOD:4	ms_run[2]:scan=2778	15.058	2	2072.0646	2072.0646	R	S	90	109
PSM	RLEAGYQIAVETEQIGQEMLENLSHDR	2386	sp|Q96AJ9-1|VTI1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=3429	18.604	4	3128.5197	3128.5197	R	E	131	158
PSM	SCQTALVEILDVIVR	2387	sp|Q9NSE4|SYIM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30	2-UNIMOD:4	ms_run[2]:scan=4517	24.571	3	1714.9288	1714.9288	R	S	818	833
PSM	SEPALAPADFVAPLAPLPIPSNLFVPTPDAEEPQLPDGTGR	2388	sp|O15027-2|SC16A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=6155	33.63	3	4206.1525	4206.1525	R	E	2205	2246
PSM	SFFSEIISSISDVK	2389	sp|Q00005-6|2ABB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5361	29.216	2	1557.7926	1557.7926	R	F	264	278
PSM	SGETEDTFIADLVVGLCTGQIK	2390	sp|P06733-2|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30	17-UNIMOD:4	ms_run[2]:scan=5970	32.592	3	2352.1519	2352.1519	R	T	280	302
PSM	SSQLLWEALESLVNR	2391	sp|Q27J81-2|INF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=3690	20.02	2	1743.9155	1743.9155	R	A	307	322
PSM	TDVNKIEEFLEEVLCPPK	2392	sp|Q9Y696|CLIC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30	15-UNIMOD:4	ms_run[2]:scan=5849	31.928	2	2159.082	2159.0820	K	Y	86	104
PSM	TDVNKIEEFLEEVLCPPK	2393	sp|Q9Y696|CLIC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30	15-UNIMOD:4	ms_run[2]:scan=5947	32.475	2	2159.082	2159.0820	K	Y	86	104
PSM	TIVAINKDPEAPIFQVADYGIVADLFK	2394	sp|P13804-2|ETFA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=1679	9.1266	2	2946.5743	2946.5743	K	V	246	273
PSM	TLDLIDEAYGLDFYILK	2395	sp|Q13084|RM28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=4405	23.978	2	2001.0347	2001.0347	R	T	131	148
PSM	TLSSSTQASIEIDSLYEGIDFYTSITR	2396	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5293	28.835	3	2996.4502	2996.4502	R	A	273	300
PSM	TMETLHLEYFEEAMNYLLSHPEVK	2397	sp|P49753|ACOT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=1516	8.2068	4	2923.3772	2923.3772	K	G	261	285
PSM	TQTSDPAMLPTMIGLLAEAGVR	2398	sp|O43175|SERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=2899	15.709	2	2271.1603	2271.1603	R	L	470	492
PSM	TVDLQDAEEAVELVQYAYFK	2399	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=4873	26.486	2	2330.1318	2330.1318	K	K	636	656
PSM	TVTVWELISSEYFTAEQR	2400	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=835	4.5379	2	2158.0582	2158.0582	R	Q	3218	3236
PSM	VFPDKEVMLDAALALAAEISSK	2401	sp|Q13011|ECH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=6593	36.067	3	2317.2239	2317.2239	R	S	246	268
PSM	VGNIIDTMITDAFLK	2402	sp|Q9Y3Z3-3|SAMH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=1944	10.51	2	1649.8698	1649.8698	K	A	308	323
PSM	VLTDSGSLDSTIPGIENTITVTTEQLTTASFPVGSK	2403	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=6336	34.622	3	3678.8727	3678.8727	K	K	210	246
PSM	VPTTGIIEYPFDLENIIFR	2404	sp|O95837|GNA14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5088	27.706	2	2236.178	2236.1780	R	M	180	199
PSM	VPTTGIIEYPFDLENIIFR	2405	sp|O95837|GNA14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5137	27.986	3	2236.178	2236.1780	R	M	180	199
PSM	YAELLAIIEELGK	2406	sp|O14519-2|CDKA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=3385	18.359	2	1460.8126	1460.8126	K	E	35	48
PSM	YAQDEHLITFFVPVFEPLPPQYFIR	2407	sp|O75643|U520_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=4964	27	3	3065.5691	3065.5691	K	V	1245	1270
PSM	YAVDDVPFSIPAASEIADLSNIINK	2408	sp|Q9GZL7|WDR12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=3970	21.589	2	2661.3538	2661.3538	K	L	15	40
PSM	YCIGLNETQLGIIAPFWLK	2409	sp|P42126|ECI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30	2-UNIMOD:4	ms_run[2]:scan=140	0.7617	3	2235.1762	2235.1762	R	D	172	191
PSM	YQDQLEAEIEETYANFIK	2410	sp|Q8NHH9-3|ATLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=340	1.875	3	2203.0321	2203.0321	R	H	273	291
PSM	YSLQYYMGLAEELVR	2411	sp|P11498|PYC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=2428	13.138	2	1833.8971	1833.8971	K	A	718	733
PSM	DGAGFLINLIDSPGHVDFSSEVTAALR	2412	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=9140	50.102094	3	2802.410300	2800.403174	K	V	94	121
PSM	WLPAGDALLQMITIHLPSPVTAQK	2413	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30	11-UNIMOD:35	ms_run[1]:scan=5448	29.704186	3	2616.441973	2615.414531	R	Y	343	367
PSM	LCYVALDFEQEMATAASSSSLEK	2414	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30	2-UNIMOD:4	ms_run[1]:scan=6893	37.746674	2	2549.163358	2549.166557	K	S	216	239
PSM	LCYVALDFEQEMATAASSSSLEK	2415	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30	2-UNIMOD:4	ms_run[1]:scan=1645	8.9328763	3	2551.174855	2549.166557	K	S	216	239
PSM	DLVVLLFETALLSSGFSLEDPQTHSNR	2416	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=9064	49.726325	3	2988.520529	2987.524017	K	I	653	680
PSM	FGANAILGVSLAVCK	2417	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30	14-UNIMOD:4	ms_run[1]:scan=7078	38.793426	2	1518.826897	1518.822835	K	A	106	121
PSM	FGANAILGVSLAVCK	2418	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30	14-UNIMOD:4	ms_run[1]:scan=7373	40.437125	2	1518.826897	1518.822835	K	A	106	121
PSM	SGETEDTFIADLVVGLCTGQIK	2419	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30	17-UNIMOD:4	ms_run[1]:scan=6474	35.389433	2	2353.152923	2352.151893	R	T	373	395
PSM	SGETEDTFIADLVVGLCTGQIK	2420	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30	17-UNIMOD:4	ms_run[1]:scan=5153	28.076144	3	2353.154924	2352.151893	R	T	373	395
PSM	GVPQIEVTFDIDANGILNVSAVDK	2421	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=7268	39.850073	3	2513.297096	2513.301334	R	S	470	494
PSM	SLPLCLQLYAPGLSPDTIMECAMGDR	2422	sp|P13284|GILT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30	5-UNIMOD:4,19-UNIMOD:35,21-UNIMOD:4	ms_run[1]:scan=676	3.6529301	3	2924.3912	2923.3582	R	G	158	184
PSM	TDALQPPHEYVPWVTVNGKPLEDQTQLLTLVCQLYQGK	2423	sp|P13284|GILT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30	32-UNIMOD:4	ms_run[1]:scan=1958	10.587338	4	4379.216232	4378.230760	R	K	195	233
PSM	HLVFPLLEFLSVK	2424	sp|P60228|EIF3E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=696	3.761855	2	1540.902487	1540.901737	R	E	17	30
PSM	HLVFPLLEFLSVK	2425	sp|P60228|EIF3E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=490	2.6468462	2	1540.902487	1540.901737	R	E	17	30
PSM	VTGEADVEFATHEDAVAAMSK	2426	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=7280	39.914945	3	2177.003986	2176.994664	R	D	327	348
PSM	QMEQISQFLQAAER	2427	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30	1-UNIMOD:28	ms_run[1]:scan=719	3.8883239	2	1660.7882	1660.7874	K	Y	89	103
PSM	NAVTQFVSSMSASADVLALAK	2428	sp|P0C7P4|UCRIL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=753	4.077199	3	2109.081324	2109.077606	K	I	140	161
PSM	ASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGK	2429	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30	36-UNIMOD:35,45-UNIMOD:4,48-UNIMOD:4	ms_run[1]:scan=1819	9.8732662	4	5822.8665	5822.8741	R	I	13	68
PSM	SVENLATATTTLTSLAQLLGK	2430	sp|Q96S52|PIGS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1418	7.6890445	3	2131.175351	2131.173614	R	I	431	452
PSM	IVAFADAAVEPIDFPIAPVYAASMVLK	2431	sp|P24752|THIL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30	24-UNIMOD:35	ms_run[1]:scan=6471	35.372533	3	2834.5322	2833.4972	R	D	312	339
PSM	GGFNKPGGPMDEGPDLDLGPPVDPDEDSDNSAIYVQGLNDSVTLDDLADFFK	2432	sp|Q01844|EWS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30	10-UNIMOD:35	ms_run[1]:scan=7160	39.248791	4	5480.4736	5480.4673	R	Q	331	383
PSM	IATLDMSSDQIAANLQAVINEVCR	2433	sp|Q9BYD6|RM01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30	6-UNIMOD:35,23-UNIMOD:4	ms_run[1]:scan=5114	27.854567	3	2648.3272	2647.2942	K	H	257	281
PSM	ERPPNPIEFLASYLLK	2434	sp|Q9C005|DPY30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=5986	32.677892	3	1886.033320	1886.030185	K	N	75	91
PSM	ERPPNPIEFLASYLLK	2435	sp|Q9C005|DPY30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=5883	32.119554	3	1886.033320	1886.030185	K	N	75	91
PSM	ERPPNPIEFLASYLLK	2436	sp|Q9C005|DPY30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=6086	33.243592	3	1886.033320	1886.030185	K	N	75	91
PSM	GLGGILLEDIEEALPNSQK	2437	sp|P29084|T2EB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=165	0.90628917	2	1996.059648	1995.052437	R	A	162	181
PSM	LKPTDVGLLAVIANNIITINK	2438	sp|O76094|SRP72_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=3249	17.614862	3	2220.330913	2219.325304	K	D	255	276
PSM	DGLLCGETGGGGGSALGPGGGGGGGGGGGGGGPGHEQEEDYRYEVLTAEQILQHMVECIR	2439	sp|Q9Y4X5|ARI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30	5-UNIMOD:4,58-UNIMOD:4	ms_run[1]:scan=6709	36.697746	5	5825.6048	5825.6124	R	E	59	119
PSM	TLSAISSSTDPTSYDGFGPFMPGFDIIPYNDLPALER	2440	sp|P04181|OAT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30	21-UNIMOD:35	ms_run[1]:scan=7216	39.568933	3	4008.905026	4006.882267	R	A	181	218
PSM	TMNLNPMILTNILSSPYFK	2441	sp|Q5VTL8|PR38B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=3718	20.179484	2	2197.120557	2196.132284	K	V	55	74
PSM	VDNMIIQSISLLDQLDK	2442	sp|O00567|NOP56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=4887	26.564639	3	1944.026603	1944.023779	R	D	164	181
PSM	AAPPPAAPPASAGAGNLLVDVFDGPAAQPSLGPTPEEAFLSPGPEDIGPPIPEADELLNK	2443	sp|O95782-2|AP2A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30		ms_run[1]:scan=6313	34.495449	4	5848.9329	5848.9358	R	F	665	725
PSM	AGIPTSSVFALHFTEPPISAQLLAFLR	2444	sp|Q86TU7|SETD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=5042	27.442462	3	2884.592537	2882.569451	R	V	360	387
PSM	ILSISADIETIGEILK	2445	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=3185	17.285351	2	1712.973636	1713.976418	R	K	87	103
PSM	FGLALAVAGGVVNSALYNVDAGHR	2446	sp|P35232|PHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=7210	39.53291	3	2369.249900	2370.244428	K	A	12	36
PSM	YWGTPIPIVHCPVCGPTPVPLEDLPVTLPNIASFTGK	2447	sp|Q15031|SYLM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30	11-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=135	0.73358268	3	4045.081930	4042.073654	R	G	454	491
PSM	DLVVLLFETALLSSGFSLEDPQTHSNR	2448	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=8523	46.88753	3	2986.524293	2987.524017	K	I	653	680
PSM	AAPEINNLIEEATEFIK	2449	sp|Q8IVP5|FUND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=3248	17.609	2	1900.9782	1900.9782	K	Q	120	137
PSM	AASQSTQVPTITEGVAAALLLLK	2450	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=5299	28.869	3	2281.2893	2281.2893	K	L	476	499
PSM	AAYLLGCSLEELSSAIFK	2451	sp|Q92614-5|MY18A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29	7-UNIMOD:4	ms_run[2]:scan=5497	29.972	2	1971.0023	1971.0023	K	H	240	258
PSM	ACDTLLMCIVTVMNHGLR	2452	sp|Q14573|ITPR3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29	2-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=1139	6.1621	3	2103.0097	2103.0097	R	N	2454	2472
PSM	AGGPNLDMGYWESLLQQLR	2453	sp|Q8WUQ7|CATIN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=3783	20.533	2	2147.047	2147.0470	R	A	427	446
PSM	AQLGVQAFADALLIIPK	2454	sp|P40227-2|TCPZ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=382	2.1034	2	1767.0295	1767.0295	R	V	388	405
PSM	ATEPQMVLFNLYDDWLK	2455	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=5439	29.654	2	2082.0132	2082.0132	K	T	1909	1926
PSM	AVGNIVTGDDIQTQVILNCSALPCLLHLLSSPK	2456	sp|O60684|IMA7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29	19-UNIMOD:4,24-UNIMOD:4	ms_run[2]:scan=5188	28.268	3	3545.8586	3545.8586	R	E	317	350
PSM	CILVITWIQHLIPK	2457	sp|Q9UL46|PSME2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:4	ms_run[2]:scan=4186	22.755	3	1733.0062	1733.0062	K	I	118	132
PSM	DANDVPIQCEISPLISYAGEGLESYVADK	2458	sp|Q16222-2|UAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29	9-UNIMOD:4	ms_run[2]:scan=3889	21.131	3	3152.486	3152.4860	K	E	456	485
PSM	DGALHMIGSLAEILLK	2459	sp|O95373|IPO7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=4209	22.877	3	1679.928	1679.9280	K	K	430	446
PSM	DKELTGALIASLINCYIR	2460	sp|O75694-2|NU155_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29	15-UNIMOD:4	ms_run[2]:scan=1483	8.0298	2	2049.0929	2049.0929	R	D	771	789
PSM	DLSILSYLSQLQPPMPK	2461	sp|Q5SY16|NOL9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=4367	23.768	2	1929.0281	1929.0281	R	P	521	538
PSM	DMAIATGGAVFGEEGLTLNLEDVQPHDLGK	2462	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=536	2.8865	3	3096.5074	3096.5074	K	V	315	345
PSM	DMAIATGGAVFGEEGLTLNLEDVQPHDLGK	2463	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=5837	31.861	3	3096.5074	3096.5074	K	V	315	345
PSM	DMAIATGGAVFGEEGLTLNLEDVQPHDLGK	2464	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6988	38.292	3	3096.5074	3096.5074	K	V	315	345
PSM	DNTIEHLLPLFLAQLK	2465	sp|P30153|2AAA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=4718	25.657	3	1864.0458	1864.0458	K	D	359	375
PSM	DQFPEVYVPTVFENYVADIEVDGK	2466	sp|P61586|RHOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6308	34.467	2	2772.317	2772.3170	K	Q	28	52
PSM	DTLAAISEVLYVDLLEGDTECHAR	2467	sp|Q4G0J3-2|LARP7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29	21-UNIMOD:4	ms_run[2]:scan=4860	26.409	3	2689.2905	2689.2905	R	F	105	129
PSM	DVLGMAQDEMAQAFEDWNK	2468	sp|P52209-2|6PGD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6779	37.097	2	2196.9456	2196.9456	K	T	194	213
PSM	EFGDSLSLEILQIIK	2469	sp|Q9UHB9-4|SRP68_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=3700	20.076	2	1703.9346	1703.9346	K	E	53	68
PSM	EQPLDEELKDAFQNAYLELGGLGER	2470	sp|P05023-3|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=5467	29.813	2	2833.377	2833.3770	K	V	496	521
PSM	ESTITLQQAEYEFLSFVR	2471	sp|Q9Y3B8-2|ORN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=5154	28.082	3	2160.0739	2160.0739	K	Q	74	92
PSM	ETDMLNYLIECFDR	2472	sp|O95155-3|UBE4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29	11-UNIMOD:4	ms_run[2]:scan=6671	36.48	2	1817.7964	1817.7964	K	V	178	192
PSM	FDLLFIMLDQMDPEQDREISDHVLR	2473	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=3076	16.691	4	3074.4841	3074.4841	R	M	479	504
PSM	FIEAEQVPELEAVLHLVIASSDTR	2474	sp|Q5VYK3|ECM29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6957	38.115	3	2665.3963	2665.3963	K	H	250	274
PSM	FTASAGIQVVGDDLTVTNPK	2475	sp|P06733-2|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6999	38.353	2	2032.0477	2032.0477	K	R	214	234
PSM	GDVTLTFLPLSFWGK	2476	sp|Q6YHK3-2|CD109_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=681	3.681	2	1679.8923	1679.8923	K	K	185	200
PSM	GFVENSYLAGLTPTEFFFHAMGGR	2477	sp|P24928|RPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=1352	7.3402	3	2647.2529	2647.2529	R	E	821	845
PSM	GIGTVTFEQSIEAVQAISMFNGQLLFDRPMHVK	2478	sp|P52272|HNRPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6186	33.805	3	3662.8589	3662.8589	R	M	245	278
PSM	IITIPPFLAYGEDGDGKDIPGQASLVFDVALLDLHNPK	2479	sp|O95302|FKBP9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=5639	30.748	4	4048.1197	4048.1197	R	D	220	258
PSM	IITIPPFLAYGEDGDGKDIPGQASLVFDVALLDLHNPK	2480	sp|O95302|FKBP9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=5834	31.844	4	4048.1197	4048.1197	R	D	220	258
PSM	ILSISADIETIGEILK	2481	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=3064	16.624	2	1713.9764	1713.9764	R	K	87	103
PSM	IQFGTLSDFFDALDK	2482	sp|Q16706|MA2A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=1522	8.2404	2	1715.8407	1715.8407	K	A	459	474
PSM	IQHPSNVLHFFNAPLEVTEENFFEICDELGVK	2483	sp|P14866-2|HNRPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29	26-UNIMOD:4	ms_run[2]:scan=3608	19.595	4	3771.8243	3771.8243	R	R	363	395
PSM	IQVTPPGFQLVFLPFADDK	2484	sp|P12956-2|XRCC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=784	4.2499	2	2131.1354	2131.1354	K	R	384	403
PSM	ISSINSISALCEATGADVEEVATAIGMDQR	2485	sp|O60701-3|UGDH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29	11-UNIMOD:4	ms_run[2]:scan=4773	25.948	3	3107.4751	3107.4751	R	I	134	164
PSM	IVLFDTLLEEYSVLNK	2486	sp|O75844|FACE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=3184	17.28	3	1895.0292	1895.0292	R	D	277	293
PSM	KTYIGEIFTQILVLPYVGK	2487	sp|P35237|SPB6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=1029	5.5444	3	2181.2449	2181.2449	K	E	208	227
PSM	LCYVALDFEQEMATAASSSSLEK	2488	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29	2-UNIMOD:4	ms_run[2]:scan=4179	22.716	2	2549.1666	2549.1666	K	S	216	239
PSM	LDALTELLSTALGPR	2489	sp|O15554|KCNN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=3318	17.99	2	1568.8774	1568.8774	K	Q	403	418
PSM	LDALTELLSTALGPR	2490	sp|O15554|KCNN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=3320	18.002	3	1568.8774	1568.8774	K	Q	403	418
PSM	LGFSEVELVQMVVDGVK	2491	sp|P12277|KCRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=612	3.2996	3	1847.9703	1847.9703	R	L	342	359
PSM	LLQDSVDFSLADAINTEFK	2492	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=2551	13.822	2	2125.0579	2125.0579	R	N	79	98
PSM	LPPLPLTLALGAFLNHR	2493	sp|O96008|TOM40_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=4345	23.645	3	1842.088	1842.0880	K	K	332	349
PSM	LTEVKDELEPLLELVEQGIIPPGK	2494	sp|Q9NQZ2|SAS10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=4573	24.871	3	2658.4731	2658.4731	K	G	237	261
PSM	LTIIGEEDLPSEEVDQELIEDSQWEEILK	2495	sp|O95861-3|BPNT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=1216	6.5963	3	3398.6505	3398.6505	K	Q	14	43
PSM	LYSEEQPQEAVPHLEAALQEYFVAYEECR	2496	sp|Q32P28-2|P3H1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29	28-UNIMOD:4	ms_run[2]:scan=241	1.3252	3	3497.6086	3497.6086	R	A	215	244
PSM	NAFGLHLIDFMSEILK	2497	sp|Q15003|CND2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6890	37.73	3	1846.9651	1846.9651	K	Q	127	143
PSM	NEFIGLQLLDVLAR	2498	sp|Q27J81-2|INF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=4156	22.585	2	1599.8984	1599.8984	R	L	219	233
PSM	NFFEPTLLCNVTQDMLCTHEETFGPLAPVIK	2499	sp|P51649|SSDH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29	9-UNIMOD:4,17-UNIMOD:4	ms_run[2]:scan=2991	16.222	3	3620.7353	3620.7353	K	F	418	449
PSM	NPPEQLPIVLQVLLSQVHR	2500	sp|Q8N122-3|RPTOR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=2625	14.206	3	2179.2477	2179.2477	R	L	428	447
PSM	NTVLCNVVEQFLQADLAR	2501	sp|Q14258|TRI25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29	5-UNIMOD:4	ms_run[2]:scan=6390	34.914	3	2089.0626	2089.0626	K	E	66	84
PSM	NWLLFACHATNEVAQLIQGGR	2502	sp|Q9Y5U8|MPC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29	7-UNIMOD:4	ms_run[2]:scan=2023	10.943	3	2397.2012	2397.2012	R	L	77	98
PSM	QAPGQTQGGQPWTYHLVQFADLLLNHSHNVTTVTPFTAQQR	2503	sp|Q9BQG0|MBB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=158	0.86459	5	4586.2843	4586.2843	K	Q	530	571
PSM	QCVLSTLAQLLLDK	2504	sp|Q9NU22|MDN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29	2-UNIMOD:4	ms_run[2]:scan=2219	12.03	2	1600.8858	1600.8858	R	D	42	56
PSM	QEFGWLIPMQLMSYPLSEGQLDQK	2505	sp|P23141|EST1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6653	36.383	3	2837.3768	2837.3768	K	T	353	377
PSM	QEGCQDIATQLISNMDIDVILGGGR	2506	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29	4-UNIMOD:4	ms_run[2]:scan=4232	23.006	2	2702.3004	2702.3004	R	K	199	224
PSM	QGGVHELSAFEQLVVELVR	2507	sp|Q9NRL2-2|BAZ1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=2386	12.93	3	2109.1219	2109.1219	R	H	1397	1416
PSM	QNLSQVPEADSVSFLQELLALR	2508	sp|Q96LD4-2|TRI47_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=5717	31.175	3	2456.2911	2456.2911	R	L	81	103
PSM	SFFSEIISSISDVK	2509	sp|Q00005-6|2ABB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=5458	29.76	2	1557.7926	1557.7926	R	F	264	278
PSM	SIFGDALLIEPLDKYPLAPGVPLPSPQDLMGR	2510	sp|Q01970-2|PLCB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=3348	18.159	3	3418.821	3418.8211	R	I	364	396
PSM	SISPFPELEQFLQDTIK	2511	sp|Q8NFF5-3|FAD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=7324	40.168	2	1991.0252	1991.0252	R	R	341	358
PSM	SLFTEDTFFLELIQR	2512	sp|Q96IR7|HPDL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=3669	19.911	2	1857.9513	1857.9513	K	Q	329	344
PSM	SLSGLLPAQTSLEYALLDAVTQQEK	2513	sp|Q8NBF2|NHLC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=2679	14.508	3	2674.4065	2674.4065	R	D	10	35
PSM	SSLIQDWETSGLVYLDYIR	2514	sp|P52948-6|NUP98_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6851	37.505	2	2257.1267	2257.1267	R	V	1577	1596
PSM	SYLALATETVDMFHILTK	2515	sp|O95155-3|UBE4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=1681	9.1378	3	2052.0602	2052.0602	R	Q	840	858
PSM	TLAFLIPAVELIVK	2516	sp|Q9NVP1|DDX18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=3272	17.736	2	1525.9484	1525.9484	K	L	230	244
PSM	TLQAAAFLDFLWHNMK	2517	sp|Q12788|TBL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=2066	11.186	2	1904.9607	1904.9607	R	L	774	790
PSM	TVDWALAEYMAFGSLLK	2518	sp|Q02218-2|ODO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6003	32.771	2	1913.9597	1913.9597	R	E	646	663
PSM	TWITNSPMADLFVVWAR	2519	sp|Q92947-2|GCDH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6886	37.707	2	2006.0084	2006.0084	K	C	211	228
PSM	VETGVLKPGMVVTFAPVNVTTEVK	2520	sp|P68104-2|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6892	37.741	3	2514.3767	2514.3767	R	S	246	270
PSM	VLVDMDGVLADFEAGLLR	2521	sp|Q8TCD5-2|NT5C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=7388	40.524	2	1932.0026	1932.0026	R	G	7	25
PSM	VQITAIGDVLGPSINGLASLIR	2522	sp|Q6YHK3-2|CD109_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=5002	27.214	2	2206.2685	2206.2685	R	M	818	840
PSM	VTPQSLFILFGVYGDVQR	2523	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=1039	5.6032	3	2038.0888	2038.0888	R	V	349	367
PSM	VVPSDLYPLVLGFLR	2524	sp|Q14978-3|NOLC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6342	34.648	2	1686.9709	1686.9709	R	D	9	24
PSM	VVPSDLYPLVLGFLR	2525	sp|Q14978-3|NOLC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6439	35.19	2	1686.9709	1686.9709	R	D	9	24
PSM	VVPSDLYPLVLGFLR	2526	sp|Q14978-3|NOLC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6537	35.748	2	1686.9709	1686.9709	R	D	9	24
PSM	WGFIPLVIYLGFKR	2527	sp|Q9P0U1|TOM7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=2926	15.863	3	1707.9865	1707.9865	R	G	25	39
PSM	YKEFAIPEEEAEWVGLTLEEAIEK	2528	sp|Q13084|RM28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=5683	30.991	3	2822.3902	2822.3902	K	Q	191	215
PSM	YLEMLLEYLQDYTDR	2529	sp|Q12874|SF3A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6564	35.901	2	1963.9237	1963.9237	R	V	185	200
PSM	YNLPESAPLIYNSFAQFLVK	2530	sp|Q5TFE4|NT5D1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=2693	14.586	3	2313.2045	2313.2045	R	E	24	44
PSM	YSLLPFWYTLLYQAHR	2531	sp|Q14697|GANAB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=376	2.0716	3	2070.0727	2070.0727	R	E	705	721
PSM	YSLLPFWYTLLYQAHR	2532	sp|Q14697|GANAB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=501	2.701	2	2070.0727	2070.0727	R	E	705	721
PSM	LCYVALDFEQEMATAASSSSLEK	2533	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29	2-UNIMOD:4	ms_run[1]:scan=814	4.4208283	2	2548.160220	2549.166557	K	S	216	239
PSM	LCYVALDFEQEMATAASSSSLEK	2534	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29	2-UNIMOD:4	ms_run[1]:scan=8568	47.144805	2	2549.164934	2549.166557	K	S	216	239
PSM	LQAVMCIISTIMESCPSTSSFYSSATAK	2535	sp|Q7Z6Z7|HUWE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29	6-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=7015	38.445055	3	3070.418480	3069.416717	R	T	2176	2204
PSM	DMAIATGGAVFGEEGLTLNLEDVQPHDLGK	2536	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1064	5.7414186	3	3097.510434	3096.507381	K	V	315	345
PSM	DMAIATGGAVFGEEGLTLNLEDVQPHDLGK	2537	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=5560	30.325114	3	3097.510732	3096.507381	K	V	315	345
PSM	VIHDNFGIVEGLMTTVHAITATQK	2538	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1769	9.6192683	3	2595.345480	2594.352658	K	T	163	187
PSM	GILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVK	2539	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=6841	37.448617	5	4034.893974	4035.887504	K	L	272	310
PSM	GILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVK	2540	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=5233	28.496692	4	4035.889222	4035.887504	K	L	272	310
PSM	GILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVK	2541	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=5331	29.049744	4	4035.889222	4035.887504	K	L	272	310
PSM	CGEEIAVQFVDMVK	2542	sp|O43175|SERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=2258	12.241686	2	1606.7384	1606.7366	R	G	295	309
PSM	SGETEDTFIADLVVGLCTGQIK	2543	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29	17-UNIMOD:4	ms_run[1]:scan=8222	45.176048	2	2352.135431	2352.151893	R	T	373	395
PSM	GLYGIKDDVFLSVPCILGQNGISDLVK	2544	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29	15-UNIMOD:4	ms_run[1]:scan=819	4.4454741	3	2920.530832	2919.541582	K	V	279	306
PSM	AQAALQAVNSVQSGNLALAASAAAVDAGMAMAGQSPVLR	2545	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29	29-UNIMOD:35	ms_run[1]:scan=4187	22.760827	3	3696.901507	3695.872328	R	I	147	186
PSM	GPAVGIDLGTTYSCVGVFQHGK	2546	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29	14-UNIMOD:4	ms_run[1]:scan=6907	37.825411	3	2263.115606	2262.110303	K	V	4	26
PSM	IGYNPDTVAFVPISGWNGDNMLEPSANMPWFK	2547	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29	21-UNIMOD:35	ms_run[1]:scan=3413	18.513864	3	3583.675594	3582.658813	K	G	181	213
PSM	AGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGK	2548	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=2470	13.36526	3	3952.8369	3952.8395	M	T	2	39
PSM	EKVETELQGVCDTVLGLLDSHLIK	2549	sp|P31947|1433S_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29	11-UNIMOD:4	ms_run[1]:scan=4344	23.636769	4	2695.413741	2695.410233	R	E	86	110
PSM	QGQYSPMAIEEQVAVIYAGVR	2550	sp|P25705|ATPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:28	ms_run[1]:scan=3593	19.514673	3	2291.1286	2291.1251	K	G	473	494
PSM	SNFFYAIQFVLSDEFSHLRPEQR	2551	sp|Q9UQE7|SMC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=6582	36.004823	3	2830.389259	2829.387464	K	L	39	62
PSM	MVNPTVFFDIAVDGEPLGR	2552	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=5553	30.285882	2	2134.0302	2134.0402	-	V	1	20
PSM	HLVFPLLEFLSVK	2553	sp|P60228|EIF3E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=600	3.2319673	2	1540.902487	1540.901737	R	E	17	30
PSM	VTGEADVEFATHEDAVAAMSK	2554	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=7095	38.891393	3	2177.003986	2176.994664	R	D	327	348
PSM	NNNIDAAIENIENMLTSENK	2555	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=7104	38.938437	2	2247.038751	2246.048490	K	V	1190	1210
PSM	TYLLFFPNDEVMNQNLAYYAAMLGEEHTR	2556	sp|Q32P28|P3H1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=3358	18.2129	3	3449.592977	3449.606049	K	S	326	355
PSM	AEEGIAAGGVMDVNTALQEVLK	2557	sp|P25398|RS12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:1	ms_run[1]:scan=4661	25.345651	3	2256.1318	2256.1302	M	T	2	24
PSM	AEISELPSIVQDLANGNITWADVEAR	2558	sp|P41250|GARS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=6057	33.079325	3	2811.396429	2810.408653	R	Y	697	723
PSM	VQVLTAGSLMGLGDIISQQLVER	2559	sp|P39210|MPV17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29	10-UNIMOD:35	ms_run[1]:scan=3706	20.109953	3	2443.335640	2442.315211	K	R	18	41
PSM	ASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGK	2560	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29	36-UNIMOD:35,45-UNIMOD:4,48-UNIMOD:4	ms_run[1]:scan=1749	9.5143412	6	5822.8872	5822.8742	R	I	13	68
PSM	EATTLANGVLASLNLPAAIEDVSGDTVPQSILTK	2561	sp|Q8WUM4|PDC6I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=5434	29.625155	3	3408.790546	3407.803546	R	S	387	421
PSM	IPNFWVTTFVNHPQVSALLGEEDEEALHYLTR	2562	sp|Q01105|SET_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=3410	18.499375	4	3725.851623	3724.852562	K	V	91	123
PSM	AEEGIAAGGVMDVNTALQEVLK	2563	sp|P25398|RS12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:1	ms_run[1]:scan=5278	28.752046	2	2256.1309	2256.1302	M	T	2	24
PSM	ASFANEDGQVSPGSLLLAGAIAGMPAASLVTPADVIK	2564	sp|Q9UJS0|CMC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29	24-UNIMOD:35	ms_run[1]:scan=4044	21.987814	3	3554.866822	3553.833801	K	T	509	546
PSM	DTDAAVGDNIGYITFVLFPR	2565	sp|O15144|ARPC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=4840	26.299939	3	2184.099182	2183.089885	K	H	211	231
PSM	MDFLLGNPFSSPVGQR	2566	sp|O60784|TOM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:1	ms_run[1]:scan=5603	30.558683	2	1805.8771	1805.8765	-	I	1	17
PSM	ERPPNPIEFLASYLLK	2567	sp|Q9C005|DPY30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=5783	31.551787	3	1886.033320	1886.030185	K	N	75	91
PSM	MQSLVQWGLDSYDYLQNAPPGFFPR	2568	sp|Q9BUR5|MIC26_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29	1-UNIMOD:35	ms_run[1]:scan=939	5.0854578	3	2944.385102	2944.385415	K	L	89	114
PSM	KHPSLIPLFVFIGTGATGATLYLLR	2569	sp|O00483|NDUA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=5796	31.624923	3	2685.546269	2684.541780	K	L	11	36
PSM	TFLVIPELAQELHVWTDK	2570	sp|P49902|5NTC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=901	4.8828826	3	2138.143743	2138.141192	R	S	368	386
PSM	SYRPAQVTWSQLPEVVELGILDQLSTEER	2571	sp|Q5VV41|ARHGG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=4958	26.963677	3	3343.706768	3342.709586	K	K	255	284
PSM	SEAANGNLDFVLSFLK	2572	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=457	2.490094	2	1724.864217	1723.878101	R	S	514	530
PSM	SEAANGNLDFVLSFLK	2573	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1708	9.2877098	2	1724.865287	1723.878101	R	S	514	530
PSM	AFIPLPSAVVQAVFGR	2574	sp|Q9NRG7|D39U1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=3893	21.154	3	1670.9508	1670.9508	R	Q	240	256
PSM	AGCEVTILFADLHAYLDNMK	2575	sp|P54577|SYYC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:4	ms_run[2]:scan=4263	23.18	3	2280.0919	2280.0919	K	A	65	85
PSM	AGCEVTILFADLHAYLDNMK	2576	sp|P54577|SYYC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:4	ms_run[2]:scan=4359	23.721	3	2280.0919	2280.0919	K	A	65	85
PSM	AGNYEEALQLYQHAVQYFLHVVK	2577	sp|O75351|VPS4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6556	35.859	3	2719.3758	2719.3758	K	Y	24	47
PSM	AKFYPEDVAEELIQDITQK	2578	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=634	3.4195	3	2236.1263	2236.1263	R	L	82	101
PSM	ALLGSMPGLMPPGLLAAAVSGLGSR	2579	sp|Q8IU81|I2BP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=4300	23.39	3	2335.2756	2335.2756	R	G	153	178
PSM	APEDFVDMVETYLK	2580	sp|Q8N3Z3-2|GTPB8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=4188	22.766	2	1655.7753	1655.7753	R	E	139	153
PSM	AQLAAITLIIGTFER	2581	sp|Q96QK1|VPS35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=2350	12.735	2	1615.9297	1615.9297	K	M	623	638
PSM	AVTLDPNFLDAYINLGNVLK	2582	sp|O15294-2|OGT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=4404	23.972	2	2189.1732	2189.1732	K	E	91	111
PSM	DAQGAATYAVVSSPAGILSLTLLER	2583	sp|Q96IR7|HPDL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=2198	11.912	2	2502.333	2502.3330	R	A	111	136
PSM	DESTALQWPSELLIFTK	2584	sp|Q9UKJ3-2|GPTC8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=1137	6.1509	2	1977.0095	1977.0095	K	A	466	483
PSM	DFNVGDYIQAVLDR	2585	sp|P06737-2|PYGL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=2737	14.838	2	1623.7893	1623.7893	R	N	223	237
PSM	DFSAFINLVEFCR	2586	sp|P78527-2|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28	12-UNIMOD:4	ms_run[2]:scan=2599	14.069	2	1616.7657	1616.7657	K	E	619	632
PSM	DFVSLYQDFENFYTR	2587	sp|O15270|SPTC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=5176	28.203	2	1942.8737	1942.8737	K	N	110	125
PSM	DGALHVIGSLAEILLK	2588	sp|O15397-2|IPO8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=2811	15.243	3	1647.956	1647.9560	K	K	226	242
PSM	DIEQIAEFLEQSVK	2589	sp|P18858-2|DNLI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=5113	27.849	2	1647.8356	1647.8356	K	D	703	717
PSM	DIEQIAEFLEQSVK	2590	sp|P18858-2|DNLI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=5211	28.387	2	1647.8356	1647.8356	K	D	703	717
PSM	DLADELALVDVIEDKLK	2591	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=1224	6.6345	3	1898.0248	1898.0248	K	G	43	60
PSM	DLSILSYLSQLQPPMPK	2592	sp|Q5SY16|NOL9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=4242	23.06	2	1929.0281	1929.0281	R	P	521	538
PSM	DMAIATGGAVFGEEGLTLNLEDVQPHDLGK	2593	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=1407	7.6312	3	3096.5074	3096.5074	K	V	315	345
PSM	DMAIATGGAVFGEEGLTLNLEDVQPHDLGK	2594	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=4430	24.114	3	3096.5074	3096.5074	K	V	315	345
PSM	DQFPEVYVPTVFENYVADIEVDGK	2595	sp|P61586|RHOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6208	33.923	2	2772.317	2772.3170	K	Q	28	52
PSM	DVYVVTDQIPVFVTMFQK	2596	sp|Q14956-2|GPNMB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=1353	7.3481	2	2128.0915	2128.0915	K	N	228	246
PSM	EDQVIQLMNAIFSK	2597	sp|P04844|RPN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=1326	7.1967	2	1634.8338	1634.8338	K	K	230	244
PSM	EEIVQFFSGLEIVPNGITLPVDPEGK	2598	sp|P52597|HNRPF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=5150	28.059	2	2826.4691	2826.4691	K	I	125	151
PSM	EFIGSFLEMFGPEGALK	2599	sp|P49585|PCY1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=3594	19.52	2	1870.9175	1870.9175	R	H	284	301
PSM	EGSGGGGGMDDIFSHIFGGGLFGFMGNQSR	2600	sp|O60884|DNJA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28	9-UNIMOD:35	ms_run[2]:scan=4157	22.59	3	3006.3025	3006.3025	R	S	76	106
PSM	EIWDMFGVFFANHPDLR	2601	sp|O75489|NDUS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=4509	24.526	3	2092.9829	2092.9829	R	R	169	186
PSM	ELPEPLLTFDLYPHVVGFLNIDESQR	2602	sp|Q07960|RHG01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=4297	23.373	3	3040.5546	3040.5546	R	V	324	350
PSM	ELSDFPQEFVWEASHYLVR	2603	sp|O00411|RPOM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=2472	13.377	3	2351.1222	2351.1222	R	Q	1016	1035
PSM	ELTGALIASLINCYIR	2604	sp|O75694-2|NU155_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28	13-UNIMOD:4	ms_run[2]:scan=6529	35.7	2	1805.971	1805.9710	K	D	773	789
PSM	EPNPQGESHPPLNLAFLDILSEFSSK	2605	sp|Q8N3U4|STAG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=3925	21.333	3	2865.4185	2865.4185	K	L	984	1010
PSM	ESEIIDFFLGASLK	2606	sp|P15880|RS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=1338	7.2616	2	1567.8134	1567.8134	K	D	90	104
PSM	ETCLITFLLAGIECPR	2607	sp|Q7KZF4|SND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=5680	30.974	3	1891.9536	1891.9536	K	G	547	563
PSM	EVFPFPEVSQDELNEINQFLGPVEK	2608	sp|Q9H845|ACAD9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6781	37.108	3	2903.4229	2903.4229	K	F	52	77
PSM	FADDQLIIDFDNFVR	2609	sp|P17655-2|CAN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=263	1.4455	3	1826.8839	1826.8839	R	C	572	587
PSM	FADDQLIIDFDNFVR	2610	sp|P17655-2|CAN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=313	1.7279	2	1826.8839	1826.8839	R	C	572	587
PSM	FDLLFIMLDQMDPEQDREISDHVLR	2611	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=3182	17.269	4	3074.4841	3074.4841	R	M	479	504
PSM	FFPEDVSEELIQEITQR	2612	sp|P35241-3|RADI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=3437	18.651	3	2079.0161	2079.0161	K	L	52	69
PSM	FFPEDVSEELIQEITQR	2613	sp|P35241-3|RADI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=3954	21.496	3	2079.0161	2079.0161	K	L	52	69
PSM	FFPEDVSEELIQEITQR	2614	sp|P35241-3|RADI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=4254	23.13	2	2079.0161	2079.0161	K	L	52	69
PSM	FGVEQDVDMVFASFIR	2615	sp|P14618-3|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28	9-UNIMOD:35	ms_run[2]:scan=823	4.4679	3	1874.8873	1874.8873	K	K	216	232
PSM	FLVVLNFGDVGLSAGLQASDLPASASLPAK	2616	sp|P08195-2|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=3452	18.736	3	2956.591	2956.5910	R	A	462	492
PSM	FRAPELLFRPDLIGEESEGIHEVLVFAIQK	2617	sp|P61163|ACTZ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=1811	9.832	4	3451.8504	3451.8504	R	S	256	286
PSM	FSDPGQPMSFVLEFHFEPNDYFTNSVLTK	2618	sp|Q99733|NP1L4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=93	0.50833	3	3392.57	3392.5700	K	T	195	224
PSM	GFNDDVLLQIVHFLLNRPKEEK	2619	sp|Q9NP92|RT30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6077	33.194	5	2623.4122	2623.4122	K	S	412	434
PSM	GFTQLQTLILPQHVNCPGGINAWNTITSYIDNQICQGQK	2620	sp|Q6UW56-2|ARAID_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28	16-UNIMOD:4,35-UNIMOD:4	ms_run[2]:scan=4294	23.356	3	4427.1791	4427.1791	R	N	57	96
PSM	GLDIPLLDNVINYSFPAK	2621	sp|Q8TDD1|DDX54_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=5235	28.508	2	1988.0619	1988.0619	R	G	401	419
PSM	GLIAEAAQLGPVGGVFNLAVVLR	2622	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=4309	23.438	2	2263.3052	2263.3052	R	D	1954	1977
PSM	GLLLFVDEADAFLR	2623	sp|Q5T2N8|ATD3C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=3337	18.1	2	1577.8453	1577.8453	R	K	230	244
PSM	GMTLVTPLQLLLFASK	2624	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28	2-UNIMOD:35	ms_run[2]:scan=2767	14.999	2	1746.9954	1746.9954	K	K	1058	1074
PSM	GNFTLPEVAECFDEITYVELQK	2625	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28	11-UNIMOD:4	ms_run[2]:scan=2218	12.024	2	2601.2309	2601.2309	K	E	619	641
PSM	GSTLPDVTEVSTFFPFHEYFANAPQPIFK	2626	sp|O60306|AQR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=1318	7.1569	3	3285.6023	3285.6023	K	G	955	984
PSM	GVPQIEVTFDIDANGILNVSAVDK	2627	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=8644	47.58	2	2513.3013	2513.3013	R	S	470	494
PSM	HFYWYLTNEGIQYLRDYLHLPPEIVPATLR	2628	sp|P46783|RS10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=5725	31.223	4	3716.9144	3716.9144	R	R	66	96
PSM	IEQLSPFPFDLLLK	2629	sp|Q02218-2|ODO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=663	3.5795	2	1658.9283	1658.9283	R	E	926	940
PSM	IEQLSPFPFDLLLK	2630	sp|Q02218-2|ODO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=818	4.4398	2	1658.9283	1658.9283	R	E	926	940
PSM	IGEGVFGEVFQTIADHTPVAIK	2631	sp|Q8TF76|HASP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=2001	10.822	3	2327.2161	2327.2161	K	I	490	512
PSM	ILSISADIETIGEILK	2632	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=2642	14.304	2	1713.9764	1713.9764	R	K	87	103
PSM	IQVIDISMILAEAIR	2633	sp|P60891-2|PRPS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6716	36.735	3	1683.9593	1683.9593	K	R	220	235
PSM	ISFDEFVYIFQEVK	2634	sp|P13797-3|PLST_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=3586	19.479	2	1762.8818	1762.8818	K	S	27	41
PSM	ISGSILNELIGLVR	2635	sp|Q86VP6-2|CAND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=511	2.7538	3	1482.877	1482.8770	K	S	562	576
PSM	KASFEEASNQLINHIEQFLDTNETPYFMK	2636	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6712	36.712	4	3443.6344	3443.6344	K	S	606	635
PSM	KPLVIIAEDVDGEALSTLVLNR	2637	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=4806	26.129	3	2364.3264	2364.3264	R	L	269	291
PSM	LCYVALDFEQEMATAASSSSLEK	2638	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28	2-UNIMOD:4	ms_run[2]:scan=1842	9.99	2	2549.1666	2549.1666	K	S	216	239
PSM	LCYVALDFEQEMATAASSSSLEK	2639	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28	2-UNIMOD:4	ms_run[2]:scan=5751	31.368	2	2549.1666	2549.1666	K	S	216	239
PSM	LDLMDAGTDAMDVLMGR	2640	sp|O00429-4|DNM1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=5795	31.619	2	1822.8263	1822.8263	K	V	217	234
PSM	LDPQELLPWVVPNNQGIAQEEALHLIDEMDLNGDKK	2641	sp|Q14257|RCN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=3311	17.954	4	4081.0466	4081.0466	R	L	247	283
PSM	LENDLEELALYQIQLLK	2642	sp|Q13057|COASY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=1073	5.7923	3	2044.1092	2044.1092	R	D	303	320
PSM	LEQFVSILMASIPLPDKAS	2643	sp|P00491|PNPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=5726	31.228	2	2058.1071	2058.1071	K	-	271	290
PSM	LLEELEDTWLPYLTPK	2644	sp|Q9C0B1|FTO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=2404	13.008	2	1959.0241	1959.0241	R	D	19	35
PSM	LLIAGTNSSDLQQILSLLESNK	2645	sp|P08195-2|4F2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=2880	15.605	3	2356.285	2356.2850	R	D	274	296
PSM	LLIVSNPVDILTYVAWK	2646	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=5455	29.744	2	1943.1132	1943.1132	K	I	133	150
PSM	LLSLLPEYVVPYTIHLLAHDPDYVK	2647	sp|Q9NTI5-2|PDS5B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=2998	16.259	4	2907.5786	2907.5786	K	V	983	1008
PSM	LMWLFGCPLLLDDVAR	2648	sp|O15067|PUR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28	7-UNIMOD:4	ms_run[2]:scan=4791	26.045	2	1917.9845	1917.9845	K	E	60	76
PSM	LNCQVIGASVDSHFCHLAWVNTPK	2649	sp|Q06830|PRDX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=7013	38.434	4	2752.3214	2752.3214	K	K	69	93
PSM	LNDTLLLGPDPLGNFLSIAVK	2650	sp|O00178|GTPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6412	35.041	3	2209.2358	2209.2358	K	S	423	444
PSM	LSNQVSTIVSLLSTLCR	2651	sp|Q9ULT8|HECD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28	16-UNIMOD:4	ms_run[2]:scan=1781	9.6842	3	1890.0244	1890.0244	K	G	272	289
PSM	LVEGLDQFTGEVISSVSELQSLK	2652	sp|Q9NU22|MDN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6694	36.613	2	2477.2901	2477.2901	R	V	4080	4103
PSM	MQSLVQWGLDSYDYLQNAPPGFFPR	2653	sp|Q9BUR5|MIC26_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=4289	23.329	3	2928.3905	2928.3905	K	L	89	114
PSM	MVYSTCSLNPIEDEAVIASLLEK	2654	sp|Q08J23-3|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28	6-UNIMOD:4	ms_run[2]:scan=900	4.8773	2	2581.2655	2581.2655	R	S	80	103
PSM	NEFIGLQLLDVLAR	2655	sp|Q27J81-2|INF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=4260	23.163	2	1599.8984	1599.8984	R	L	219	233
PSM	NESNLGDLLLGFLK	2656	sp|Q6PIY7-2|GLD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=3705	20.104	2	1531.8246	1531.8246	K	Y	379	393
PSM	NYLDWLTSIPWGK	2657	sp|P36776-3|LONM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=2984	16.182	2	1591.8035	1591.8035	R	Y	264	277
PSM	NYLDWLTSIPWGK	2658	sp|P36776-3|LONM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=3082	16.722	2	1591.8035	1591.8035	R	Y	264	277
PSM	QAFDDAIAELDTLNEDSYKDSTLIMQLLR	2659	sp|Q04917|1433F_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7567	41.519	3	3327.6181	3327.6181	K	D	199	228
PSM	QEGCQDIATQLISNMDIDVILGGGR	2660	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28	4-UNIMOD:4	ms_run[2]:scan=4584	24.931	3	2702.3004	2702.3004	R	K	199	224
PSM	QICLVMLETLSQSPQGR	2661	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:4	ms_run[2]:scan=1689	9.1828	2	1958.9918	1958.9918	K	V	161	178
PSM	QLYEPLVMQLIHWFTNNKK	2662	sp|P78527-2|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6978	38.235	3	2401.2617	2401.2617	R	F	982	1001
PSM	QNWSLLPAQAIYASVLPGELMR	2663	sp|P35251-2|RFC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=230	1.2653	2	2456.2886	2456.2886	K	G	928	950
PSM	QQQEGLSHLISIIKDDLEDIK	2664	sp|Q7Z3B4-2|NUP54_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=181	0.99258	3	2421.2751	2421.2751	K	L	253	274
PSM	RDWYVYAFLSSLPWVGK	2665	sp|Q09161|NCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=4627	25.161	3	2086.0676	2086.0676	R	E	166	183
PSM	SDPLCVLLQDVGGGSWAELGR	2666	sp|Q99829|CPNE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28	5-UNIMOD:4	ms_run[2]:scan=5825	31.79	2	2228.0896	2228.0896	K	T	26	47
PSM	SEDPLFVLEHSLPIDTQYYLEQQLAK	2667	sp|P28340|DPOD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=2572	13.929	3	3075.5441	3075.5441	K	P	939	965
PSM	SGETEDTFIADLVVGLCTGQIK	2668	sp|P06733-2|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28	17-UNIMOD:4	ms_run[2]:scan=8699	47.894	2	2352.1519	2352.1519	R	T	280	302
PSM	SLSLNPFLWSPFESLCEIGEKPDPDQTFK	2669	sp|P30260|CDC27_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28	16-UNIMOD:4	ms_run[2]:scan=4171	22.671	3	3380.6275	3380.6275	K	F	141	170
PSM	SLTGVVNAQALTSAFSPHTKPWIGLAEALGTLMR	2670	sp|O43175|SERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6760	36.987	3	3536.8814	3536.8814	K	A	311	345
PSM	TEAAKEESQQMVLDIEDLDNIQTPESVLLSAVSGEDTQDR	2671	sp|Q14152-2|EIF3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=2651	14.357	3	4403.081	4403.0810	K	T	67	107
PSM	TEFLSFMNTELAAFTK	2672	sp|P31949|S10AB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=43	0.22245	3	1848.8968	1848.8968	K	N	37	53
PSM	TGAFALPILNALLETPQR	2673	sp|Q9H0S4-2|DDX47_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=5604	30.564	3	1924.0782	1924.0782	K	L	75	93
PSM	TLQAAAFLDFLWHNMK	2674	sp|Q12788|TBL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=2065	11.18	3	1904.9607	1904.9607	R	L	774	790
PSM	TTNSFHLPDDPSIPIIMVGPGTGIAPFIGFLQHR	2675	sp|Q9UBK8|MTRR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=2668	14.449	4	3644.8814	3644.8814	R	E	526	560
PSM	TVSLGAGAKDELHIVEAEAMNYEGSPIK	2676	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6848	37.488	4	2928.4539	2928.4539	R	V	46	74
PSM	VADNLAIQLAAVTEDKYEILQSVDDAAIVIK	2677	sp|Q12906-5|ILF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=3003	16.287	4	3327.7814	3327.7814	K	N	128	159
PSM	VDIVAINDPFIDLNYMVYMFQYDSTHGKFHGTVK	2678	sp|P04406|G3P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=5819	31.759	5	3976.9168	3976.9168	K	A	28	62
PSM	VFIMDSCDELIPEYLNFIR	2679	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28	7-UNIMOD:4	ms_run[2]:scan=2546	13.794	2	2373.1385	2373.1385	R	G	360	379
PSM	VGQYVVDLTSFEQLALPVLR	2680	sp|Q9BSD7|NTPCR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=4859	26.403	3	2246.2311	2246.2311	R	N	78	98
PSM	VKDALEFWLQAGVDGFQVR	2681	sp|P08195-2|4F2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7424	40.729	3	2177.1269	2177.1269	K	D	229	248
PSM	VLTDSGSLDSTIPGIENTITVTTEQLTTASFPVGSK	2682	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6411	35.035	4	3678.8727	3678.8727	K	K	210	246
PSM	VTPQSLFILFGVYGDVQR	2683	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=673	3.636	2	2038.0888	2038.0888	R	V	349	367
PSM	VTPQSLFILFGVYGDVQR	2684	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=1088	5.8766	2	2038.0888	2038.0888	R	V	349	367
PSM	VVPSDLYPLVLGFLR	2685	sp|Q14978-3|NOLC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6506	35.572	3	1686.9709	1686.9709	R	D	9	24
PSM	VVPSDLYPLVLGFLR	2686	sp|Q14978-3|NOLC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6607	36.138	3	1686.9709	1686.9709	R	D	9	24
PSM	WLPAGDALLQMITIHLPSPVTAQK	2687	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=5178	28.215	3	2599.4196	2599.4196	R	Y	343	367
PSM	YMLLPNQVWDSIIQQATK	2688	sp|O14980|XPO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=2447	13.246	3	2147.1085	2147.1085	K	N	657	675
PSM	YNVTVIQYIGELLR	2689	sp|O14975-2|S27A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=3927	21.344	2	1679.9247	1679.9247	K	Y	251	265
PSM	YSLLPFWYTLLYQAHR	2690	sp|Q14697|GANAB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=486	2.6297	3	2070.0727	2070.0727	R	E	705	721
PSM	YSLLPFWYTLLYQAHR	2691	sp|Q14697|GANAB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=389	2.1418	2	2070.0727	2070.0727	R	E	705	721
PSM	WTELGALDILQMLGR	2692	sp|O75643|U520_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=4699	25.551793	2	1714.917462	1714.907627	R	A	841	856
PSM	WLPAGDALLQMITIHLPSPVTAQK	2693	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28	11-UNIMOD:35	ms_run[1]:scan=5312	28.943136	4	2616.4452	2615.4142	R	Y	343	367
PSM	WLPAGDALLQMITIHLPSPVTAQK	2694	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28	11-UNIMOD:35	ms_run[1]:scan=5570	30.380997	3	2616.441973	2615.414531	R	Y	343	367
PSM	LCYVALDFEQEMATAASSSSLEK	2695	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28	2-UNIMOD:4	ms_run[1]:scan=3647	19.807196	2	2550.169438	2549.166557	K	S	216	239
PSM	DMAIATGGAVFGEEGLTLNLEDVQPHDLGK	2696	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1193	6.4655522	3	3097.510434	3096.507381	K	V	315	345
PSM	DMAIATGGAVFGEEGLTLNLEDVQPHDLGK	2697	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=6786	37.136286	3	3096.513163	3096.507381	K	V	315	345
PSM	GILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVK	2698	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=3651	19.829777	4	4035.888558	4035.887504	K	L	272	310
PSM	SKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICR	2699	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28	36-UNIMOD:4,49-UNIMOD:4	ms_run[1]:scan=6842	37.456573	5	5731.7102	5731.7156	K	R	165	215
PSM	SLQDIIAILGMDELSEEDKLTVSR	2700	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=5242	28.547244	2	2674.367657	2674.373513	K	A	433	457
PSM	GVPQIEVTFDIDANGILNVSAVDK	2701	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=7298	40.018791	2	2513.293959	2513.301334	R	S	470	494
PSM	QKHDGTVGLLTYPVLQAADILLYK	2702	sp|Q9UGM6|SYWM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:28	ms_run[1]:scan=3498	18.991354	3	2638.4408	2638.4365	K	S	149	173
PSM	IGYNPDTVAFVPISGWNGDNMLEPSANMPWFK	2703	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28	21-UNIMOD:35	ms_run[1]:scan=4350	23.67044	3	3584.673091	3582.658813	K	G	181	213
PSM	IGYNPDTVAFVPISGWNGDNMLEPSANMPWFK	2704	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28	21-UNIMOD:35	ms_run[1]:scan=3628	19.704107	3	3583.671149	3582.658813	K	G	181	213
PSM	ILLANFLAQTEALMR	2705	sp|P06744|G6PI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=2789	15.122494	2	1702.945611	1702.944012	K	G	424	439
PSM	LQLETEIEALKEELLFMK	2706	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1906	10.309652	3	2176.172064	2176.170109	R	K	197	215
PSM	DYIYAVTPLLEDALMDR	2707	sp|O75533|SF3B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1243	6.7439003	3	1997.987672	1996.981580	K	D	1164	1181
PSM	AEYLASIFGTEK	2708	sp|Q01081|U2AF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:1	ms_run[1]:scan=1531	8.2897676	2	1369.6776	1369.6760	M	D	2	14
PSM	QMEQISQFLQAAER	2709	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:28	ms_run[1]:scan=816	4.4285907	2	1660.7882	1660.7874	K	Y	89	103
PSM	AQLGVQAFADALLIIPK	2710	sp|P40227|TCPZ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=556	2.9924922	2	1767.031514	1767.029457	R	V	433	450
PSM	QSLMQCQDFHQLSQNLLLWLASAK	2711	sp|Q8WXH0|SYNE2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28	6-UNIMOD:4	ms_run[1]:scan=5152	28.070527	3	2858.409136	2858.420755	R	N	6658	6682
PSM	EATTLANGVLASLNLPAAIEDVSGDTVPQSILTK	2712	sp|Q8WUM4|PDC6I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=5566	30.361118	3	3408.790546	3407.803546	R	S	387	421
PSM	QFTTVVADTGDFHAIDEYKPQDATTNPSLILAAAQMPAYQELVEEAIAYGR	2713	sp|P37837|TALDO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28		ms_run[1]:scan=5079	27.6557	4	5568.7004	5568.7030	K	K	20	71
PSM	AEEGIAAGGVMDVNTALQEVLK	2714	sp|P25398|RS12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:1,11-UNIMOD:35	ms_run[1]:scan=175	0.96009335	3	2272.1263	2272.1252	M	T	2	24
PSM	QNRDEVLDNLLAFVCDIRPEIHENYR	2715	sp|O75348|VATG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:28,15-UNIMOD:4	ms_run[1]:scan=4230	22.994356	4	3210.5534	3210.5511	R	I	90	116
PSM	QWADDWLVHLISPNVYR	2716	sp|Q9H7Z7|PGES2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:28	ms_run[1]:scan=7255	39.781389	2	2095.0422	2094.0322	R	T	236	253
PSM	ASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGK	2717	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28	45-UNIMOD:4,48-UNIMOD:4	ms_run[1]:scan=4871	26.472793	7	5806.8857	5806.8792	R	I	13	68
PSM	FGVEQDVDMVFASFIR	2718	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=6859	37.552682	2	1858.891849	1858.892371	K	K	231	247
PSM	KLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTALPDEDDDL	2719	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28	13-UNIMOD:35	ms_run[1]:scan=1696	9.2247931	4	5402.6059	5402.6097	R	-	167	217
PSM	LQDFNVGDYIEAVLDR	2720	sp|P11216|PYGB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=3305	17.917489	3	1865.918360	1865.915943	K	N	255	271
PSM	CLRPEELTNQMNQIEISMQHEQLEESFQELVEDYRR	2721	sp|O14929|HAT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=2746	14.887021	4	4504.0712	4504.0728	K	V	376	412
PSM	TISQLVHAFQTTEAQHLFLQAFWQTMNR	2722	sp|P56182|RRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=5390	29.375363	3	3346.672181	3345.671701	R	E	78	106
PSM	ERPPNPIEFLASYLLK	2723	sp|Q9C005|DPY30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=5866	32.025758	2	1886.037369	1886.030185	K	N	75	91
PSM	KNELAIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHGIFDRPVAIGGK	2724	sp|P36957|ODO2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28		ms_run[1]:scan=3427	18.592491	5	5556.8212	5555.8212	R	V	356	410
PSM	ERWENPLMGWASTADPLSNMVLTFSTK	2725	sp|O43181|NDUS4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=6211	33.93908	3	3079.471432	3080.473578	R	E	105	132
PSM	SEAANGNLDFVLSFLK	2726	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1616	8.7724742	2	1724.865287	1723.878101	R	S	514	530
PSM	NIAPHTVVDSIMTALSPYASLAVNNIR	2727	sp|P52756|RBM5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=6499	35.532468	3	2869.527244	2866.501114	R	L	237	264
PSM	GYYDVPIATLDFSSLYPSIMMAHNLCYTTLLRPGTAQK	2728	sp|P28340|DPOD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28	26-UNIMOD:4	ms_run[1]:scan=3051	16.550853	4	4310.120835	4307.110510	K	L	592	630
PSM	AATFGLILDDVSLTHLTFGK	2729	sp|P35232|PHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=7337	40.242	3	2118.1361	2118.1361	R	E	158	178
PSM	AAYSFYNVHTQTPLLDLMSDALVLAK	2730	sp|P30419-2|NMT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6373	34.821	3	2880.4732	2880.4732	K	M	338	364
PSM	ADFNAVEYINTLFPTEQSLANIDEVVNK	2731	sp|Q5VIR6-2|VPS53_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6610	36.155	3	3153.5506	3153.5506	R	I	40	68
PSM	AEISELPSIVQDLANGNITWADVEAR	2732	sp|P41250|GARS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=4312	23.457	2	2810.4087	2810.4087	R	Y	697	723
PSM	ASPESQEPLIQLVQAFVR	2733	sp|Q5SRE5-2|NU188_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=5805	31.678	2	2011.0738	2011.0738	K	H	1617	1635
PSM	DETGAIFIDRDPAAFAPILNFLR	2734	sp|Q9Y597-2|KCTD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6838	37.433	3	2561.3278	2561.3278	R	T	57	80
PSM	DFLDEYIFLAVGR	2735	sp|O00571-2|DDX3X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=4880	26.523	2	1556.7875	1556.7875	R	V	379	392
PSM	DFLDEYIFLAVGR	2736	sp|O00571-2|DDX3X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=4978	27.079	2	1556.7875	1556.7875	R	V	379	392
PSM	DFSAFINLVEFCR	2737	sp|P78527-2|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27	12-UNIMOD:4	ms_run[2]:scan=2504	13.553	2	1616.7657	1616.7657	K	E	619	632
PSM	DGAGFLINLIDSPGHVDFSSEVTAALR	2738	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=4540	24.697	2	2800.4032	2800.4032	K	V	94	121
PSM	DLFAEGLLEFLRPAVQQLDSHVHAVR	2739	sp|O95295|SNAPN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=7389	40.53	4	2959.5668	2959.5668	R	E	23	49
PSM	DLTVLCHLEQLLLVTHLDLSHNR	2740	sp|Q92696|PGTA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27	6-UNIMOD:4	ms_run[2]:scan=3144	17.06	4	2738.4538	2738.4538	K	L	452	475
PSM	DLVSSLTSGLLTIGDR	2741	sp|P53396-3|ACLY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=3426	18.587	3	1645.8887	1645.8887	K	F	648	664
PSM	DMAIATGGAVFGEEGLTLNLEDVQPHDLGK	2742	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=278	1.53	3	3096.5074	3096.5074	K	V	315	345
PSM	DSSTWTVDHQLLWGEALLITPVLQAGK	2743	sp|P10253|LYAG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=5577	30.42	3	2977.5549	2977.5549	K	A	734	761
PSM	ECFGACLFTCYDLLRPDVVLETAWR	2744	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27	2-UNIMOD:4,6-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=4042	21.977	3	3090.4402	3090.4402	R	H	1564	1589
PSM	EDPDTPMSFFDFVVDPHSFPR	2745	sp|Q9NXX6|NSE4A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=1934	10.454	3	2481.0947	2481.0947	R	T	280	301
PSM	EERPLFPQILATIELLQR	2746	sp|P10398|ARAF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=3894	21.162	3	2165.2208	2165.2208	R	S	555	573
PSM	EFSVTDAVPFPISLIWNHDSEDTEGVHEVFSR	2747	sp|Q92598-2|HS105_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=2021	10.932	4	3658.7216	3658.7216	R	N	391	423
PSM	EISQETAVNPVDIVSTLQALQMLK	2748	sp|O95251-3|KAT7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6351	34.696	2	2626.3888	2626.3888	K	Y	374	398
PSM	ENAPAIIFIDEIDAIATK	2749	sp|P43686-2|PRS6B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=7004	38.381	3	1943.0252	1943.0252	K	R	225	243
PSM	ETCLITFLLAGIECPR	2750	sp|Q7KZF4|SND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=5777	31.518	3	1891.9536	1891.9536	K	G	547	563
PSM	EVFPFPEVSQDELNEINQFLGPVEK	2751	sp|Q9H845|ACAD9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6976	38.224	3	2903.4229	2903.4229	K	F	52	77
PSM	EVVPGDSVNSLLSILDVITGHQHPQR	2752	sp|Q8IY17-5|PLPL6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=4266	23.197	3	2809.4723	2809.4723	K	T	208	234
PSM	FDAVSGDYYPIIYFNDYWNLQK	2753	sp|O96005-3|CLPT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=2782	15.081	2	2730.2642	2730.2642	K	D	166	188
PSM	FFPEDVSEELIQEITQR	2754	sp|P35241-3|RADI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=4218	22.928	3	2079.0161	2079.0161	K	L	52	69
PSM	FSGNLLVSLLGTWSDTSSGGPAR	2755	sp|P61619-3|S61A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=4121	22.392	2	2321.1652	2321.1652	R	A	192	215
PSM	FSLEALTGPDTELWLIQAPADFAPECFNGR	2756	sp|O15446|RPA34_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27	26-UNIMOD:4	ms_run[2]:scan=7277	39.898	3	3364.6074	3364.6074	R	H	30	60
PSM	GFNDDVLLQIVHFLLNRPKEEK	2757	sp|Q9NP92|RT30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6090	33.266	3	2623.4122	2623.4122	K	S	412	434
PSM	GFQQILAGEYDHLPEQAFYMVGPIEEAVAK	2758	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=2325	12.604	4	3349.6329	3349.6329	K	A	490	520
PSM	GLQVLLTPVLANILEADQEK	2759	sp|Q9UHD2|TBK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=2580	13.967	2	2163.2151	2163.2151	R	C	272	292
PSM	GQLVPLETVLDMLR	2760	sp|P00568|KAD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=4726	25.698	2	1582.8753	1582.8753	K	D	64	78
PSM	GWPWLLPDGSPVDIFAK	2761	sp|Q6P1J9|CDC73_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=2381	12.902	2	1896.9774	1896.9774	K	I	456	473
PSM	GYWASLDASTQTTHELTIPNNLIGCIIGR	2762	sp|Q15365|PCBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27	25-UNIMOD:4	ms_run[2]:scan=7238	39.689	3	3200.5924	3200.5924	K	Q	269	298
PSM	HSQDLAFLSMLNDIAAVPATAMPFR	2763	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=5543	30.23	3	2715.3513	2715.3513	R	G	444	469
PSM	HYLDQLNHILGILGSPSQEDLNCIINLK	2764	sp|P28482|MK01_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27	23-UNIMOD:4	ms_run[2]:scan=1716	9.3327	3	3216.6601	3216.6601	K	A	232	260
PSM	IDDILQTLLDATYK	2765	sp|Q16850-2|CP51A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=797	4.3232	2	1620.8611	1620.8611	K	D	179	193
PSM	IEQLSPFPFDLLLK	2766	sp|Q02218-2|ODO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=1049	5.6582	2	1658.9283	1658.9283	R	E	926	940
PSM	IETELRDICNDVLSLLEK	2767	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27	9-UNIMOD:4	ms_run[2]:scan=2670	14.46	3	2159.1144	2159.1144	K	F	86	104
PSM	IFTENIVEQPCPDVFWFPIFSEK	2768	sp|O00469-3|PLOD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27	11-UNIMOD:4	ms_run[2]:scan=5174	28.192	3	2841.3724	2841.3724	K	A	233	256
PSM	IMSLVDPNHSGLVTFQAFIDFMSR	2769	sp|O43707-3|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27	2-UNIMOD:35	ms_run[2]:scan=6822	37.344	3	2740.3353	2740.3353	R	E	424	448
PSM	IQHPSNVLHFFNAPLEVTEENFFEICDELGVK	2770	sp|P14866-2|HNRPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27	26-UNIMOD:4	ms_run[2]:scan=3471	18.843	4	3771.8243	3771.8243	R	R	363	395
PSM	ISFDEFVYIFQEVK	2771	sp|P13797-3|PLST_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=3721	20.197	2	1762.8818	1762.8818	K	S	27	41
PSM	IVAFADAAVEPIDFPIAPVYAASMVLK	2772	sp|P24752|THIL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6684	36.556	3	2817.5027	2817.5027	R	D	312	339
PSM	KNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGK	2773	sp|Q09028-3|RBBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=4913	26.711	4	3953.0186	3953.0186	K	D	26	60
PSM	LCYVALDFEQEMATAASSSSLEK	2774	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27	2-UNIMOD:4	ms_run[2]:scan=3828	20.79	2	2549.1666	2549.1666	K	S	216	239
PSM	LCYVALDFEQEMATAASSSSLEK	2775	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27	2-UNIMOD:4	ms_run[2]:scan=5400	29.429	2	2549.1666	2549.1666	K	S	216	239
PSM	LGAGYPMGPFELLDYVGLDTTK	2776	sp|Q16836|HCDH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=5401	29.437	3	2356.1661	2356.1661	K	F	250	272
PSM	LGFFTTYFLPLANTLK	2777	sp|Q5JTH9-2|RRP12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=3072	16.669	2	1845.0077	1845.0077	R	S	482	498
PSM	LIPEMDQIFTEVEMTTLEK	2778	sp|Q9Y4L1|HYOU1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=3820	20.743	3	2266.1113	2266.1113	R	V	841	860
PSM	LLIVSNPVDILTYVAWK	2779	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=4887	26.565	3	1943.1132	1943.1132	K	I	133	150
PSM	LNYAQWYPIVVFLNPDSK	2780	sp|Q07157-2|ZO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=2271	12.309	2	2166.115	2166.1150	R	Q	716	734
PSM	LVETLQADSGLLLDALLAR	2781	sp|O60936|NOL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=3506	19.037	3	2010.1361	2010.1361	R	G	19	38
PSM	MNYIGQFLPGYEAPAFMDPLLPK	2782	sp|P32754-2|HPPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=1373	7.4571	2	2611.2855	2611.2855	K	L	111	134
PSM	MSLLQLVEILQSK	2783	sp|O00159-2|MYO1C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=2349	12.73	2	1500.8586	1500.8586	K	E	571	584
PSM	NLLSSWDEVIHIADQLR	2784	sp|Q15813|TBCE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=2798	15.173	3	2008.0378	2008.0378	K	H	163	180
PSM	NSELFDPFDLFDVR	2785	sp|P52735-3|VAV2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=5134	27.967	2	1712.8046	1712.8046	R	D	90	104
PSM	QALIDMNTLFTLLK	2786	sp|O75027-3|ABCB7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=3887	21.12	2	1619.8957	1619.8957	R	V	396	410
PSM	QTAVSVENFIAELLPDK	2787	sp|Q96M27-5|PRRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=3024	16.4	2	1872.9833	1872.9833	K	W	326	343
PSM	QVQTSGGLWTECIAQLSPEQQAAIQELLNSA	2788	sp|O00410-2|IPO5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27	12-UNIMOD:4	ms_run[2]:scan=7315	40.117	3	3369.6511	3369.6511	R	-	1007	1038
PSM	SAATDIFSYLVEYNPSMVR	2789	sp|Q6IN85-5|P4R3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=712	3.8494	2	2162.0354	2162.0354	R	E	379	398
PSM	SAEHTLVDMVQLLFTR	2790	sp|Q92538-3|GBF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=3713	20.149	3	1858.9611	1858.9611	K	L	180	196
PSM	SELHLMDRDLLQIIFSFSK	2791	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=4064	22.099	3	2291.1984	2291.1984	K	A	296	315
PSM	SHHWCIQGCSAVTGENLLPGIDWLLDDISSR	2792	sp|P36404-2|ARL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=527	2.8383	4	3535.6613	3535.6613	R	I	122	153
PSM	SLDPSDAFNGVDCNSLSFLSVFTDGDLGDSGKR	2793	sp|O75153|CLU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27	13-UNIMOD:4	ms_run[2]:scan=1263	6.854	3	3491.5787	3491.5787	K	K	141	174
PSM	SSQLLWEALESLVNR	2794	sp|Q27J81-2|INF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=3670	19.917	3	1743.9155	1743.9155	R	A	307	322
PSM	STAPLLDVFSSMLK	2795	sp|Q9BTC0|DIDO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=1943	10.504	2	1507.7956	1507.7956	K	D	825	839
PSM	THINIVVIGHVDSGK	2796	sp|P68104-2|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=7035	38.55	3	1587.8733	1587.8733	K	S	6	21
PSM	TIQQLETVLGEPLQSYF	2797	sp|Q9H583|HEAT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=3502	19.014	2	1965.0095	1965.0095	K	-	2128	2145
PSM	TLFSFLGEIEELR	2798	sp|Q8WXA9-2|SREK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=1878	10.171	2	1552.8137	1552.8137	R	L	37	50
PSM	TLLEGSGLESIISIIHSSLAEPR	2799	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=7202	39.485	4	2421.3115	2421.3115	R	V	2483	2506
PSM	VASVYEAPGFFLDLEPIPGALDAVR	2800	sp|Q8TCD5-2|NT5C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=1249	6.7753	3	2645.3741	2645.3741	K	E	61	86
PSM	VLGEAVLPFSPALAEVTLGIGR	2801	sp|Q99638|RAD9A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=1052	5.6751	2	2208.2518	2208.2518	R	G	151	173
PSM	YLEMLLEYLQDYTDR	2802	sp|Q12874|SF3A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6673	36.492	2	1963.9237	1963.9237	R	V	185	200
PSM	DGAGFLINLIDSPGHVDFSSEVTAALR	2803	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=7531	41.328104	3	2801.427997	2800.403174	K	V	94	121
PSM	LCYVALDFEQEMATAASSSSLEK	2804	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27	2-UNIMOD:4	ms_run[1]:scan=6427	35.121116	3	2550.166548	2549.166557	K	S	216	239
PSM	VFIMDSCDELIPEYLNFIR	2805	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27	7-UNIMOD:4	ms_run[1]:scan=2006	10.847677	3	2373.139087	2373.138492	R	G	360	379
PSM	DLVVLLFETALLSSGFSLEDPQTHSNR	2806	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=8077	44.364562	3	2989.520266	2987.524017	K	I	653	680
PSM	DMAIATGGAVFGEEGLTLNLEDVQPHDLGK	2807	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=5706	31.115702	3	3095.500372	3096.507381	K	V	315	345
PSM	DMAIATGGAVFGEEGLTLNLEDVQPHDLGK	2808	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=2979	16.15668	3	3098.503014	3096.507381	K	V	315	345
PSM	DMAIATGGAVFGEEGLTLNLEDVQPHDLGK	2809	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=3602	19.562773	3	3097.515270	3096.507381	K	V	315	345
PSM	GILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVK	2810	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=5115	27.862523	4	4035.889222	4035.887504	K	L	272	310
PSM	GILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVK	2811	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=5890	32.158792	4	4036.894371	4035.887504	K	L	272	310
PSM	GLYGIKDDVFLSVPCILGQNGISDLVK	2812	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27	15-UNIMOD:4	ms_run[1]:scan=7405	40.622169	3	2920.554926	2919.541582	K	V	279	306
PSM	VTPQSLFILFGVYGDVQR	2813	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=839	4.5590534	3	2038.089261	2038.088763	R	V	349	367
PSM	IGYNPDTVAFVPISGWNGDNMLEPSANMPWFK	2814	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=2305	12.491513	4	3566.666439	3566.663898	K	G	181	213
PSM	GIEGVQVIPLIPGAGEIIIADNIIK	2815	sp|P28288|ABCD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=2822	15.294892	2	2542.479701	2541.478176	K	F	417	442
PSM	NYVLQTLGTETYRPSSASQCVAGIACAEIPVNQWPELIPQLVANVTNPNSTEHMK	2816	sp|Q14974|IMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27	20-UNIMOD:4,26-UNIMOD:4	ms_run[1]:scan=4565	24.828044	5	6095.9771	6095.9814	K	E	93	148
PSM	LLQDSVDFSLADAINTEFK	2817	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=8095	44.464889	2	2125.067722	2125.057916	R	N	79	98
PSM	EVAAFAQFGSDLDAATQQLLSR	2818	sp|P25705|ATPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=2569	13.911829	3	2337.162696	2337.160090	R	G	442	464
PSM	GTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVK	2819	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=4774	25.955709	3	4147.984029	4147.984364	K	S	287	323
PSM	LLQDSVDFSLADAINTEFK	2820	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=8700	47.899343	2	2125.073783	2125.057916	R	N	79	98
PSM	MVNPTVFFDIAVDGEPLGR	2821	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=5657	30.846164	2	2134.0302	2134.0402	-	V	1	20
PSM	CLGIPNTAHFANVTQIEDAVSLWAK	2822	sp|Q12874|SF3A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=4760	25.876437	3	2738.3642	2737.3532	R	L	437	462
PSM	HLVFPLLEFLSVK	2823	sp|P60228|EIF3E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=821	4.4567074	2	1540.902487	1540.901737	R	E	17	30
PSM	HLVFPLLEFLSVK	2824	sp|P60228|EIF3E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=381	2.0977522	2	1540.902487	1540.901737	R	E	17	30
PSM	AEYLASIFGTEK	2825	sp|Q01081|U2AF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:1	ms_run[1]:scan=1436	7.7769342	2	1369.6776	1369.6760	M	D	2	14
PSM	AEYLASIFGTEK	2826	sp|Q01081|U2AF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:1	ms_run[1]:scan=1635	8.8801743	2	1369.6776	1369.6760	M	D	2	14
PSM	DGTVLCELINALYPEGQAPVK	2827	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27	6-UNIMOD:4	ms_run[1]:scan=7011	38.422593	3	2286.158679	2286.156584	K	K	58	79
PSM	QVDLENVWLHFIR	2828	sp|O00469|PLOD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:28	ms_run[1]:scan=3780	20.516032	2	1650.8538	1650.8513	K	E	615	628
PSM	TGKPLSVELGPGIMGAIFDGIQRPLSDISSQTQSIYIPR	2829	sp|P38606|VATA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27		ms_run[1]:scan=3759	20.401611	5	4143.1922	4141.1872	R	G	82	121
PSM	QICLVMLETLSQSPQGR	2830	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:28,3-UNIMOD:4	ms_run[1]:scan=1653	8.9779368	2	1942.9702	1941.9642	K	V	161	178
PSM	LAPPLVTLLSAEPELQYVALR	2831	sp|Q10567|AP1B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=4189	22.772064	3	2293.314654	2292.309320	K	N	284	305
PSM	ASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGK	2832	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27	45-UNIMOD:4,48-UNIMOD:4	ms_run[1]:scan=4411	24.013227	6	5806.8886	5806.8792	R	I	13	68
PSM	DIEQVPQQPTYVQALFDFDPQEDGELGFR	2833	sp|P62993|GRB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=2746	14.887021	3	3380.585859	3380.583717	R	R	150	179
PSM	ALALAALAAVEPACGSR	2834	sp|Q9BT67|NFIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:1,14-UNIMOD:4	ms_run[1]:scan=4471	24.327571	2	1681.8842	1681.8816	M	Y	2	19
PSM	ALALAALAAVEPACGSR	2835	sp|Q9BT67|NFIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:1,14-UNIMOD:4	ms_run[1]:scan=4678	25.44089	2	1681.8842	1681.8816	M	Y	2	19
PSM	QLEADILDVNQIFK	2836	sp|Q86Y82|STX12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:28	ms_run[1]:scan=1628	8.8422283	2	1627.8500	1627.8452	R	D	190	204
PSM	QQWQQLYDTLNAWK	2837	sp|Q7L2H7|EIF3M_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:28	ms_run[1]:scan=1738	9.4502975	2	1803.8573	1803.8575	K	Q	345	359
PSM	EISYLESEMYQLSHLLTEQK	2838	sp|Q8IYI6|EXOC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=473	2.5687712	3	2440.187199	2440.183193	R	S	76	96
PSM	GLPQLGTLGAGNHYAEIQVVDEIFNEYAAK	2839	sp|Q9Y3I0|RTCB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=988	5.3237454	3	3217.595895	3216.609144	R	K	215	245
PSM	VDNMIIQSISLLDQLDK	2840	sp|O00567|NOP56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=4977	27.073016	2	1944.026899	1944.023779	R	D	164	181
PSM	AATLLDEDIWEEIQMFR	2841	sp|Q2TBE0|C19L2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=5004	27.225623	2	2080.004001	2078.998293	R	K	721	738
PSM	SAEHTLVDMVQLLFTR	2842	sp|Q92538|GBF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=3768	20.448678	2	1857.958417	1858.961119	K	L	180	196
PSM	GVPQIEVTFEIDVNGILR	2843	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=8102	44.506158	2	1999.065159	1998.078592	R	V	493	511
PSM	AALSALESFLKQVSNMVAK	2844	sp|P78527-2|PRKDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7105	38.944	3	2006.087	2006.0870	K	N	311	330
PSM	AFYAELYHIISSNLEKIVNPK	2845	sp|Q9UL46|PSME2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5936	32.421	3	2448.3053	2448.3053	R	G	211	232
PSM	ALSIPPNIDVLLCEQEVVADETPAVQAVLR	2846	sp|Q8NE71-2|ABCF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26	13-UNIMOD:4	ms_run[2]:scan=3350	18.17	3	3258.717	3258.7170	R	A	315	345
PSM	ANLINNIFELAGLGK	2847	sp|Q9UIQ6-3|LCAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=1933	10.449	2	1585.8828	1585.8828	R	V	710	725
PSM	AQLGVQAFADALLIIPK	2848	sp|P40227-2|TCPZ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=527	2.8383	2	1767.0295	1767.0295	R	V	388	405
PSM	ATSPADALQYLLQFAR	2849	sp|Q96HW7-2|INT4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5066	27.58	2	1763.9206	1763.9206	K	K	46	62
PSM	AYHEQLSVAEITNACFEPANQMVK	2850	sp|P68363-2|TBA1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26	15-UNIMOD:4	ms_run[2]:scan=6896	37.764	3	2749.284	2749.2840	K	C	165	189
PSM	CDAIVDLIHDIQIVSTTR	2851	sp|Q8TEM1-2|PO210_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:4	ms_run[2]:scan=3484	18.913	3	2068.0623	2068.0623	R	E	109	127
PSM	DALEFWLQAGVDGFQVR	2852	sp|P08195-2|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5555	30.299	2	1949.9636	1949.9636	K	D	231	248
PSM	DGYIMMFNYLPITFGDK	2853	sp|Q92616|GCN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=4174	22.688	2	2023.9424	2023.9424	R	F	1754	1771
PSM	DKEQSSVLITLLLPFLHR	2854	sp|O75691|UTP20_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=3242	17.575	3	2108.1994	2108.1994	K	G	1345	1363
PSM	DMAIATGGAVFGEEGLTLNLEDVQPHDLGK	2855	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=8166	44.858	3	3096.5074	3096.5074	K	V	315	345
PSM	DMTEFFTDLITK	2856	sp|Q70CQ2-3|UBP34_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=2024	10.951	2	1459.6905	1459.6905	K	I	1827	1839
PSM	ECANGYLELLDHVLLTLQKPSPELK	2857	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26	2-UNIMOD:4	ms_run[2]:scan=3243	17.581	3	2879.5103	2879.5103	R	Q	2242	2267
PSM	EIYDDSFIRPVTFWIVGDFDSPSGR	2858	sp|Q9NYU2-2|UGGG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=2689	14.564	3	2917.3923	2917.3923	K	Q	727	752
PSM	EMYTLGITNFPIPGEPGFPLNAIYAK	2859	sp|O15145|ARPC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=1265	6.8676	3	2852.4459	2852.4459	K	P	94	120
PSM	ENAPAIIFIDEIDAIATKR	2860	sp|P43686-2|PRS6B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=1723	9.3696	3	2099.1263	2099.1263	K	F	225	244
PSM	EQNSALPTSSQDEELMEVVEKSEEPAGQILSHLSSELK	2861	sp|Q9UQ35-2|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=2343	12.701	4	4168.0005	4168.0005	K	E	1224	1262
PSM	ESDDPMAYIHFTAEGEVTFK	2862	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7115	39	3	2286.0151	2286.0151	K	S	365	385
PSM	ESEIIDFFLGASLK	2863	sp|P15880|RS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=1119	6.0534	2	1567.8134	1567.8134	K	D	90	104
PSM	ESEIIDFFLGASLKDEVLK	2864	sp|P15880|RS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=737	3.9944	3	2152.1304	2152.1304	K	I	90	109
PSM	FGAQNESLLPSILVLLQR	2865	sp|Q9UBF2-2|COPG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=3384	18.354	3	1997.131	1997.1310	K	C	498	516
PSM	FIEAEQVPELEAVLHLVIASSDTR	2866	sp|Q5VYK3|ECM29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6765	37.018	3	2665.3963	2665.3963	K	H	250	274
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	2867	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26	27-UNIMOD:4	ms_run[2]:scan=8268	45.434	3	3512.6956	3512.6956	R	R	85	117
PSM	GDLLIDIGSGPTIYQLLSACESFK	2868	sp|P40261|NNMT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26	20-UNIMOD:4	ms_run[2]:scan=5015	27.288	3	2596.3095	2596.3095	K	E	56	80
PSM	GFQQILAGEYDHLPEQAFYMVGPIEEAVAK	2869	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=2748	14.898	4	3349.6329	3349.6329	K	A	490	520
PSM	GGLGGGYGGASGMGGITAVTVNQSLLSPLVLEVDPNIQAVR	2870	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=806	4.3736	3	3924.0415	3924.0415	R	T	48	89
PSM	GLPFQANAQDIINFFAPLKPVR	2871	sp|Q12849|GRSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=3043	16.506	4	2455.3376	2455.3376	R	I	407	429
PSM	GSTLPDVTEVSTFFPFHEYFANAPQPIFK	2872	sp|O60306|AQR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=1534	8.3043	3	3285.6023	3285.6023	K	G	955	984
PSM	GTLDALLAGERDPWTVSSEGVHTVDQVLSEVSR	2873	sp|P0DPD7|EFMT4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=1646	8.9385	3	3522.7591	3522.7591	K	V	131	164
PSM	GVPQIEVTFEIDVNGILR	2874	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=8504	46.778	2	1998.0786	1998.0786	R	V	493	511
PSM	GWPWLLPDGSPVDIFAK	2875	sp|Q6P1J9|CDC73_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=2496	13.506	2	1896.9774	1896.9774	K	I	456	473
PSM	HLVFPLLEFLSVK	2876	sp|P60228|EIF3E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=493	2.6637	3	1540.9017	1540.9017	R	E	17	30
PSM	HLVFPLLEFLSVK	2877	sp|P60228|EIF3E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=711	3.8438	3	1540.9017	1540.9017	R	E	17	30
PSM	IDVIDWLVFDPAQR	2878	sp|P57740-3|NU107_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=578	3.1129	3	1685.8777	1685.8777	K	A	433	447
PSM	IIDFLSALEGFK	2879	sp|P52701-4|MSH6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=197	1.0828	2	1351.7388	1351.7388	K	V	553	565
PSM	ILQMEEEYIQQLCEDIIQLKPDVVITEK	2880	sp|P49368-2|TCPG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=3704	20.099	3	3432.7408	3432.7408	R	G	229	257
PSM	ILSISADIETIGEILK	2881	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=2046	11.073	3	1713.9764	1713.9764	R	K	87	103
PSM	ILSISADIETIGEILK	2882	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=2152	11.657	3	1713.9764	1713.9764	R	K	87	103
PSM	IQVIDISMILAEAIR	2883	sp|P60891-2|PRPS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6944	38.039	2	1683.9593	1683.9593	K	R	220	235
PSM	ISTSLNPGNPVNNQIFLQEYVANLLK	2884	sp|O14980|XPO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=206	1.1304	2	2885.5287	2885.5287	K	S	958	984
PSM	ISTYSTIAIPSIEAIAELPLDYK	2885	sp|Q5TFE4|NT5D1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=1881	10.188	2	2507.3411	2507.3411	R	F	402	425
PSM	LCYVALDFEQEMATAASSSSLEK	2886	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26	2-UNIMOD:4	ms_run[2]:scan=4520	24.587	2	2549.1666	2549.1666	K	S	216	239
PSM	LCYVALDFEQEMATAASSSSLEK	2887	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26	2-UNIMOD:4	ms_run[2]:scan=2156	11.679	3	2549.1666	2549.1666	K	S	216	239
PSM	LKEDGDYQLPVVVLMLNLPR	2888	sp|Q99797|MIPEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=1609	8.7332	3	2311.261	2311.2610	R	S	457	477
PSM	LLIVSNPVDILTYVAWK	2889	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5274	28.73	2	1943.1132	1943.1132	K	I	133	150
PSM	LNDTLLLGPDPLGNFLSIAVK	2890	sp|O00178|GTPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6397	34.954	2	2209.2358	2209.2358	K	S	423	444
PSM	LQEDPPAGVSGAPSENNIMVWNAVIFGPEGTPFEDGTFK	2891	sp|P49459|UBE2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=1802	9.7905	3	4116.9415	4116.9415	R	L	16	55
PSM	LVQLVYFLPSLPADLLSR	2892	sp|Q9NXF1-2|TEX10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6757	36.971	2	2043.1768	2043.1768	R	L	621	639
PSM	MILELFSKVPSLVGSFIR	2893	sp|P78417-3|GSTO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5946	32.47	3	2035.154	2035.1540	K	S	87	105
PSM	NAATEDLWESLENASGKPIAAVMNTWTK	2894	sp|P55786-2|PSA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=548	2.9527	4	3046.4706	3046.4706	K	Q	392	420
PSM	NAVLFEAISLIIHHDSEPNLLVR	2895	sp|O94973-3|AP2A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=1617	8.7804	4	2599.4122	2599.4122	K	A	307	330
PSM	NEILTAILASLTAR	2896	sp|Q9C0B1|FTO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=4177	22.705	3	1484.8562	1484.8562	R	Q	432	446
PSM	NGLSAWELIELIGNGQFSK	2897	sp|Q9UH65|SWP70_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=3013	16.34	3	2075.0688	2075.0688	K	G	171	190
PSM	NGQVELNEFLQLMSAIQK	2898	sp|P43304-2|GPDM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=1558	8.4422	3	2061.0565	2061.0565	K	G	550	568
PSM	NHLVTLPEAIHFLTEIEVLDVR	2899	sp|Q13045-2|FLII_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5302	28.888	3	2557.3904	2557.3904	K	E	296	318
PSM	NLEVLNFFNNQIEELPTQISSLQK	2900	sp|Q15404|RSU1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=3046	16.523	2	2817.4549	2817.4549	K	L	64	88
PSM	NPEEAELEDTLNQVMVVFK	2901	sp|Q13616|CUL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=4715	25.64	2	2204.0671	2204.0671	K	Y	436	455
PSM	QATTIIADNIIFLSDQTK	2902	sp|Q04837|SSBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=2035	11.008	2	1991.0575	1991.0575	R	E	128	146
PSM	QDFDEDDILKELEELSLEAQGIK	2903	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6727	36.797	3	2676.3018	2676.3018	K	A	51	74
PSM	QGFGELLQAVPLADSFR	2904	sp|P27695|APEX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6175	33.744	2	1846.9577	1846.9577	R	H	238	255
PSM	QQDAQEFFLHLINMVER	2905	sp|P45974-2|UBP5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=3409	18.491	3	2117.0364	2117.0364	R	N	433	450
PSM	QVVIDGETCLLDILDTAGQEEYSAMR	2906	sp|P01112-2|RASH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26	9-UNIMOD:4	ms_run[2]:scan=4583	24.925	2	2925.3736	2925.3736	K	D	43	69
PSM	SFAPILPHLAEEVFQHIPYIK	2907	sp|Q9NSE4|SYIM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=2018	10.915	4	2448.3206	2448.3206	R	E	833	854
PSM	SLSGLLPAQTSLEYALLDAVTQQEK	2908	sp|Q8NBF2|NHLC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=2581	13.972	3	2674.4065	2674.4065	R	D	10	35
PSM	SNLMDAISFVLGEK	2909	sp|Q14683|SMC1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=4762	25.886	2	1522.7701	1522.7701	K	T	39	53
PSM	SNLMDAISFVLGEK	2910	sp|Q14683|SMC1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=4864	26.433	2	1522.7701	1522.7701	K	T	39	53
PSM	SQVLDYLSYAVFQLGDLHR	2911	sp|O15460-2|P4HA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=2865	15.521	3	2223.1324	2223.1324	K	A	207	226
PSM	STAISLFYELSENDLNFIK	2912	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=3473	18.854	3	2203.1049	2203.1049	K	Q	72	91
PSM	STAPLLDVFSSMLK	2913	sp|Q9BTC0|DIDO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=1834	9.9513	2	1507.7956	1507.7956	K	D	825	839
PSM	TDVNKIEEFLEEVLCPPK	2914	sp|Q9Y696|CLIC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26	15-UNIMOD:4	ms_run[2]:scan=5728	31.24	2	2159.082	2159.0820	K	Y	86	104
PSM	TECALLGLLLDLK	2915	sp|P20020-5|AT2B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:4	ms_run[2]:scan=1471	7.9659	2	1457.8164	1457.8164	K	R	545	558
PSM	TGAFALPILNALLETPQR	2916	sp|Q9H0S4-2|DDX47_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5461	29.777	2	1924.0782	1924.0782	K	L	75	93
PSM	THINIVVIGHVDSGK	2917	sp|P68104-2|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7137	39.123	3	1587.8733	1587.8733	K	S	6	21
PSM	THINIVVIGHVDSGK	2918	sp|P68104-2|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7257	39.793	3	1587.8733	1587.8733	K	S	6	21
PSM	TITDVINIGIGGSDLGPLMVTEALKPYSSGGPR	2919	sp|P06744|G6PI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=934	5.0643	3	3327.7384	3327.7384	K	V	148	181
PSM	TLSAISSSTDPTSYDGFGPFMPGFDIIPYNDLPALER	2920	sp|P04181-2|OAT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7194	39.443	3	3990.8874	3990.8874	R	A	43	80
PSM	TLSSSTQASIEIDSLYEGIDFYTSITR	2921	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=4751	25.83	3	2996.4502	2996.4502	R	A	273	300
PSM	TLSSSTQASIEIDSLYEGIDFYTSITR	2922	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5190	28.279	3	2996.4502	2996.4502	R	A	273	300
PSM	TVTVWELISSEYFTAEQR	2923	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=868	4.7084	3	2158.0582	2158.0582	R	Q	3218	3236
PSM	VFIMDSCDELIPEYLNFIR	2924	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:35,7-UNIMOD:4	ms_run[2]:scan=1919	10.377	3	2389.1334	2389.1334	R	G	360	379
PSM	VNMPPAVDPAEFFVLMER	2925	sp|Q9BYN8|RT26_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=274	1.505	2	2061.0064	2061.0064	R	Y	42	60
PSM	VNMPPAVDPAEFFVLMER	2926	sp|Q9BYN8|RT26_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=436	2.3842	2	2061.0064	2061.0064	R	Y	42	60
PSM	VQLAEPDLEQAAHLIQALSNHEDVIHVYDNIE	2927	sp|Q9BSH4|TACO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=362	1.997	4	3622.7904	3622.7904	K	-	266	298
PSM	VSVEDFLTDLNNFR	2928	sp|Q9NSV4-1|DIAP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=810	4.396	2	1667.8155	1667.8155	K	T	729	743
PSM	VVPSDLYPLVLGFLR	2929	sp|Q14978-3|NOLC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6639	36.304	2	1686.9709	1686.9709	R	D	9	24
PSM	VWVNGNKPGFIQFLGETQFAPGQWAGIVLDEPIGK	2930	sp|P30622-2|CLIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=1991	10.775	3	3811.9726	3811.9726	R	N	64	99
PSM	WLQDVFNVPLVIQMTDDEK	2931	sp|P23381-2|SYWC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=1417	7.6834	2	2289.1351	2289.1351	K	Y	141	160
PSM	YELPLVIQALTNIEDK	2932	sp|Q96QD8-2|S38A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=2220	12.035	2	1858.0088	1858.0088	K	T	71	87
PSM	YLTLDIFAGPPNYPFSDEY	2933	sp|Q04828|AK1C1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5208	28.37	2	2221.0256	2221.0256	R	-	305	324
PSM	YNLPESAPLIYNSFAQFLVK	2934	sp|Q5TFE4|NT5D1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=2671	14.466	2	2313.2045	2313.2045	R	E	24	44
PSM	YQTFLQLLYTLQGK	2935	sp|O95229|ZWINT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=1237	6.7078	2	1714.9294	1714.9294	R	L	209	223
PSM	DFSAFINLVEFCR	2936	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26	12-UNIMOD:4	ms_run[1]:scan=2645	14.321273	2	1616.767934	1616.765714	K	E	619	632
PSM	LCYVALDFEQEMATAASSSSLEK	2937	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26	2-UNIMOD:4	ms_run[1]:scan=6585	36.021637	3	2550.166548	2549.166557	K	S	216	239
PSM	DLVVLLFETALLSSGFSLEDPQTHSNR	2938	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=8705	47.927422	3	2987.535915	2987.524017	K	I	653	680
PSM	DMAIATGGAVFGEEGLTLNLEDVQPHDLGK	2939	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=6608	36.143698	3	3097.509018	3096.507381	K	V	315	345
PSM	SGETEDTFIADLVVGLCTGQIK	2940	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26	17-UNIMOD:4	ms_run[1]:scan=6770	37.043694	2	2353.152923	2352.151893	R	T	373	395
PSM	SGETEDTFIADLVVGLCTGQIK	2941	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26	17-UNIMOD:4	ms_run[1]:scan=8390	46.129174	2	2352.135431	2352.151893	R	T	373	395
PSM	SGETEDTFIADLVVGLCTGQIK	2942	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26	17-UNIMOD:4	ms_run[1]:scan=6805	37.243046	2	2352.151436	2352.151893	R	T	373	395
PSM	SGETEDTFIADLVVGLCTGQIK	2943	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26	17-UNIMOD:4	ms_run[1]:scan=8357	45.942473	2	2352.135431	2352.151893	R	T	373	395
PSM	GPAVGIDLGTTYSCVGVFQHGK	2944	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26	14-UNIMOD:4	ms_run[1]:scan=7321	40.150687	3	2263.1152	2262.1102	K	V	4	26
PSM	IGYNPDTVAFVPISGWNGDNMLEPSANMPWFK	2945	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26	21-UNIMOD:35	ms_run[1]:scan=2332	12.644295	4	3583.691690	3582.658813	K	G	181	213
PSM	MEYEWKPDEQGLQQILQLLK	2946	sp|Q92973-2|TNPO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=6280	34.312134	2	2546.2794	2546.2722	-	E	1	21
PSM	TVDLQDAEEAVELVQYAYFK	2947	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=4637	25.216861	2	2330.134345	2330.131809	K	K	636	656
PSM	LSPHFPHTAALDQAVGAAVTSMGPEVVLQAVPLEIDGSEETLDFPR	2948	sp|Q5JTH9|RRP12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1593	8.6403845	5	4811.426205	4811.411637	R	S	521	567
PSM	FQDTAEALAAFTALMEGK	2949	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1625	8.8230534	3	1912.925454	1912.924065	K	I	50	68
PSM	ASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGK	2950	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26	45-UNIMOD:4,48-UNIMOD:4	ms_run[1]:scan=4889	26.57592	4	5806.8709	5806.8792	R	I	13	68
PSM	AEEGIAAGGVMDVNTALQEVLK	2951	sp|P25398|RS12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:1	ms_run[1]:scan=4990	27.148689	3	2257.1372	2256.1302	M	T	2	24
PSM	FGVEQDVDMVFASFIR	2952	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=6626	36.234829	2	1858.891849	1858.892371	K	K	231	247
PSM	FGVEQDVDMVFASFIR	2953	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26	9-UNIMOD:35	ms_run[1]:scan=923	5.0046974	3	1874.887786	1874.887286	K	K	231	247
PSM	KLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTALPDEDDDL	2954	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26	13-UNIMOD:35,23-UNIMOD:35	ms_run[1]:scan=1741	9.4669891	4	5419.6342	5418.6042	R	-	167	217
PSM	ASPESQEPLIQLVQAFVR	2955	sp|Q5SRE5|NU188_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=6025	32.896957	2	2011.078187	2011.073841	K	H	1728	1746
PSM	FFPEDVSEELIQEITQR	2956	sp|P35241|RADI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=4020	21.857812	3	2079.017437	2079.016051	K	L	84	101
PSM	SLYALFSQFGHVVDIVALK	2957	sp|P08579|RU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=5228	28.471669	3	2106.155188	2106.151363	R	T	26	45
PSM	GVPQIEVTFEIDVNGILR	2958	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=8280	45.504002	2	1998.062107	1998.078592	R	V	493	511
PSM	MNAPPAFESFLLFEGEK	2959	sp|P52435|RPB11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:1	ms_run[1]:scan=5378	29.314515	2	1967.9342	1967.9334	-	K	1	18
PSM	CGGLPNNIVDVWEFLGKPK	2960	sp|O95551|TYDP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=2551	13.821933	2	2125.0673	2125.0661	R	H	273	292
PSM	QTYFLPVIGLVDAEK	2961	sp|P17980|PRS6A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:28	ms_run[1]:scan=4923	26.76471	2	1674.8882	1674.8864	R	L	130	145
PSM	GVPQIEVTFDIDANGILNVTATDK	2962	sp|P0DMV8|HS71A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=7333	40.217704	2	2529.285126	2529.296249	R	S	470	494
PSM	ESLVLPIYEGIPVLNCWGALPLGGK	2963	sp|Q9NZ32|ARP10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26	16-UNIMOD:4	ms_run[1]:scan=6547	35.806404	3	2695.450509	2694.445496	R	A	145	170
PSM	DYCWEYFLSSNTLQMLHNMK	2964	sp|Q9H2U1|DHX36_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26	3-UNIMOD:4	ms_run[1]:scan=268	1.4712061	3	2580.1622	2579.1282	K	G	779	799
PSM	QMQLENVSVALEFLDR	2965	sp|P21333|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=6244	34.112907	2	1889.959931	1890.950948	R	E	101	117
PSM	NLILFLGDGLGVPTVTATR	2966	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=5835	31.849294	2	1957.090547	1956.104413	K	I	54	73
PSM	LQLYDLASGNLLETIDAHDGALWSMSLSPDQR	2967	sp|Q9UNX4|WDR3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=3645	19.795892	3	3529.722218	3528.719499	K	G	478	510
PSM	QGLNGVPILSEEELSLLDEFYK	2968	sp|Q14444|CAPR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=5922	32.343084	2	2493.251721	2492.268637	K	L	170	192
PSM	AFADALEVIPMALSENSGMNPIQTMTEVR	2969	sp|P48643-2|TCPE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25	19-UNIMOD:35	ms_run[2]:scan=2638	14.282	3	3150.5036	3150.5036	R	A	357	386
PSM	ALDLFSDNAPPPELLEIINEDIAK	2970	sp|Q15084-3|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6563	35.895	2	2636.3585	2636.3585	R	R	262	286
PSM	AMPLPEEVTQILEENSDLIR	2971	sp|Q7Z2Z2-2|EFL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=2777	15.053	2	2296.1621	2296.1621	R	S	704	724
PSM	AQLGVQAFADALLIIPK	2972	sp|P40227-2|TCPZ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=714	3.8607	2	1767.0295	1767.0295	R	V	388	405
PSM	ATEPQMVLFNLYDDWLK	2973	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5540	30.213	3	2082.0132	2082.0132	K	T	1909	1926
PSM	AVLAPLIALVYSVPR	2974	sp|Q9Y320-2|TMX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=2016	10.904	3	1580.9654	1580.9654	M	L	2	17
PSM	AVSPELFHVIDDFVQFQLEK	2975	sp|Q9UPY3-3|DICER_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5429	29.595	3	2360.2052	2360.2052	K	N	658	678
PSM	AYVLGSPALAAELEAVGVASVGVGPEPLQGEGPGDWLHAPLEPDVR	2976	sp|A6NDG6|PGP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5245	28.564	4	4589.3442	4589.3442	K	A	121	167
PSM	CILVITWIQHLIPK	2977	sp|Q9UL46|PSME2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:4	ms_run[2]:scan=4018	21.847	2	1733.0062	1733.0062	K	I	118	132
PSM	CILVITWIQHLIPK	2978	sp|Q9UL46|PSME2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:4	ms_run[2]:scan=4077	22.168	3	1733.0062	1733.0062	K	I	118	132
PSM	DFSWSPGGNIIAFWVPEDK	2979	sp|P55884|EIF3B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4185	22.75	2	2164.0266	2164.0266	K	D	469	488
PSM	DLADELALVDVIEDKLK	2980	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=1127	6.0971	3	1898.0248	1898.0248	K	G	43	60
PSM	DLGMMIHEQGDVIDSIEANVENAEVHVQQANQQLSR	2981	sp|O15400-2|STX7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5214	28.404	4	4016.8956	4016.8956	K	A	191	227
PSM	DQVAYLIQQNVIPPFCNLLTVK	2982	sp|O00629|IMA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25	16-UNIMOD:4	ms_run[2]:scan=659	3.5605	3	2572.3723	2572.3723	K	D	402	424
PSM	DVPVAEEVSALFAGELNPVAPK	2983	sp|O14617-3|AP3D1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4614	25.091	3	2251.1736	2251.1736	K	A	420	442
PSM	EIVDSYLPVILDIIK	2984	sp|P07602|SAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6924	37.924	2	1728.9913	1728.9913	K	G	108	123
PSM	EMYTLGITNFPIPGEPGFPLNAIYAK	2985	sp|O15145|ARPC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=1153	6.2434	3	2852.4459	2852.4459	K	P	94	120
PSM	ENILHVSENVIFTDVNSILR	2986	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=1560	8.4534	2	2311.2172	2311.2172	K	Y	37	57
PSM	EQNILAQVFGILK	2987	sp|Q14571|ITPR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=1402	7.603	2	1471.8399	1471.8399	R	A	511	524
PSM	ESLQSVDVLREEVSEILDEMSHK	2988	sp|O15228-2|GNPAT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=3711	20.138	4	2671.3011	2671.3011	K	L	30	53
PSM	FAINFFTSIGLGGLTDELREHLK	2989	sp|Q9HCG8|CWC22_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=1678	9.121	4	2577.3591	2577.3591	R	N	626	649
PSM	FDQFDFLIDIVPR	2990	sp|Q13952-4|NFYC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=1901	10.284	2	1623.8297	1623.8297	K	D	70	83
PSM	FFPEDVSEELIQEITQR	2991	sp|P35241-3|RADI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4356	23.706	2	2079.0161	2079.0161	K	L	52	69
PSM	FLLTGLLSGLPAPQFAIR	2992	sp|Q9BZH6|WDR11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=2319	12.569	2	1913.1139	1913.1139	K	M	454	472
PSM	FPNGVQLSPAEDFVLVAETTMAR	2993	sp|Q9HDC9-2|APMAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=3625	19.687	3	2491.2417	2491.2417	R	I	258	281
PSM	FQDADPLEQDELHTFTDTMLPGCFHLLDELPDTVYR	2994	sp|Q7Z6Z7-2|HUWE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25	23-UNIMOD:4	ms_run[2]:scan=1990	10.767	4	4277.9562	4277.9562	K	V	1425	1461
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	2995	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25	13-UNIMOD:4,27-UNIMOD:4	ms_run[2]:scan=8701	47.905	3	3585.6942	3585.6942	R	R	85	117
PSM	FSSAVGLVTIVECCPVLLGPPLLGR	2996	sp|P53985|MOT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25	13-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=2288	12.407	3	2653.4336	2653.4336	R	L	387	412
PSM	GDLENAFLNLVQCIQNK	2997	sp|P07355|ANXA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25	13-UNIMOD:4	ms_run[2]:scan=3515	19.086	2	1974.9833	1974.9833	K	P	250	267
PSM	GNGPLPLGGSGLMEEMSALLAR	2998	sp|Q8N8S7-3|ENAH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=2571	13.923	3	2169.0922	2169.0922	R	R	396	418
PSM	GSIPTDVEVLPTETEIHNEPFLTLWLTQVER	2999	sp|P46013|KI67_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=525	2.8271	3	3562.8195	3562.8195	R	K	424	455
PSM	HLVFPLLEFLSVK	3000	sp|P60228|EIF3E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=385	2.1202	3	1540.9017	1540.9017	R	E	17	30
PSM	HLVFPLLEFLSVK	3001	sp|P60228|EIF3E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=605	3.26	3	1540.9017	1540.9017	R	E	17	30
PSM	IDDILQTLLDATYK	3002	sp|Q16850-2|CP51A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=867	4.7028	3	1620.8611	1620.8611	K	D	179	193
PSM	IDLRPVLGEGVPILASFLR	3003	sp|Q86VP6-2|CAND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5276	28.741	3	2064.2095	2064.2095	K	K	474	493
PSM	ISFDEFVYIFQEVK	3004	sp|P13797-3|PLST_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=3837	20.838	2	1762.8818	1762.8818	K	S	27	41
PSM	LCYVALDFEQEMATAASSSSLEK	3005	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25	2-UNIMOD:4	ms_run[2]:scan=5595	30.513	2	2549.1666	2549.1666	K	S	216	239
PSM	LDTMNTTCVDRFINWFSHHLSNFQFR	3006	sp|Q09161|NCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25	8-UNIMOD:4	ms_run[2]:scan=2801	15.19	5	3285.5237	3285.5237	R	W	402	428
PSM	LGFSEVELVQMVVDGVK	3007	sp|P12277|KCRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=713	3.855	3	1847.9703	1847.9703	R	L	342	359
PSM	LKGYTSWAIGLSVADLAESIMK	3008	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4050	22.021	3	2352.2399	2352.2399	K	N	244	266
PSM	LNYAQWYPIVVFLNPDSK	3009	sp|Q07157-2|ZO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=2306	12.497	3	2166.115	2166.1150	R	Q	716	734
PSM	LTLLSLLHMPFTIAAEK	3010	sp|Q03519-2|TAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=658	3.5549	3	1897.0747	1897.0747	R	V	292	309
PSM	LVFCLLELLSR	3011	sp|Q8TEQ6|GEMI5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25	4-UNIMOD:4	ms_run[2]:scan=1724	9.3752	2	1361.7741	1361.7741	R	H	1119	1130
PSM	NANELSVLKDEVLEVLEDGR	3012	sp|Q9H6S3-2|ES8L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=1670	9.0761	3	2241.1489	2241.1489	R	Q	119	139
PSM	NDSIIVDIFHGLFK	3013	sp|Q9Y4E8-2|UBP15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=3815	20.715	2	1616.8562	1616.8562	R	S	401	415
PSM	NLDPFLLFDEFK	3014	sp|O00625|PIR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=2555	13.84	2	1496.7551	1496.7551	K	G	35	47
PSM	NLVTEVLGALEAK	3015	sp|Q96HR9-2|REEP6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=3988	21.688	2	1355.766	1355.7660	R	T	16	29
PSM	NNSNDIVNAIMELTM	3016	sp|Q13765|NACA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25	15-UNIMOD:35	ms_run[2]:scan=4253	23.124	2	1693.7651	1693.7651	K	-	201	216
PSM	NQEDLLSEFGQFLPDANSSVLLSK	3017	sp|Q96ST3|SIN3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=2087	11.306	2	2650.3126	2650.3126	K	T	368	392
PSM	NVITEPIYPEVVHMFAVNMFR	3018	sp|Q13362-2|2A5G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=997	5.3718	3	2505.2549	2505.2549	R	T	85	106
PSM	QDMPSEDVVSLQVSLINLAMK	3019	sp|Q96QK1|VPS35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=844	4.586	2	2316.1705	2316.1705	R	C	340	361
PSM	QEGCQDIATQLISNMDIDVILGGGR	3020	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25	4-UNIMOD:4	ms_run[2]:scan=4605	25.043	2	2702.3004	2702.3004	R	K	199	224
PSM	QLEGDCCSFITQLVNHFWK	3021	sp|Q5T4S7-3|UBR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25	6-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=2363	12.801	3	2381.0933	2381.0933	K	L	2624	2643
PSM	QMEQISQFLQAAER	3022	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=752	4.0716	2	1677.8145	1677.8145	K	Y	89	103
PSM	SLGPDVPELIILPVYSALPSEMQTR	3023	sp|Q14562|DHX8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=1141	6.1733	3	2724.4408	2724.4408	K	I	799	824
PSM	SLSLNPFLWSPFESLCEIGEKPDPDQTFK	3024	sp|P30260|CDC27_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25	16-UNIMOD:4	ms_run[2]:scan=4075	22.157	3	3380.6275	3380.6275	K	F	141	170
PSM	SNLMDAISFVLGEK	3025	sp|Q14683|SMC1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4780	25.987	3	1522.7701	1522.7701	K	T	39	53
PSM	SNVIDSMLFVFGYR	3026	sp|Q9NTJ3-2|SMC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4883	26.54	2	1646.8127	1646.8127	K	A	120	134
PSM	SQVVIPILQWAIASTTLDHR	3027	sp|Q9Y5L0-5|TNPO3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=3971	21.597	2	2247.2376	2247.2376	R	D	706	726
PSM	SVEQTLLPLVSQITTLINHK	3028	sp|Q9UBT7-3|CTNL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5593	30.502	3	2233.2682	2233.2682	R	D	36	56
PSM	TASPLEHILQTLFGK	3029	sp|Q9BTC0|DIDO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4693	25.521	3	1653.909	1653.9090	K	K	1310	1325
PSM	TFDFWKDIVAAIQHNYK	3030	sp|Q5TFE4|NT5D1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=1252	6.7921	4	2095.0527	2095.0527	K	M	155	172
PSM	TFLVIPELAQELHVWTDK	3031	sp|P49902-2|5NTC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=747	4.0471	2	2138.1412	2138.1412	R	S	339	357
PSM	TGAFSIPVIQIVYETLKDQQEGK	3032	sp|Q92499-2|DDX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6131	33.495	3	2563.3534	2563.3534	K	K	53	76
PSM	TGDVLLAEPADFESLLLSRPVLEGLR	3033	sp|Q9UHI6-2|DDX20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=863	4.6804	3	2809.5226	2809.5226	R	A	53	79
PSM	TLAFLIPAVELIVK	3034	sp|Q9NVP1|DDX18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=3374	18.3	2	1525.9484	1525.9484	K	L	230	244
PSM	TTSGYAGGLSSAYGGLTSPGLSYSLGSSFGSGAGSSSFSR	3035	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7242	39.708	3	3724.7129	3724.7129	K	T	415	455
PSM	VSFANFIQYLLDPHTEK	3036	sp|Q9NRB3|CHSTC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5760	31.421	3	2021.0258	2021.0258	K	L	298	315
PSM	VVPSDLYPLVLGFLR	3037	sp|Q14978-3|NOLC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6330	34.588	3	1686.9709	1686.9709	R	D	9	24
PSM	WALSSLLQQLLK	3038	sp|Q6UWE0-3|LRSM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6858	37.547	2	1398.8235	1398.8235	R	E	89	101
PSM	WLQDVFNVPLVIQMTDDEK	3039	sp|P23381-2|SYWC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=1210	6.5662	2	2289.1351	2289.1351	K	Y	141	160
PSM	YAELLAIIEELGK	3040	sp|O14519-2|CDKA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=3485	18.918	2	1460.8126	1460.8126	K	E	35	48
PSM	YFAGNLASGGAAGATSLCFVYPLDFAR	3041	sp|P12236|ADT3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25	18-UNIMOD:4	ms_run[2]:scan=7367	40.404	2	2795.3377	2795.3377	R	T	112	139
PSM	YLPPATQVVLISATLPHEILEMTNK	3042	sp|P38919|IF4A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=2855	15.465	3	2777.5037	2777.5037	R	F	207	232
PSM	YVELFLNSTAGASGGAYEHR	3043	sp|P31943|HNRH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7136	39.117	3	2141.0178	2141.0178	R	Y	356	376
PSM	YVSEVVIGAPYAVTAELLSHFK	3044	sp|Q99447-2|PCY2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=825	4.4814	3	2392.2678	2392.2678	R	V	202	224
PSM	DGAGFLINLIDSPGHVDFSSEVTAALR	3045	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=8383	46.088363	3	2799.392506	2800.403174	K	V	94	121
PSM	LMEPIYLVEIQCPEQVVGGIYGVLNRK	3046	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25	12-UNIMOD:4	ms_run[1]:scan=2485	13.446158	3	3117.648553	3116.640250	R	R	740	767
PSM	GILEEPLPSTSSEEEDPLAGISLPEGVDPSFLAALPDDIRR	3047	sp|Q7Z6Z7|HUWE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1177	6.3803813	4	4331.195584	4331.169658	R	E	2942	2983
PSM	HNDDEQYAWESSAGGSFTVR	3048	sp|Q14568|HS902_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=7461	40.929948	3	2254.955799	2254.951553	K	T	154	174
PSM	CLELFSELAEDK	3049	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=6340	34.637105	2	1435.6546	1435.6536	K	E	412	424
PSM	ENFIPTIVNFSAEEISDAIR	3050	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=5909	32.270175	3	2264.135350	2264.132478	R	E	3345	3365
PSM	SGETEDTFIADLVVGLCTGQIK	3051	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25	17-UNIMOD:4	ms_run[1]:scan=8097	44.476139	2	2353.137058	2352.151893	R	T	373	395
PSM	SPLMSEFQSQISSNPELAAIFESIQK	3052	sp|Q86VP6|CAND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25	4-UNIMOD:35	ms_run[1]:scan=5428	29.589101	3	2897.4492	2896.4162	K	D	1192	1218
PSM	LIIVSNPVDILTYVAWK	3053	sp|Q9BYZ2|LDH6B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=5327	29.027296	2	1943.115797	1943.113186	K	L	182	199
PSM	TITDVINIGIGGSDLGPLMVTEALKPYSSGGPR	3054	sp|P06744|G6PI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25	19-UNIMOD:35	ms_run[1]:scan=505	2.7234859	3	3343.755161	3343.733358	K	V	148	181
PSM	TFDFWKDIVAAIQHNYK	3055	sp|Q5TFE4|NT5D1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1359	7.3808402	3	2095.052979	2095.052711	K	M	155	172
PSM	LAYVAAGDLAPINAFIGGLAAQEVMK	3056	sp|P22314|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25	25-UNIMOD:35	ms_run[1]:scan=623	3.3601591	3	2619.380781	2618.377811	K	A	386	412
PSM	IECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFK	3057	sp|O75369|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25	3-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=7161	39.256745	4	4503.105909	4502.108655	K	A	1085	1125
PSM	CSGVEHFILEVIGR	3058	sp|Q8NBL1|PGLT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=5503	30.006068	2	1597.7948	1597.7917	R	L	108	122
PSM	VTGEADVEFATHEDAVAAMSK	3059	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=7424	40.728965	3	2177.003986	2176.994664	R	D	327	348
PSM	SLELLPIILTALATKK	3060	sp|Q9NVI1|FANCI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=2936	15.915982	3	1724.090315	1723.085909	K	E	126	142
PSM	EIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSER	3061	sp|Q15293|RCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25		ms_run[1]:scan=6391	34.922374	4	5194.3352	5193.3552	K	E	205	250
PSM	IQHPSNVLHFFNAPLEVTEENFFEICDELGVK	3062	sp|P14866|HNRPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25	26-UNIMOD:4	ms_run[1]:scan=3714	20.154615	4	3771.829563	3771.824299	R	R	496	528
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	3063	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25	27-UNIMOD:4	ms_run[1]:scan=8167	44.863387	3	3511.675944	3512.695593	R	R	85	117
PSM	EIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSER	3064	sp|Q15293|RCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25		ms_run[1]:scan=7253	39.770141	4	5193.3499	5193.3556	K	E	205	250
PSM	EFVEEFIWPAIQSSALYEDR	3065	sp|P00966|ASSY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=442	2.4137461	2	2429.160984	2428.158693	R	Y	67	87
PSM	TVHADLSNYDEDGAWPVLLDEFVEWQK	3066	sp|Q9BTE7|DCNL5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=3687	20.003265	3	3177.475123	3175.477461	R	V	206	233
PSM	KLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTALPDEDDDL	3067	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25	13-UNIMOD:35,23-UNIMOD:35	ms_run[1]:scan=1647	8.9441743	4	5419.6342	5418.6042	R	-	167	217
PSM	AAAEGPVGDGELWQTWLPNHVVFLR	3068	sp|Q99567|NUP88_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:1	ms_run[1]:scan=1682	9.1435013	2	2803.3995	2803.4077	M	L	2	27
PSM	FFPEDVSEELIQEITQR	3069	sp|P35241|RADI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=3399	18.435002	2	2079.017464	2079.016051	K	L	84	101
PSM	GQNLLLTNLQTIQGILER	3070	sp|P12270|TPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=3696	20.056132	2	2023.146018	2023.142589	R	S	811	829
PSM	LSIAEVVHQLQEIAAAR	3071	sp|O14976|GAK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=2691	14.575052	3	1847.028270	1847.026497	R	N	304	321
PSM	TEFLSFMNTELAAFTK	3072	sp|P31949|S10AB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=999	5.3830976	2	1849.899576	1848.896788	K	N	37	53
PSM	VDLITLSYTFFEAK	3073	sp|Q9Y6N1|COX11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=4486	24.405136	2	1646.867459	1645.860326	K	E	252	266
PSM	GPGTSFEFALAIVEALNGKEVAAQVK	3074	sp|Q99497|PARK7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=4557	24.783065	3	2646.396906	2645.406468	R	A	157	183
PSM	VAIDASMSIYQFLIAVR	3075	sp|P39748|FEN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=3278	17.769824	2	1895.030962	1896.017906	K	Q	31	48
PSM	DLVVLLFETALLSSGFSLEDPQTHSNR	3076	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=8177	44.921356	3	2988.501527	2987.524017	K	I	653	680
PSM	IPNFWVTTFVNHPQVSALLGEEDEEALHYLTR	3077	sp|Q01105|SET_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=842	4.5747159	5	3727.871359	3724.852562	K	V	91	123
PSM	KHISQISVAEDDDESLLGHLMIVGK	3078	sp|P49773|HINT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=7311	40.091798	4	2732.400422	2733.400731	K	K	58	83
PSM	IPNFWVTTFVNHPQVSALLGEEDEEALHYLTR	3079	sp|Q01105|SET_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1311	7.1216046	4	3724.858124	3724.852562	K	V	91	123
PSM	ADIWSLGITAIELAR	3080	sp|Q9Y6E0-2|STK24_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=2779	15.064	2	1627.8934	1627.8934	K	G	200	215
PSM	AGNFIGWLHIDGANLSVLLVEHALSK	3081	sp|Q7KZF4|SND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=1639	8.9026	4	2773.4915	2773.4915	K	V	604	630
PSM	AMPLPEEVTQILEENSDLIR	3082	sp|Q7Z2Z2-2|EFL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=2800	15.184	3	2296.1621	2296.1621	R	S	704	724
PSM	AVHADFFNDFEDLFDDDDIQ	3083	sp|Q8WXC6|CSN9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=3911	21.258	2	2386.9866	2386.9866	K	-	38	58
PSM	DFNVGDYIQAVLDR	3084	sp|P06737-2|PYGL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=2791	15.134	3	1623.7893	1623.7893	R	N	223	237
PSM	DHVFPVNDGFQALQGIIHSILKK	3085	sp|Q9H6X2-3|ANTR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=3746	20.336	4	2575.3911	2575.3911	K	S	196	219
PSM	DLGMMIHEQGDVIDSIEANVENAEVHVQQANQQLSR	3086	sp|O15400-2|STX7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5287	28.801	4	4016.8956	4016.8956	K	A	191	227
PSM	DVEGQDVVEAILAHLNTVPR	3087	sp|Q9UNS1-2|TIM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=2728	14.788	3	2174.1331	2174.1331	K	T	838	858
PSM	DYFEEYGKIDTIEIITDR	3088	sp|P22626-2|ROA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7389	40.53	3	2219.0634	2219.0634	R	Q	118	136
PSM	DYQFTILDVRPALDSLSAVWDR	3089	sp|P53701|CCHL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6456	35.286	3	2579.302	2579.3020	K	M	237	259
PSM	EIYPYVIQELRPTLNELGISTPEELGLDKV	3090	sp|P20674|COX5A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=3933	21.378	3	3427.8127	3427.8127	K	-	121	151
PSM	EIYPYVIQELRPTLNELGISTPEELGLDKV	3091	sp|P20674|COX5A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=3993	21.716	4	3427.8127	3427.8127	K	-	121	151
PSM	ELLLNLIEYLCK	3092	sp|O75976-2|CBPD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24	11-UNIMOD:4	ms_run[2]:scan=3300	17.889	2	1519.832	1519.8320	R	N	325	337
PSM	EMDDVAIEDEVLEQLFK	3093	sp|O60934|NBN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4279	23.272	2	2021.9503	2021.9503	R	D	552	569
PSM	EQLIIPQVPLFNILAK	3094	sp|Q53GS9-2|SNUT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=391	2.1531	2	1835.0921	1835.0921	K	F	303	319
PSM	EQNSALPTSSQDEELMEVVEKSEEPAGQILSHLSSELK	3095	sp|Q9UQ35-2|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=2445	13.235	4	4168.0005	4168.0005	K	E	1224	1262
PSM	ESEIIDFFLGASLK	3096	sp|P15880|RS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=1460	7.9108	2	1567.8134	1567.8134	K	D	90	104
PSM	EVIQQTLAAIVDAIK	3097	sp|Q6UB99|ANR11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5368	29.258	2	1610.9243	1610.9243	R	L	2409	2424
PSM	FAADIISVLAMTMSGERECLK	3098	sp|Q13200|PSMD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24	19-UNIMOD:4	ms_run[2]:scan=337	1.8581	3	2341.148	2341.1480	R	Y	121	142
PSM	FGANAILGVSLAVCK	3099	sp|P06733-2|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24	14-UNIMOD:4	ms_run[2]:scan=1525	8.2572	2	1518.8228	1518.8228	K	A	13	28
PSM	FINMFAVLDELK	3100	sp|Q96F07-2|CYFP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=1603	8.6993	2	1438.753	1438.7530	K	N	164	176
PSM	FLVVLNFGDVGLSAGLQASDLPASASLPAK	3101	sp|P08195-2|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=2635	14.265	3	2956.591	2956.5910	R	A	462	492
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	3102	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24	27-UNIMOD:4	ms_run[2]:scan=8669	47.723	3	3512.6956	3512.6956	R	R	85	117
PSM	GFNYHQGPEWLWPIGYFLR	3103	sp|P35573-2|GDE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=2969	16.098	3	2379.1589	2379.1589	K	A	1425	1444
PSM	GLALHDILTEIHLFVHRVDFPSSVR	3104	sp|P40937-2|RFC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=1122	6.0725	4	2870.5555	2870.5555	K	I	253	278
PSM	GLLPQILENLLSAR	3105	sp|P28340|DPOD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6354	34.713	2	1535.9035	1535.9035	K	K	654	668
PSM	GWPWLLPDGSPVDIFAK	3106	sp|Q6P1J9|CDC73_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=2275	12.332	2	1896.9774	1896.9774	K	I	456	473
PSM	IEQLSPFPFDLLLK	3107	sp|Q02218-2|ODO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=567	3.0507	2	1658.9283	1658.9283	R	E	926	940
PSM	IEQLSPFPFDLLLK	3108	sp|Q02218-2|ODO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=1151	6.2321	2	1658.9283	1658.9283	R	E	926	940
PSM	IEQLSPFPFDLLLK	3109	sp|Q02218-2|ODO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=1247	6.764	2	1658.9283	1658.9283	R	E	926	940
PSM	IYMNLEKPDFINVCQCLIFLDDPQAVSDILEK	3110	sp|Q99460-2|PSMD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24	14-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=3629	19.71	3	3839.8824	3839.8824	K	L	204	236
PSM	KLGLVFDDVVGIVEIINSK	3111	sp|Q01518|CAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5071	27.61	3	2057.1772	2057.1772	K	D	377	396
PSM	LCYVALDFEQEMATAASSSSLEK	3112	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24	2-UNIMOD:4	ms_run[2]:scan=3231	17.519	3	2549.1666	2549.1666	K	S	216	239
PSM	LEQFVSILMASIPLPDK	3113	sp|P00491|PNPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5828	31.807	3	1900.038	1900.0380	K	A	271	288
PSM	LIPEMDQIFTEVEMTTLEK	3114	sp|Q9Y4L1|HYOU1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=3725	20.219	3	2266.1113	2266.1113	R	V	841	860
PSM	LLILEQLLDSIK	3115	sp|Q86XA9-2|HTR5A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7413	40.667	2	1396.8541	1396.8541	R	H	799	811
PSM	LLIVSNPVDILTYVAWK	3116	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5060	27.549	3	1943.1132	1943.1132	K	I	133	150
PSM	LLMEELVNFIER	3117	sp|Q9NV88-3|INT9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=1546	8.3721	2	1504.796	1504.7960	R	V	111	123
PSM	LLQDSVDFSLADAINTEFK	3118	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8362	45.971	2	2125.0579	2125.0579	R	N	79	98
PSM	LLTNMTVTNEYQHMLANSISDFFR	3119	sp|Q9UH62|ARMX3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=1890	10.235	3	2844.3575	2844.3575	R	L	227	251
PSM	LNYAQWYPIVVFLNPDSK	3120	sp|Q07157-2|ZO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=2383	12.913	2	2166.115	2166.1150	R	Q	716	734
PSM	LVQLVYFLPSLPADLLSR	3121	sp|Q9NXF1-2|TEX10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6661	36.426	2	2043.1768	2043.1768	R	L	621	639
PSM	MCLDQYSMLPATPWGVWEIIK	3122	sp|P13995-2|MTDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24	2-UNIMOD:4	ms_run[2]:scan=5264	28.671	2	2537.2157	2537.2157	R	R	63	84
PSM	NGEFELMHVDEFIDELLHSER	3123	sp|Q8NAV1|PR38A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4848	26.341	4	2558.1748	2558.1748	R	V	136	157
PSM	NLVTEVLGALEAK	3124	sp|Q96HR9-2|REEP6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4023	21.875	3	1355.766	1355.7660	R	T	16	29
PSM	NQGATCYMNSLLQTLFFTNQLR	3125	sp|Q93009-3|UBP7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:4	ms_run[2]:scan=5279	28.758	2	2619.2574	2619.2574	K	K	202	224
PSM	NYLDWLTSIPWGK	3126	sp|P36776-3|LONM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=2882	15.619	2	1591.8035	1591.8035	R	Y	264	277
PSM	QDQIQQVVNHGLVPFLVSVLSK	3127	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5571	30.387	4	2447.3536	2447.3536	R	A	367	389
PSM	QSYYSLMHDVYGMLLNLEK	3128	sp|P82933|RT09_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6650	36.366	3	2303.0966	2303.0966	K	H	156	175
PSM	QWVEEFFPSVSLGDPTLETLLR	3129	sp|Q9BU23-3|LMF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5525	30.128	3	2562.3006	2562.3006	R	Q	466	488
PSM	RGIHSAIDASQTPDVVFASILAAFSK	3130	sp|P54819-6|KAD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=1569	8.5039	3	2700.4235	2700.4235	K	A	156	182
PSM	SDPMVQCIIEESGEHIIAGAGELHLEICLK	3131	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24	7-UNIMOD:4,28-UNIMOD:4	ms_run[2]:scan=2002	10.828	4	3347.62	3347.6200	K	D	530	560
PSM	SELHLMDRDLLQIIFSFSK	3132	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4068	22.121	4	2291.1984	2291.1984	K	A	296	315
PSM	SKPIIAEPEIHGAQPLDGVTGFLVLMSEGLYK	3133	sp|Q15750-2|TAB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=3630	19.715	4	3408.8003	3408.8003	K	A	263	295
PSM	SLFTEDTFFLELIQR	3134	sp|Q96IR7|HPDL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=3768	20.449	2	1857.9513	1857.9513	K	Q	329	344
PSM	STAISLFYELSENDLNFIK	3135	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4024	21.88	2	2203.1049	2203.1049	K	Q	72	91
PSM	STAISLFYELSENDLNFIK	3136	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=3596	19.532	3	2203.1049	2203.1049	K	Q	72	91
PSM	SYDSGSFTIMQEVYSAFLPDGCDHLR	3137	sp|Q8TEQ6|GEMI5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24	22-UNIMOD:4	ms_run[2]:scan=3010	16.324	3	2994.3164	2994.3164	R	D	1234	1260
PSM	TDQFPLFLIIMGK	3138	sp|Q9UNN5-2|FAF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=3779	20.51	2	1521.8265	1521.8265	K	R	293	306
PSM	TEFLSFMNTELAAFTK	3139	sp|P31949|S10AB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=707	3.8214	2	1848.8968	1848.8968	K	N	37	53
PSM	THINIVVIGHVDSGK	3140	sp|P68104-2|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6927	37.941	3	1587.8733	1587.8733	K	S	6	21
PSM	TLAFLIPAVELIVK	3141	sp|Q9NVP1|DDX18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=3172	17.21	2	1525.9484	1525.9484	K	L	230	244
PSM	TSSCPVIFILDEFDLFAHHK	3142	sp|O43929-2|ORC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:4	ms_run[2]:scan=5236	28.514	3	2375.162	2375.1620	R	N	65	85
PSM	TVDGSTFSVVIPFLVPGIR	3143	sp|Q9Y6N7-6|ROBO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=1172	6.35	2	2003.1092	2003.1092	K	Y	793	812
PSM	TVDWALAEYMAFGSLLK	3144	sp|Q02218-2|ODO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6105	33.35	2	1913.9597	1913.9597	R	E	646	663
PSM	VFIMDNCEELIPEYLNFIR	3145	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:35,7-UNIMOD:4	ms_run[2]:scan=2885	15.636	2	2430.16	2430.1600	R	G	368	387
PSM	VFPDKEVMLDAALALAAEISSK	3146	sp|Q13011|ECH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6692	36.601	3	2317.2239	2317.2239	R	S	246	268
PSM	VQLAEPDLEQAAHLIQALSNHEDVIHVYDNIE	3147	sp|Q9BSH4|TACO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=480	2.5997	4	3622.7904	3622.7904	K	-	266	298
PSM	VTTAMELITPISAGDLLSPDSVLSCLYPGDHGK	3148	sp|Q13769|THOC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24	25-UNIMOD:4	ms_run[2]:scan=2514	13.609	3	3456.7157	3456.7157	K	K	379	412
PSM	WLPAGDALLQMITIHLPSPVTAQK	3149	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24	11-UNIMOD:35	ms_run[2]:scan=6063	33.113	3	2615.4145	2615.4145	R	Y	343	367
PSM	YNLPESAPLIYNSFAQFLVK	3150	sp|Q5TFE4|NT5D1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=2771	15.022	2	2313.2045	2313.2045	R	E	24	44
PSM	WLPAGDALLQMITIHLPSPVTAQK	3151	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24	11-UNIMOD:35	ms_run[1]:scan=5351	29.16013	3	2616.441973	2615.414531	R	Y	343	367
PSM	LCYVALDFEQEMATAASSSSLEK	3152	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24	2-UNIMOD:4	ms_run[1]:scan=6180	33.772545	3	2550.171194	2549.166557	K	S	216	239
PSM	HNIMDFAMPYFIQVMKEYLTK	3153	sp|Q00610|CLH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24	8-UNIMOD:35	ms_run[1]:scan=5301	28.88003	4	2634.271346	2634.268460	R	V	1589	1610
PSM	HNDDEQYAWESSAGGSFTVR	3154	sp|Q14568|HS902_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=7331	40.206423	3	2254.955799	2254.951553	K	T	154	174
PSM	DMAIATGGAVFGEEGLTLNLEDVQPHDLGK	3155	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=2827	15.322973	3	3095.491712	3096.507381	K	V	315	345
PSM	SGETEDTFIADLVVGLCTGQIK	3156	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24	17-UNIMOD:4	ms_run[1]:scan=4974	27.056125	3	2353.154924	2352.151893	R	T	373	395
PSM	LIIVSNPVDILTYVAWK	3157	sp|Q9BYZ2|LDH6B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=5562	30.336345	2	1944.120351	1943.113186	K	L	182	199
PSM	HNDLDDVGKDVYHHTFFEMLGSWSFGDYFK	3158	sp|P49588|SYAC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=323	1.7829833	4	3606.607391	3605.598655	K	E	82	112
PSM	IGYNPDTVAFVPISGWNGDNMLEPSANMPWFK	3159	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=4396	23.924844	4	3567.651349	3566.663898	K	G	181	213
PSM	LQLETEIEALKEELLFMK	3160	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=2008	10.858894	3	2176.172064	2176.170109	R	K	197	215
PSM	GMYGIENEVFLSLPCILNAR	3161	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24	2-UNIMOD:35,15-UNIMOD:4	ms_run[1]:scan=1770	9.624885	3	2312.1642	2311.1332	K	G	280	300
PSM	MLAEDELRDAVLLVFANK	3162	sp|P84077|ARF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=3986	21.676645	3	2046.084572	2046.081963	R	Q	110	128
PSM	AQLGVQAFADALLIIPK	3163	sp|P40227|TCPZ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=652	3.521132	2	1767.031514	1767.029457	R	V	433	450
PSM	QDDPFELFIAATNIR	3164	sp|Q9H0A0|NAT10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=108	0.58169527	3	1748.876044	1748.873350	K	Y	89	104
PSM	ESEIIDFFLGASLKDEVLK	3165	sp|P15880|RS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=251	1.3816705	3	2153.136790	2152.130353	K	I	90	109
PSM	AQLAAITLIIGTFER	3166	sp|Q96QK1|VPS35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=2504	13.553068	2	1615.931638	1615.929743	K	M	623	638
PSM	TLRDPSLPLLELQDIMTSVSGR	3167	sp|Q13085|ACACA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=506	2.7291004	3	2440.303079	2440.299560	K	I	888	910
PSM	KIDLDSDGFLTESELSSWIQMSFK	3168	sp|Q14257|RCN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=4067	22.115643	3	2777.363557	2775.331314	K	H	72	96
PSM	NLFAFFDMAYQGFASGDGDKDAWAVR	3169	sp|P00505|AATM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=7388	40.523946	3	2898.310222	2898.307165	R	H	237	263
PSM	PVFAFHHANFPQYVMDVLMDQHFTEPTPIQCQGFPLALSGR	3170	sp|Q92841|DDX17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24	31-UNIMOD:4	ms_run[1]:scan=1383	7.5116923	5	4742.275502	4742.266116	K	D	169	210
PSM	LDLNGNTLGEEGCEQLQEVLEGFNMAK	3171	sp|P46060|RAGP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24	13-UNIMOD:4	ms_run[1]:scan=4010	21.804299	3	3008.378680	3007.390302	K	V	326	353
PSM	LFQVSTLDAALSGTLSGVEGFTSQEDQEMLSR	3172	sp|P33992|MCM5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24	29-UNIMOD:35	ms_run[1]:scan=6621	36.209137	3	3432.674330	3431.640246	R	I	643	675
PSM	GVPQIEVTFEIDVNGILR	3173	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=2559	13.862356	2	1999.077473	1998.078592	R	V	493	511
PSM	GVPQIEVTFEIDVNGILR	3174	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=3537	19.205783	2	1999.076418	1998.078592	R	V	493	511
PSM	GVPQIEVTFEIDVNGILR	3175	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=5293	28.8351	2	1999.075578	1998.078592	R	V	493	511
PSM	NSELFDPFDLFDVR	3176	sp|P52735|VAV2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=5076	27.638802	2	1712.806365	1712.804602	R	D	90	104
PSM	QSLETICLLLAYK	3177	sp|P62136|PP1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:28,7-UNIMOD:4	ms_run[1]:scan=1438	7.788132	2	1533.8141	1533.8107	K	I	99	112
PSM	GTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTR	3178	sp|P16455|MGMT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24	26-UNIMOD:4	ms_run[1]:scan=2547	13.799404	5	6525.1607	6525.1622	K	Q	37	97
PSM	MDALQLANSAFAVDLFK	3179	sp|P36952|SPB5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=4869	26.461576	2	1910.9491	1910.9443	-	Q	1	18
PSM	VLLPDLEFYVNLGDWPLEHR	3180	sp|Q7Z4H8|PLGT3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=2599	14.069375	3	2424.253036	2424.247782	K	K	229	249
PSM	LGIDDLVHFDFMDPPAPETLMR	3181	sp|O43143|DHX15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1515	8.2012154	3	2528.209691	2528.207968	K	A	517	539
PSM	YASGPLLPTLTAPLLPIPFPLAPGTGR	3182	sp|Q9H6T0|ESRP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=6967	38.17102	3	2730.556865	2729.552010	R	D	448	475
PSM	TWWNQFSVTALQLLQANR	3183	sp|Q99536|VAT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=5133	27.961296	3	2178.131428	2175.122522	R	A	304	322
PSM	AMGIMNSFVNDIFER	3184	sp|P33778|H2B1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=962	5.1926099	2	1743.802146	1742.812012	K	I	59	74
PSM	AEFEVHEVYAVDVLVSSGEGK	3185	sp|Q9UQ80|PA2G4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=7321	40.150687	3	2263.115606	2263.100843	K	A	216	237
PSM	YALQMEQLNGILLHLESELAQTR	3186	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24	5-UNIMOD:35	ms_run[1]:scan=2143	11.609434	3	2686.360806	2685.379602	R	A	331	354
PSM	SPIMADFSSQIRSNPELAALFESIQK	3187	sp|O75155|CAND2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24	4-UNIMOD:35	ms_run[1]:scan=5428	29.589101	3	2897.449547	2894.448410	K	D	1197	1223
PSM	GTPVGLIVSHLPFGPTAYFTLCNVVMR	3188	sp|Q96G21|IMP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24	22-UNIMOD:4	ms_run[1]:scan=5928	32.376879	3	2944.531617	2945.529577	R	H	144	171
PSM	CLFAMPETAIGLFPDVGGGYFLPR	3189	sp|Q6NVY1|HIBCH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24	1-UNIMOD:4	ms_run[1]:scan=5487	29.920607	3	2630.280775	2627.291638	K	L	163	187
PSM	ADIIVSELLGSFADNELSPECLDGAQHFLK	3190	sp|O14744-4|ANM5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23	21-UNIMOD:4	ms_run[2]:scan=2618	14.169	3	3287.602	3287.6020	K	D	258	288
PSM	AISEELDNALNDITSL	3191	sp|P07951|TPM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=884	4.7879	2	1716.8418	1716.8418	K	-	269	285
PSM	ALQLLDEVLHTMPIADPQPLD	3192	sp|Q13485|SMAD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=3530	19.168	3	2328.2035	2328.2035	R	-	532	553
PSM	ALSIPPNIDVLLCEQEVVADETPAVQAVLR	3193	sp|Q8NE71-2|ABCF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23	13-UNIMOD:4	ms_run[2]:scan=3178	17.244	3	3258.717	3258.7170	R	A	315	345
PSM	ANTNEVLWAVVAAFTK	3194	sp|Q9H4A6|GOLP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6747	36.912	3	1732.9148	1732.9148	K	-	283	299
PSM	ASELPVSEVASILQADLQNGLNK	3195	sp|P98194-2|AT2C1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=2859	15.488	3	2395.2595	2395.2595	K	C	26	49
PSM	ATLTQMLNVIFAR	3196	sp|Q9Y6D6|BIG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=987	5.3181	2	1476.8123	1476.8123	K	M	196	209
PSM	ATSPADALQYLLQFAR	3197	sp|Q96HW7-2|INT4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4968	27.022	2	1763.9206	1763.9206	K	K	46	62
PSM	AVHADFFNDFEDLFDDDDIQ	3198	sp|Q8WXC6|CSN9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4013	21.821	2	2386.9866	2386.9866	K	-	38	58
PSM	DFLDEYIFLAVGR	3199	sp|O00571-2|DDX3X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5107	27.816	2	1556.7875	1556.7875	R	V	379	392
PSM	DTSLIPNVLWFEYTVTR	3200	sp|Q86YN1-2|DOPP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4779	25.981	2	2053.052	2053.0520	R	A	164	181
PSM	DYIYAVTPLLEDALMDR	3201	sp|O75533|SF3B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=1163	6.2995	2	1996.9816	1996.9816	K	D	1164	1181
PSM	EALDHMVEYVAQNTPVTWLVGPFAPGITEK	3202	sp|O60664-2|PLIN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7232	39.655	4	3311.6537	3311.6537	R	A	216	246
PSM	EFSVTDAVPFPISLIWNHDSEDTEGVHEVFSR	3203	sp|Q92598-2|HS105_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=1624	8.8175	4	3658.7216	3658.7216	R	N	391	423
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	3204	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23	27-UNIMOD:4	ms_run[2]:scan=8367	45.999	3	3512.6956	3512.6956	R	R	85	117
PSM	FTASAGIQVVGDDLTVTNPK	3205	sp|P06733-2|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6902	37.797	2	2032.0477	2032.0477	K	R	214	234
PSM	GFDLASFNPHGISTFIDNDDTVYLFVVNHPEFK	3206	sp|Q15165-1|PON2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=2205	11.951	4	3754.7944	3754.7944	R	N	105	138
PSM	GGDCDGFSTFDVPIFTEEFLDQNK	3207	sp|Q9P0W2-2|HM20B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:4	ms_run[2]:scan=1419	7.6947	2	2737.1854	2737.1854	K	A	72	96
PSM	GGLGGGYGGASGMGGITAVTVNQSLLSPLVLEVDPNIQAVR	3208	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=935	5.0699	3	3924.0415	3924.0415	R	T	48	89
PSM	GILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVK	3209	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6950	38.073	3	4035.8875	4035.8875	K	L	272	310
PSM	GLLPQILENLLSAR	3210	sp|P28340|DPOD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6448	35.241	2	1535.9035	1535.9035	K	K	654	668
PSM	GLPFQANAQDIINFFAPLKPVR	3211	sp|Q12849|GRSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=2934	15.905	3	2455.3376	2455.3376	R	I	407	429
PSM	GSEYDDFLDEFMEAVSSK	3212	sp|P48163-2|MAOX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7347	40.296	3	2067.8619	2067.8619	R	Y	143	161
PSM	HDGTVGLLTYPVLQAADILLYK	3213	sp|Q9UGM6-2|SYWM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4260	23.163	3	2399.31	2399.3100	K	S	151	173
PSM	HLVFPLLEFLSVK	3214	sp|P60228|EIF3E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=242	1.3308	3	1540.9017	1540.9017	R	E	17	30
PSM	HYGDQVDRVLGTLAAVFVSHLHADHHTGLPSILLQR	3215	sp|Q9BQ52-3|RNZ2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4629	25.172	5	3972.0871	3972.0871	R	E	155	191
PSM	IFTENIVEQPCPDVFWFPIFSEK	3216	sp|O00469-3|PLOD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23	11-UNIMOD:4	ms_run[2]:scan=5192	28.293	2	2841.3724	2841.3724	K	A	233	256
PSM	ILNDVQDRFEVNISELPDEIDISSYIEQTR	3217	sp|Q13838|DX39B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7490	41.099	3	3549.7475	3549.7475	K	-	399	429
PSM	IPNFWVTTFVNHPQVSALLGEEDEEALHYLTR	3218	sp|Q01105-3|SET_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=2616	14.158	4	3724.8526	3724.8526	K	V	66	98
PSM	ISFDEFVYIFQEVK	3219	sp|P13797-3|PLST_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=3635	19.741	3	1762.8818	1762.8818	K	S	27	41
PSM	ITPLEIEVLEETVQTMDTS	3220	sp|Q99436|PSB7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=3946	21.451	2	2147.0555	2147.0555	K	-	259	278
PSM	LCYVALDFEQEMATAASSSSLEK	3221	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:4	ms_run[2]:scan=2276	12.337	2	2549.1666	2549.1666	K	S	216	239
PSM	LCYVALDFEQEMATAASSSSLEK	3222	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:4	ms_run[2]:scan=6367	34.786	2	2549.1666	2549.1666	K	S	216	239
PSM	LDTMNTTCVDRFINWFSHHLSNFQFR	3223	sp|Q09161|NCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23	8-UNIMOD:4	ms_run[2]:scan=2772	15.027	4	3285.5237	3285.5237	R	W	402	428
PSM	LPSGLGCSTVLSPEGSAQFAAQIFGLSNHLVWSK	3224	sp|P22234|PUR6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:4	ms_run[2]:scan=5020	27.319	4	3557.7977	3557.7977	R	L	368	402
PSM	LSMSQLNEKETPFELIEALLK	3225	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5923	32.349	3	2432.2873	2432.2873	R	Y	622	643
PSM	LTAQVASLTSELTTLNATIQQQDQELAGLK	3226	sp|Q14980-4|NUMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=1033	5.5668	3	3184.6827	3184.6827	R	Q	496	526
PSM	LTLLSLLHMPFTIAAEK	3227	sp|Q03519-2|TAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=762	4.128	3	1897.0747	1897.0747	R	V	292	309
PSM	MILELFSKVPSLVGSFIR	3228	sp|P78417-3|GSTO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:35	ms_run[2]:scan=984	5.3013	3	2051.1489	2051.1489	K	S	87	105
PSM	NHLVTLPEAIHFLTEIEVLDVR	3229	sp|Q13045-2|FLII_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5199	28.329	4	2557.3904	2557.3904	K	E	296	318
PSM	NLLILYDAIGTLADSVGHHLNQPEYIQK	3230	sp|O14787-2|TNPO2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5054	27.513	3	3134.64	3134.6400	K	L	534	562
PSM	NYQFDFLRPQHSLFNYFTKLVEQYTK	3231	sp|Q15459-2|SF3A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5374	29.292	4	3325.656	3325.6560	R	I	127	153
PSM	QDMPSEDVVSLQVSLINLAMK	3232	sp|Q96QK1|VPS35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=778	4.2175	3	2316.1705	2316.1705	R	C	340	361
PSM	QQDAQEFFLHLVNLVER	3233	sp|Q92995-2|UBP13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=1040	5.6088	3	2085.0643	2085.0643	R	N	380	397
PSM	QSTCSPGDHIIEITEVEEDLFPAETVELLR	3234	sp|P28290-2|ITPI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:4	ms_run[2]:scan=218	1.1982	3	3426.6501	3426.6501	K	E	456	486
PSM	QVEHPLLSGLLYPGLQALDEEYLK	3235	sp|P54577|SYYC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=3574	19.413	3	2724.4374	2724.4374	K	V	155	179
PSM	SAATDIFSYLVEYNPSMVR	3236	sp|Q6IN85-5|P4R3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=736	3.9865	3	2162.0354	2162.0354	R	E	379	398
PSM	SFAPILPHLAEEVFQHIPYIK	3237	sp|Q9NSE4|SYIM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=1868	10.122	3	2448.3206	2448.3206	R	E	833	854
PSM	SNVKPNSGELDPLYVVEVLLR	3238	sp|P42285|MTREX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=3476	18.871	2	2340.2689	2340.2689	K	C	681	702
PSM	SQEPLPDDDEEFELPEFVEPFLK	3239	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=1246	6.7584	2	2748.2694	2748.2694	K	D	367	390
PSM	SRDNGPDGMEPEGVIESNWNEIVDSFDDMNLSESLLR	3240	sp|P60842-2|IF4A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23	29-UNIMOD:35	ms_run[2]:scan=6660	36.421	3	4181.843	4181.8430	R	G	9	46
PSM	TGFIASFLDFLK	3241	sp|Q2KHR3-2|QSER1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5863	32.009	2	1357.7282	1357.7282	K	S	908	920
PSM	TMADSSYQPEVLNILSFLR	3242	sp|Q9BQL6-3|FERM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5377	29.309	2	2183.0933	2183.0933	K	M	29	48
PSM	TTYLEDLPPPPEYELAPSKLEEEVDDVFLIR	3243	sp|Q12849|GRSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=3881	21.086	3	3616.8076	3616.8076	K	A	123	154
PSM	VADNLAIQLAAVTEDKYEILQSVDDAAIVIK	3244	sp|Q12906-5|ILF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=2727	14.78	3	3327.7814	3327.7814	K	N	128	159
PSM	VWITNGGLANIFTVFAK	3245	sp|Q9H845|ACAD9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=2195	11.895	2	1850.0091	1850.0091	K	T	212	229
PSM	DGAGFLINLIDSPGHVDFSSEVTAALR	3246	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=8171	44.885887	3	2801.392468	2800.403174	K	V	94	121
PSM	LCYVALDFEQEMATAASSSSLEK	3247	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23	2-UNIMOD:4	ms_run[1]:scan=704	3.8068657	2	2550.167238	2549.166557	K	S	216	239
PSM	QVVNQVWEAADVLIK	3248	sp|Q7Z6Z7|HUWE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:28	ms_run[1]:scan=1870	10.133012	2	1693.9072	1693.9034	K	A	1483	1498
PSM	CLELFSELAEDK	3249	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=6236	34.075884	2	1435.6546	1435.6536	K	E	412	424
PSM	IDLRPVLGEGVPILASFLR	3250	sp|Q86VP6|CAND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=5758	31.410106	3	2064.212240	2064.209546	K	K	642	661
PSM	TLSSSTQASIEIDSLYEGIDFYTSITR	3251	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=5653	30.823729	3	2995.449635	2996.450243	R	A	273	300
PSM	GSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHNK	3252	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23	36-UNIMOD:35	ms_run[1]:scan=4960	26.974908	4	4306.116752	4306.115730	R	Q	86	126
PSM	GSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHNK	3253	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23	36-UNIMOD:35	ms_run[1]:scan=5181	28.231302	5	4306.121978	4306.115730	R	Q	86	126
PSM	IGYNPDTVAFVPISGWNGDNMLEPSANMPWFK	3254	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23	21-UNIMOD:35	ms_run[1]:scan=3762	20.418461	3	3583.671149	3582.658813	K	G	181	213
PSM	LVSDDLDSSLANLVGNLGIGNGTTK	3255	sp|Q13492|PICAL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=281	1.5469124	3	2473.257744	2472.270762	K	N	535	560
PSM	LLQDSVDFSLADAINTEFK	3256	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=8564	47.122264	2	2125.073783	2125.057916	R	N	79	98
PSM	QYPEFPWTDVQAEIFR	3257	sp|Q14166|TTL12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:28	ms_run[1]:scan=5729	31.245233	2	2007.9366	2007.9362	K	A	538	554
PSM	AGTGLVAGEVVVDALPYFDQGYEAPGVR	3258	sp|O75934|SPF27_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1	ms_run[1]:scan=5971	32.598029	2	2891.4293	2891.4336	M	E	2	30
PSM	ASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGK	3259	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23	36-UNIMOD:35,45-UNIMOD:4,48-UNIMOD:4	ms_run[1]:scan=1572	8.5208115	5	5822.8757	5822.8741	R	I	13	68
PSM	GVFHGIENFINEASYMSILGMTPGFGDK	3260	sp|P00367|DHE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23	16-UNIMOD:35	ms_run[1]:scan=4971	27.03937	3	3046.422450	3046.420480	R	T	275	303
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	3261	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=8242	45.285748	3	3585.665704	3585.694213	R	R	85	117
PSM	HFYWYLTNEGIQYLRDYLHLPPEIVPATLR	3262	sp|P46783|RS10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=5953	32.505592	4	3716.920189	3716.914374	R	R	66	96
PSM	IVAFADAAVEPIDFPIAPVYAASMVLK	3263	sp|P24752|THIL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23	24-UNIMOD:35	ms_run[1]:scan=6377	34.843747	3	2834.5322	2833.4972	R	D	312	339
PSM	FGVEQDVDMVFASFIR	3264	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=6220	33.987249	3	1858.893668	1858.892371	K	K	231	247
PSM	KLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTALPDEDDDL	3265	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23		ms_run[1]:scan=6199	33.874513	4	5386.6133	5386.6148	R	-	167	217
PSM	ERPPNPIEFLASYLLK	3266	sp|Q9C005|DPY30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=6060	33.096161	2	1886.037369	1886.030185	K	N	75	91
PSM	LVETLQADSGLLLDALLAR	3267	sp|O60936|NOL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=3526	19.145288	3	2010.137706	2010.136107	R	G	19	38
PSM	QATTIIADNIIFLSDQTK	3268	sp|Q04837|SSBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:28	ms_run[1]:scan=2130	11.539255	2	1974.0323	1974.0304	R	E	128	146
PSM	QEIVSLFNAFGR	3269	sp|Q96HE7|ERO1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:28	ms_run[1]:scan=479	2.5940358	2	1362.6943	1362.6927	R	I	438	450
PSM	TTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHVEMHLR	3270	sp|Q15393|SF3B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=5045	27.45931	6	4737.356732	4737.353728	K	S	1107	1150
PSM	KTYIGEIFTQILVLPYVGK	3271	sp|P35237|SPB6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1131	6.1195021	3	2181.249385	2181.244929	K	E	208	227
PSM	QGQAITLVTQYDIHLVHAIEEQIKK	3272	sp|Q9Y6V7|DDX49_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:28	ms_run[1]:scan=2011	10.875706	4	2857.5361	2857.5333	R	K	345	370
PSM	FGANAILGVSLAVCK	3273	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23	14-UNIMOD:4	ms_run[1]:scan=8108	44.539827	2	1519.815173	1518.822835	K	A	106	121
PSM	GVPQIEVTFEIDVNGILR	3274	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=8221	45.168075	2	1999.063837	1998.078592	R	V	493	511
PSM	HNNGQPIWFTLGILEALK	3275	sp|Q9NWM8|FKB14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=3497	18.983415	3	2051.086070	2050.099996	K	G	69	87
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	3276	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23	27-UNIMOD:4	ms_run[1]:scan=8990	49.375444	3	3515.700949	3512.695593	R	R	85	117
PSM	GGGGGGSPGPTAGPEPLSLPGILHFIQHEWAR	3277	sp|Q9NRL3|STRN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=4433	24.133269	4	3147.583739	3148.584266	K	F	47	79
PSM	AMPLPEEVTQILEENSDLIR	3278	sp|Q7Z2Z2-2|EFL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=2701	14.631	3	2296.1621	2296.1621	R	S	704	724
PSM	CGEEIAVQFVDMVK	3279	sp|O43175|SERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:4	ms_run[2]:scan=2229	12.088	2	1623.7637	1623.7637	R	G	295	309
PSM	DGAGFLINLIDSPGHVDFSSEVTAALR	3280	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=8751	48.189	3	2800.4032	2800.4032	K	V	94	121
PSM	DGALHVIGSLAEILLK	3281	sp|O15397-2|IPO8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=2813	15.255	2	1647.956	1647.9560	K	K	226	242
PSM	DGTVLCELINALYPEGQAPVK	3282	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22	6-UNIMOD:4	ms_run[2]:scan=6925	37.93	3	2286.1566	2286.1566	K	K	58	79
PSM	DLEEDLYELFK	3283	sp|Q9BTU6|P4K2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=3792	20.586	2	1412.6711	1412.6711	K	K	396	407
PSM	DLYLISQMDSDQFIPIWTVANMEEIKK	3284	sp|Q71RC2-7|LARP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=4046	21.999	3	3226.593	3226.5930	K	L	139	166
PSM	DVNFEFPEFQL	3285	sp|P62081|RS7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=2136	11.572	2	1383.6347	1383.6347	K	-	184	195
PSM	ECANGYLELLDHVLLTLQK	3286	sp|Q9Y490|TLN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22	2-UNIMOD:4	ms_run[2]:scan=6857	37.541	3	2228.1511	2228.1511	R	P	2242	2261
PSM	EQLPPMSEDFLLDALSEDFSGPQNASSLKFEDAK	3287	sp|P20810-3|ICAL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=682	3.689	3	3754.756	3754.7560	K	L	383	417
PSM	EYYTLDSILFLLNNVHLSHPVYVR	3288	sp|Q6P1J9|CDC73_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=3880	21.081	4	2904.5174	2904.5174	R	R	53	77
PSM	FCGDLDCPDWVLAEISTLAK	3289	sp|Q9H0A8-3|COMD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22	2-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=5485	29.909	2	2309.0708	2309.0708	R	M	5	25
PSM	FGANAILGVSLAVCK	3290	sp|P06733-2|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22	14-UNIMOD:4	ms_run[2]:scan=8581	47.218	2	1518.8228	1518.8228	K	A	13	28
PSM	FYTEDGNWDLVGNNTPIFFIRDPILFPSFIHSQK	3291	sp|P04040|CATA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=2884	15.631	3	4026.9945	4026.9945	K	R	136	170
PSM	GMYGIENEVFLSLPCILNAR	3292	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22	2-UNIMOD:35,15-UNIMOD:4	ms_run[2]:scan=1858	10.075	2	2311.1341	2311.1341	K	G	280	300
PSM	GNFTLPEVAECFDEITYVELQK	3293	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22	11-UNIMOD:4	ms_run[2]:scan=2418	13.084	3	2601.2309	2601.2309	K	E	619	641
PSM	GQLVPLETVLDMLR	3294	sp|P00568|KAD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=4836	26.277	2	1582.8753	1582.8753	K	D	64	78
PSM	GVESVFDIMEMEDEERNALLQLTDSQIADVAR	3295	sp|O75643|U520_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5588	30.478	4	3622.7131	3622.7131	K	F	1978	2010
PSM	IECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFK	3296	sp|O75369-5|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=5495	29.961	4	4502.1087	4502.1087	K	A	1085	1125
PSM	ILQAVQAAEDAAGQALQQADHTWATVVR	3297	sp|O15230|LAMA5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6254	34.167	4	2960.5104	2960.5104	R	Q	2528	2556
PSM	LEQLNQYPDFNNYLIFVLTK	3298	sp|Q92973-3|TNPO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=2033	10.997	2	2471.2737	2471.2737	K	L	45	65
PSM	LGYVCPQEVAPMLQQFIRPWCTSLR	3299	sp|O14787-2|TNPO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22	5-UNIMOD:4,21-UNIMOD:4	ms_run[2]:scan=1226	6.6458	3	3048.5136	3048.5136	R	N	775	800
PSM	LHLVNFVEPVGLNYSMFIPTLLNQGTTAQK	3300	sp|Q15067|ACOX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=505	2.7235	3	3343.7639	3343.7639	K	E	91	121
PSM	LPHWLLGNLVSDFVDTFRPTAR	3301	sp|Q9ULK4-6|MED23_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7176	39.337	4	2553.3492	2553.3492	K	I	196	218
PSM	MIFIPSSIAFLTTLER	3302	sp|Q8NBQ5|DHB11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=1748	9.5064	2	1838.0012	1838.0012	K	I	256	272
PSM	NAFPVSGQLYTTHLLSLDALLTVIDSTEAHCQAK	3303	sp|Q92538-3|GBF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22	31-UNIMOD:4	ms_run[2]:scan=2788	15.117	4	3712.8771	3712.8771	K	V	562	596
PSM	NAVLFEAISLIIHHDSEPNLLVR	3304	sp|O94973-3|AP2A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=1626	8.8287	3	2599.4122	2599.4122	K	A	307	330
PSM	NLDPFLLFDEFK	3305	sp|O00625|PIR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=2458	13.303	2	1496.7551	1496.7551	K	G	35	47
PSM	NNFSDTGNFGFGIQEHIDLGIK	3306	sp|P62913-2|RL11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7431	40.768	3	2422.1553	2422.1553	K	Y	96	118
PSM	NSPLTVPMFLSLFSR	3307	sp|Q9BQG0|MBB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=2977	16.145	2	1707.9018	1707.9018	R	H	990	1005
PSM	NYQFDFLRPQHSLFNYFTKLVEQYTK	3308	sp|Q15459-2|SF3A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5405	29.46	5	3325.656	3325.6560	R	I	127	153
PSM	QLAAFLEGFYEIIPK	3309	sp|Q7Z6Z7-2|HUWE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=4729	25.715	2	1737.9342	1737.9342	K	R	4206	4221
PSM	QQQEGLSHLISIIKDDLEDIK	3310	sp|Q7Z3B4-2|NUP54_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=171	0.93763	4	2421.2751	2421.2751	K	L	253	274
PSM	SDPLCVLLQDVGGGSWAELGR	3311	sp|Q99829|CPNE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22	5-UNIMOD:4	ms_run[2]:scan=5881	32.109	3	2228.0896	2228.0896	K	T	26	47
PSM	SGTIFDNFLITNDEAYAEEFGNETWGVTK	3312	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=4136	22.472	3	3267.4884	3267.4884	K	A	323	352
PSM	SMMQTLAQNPDFAAQMMVNVPLFAGNPQLQEQLR	3313	sp|Q9NRR5|UBQL4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=2911	15.774	3	3817.8412	3817.8412	R	L	408	442
PSM	STAISLFYELSENDLNFIK	3314	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=3681	19.969	2	2203.1049	2203.1049	K	Q	72	91
PSM	STAISLFYELSENDLNFIK	3315	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=3805	20.658	2	2203.1049	2203.1049	K	Q	72	91
PSM	TVPPAVTGITFLSGGQSEEEASINLNAINK	3316	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7358	40.355	4	3056.5666	3056.5666	R	C	260	290
PSM	TVYALPTIAFAFVCHPSVLPIYSELK	3317	sp|Q9H2H9|S38A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22	14-UNIMOD:4	ms_run[2]:scan=3171	17.205	3	2935.5558	2935.5558	K	D	275	301
PSM	VFIMDNCEELIPEYLNFIR	3318	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:35,7-UNIMOD:4	ms_run[2]:scan=2987	16.199	2	2430.16	2430.1600	R	G	368	387
PSM	VFPDKEVMLDAALALAAEISSK	3319	sp|Q13011|ECH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6809	37.268	3	2317.2239	2317.2239	R	S	246	268
PSM	VQFVITAQEWDPSFEEALMDNPSLAFVRPR	3320	sp|P18887|XRCC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=227	1.2484	3	3491.7184	3491.7184	R	W	581	611
PSM	DVLIQGLIDENPGLQLIIR	3321	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=3308	17.934366	3	2118.206633	2118.204855	K	N	2504	2523
PSM	AILELHYSQELSLLYLLQDDVDR	3322	sp|P78527|PRKDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=7472	40.994565	3	2746.432180	2745.422512	K	A	3076	3099
PSM	MTQIMFETFNTPAMYVAIQAVLSLYASGR	3323	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=8288	45.551286	3	3252.575578	3252.602150	K	T	119	148
PSM	DMAIATGGAVFGEEGLTLNLEDVQPHDLGK	3324	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22	2-UNIMOD:35	ms_run[1]:scan=8101	44.500525	3	3113.504660	3112.502296	K	V	315	345
PSM	GILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVK	3325	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=6738	36.861023	5	4034.893974	4035.887504	K	L	272	310
PSM	CGEEIAVQFVDMVK	3326	sp|O43175|SERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=2163	11.715136	2	1606.7384	1606.7366	R	G	295	309
PSM	GLYGIKDDVFLSVPCILGQNGISDLVK	3327	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22	15-UNIMOD:4	ms_run[1]:scan=945	5.1191578	3	2920.530832	2919.541582	K	V	279	306
PSM	DDVFLSVPCILGQNGISDLVK	3328	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22	9-UNIMOD:4	ms_run[1]:scan=2291	12.422195	3	2289.158842	2288.172235	K	V	285	306
PSM	IGYNPDTVAFVPISGWNGDNMLEPSANMPWFK	3329	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22	21-UNIMOD:35,28-UNIMOD:35	ms_run[1]:scan=2347	12.718359	3	3598.662417	3598.653728	K	G	181	213
PSM	WYQADSPPADLLLTEEEFLSFLHPEHSR	3330	sp|Q9BRK5|CAB45_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=6611	36.160579	3	3328.585296	3326.588408	R	G	204	232
PSM	VTGQHPEVPPAFWNNAFTLLSAVSLPR	3331	sp|Q9BVI4|NOC4L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=3502	19.014115	3	2947.540934	2947.534463	R	R	195	222
PSM	LVDISYGGENGFNQAIELSTEVLSNVK	3332	sp|P62495|ERF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=7390	40.535212	2	2896.430464	2895.450183	K	F	253	280
PSM	TAAFLLPILSQIYSDGPGEALR	3333	sp|O00571|DDX3X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=6225	34.015311	3	2331.249960	2331.247448	K	A	231	253
PSM	LGPAPLNLEVPTYEFTSDDMVIVG	3334	sp|P47985|UCRI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22	20-UNIMOD:35	ms_run[1]:scan=75	0.40475545	2	2593.2992	2592.2662	R	-	251	275
PSM	QIGLDQIWDDLR	3335	sp|Q13616|CUL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:28	ms_run[1]:scan=2617	14.163641	2	1453.7199	1453.7196	K	A	14	26
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	3336	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=8455	46.500672	3	3585.665704	3585.694213	R	R	85	117
PSM	HEWVTTENGIGTVGISNFAQEALGDVVYCSLPEVGTK	3337	sp|P23434|GCSH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22	29-UNIMOD:4	ms_run[1]:scan=2959	16.043834	3	3977.895969	3976.915299	K	L	57	94
PSM	FGVEQDVDMVFASFIR	3338	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=6559	35.872975	3	1858.893668	1858.892371	K	K	231	247
PSM	KLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTALPDEDDDL	3339	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22		ms_run[1]:scan=6361	34.752656	5	5386.6181	5386.6148	R	-	167	217
PSM	ELSDFPQEFVWEASHYLVR	3340	sp|O00411|RPOM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=2556	13.845473	3	2351.120242	2351.122248	R	Q	1016	1035
PSM	AAPDPPPLFDDTSGGYSSQPGGYPATGADVAFSVNHLLGDPMANVAMAYGSSIASHGK	3341	sp|O95070|YIF1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22		ms_run[1]:scan=432	2.3641689	4	5732.6485	5732.6459	R	D	18	76
PSM	QFILVMNALDNR	3342	sp|Q9UBT2|SAE2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:28	ms_run[1]:scan=1305	7.0904546	2	1415.7233	1415.7226	R	A	108	120
PSM	NLVTEVLGALEAK	3343	sp|Q96HR9|REEP6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=4084	22.200658	2	1355.768226	1355.766031	R	T	16	29
PSM	LKEDGDYQLPVVVLMLNLPR	3344	sp|Q99797|MIPEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1633	8.8689095	3	2311.259489	2311.260990	R	S	457	477
PSM	CLIFPLIVTGQR	3345	sp|Q15070|OXA1L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=6281	34.320074	2	1398.7706	1398.7688	R	E	153	165
PSM	GPNLVESAVPEMIPPTLFGLTEFNPEIQVSR	3346	sp|Q96I51|RCC1L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=5995	32.728386	3	3382.735729	3380.732630	K	I	368	399
PSM	SENVQDLLLLDVTPLSLGIETAGGVMTPLIK	3347	sp|P54652|HSP72_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=3544	19.245302	3	3236.758634	3235.762533	K	R	388	419
PSM	KPLVIIAEDVDGEALSTLVLNR	3348	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=7414	40.675087	4	2363.327532	2364.326427	R	L	269	291
PSM	SLQDIIAILGMDELSEEDKLTVSR	3349	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22	11-UNIMOD:35	ms_run[1]:scan=1688	9.1771368	3	2692.356866	2690.368428	K	A	433	457
PSM	NGDGFVSLEEFLGDYR	3350	sp|Q14257|RCN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=2849	15.431229	2	1817.812845	1816.826794	K	W	201	217
PSM	DDVFLSVPCILGQNGISDLVK	3351	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22	9-UNIMOD:4	ms_run[1]:scan=1730	9.407691	2	2289.156802	2288.172235	K	V	285	306
PSM	DDVFLSVPCILGQNGISDLVK	3352	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22	9-UNIMOD:4	ms_run[1]:scan=2323	12.592757	2	2289.156926	2288.172235	K	V	285	306
PSM	DDVFLSVPCILGQNGISDLVK	3353	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22	9-UNIMOD:4	ms_run[1]:scan=2224	12.06018	2	2289.156926	2288.172235	K	V	285	306
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	3354	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22	27-UNIMOD:4	ms_run[1]:scan=8006	43.965518	3	3515.672146	3512.695593	R	R	85	117
PSM	VSSLFGILSPSSDLTLSSVLWDR	3355	sp|Q8WUM0|NU133_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=6826	37.366446	2	2477.291486	2478.300606	K	E	259	282
PSM	ISLHPIEDNPIEEISVLSPEDLEAIKNPDSITNQIALLEAR	3356	sp|Q9NTJ3|SMC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1010	5.4436558	5	4536.372243	4535.364670	K	C	1042	1083
PSM	AQAALQAVNSVQSGNLALAASAAAVDAGMAMAGQSPVLR	3357	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=5444	29.681726	3	3682.858786	3679.877413	R	I	147	186
PSM	AAAGYAACLLPGAGARPEVEALDASLEDLLTR	3358	sp|Q9NUP1|BL1S4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21	8-UNIMOD:4	ms_run[2]:scan=1001	5.3967	3	3240.6449	3240.6449	R	V	64	96
PSM	ANWPENGLQLAEIFFTAEK	3359	sp|P50748|KNTC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6366	34.781	2	2177.0793	2177.0793	K	T	640	659
PSM	AVITSLLDQIPEMFADTR	3360	sp|P53992|SC24C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=3934	21.384	2	2019.0347	2019.0347	R	E	596	614
PSM	CYLEELLHILTDADPEVCKK	3361	sp|Q9NZQ3-5|SPN90_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:4,18-UNIMOD:4	ms_run[2]:scan=282	1.5525	3	2445.192	2445.1920	R	M	412	432
PSM	DKPSGDTAAVFEEGGDVDDLLDMI	3362	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=3418	18.542	3	2508.1214	2508.1214	K	-	709	733
PSM	DLEHLMLLIGELYKK	3363	sp|Q92621|NU205_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=840	4.5635	3	1814.0012	1814.0012	R	N	438	453
PSM	DLPPSVHLLTLASWGPEMVLLR	3364	sp|O00754-2|MA2B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=3706	20.11	3	2443.3297	2443.3297	R	L	894	916
PSM	DSGTLTLGLLLRPEGLTSVLELGPEADQPEAAK	3365	sp|Q9H6R4-3|NOL6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=2317	12.557	3	3389.793	3389.7930	K	F	546	579
PSM	DVLKEEGVSFLINTFEGGGCGQPSGILAQPTLLYLR	3366	sp|P78527-2|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21	20-UNIMOD:4	ms_run[2]:scan=6158	33.647	3	3877.9924	3877.9924	K	G	1210	1246
PSM	DVNFEFPEFQL	3367	sp|P62081|RS7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=2040	11.037	2	1383.6347	1383.6347	K	-	184	195
PSM	EPEAFDWSPVVTYVCDLEGNR	3368	sp|P40261|NNMT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21	15-UNIMOD:4	ms_run[2]:scan=2194	11.889	2	2482.1111	2482.1111	K	V	101	122
PSM	FDLLFIMLDQMDPEQDREISDHVLR	3369	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=3078	16.703	3	3074.4841	3074.4841	R	M	479	504
PSM	FMDSVIFTLYNYASNQREEYLLLR	3370	sp|P46940|IQGA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6110	33.379	3	2984.4742	2984.4742	K	L	1001	1025
PSM	GFLFGPSLAQELGLGCVLIR	3371	sp|P07741-2|APT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21	16-UNIMOD:4	ms_run[2]:scan=5052	27.501	3	2146.1609	2146.1609	R	K	68	88
PSM	GILEEPLPSTSSEEEDPLAGISLPEGVDPSFLAALPDDIR	3372	sp|Q7Z6Z7-2|HUWE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6398	34.959	3	4175.0685	4175.0685	R	R	2942	2982
PSM	GLMTLQALYGTIPQIFGK	3373	sp|Q96AX1|VP33A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=2144	11.615	2	1950.0649	1950.0649	K	G	178	196
PSM	GLSDFLGVISDTFAPSPDK	3374	sp|Q9NW68-5|BSDC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4212	22.894	2	1964.9731	1964.9731	K	T	77	96
PSM	GQDMETEAHQNKLEEMINELAVAMTAVK	3375	sp|Q15363|TMED2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21	16-UNIMOD:35	ms_run[2]:scan=2595	14.049	4	3145.473	3145.4730	K	H	118	146
PSM	GVVEYFGLDPEDVDVMMGTFTK	3376	sp|O15270|SPTC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=2914	15.791	2	2448.1229	2448.1229	R	S	358	380
PSM	IEQLSPFPFDLLLK	3377	sp|Q02218-2|ODO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=458	2.4957	2	1658.9283	1658.9283	R	E	926	940
PSM	IGNILDLCTALSALSGIPADK	3378	sp|Q9Y4E8-2|UBP15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21	8-UNIMOD:4	ms_run[2]:scan=3157	17.138	2	2141.1402	2141.1402	K	M	470	491
PSM	IPNFWVTTFVNHPQVSALLGEEDEEALHYLTR	3379	sp|Q01105-3|SET_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=3715	20.16	4	3724.8526	3724.8526	K	V	66	98
PSM	LCYVALDFEQEMATAASSSSLEK	3380	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21	2-UNIMOD:4	ms_run[2]:scan=4884	26.548	2	2549.1666	2549.1666	K	S	216	239
PSM	LGYVCPQEVAPMLQQFIRPWCTSLR	3381	sp|O14787-2|TNPO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21	5-UNIMOD:4,21-UNIMOD:4	ms_run[2]:scan=1125	6.0859	3	3048.5136	3048.5136	R	N	775	800
PSM	LTLMEEVLLLGLK	3382	sp|Q9H4A6|GOLP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=2318	12.563	2	1470.8731	1470.8731	R	D	60	73
PSM	LVDISYGGENGFNQAIELSTEVLSNVK	3383	sp|P62495-2|ERF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5629	30.693	2	2895.4502	2895.4502	K	F	220	247
PSM	LVNLYGLLHGLQAAVAQQDTLMEAR	3384	sp|Q92974-3|ARHG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6457	35.294	4	2723.4429	2723.4429	R	F	714	739
PSM	NLLGELNPSIPLLPDDILSQIR	3385	sp|Q8WXH0|SYNE2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5049	27.484	2	2429.353	2429.3530	K	K	2745	2767
PSM	QEGLDGGLPEEVLFGNLDLLPPPGK	3386	sp|Q8N163-2|CCAR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=701	3.79	2	2603.3483	2603.3483	R	S	764	789
PSM	QIPVVGSVLNWFSPVQALQK	3387	sp|Q6P996-3|PDXD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=2374	12.863	2	2209.2259	2209.2259	R	G	549	569
PSM	QITSISIEPGVEVEVTIADA	3388	sp|P60866|RS20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7422	40.718	2	2070.0732	2070.0732	K	-	100	120
PSM	QLLLSELLEHLLEK	3389	sp|P42575-3|CASP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7177	39.342	3	1676.9713	1676.9713	K	D	33	47
PSM	QQWDAAIYFMEEALQAR	3390	sp|O60313-13|OPA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4562	24.811	3	2068.9677	2068.9677	K	L	703	720
PSM	SGVAYIAAPSGSAADKVVIEACDELGIILAHTNLR	3391	sp|P31939-2|PUR9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21	22-UNIMOD:4	ms_run[2]:scan=5929	32.385	3	3580.8559	3580.8559	R	L	553	588
PSM	STAPLLDVFSSMLK	3392	sp|Q9BTC0|DIDO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=2044	11.059	2	1507.7956	1507.7956	K	D	825	839
PSM	SVEQTLLPLVSQITTLINHK	3393	sp|Q9UBT7-3|CTNL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5498	29.978	3	2233.2682	2233.2682	R	D	36	56
PSM	TDQFPLFLIIMGK	3394	sp|Q9UNN5-2|FAF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=3874	21.047	2	1521.8265	1521.8265	K	R	293	306
PSM	TISSSLAVVDLIDAIQPGCINYDLVK	3395	sp|P13797-3|PLST_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21	19-UNIMOD:4	ms_run[2]:scan=4427	24.097	2	2803.4677	2803.4677	K	S	503	529
PSM	VSTYTNAFAFTQFGVLCAPWNGLLMDR	3396	sp|Q8NBI5|S43A3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21	17-UNIMOD:4	ms_run[2]:scan=6720	36.757	3	3078.4732	3078.4732	R	L	315	342
PSM	VVPSDLYPLVLGFLR	3397	sp|Q14978-3|NOLC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6235	34.07	2	1686.9709	1686.9709	R	D	9	24
PSM	WLPAGDALLQMITIHLPSPVTAQK	3398	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21	11-UNIMOD:35	ms_run[2]:scan=5967	32.575	3	2615.4145	2615.4145	R	Y	343	367
PSM	YYNWTTAAPLLLAMQAFQKPLPK	3399	sp|Q14693|LPIN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=2511	13.592	3	2664.4138	2664.4138	K	A	513	536
PSM	DMAIATGGAVFGEEGLTLNLEDVQPHDLGK	3400	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=6878	37.659534	3	3096.513163	3096.507381	K	V	315	345
PSM	GILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVK	3401	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=8134	44.6762	4	4035.866354	4035.887504	K	L	272	310
PSM	FGANAILGVSLAVCK	3402	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21	14-UNIMOD:4	ms_run[1]:scan=6903	37.802932	2	1518.826897	1518.822835	K	A	106	121
PSM	SGETEDTFIADLVVGLCTGQIK	3403	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21	17-UNIMOD:4	ms_run[1]:scan=5718	31.180693	3	2353.155998	2352.151893	R	T	373	395
PSM	NWMNSLGVNPHVNHLYADLQDALVILQLYER	3404	sp|P13797|PLST_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21	3-UNIMOD:35	ms_run[1]:scan=6298	34.414457	4	3649.835719	3650.830387	R	I	405	436
PSM	TLSSSTQASIEIDSLYEGIDFYTSITR	3405	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21		ms_run[1]:scan=5827	31.801727	3	2997.4882	2996.4502	R	A	273	300
PSM	TLSSSTQASIEIDSLYEGIDFYTSITR	3406	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=5507	30.028551	3	2995.449635	2996.450243	R	A	273	300
PSM	GVPQIEVTFDIDANGILNVSAVDK	3407	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=8130	44.653764	2	2513.281557	2513.301334	R	S	470	494
PSM	ALDLFSDNAPPPELLEIINEDIAK	3408	sp|Q15084|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=6399	34.965012	4	2637.368952	2636.358515	R	R	265	289
PSM	VNPTVFFDIAVDGEPLGR	3409	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21		ms_run[1]:scan=7405	40.622169	2	1946.0132	1944.9942	M	V	2	20
PSM	VVPSDLYPLVLGFLR	3410	sp|Q14978|NOLC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=6682	36.54504	2	1686.972974	1686.970879	R	D	9	24
PSM	QIGLDQIWDDLR	3411	sp|Q13616|CUL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:28	ms_run[1]:scan=2625	14.20621	2	1453.7199	1453.7196	K	A	14	26
PSM	DYLMSTHFWGPVANWGLPIAAINDMK	3412	sp|Q9Y5U8|MPC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=3406	18.47462	3	2947.409138	2946.419692	R	K	20	46
PSM	AEEGIAAGGVMDVNTALQEVLK	3413	sp|P25398|RS12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1	ms_run[1]:scan=5085	27.689323	3	2257.1372	2256.1302	M	T	2	24
PSM	KLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTALPDEDDDL	3414	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21	13-UNIMOD:35,23-UNIMOD:35	ms_run[1]:scan=6312	34.489785	4	5419.6412	5418.6042	R	-	167	217
PSM	SHIQIPPGLTELLQGYTVEVLR	3415	sp|P13861|KAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1	ms_run[1]:scan=7467	40.963711	2	2505.3672	2504.3632	M	Q	2	24
PSM	CSSAFQNLLPFYSPVVEDFIK	3416	sp|Q96ER3|SAAL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21	1-UNIMOD:4	ms_run[1]:scan=4969	27.028106	3	2460.208490	2460.203535	K	I	430	451
PSM	EQLIIPQVPLFNILAK	3417	sp|Q53GS9|SNUT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=576	3.1016964	2	1835.094399	1835.092057	K	F	406	422
PSM	NYLPAINGIVFLVDCADHSR	3418	sp|Q9NR31|SAR1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21	15-UNIMOD:4	ms_run[1]:scan=998	5.3774663	3	2274.114231	2273.126287	K	L	88	108
PSM	LCYVALDFENEMATAASSSSLEK	3419	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21	2-UNIMOD:4,12-UNIMOD:35	ms_run[1]:scan=4663	25.356934	2	2551.1692	2551.1452	K	S	218	241
PSM	CMQLTDFILK	3420	sp|P50914|RL14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=255	1.4028184	2	1250.6040	1250.6034	K	F	54	64
PSM	SGTIFDNFLITDDEEYADNFGKATWGETK	3421	sp|Q96L12|CALR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=3304	17.911889	3	3284.514953	3283.483334	R	G	309	338
PSM	FQSSAVMALQEACESYLVGLFEDTNLCVIHAK	3422	sp|Q16695|H31T_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=2063	11.168696	4	3631.740791	3629.720427	R	R	85	117
PSM	SEAANGNLDFVLSFLK	3423	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1701	9.2529056	3	1724.864360	1723.878101	R	S	514	530
PSM	GPGTSFEFALAIVEALNGK	3424	sp|Q99497|PARK7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=6934	37.983015	2	1920.988911	1919.999279	R	E	157	176
PSM	NLILFLGDGLGVPTVTATR	3425	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=5932	32.398083	2	1957.090547	1956.104413	K	I	54	73
PSM	LCYVALDFEQEMAMVASSSSLEK	3426	sp|P0CG39|POTEJ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21	2-UNIMOD:4	ms_run[1]:scan=6954	38.097982	3	2606.190563	2607.190663	K	S	879	902
PSM	YALQMEQLNGILLHLESELAQTR	3427	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=7198	39.462964	4	2668.385423	2669.384687	R	A	331	354
PSM	QGLNGVPILSEEELSLLDEFYK	3428	sp|Q14444|CAPR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=5583	30.450389	3	2494.260844	2492.268637	K	L	170	192
PSM	ALSIPPNIDVLLCEQEVVADETPAVQAVLR	3429	sp|Q8NE71-2|ABCF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20	13-UNIMOD:4	ms_run[2]:scan=3002	16.281	3	3258.717	3258.7170	R	A	315	345
PSM	CLELFSELAEDK	3430	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:4	ms_run[2]:scan=6277	34.295	2	1452.6806	1452.6806	K	E	412	424
PSM	CLELFSELAEDK	3431	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:4	ms_run[2]:scan=6371	34.81	2	1452.6806	1452.6806	K	E	412	424
PSM	CLFAMPETAIGLFPDVGGGYFLPR	3432	sp|Q6NVY1-2|HIBCH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:4	ms_run[2]:scan=5483	29.898	2	2627.2916	2627.2916	K	L	163	187
PSM	CPESGEHYEVTLLHFLQEYL	3433	sp|Q86TI2|DPP9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:4	ms_run[2]:scan=6728	36.802	3	2463.1417	2463.1417	R	-	844	864
PSM	DGTVLCELINALYPEGQAPVK	3434	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20	6-UNIMOD:4	ms_run[2]:scan=6828	37.378	3	2286.1566	2286.1566	K	K	58	79
PSM	EDFTLLDFINAVK	3435	sp|A0AVT1|UBA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=3745	20.33	2	1523.7872	1523.7872	K	E	964	977
PSM	EIDVDAVASDGVVAAIAISEHVENAGVHSGDATLVTPPQDITAK	3436	sp|P27708|PYR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4551	24.753	3	4381.1925	4381.1925	K	T	1134	1178
PSM	EQPLDEELKDAFQNAYLELGGLGER	3437	sp|P05023-3|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5440	29.659	4	2833.377	2833.3770	K	V	496	521
PSM	ESDDPMAYIHFTAEGEVTFK	3438	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=7254	39.776	3	2286.0151	2286.0151	K	S	365	385
PSM	EVFPFPEVSQDELNEINQFLGPVEK	3439	sp|Q9H845|ACAD9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6915	37.873	2	2903.4229	2903.4229	K	F	52	77
PSM	GASELVAELSTLYQCIR	3440	sp|Q8IXH7-4|NELFD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20	15-UNIMOD:4	ms_run[2]:scan=164	0.89833	2	1908.9615	1908.9615	K	F	394	411
PSM	GFDLASFNPHGISTFIDNDDTVYLFVVNHPEFK	3441	sp|Q15165-1|PON2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=2265	12.278	3	3754.7944	3754.7944	R	N	105	138
PSM	GILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVK	3442	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=787	4.2668	5	4035.8875	4035.8875	K	L	272	310
PSM	GTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDK	3443	sp|P62191-2|PRS4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=723	3.9108	4	4045.983	4045.9830	R	D	31	69
PSM	HLVFPLLEFLSVK	3444	sp|P60228|EIF3E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=805	4.3679	3	1540.9017	1540.9017	R	E	17	30
PSM	ILLDQVEEAVADFDECIR	3445	sp|O94826|TOM70_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20	16-UNIMOD:4	ms_run[2]:scan=5657	30.846	2	2134.0252	2134.0252	K	L	412	430
PSM	IVLFDTLLEEYSVLNK	3446	sp|O75844|FACE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=3278	17.77	2	1895.0292	1895.0292	R	D	277	293
PSM	LEAAGGPSALNFDSPSSLFESLISPIK	3447	sp|Q8IUF8-2|RIOX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5826	31.796	2	2746.4065	2746.4065	K	T	24	51
PSM	LGYVCPQEVAPMLQQFIRPWCTSLR	3448	sp|O14787-2|TNPO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20	5-UNIMOD:4,21-UNIMOD:4	ms_run[2]:scan=1323	7.1849	3	3048.5136	3048.5136	R	N	775	800
PSM	LLSYQTSLVSDGETWHVMGISSLLPSLEAWK	3449	sp|O43175|SERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=3362	18.235	4	3446.7432	3446.7432	R	Q	492	523
PSM	LSIQPLTQEEFDFVLSLEEKEPS	3450	sp|Q9P016|THYN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=297	1.6384	3	2677.3374	2677.3374	R	-	203	226
PSM	NILDDFREAYFWLR	3451	sp|Q8TCJ2|STT3B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4653	25.302	3	1856.921	1856.9210	R	Q	579	593
PSM	NLLPATLQLIDTYASFTR	3452	sp|Q5T4S7-3|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=2450	13.263	2	2036.0942	2036.0942	K	A	1157	1175
PSM	NPEILAIAPVLLDALTDPSRK	3453	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=3784	20.541	2	2245.2682	2245.2682	R	T	1571	1592
PSM	NSPLTVPMFLSLFSR	3454	sp|Q9BQG0|MBB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=3170	17.199	2	1707.9018	1707.9018	R	H	990	1005
PSM	NVDSNLANLIMNEIVDNGTAVK	3455	sp|Q9UBP0-4|SPAST_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=1132	6.1252	2	2343.174	2343.1740	R	F	201	223
PSM	QSILDMTAVLLACGINPEK	3456	sp|Q9UGM6-2|SYWM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20	13-UNIMOD:4	ms_run[2]:scan=2812	15.249	3	2072.0646	2072.0646	R	S	90	109
PSM	QWVEEFFPSVSLGDPTLETLLR	3457	sp|Q9BU23-3|LMF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5504	30.012	2	2562.3006	2562.3006	R	Q	466	488
PSM	SLLSIPNTDYIQLLSEIAK	3458	sp|O75569-3|PRKRA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=2643	14.31	2	2117.162	2117.1620	R	E	207	226
PSM	SNPEATNQPVTEQEILNIFQGVIGGDNIR	3459	sp|Q9H0H0|INT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6325	34.565	3	3152.5738	3152.5738	K	L	610	639
PSM	STAPLLDVFSSMLK	3460	sp|Q9BTC0|DIDO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=1725	9.3808	2	1507.7956	1507.7956	K	D	825	839
PSM	SVEQTLLPLVSQITTLINHK	3461	sp|Q9UBT7-3|CTNL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5714	31.158	3	2233.2682	2233.2682	R	D	36	56
PSM	SVVPGGGAVEAALSIYLENYATSMGSR	3462	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5252	28.603	2	2698.3272	2698.3272	K	E	407	434
PSM	TIESILEPVAQQISHLVIMHEEGEVDGK	3463	sp|P18206-2|VINC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4399	23.942	4	3100.5751	3100.5751	R	A	8	36
PSM	VDGWEQDLSVPEFPEGLEWLNTEEPISVYK	3464	sp|Q8NBF2|NHLC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4284	23.301	3	3504.6613	3504.6613	K	D	45	75
PSM	VFLEELMAPVASIWLSQDMHR	3465	sp|Q9HAV4|XPO5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20	19-UNIMOD:35	ms_run[2]:scan=6421	35.09	3	2487.229	2487.2290	K	V	667	688
PSM	VGDPAEDFGTFFSAVIDAK	3466	sp|P30038-2|AL4A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=3057	16.585	2	1984.9418	1984.9418	K	S	317	336
PSM	VNPILGPQMFQPILPYVFK	3467	sp|Q9UI26|IPO11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=1737	9.4447	2	2200.2119	2200.2119	K	G	758	777
PSM	YFAQEALTVLSLA	3468	sp|P30153|2AAA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=1643	8.9216	2	1424.7551	1424.7551	K	-	577	590
PSM	YFAQEALTVLSLA	3469	sp|P30153|2AAA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=1740	9.4613	2	1424.7551	1424.7551	K	-	577	590
PSM	WLPAGDALLQMITIHLPSPVTAQK	3470	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20	11-UNIMOD:35	ms_run[1]:scan=4790	26.039305	3	2615.417328	2615.414531	R	Y	343	367
PSM	MTQIMFETFNTPAMYVAIQAVLSLYASGR	3471	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=8538	46.974476	3	3254.589514	3252.602150	K	T	119	148
PSM	IQEIIEQLDVTTSEYEK	3472	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=7332	40.212056	2	2039.037954	2037.015382	R	E	371	388
PSM	VVIGMDVAASEFFR	3473	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=821	4.4567074	2	1540.786797	1539.775550	K	S	240	254
PSM	DALEFWLQAGVDGFQVR	3474	sp|P08195|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=5940	32.443061	2	1950.971410	1949.963562	K	D	332	349
PSM	NYVLQTLGTETYRPSSASQCVAGIACAEIPVNQWPELIPQLVANVTNPNSTEHMK	3475	sp|Q14974|IMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20	20-UNIMOD:4,26-UNIMOD:4	ms_run[1]:scan=4685	25.480284	5	6095.9771	6095.9814	K	E	93	148
PSM	LLQDSVDFSLADAINTEFK	3476	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=8259	45.38374	2	2126.051324	2125.057916	R	N	79	98
PSM	ETEEEKEIADFDIFDDPESPFSTFNFQYPNQAFK	3477	sp|P47712|PA24A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=3108	16.870318	4	4074.804280	4073.800705	R	R	658	692
PSM	GMYGIENEVFLSLPCILNAR	3478	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20	15-UNIMOD:4	ms_run[1]:scan=2266	12.283661	2	2296.144855	2295.139160	K	G	280	300
PSM	CVSTLLDLIQTK	3479	sp|Q10567|AP1B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=6594	36.073021	2	1372.7283	1372.7267	R	V	391	403
PSM	EALLLVTVLTSLSK	3480	sp|Q9NVI1|FANCI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=6857	37.541432	2	1486.908893	1485.901797	K	L	981	995
PSM	ASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGK	3481	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20	45-UNIMOD:4,48-UNIMOD:4	ms_run[1]:scan=4441	24.174775	6	5806.8886	5806.8792	R	I	13	68
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	3482	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20	27-UNIMOD:4	ms_run[1]:scan=8567	47.139155	3	3511.693498	3512.695593	R	R	85	117
PSM	QGLNGVPILSEEELSLLDEFYK	3483	sp|Q14444|CAPR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=5646	30.784449	2	2493.252529	2492.268637	K	L	170	192
PSM	DDLFNTNATIVATLTAACAQHCPEAMICVIANPVNSTIPITAEVFKK	3484	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20	18-UNIMOD:4,22-UNIMOD:4,28-UNIMOD:4	ms_run[1]:scan=7402	40.602687	4	5130.5342	5129.5332	R	H	111	158
PSM	ALSFLGFSAPTPIQALTLAPAIR	3485	sp|Q9GZR7|DDX24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=3656	19.84905	3	2354.337569	2354.336204	R	D	206	229
PSM	FFPEDVSEELIQEITQR	3486	sp|P35241|RADI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=4361	23.732186	3	2079.017437	2079.016051	K	L	84	101
PSM	HLYTADMFTHGIQSAAHFVMFFAPWCGHCQR	3487	sp|Q8NBS9|TXND5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20	20-UNIMOD:35,26-UNIMOD:4,29-UNIMOD:4	ms_run[1]:scan=995	5.360633	5	3738.656841	3738.652974	K	L	64	95
PSM	QLDENISLFLIHLSPYFLLKPAQK	3488	sp|Q9H583|HEAT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=5120	27.888221	4	2826.578039	2826.568388	K	C	89	113
PSM	FFGPNAEISQPPALSQLVNLYLGR	3489	sp|Q9BQ70|TCF25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=3848	20.901517	3	2630.406046	2630.385673	R	S	482	506
PSM	SHIQIPPGLTELLQGYTVEVLR	3490	sp|P13861|KAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1	ms_run[1]:scan=7366	40.397879	2	2504.3636	2504.3634	M	Q	2	24
PSM	FLLTGLLSGLPAPQFAIR	3491	sp|Q9BZH6|WDR11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=2352	12.746499	2	1913.117403	1913.113855	K	M	454	472
PSM	TTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHVEMHLR	3492	sp|Q15393|SF3B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=5290	28.81825	6	4737.356732	4737.353728	K	S	1107	1150
PSM	TTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHVEMHLR	3493	sp|Q15393|SF3B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=5180	28.225686	6	4737.356732	4737.353728	K	S	1107	1150
PSM	AGPQPLALQLEQLLNPRPSEADPEADPEEATAAR	3494	sp|Q9NY61|AATF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1	ms_run[1]:scan=878	4.7584367	3	3635.8212	3635.8062	M	V	2	36
PSM	CMQLTDFILK	3495	sp|P50914|RL14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=161	0.88145785	2	1250.6040	1250.6034	K	F	54	64
PSM	VTNGELLAQYMADAASELGPTTPYGK	3496	sp|Q9NR46|SHLB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=261	1.4343436	3	2697.288664	2696.300348	R	T	88	114
PSM	ALMVEWTDEFKNDPQLSLISAMIK	3497	sp|Q92783|STAM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=248	1.3648186	3	2780.414018	2778.397225	K	N	110	134
PSM	SENVQDLLLLDVTPLSLGIETAGGVMTPLIK	3498	sp|P54652|HSP72_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=3448	18.713052	3	3236.758634	3235.762533	K	R	388	419
PSM	DDVFLSVPCILGQNGISDLVK	3499	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20	9-UNIMOD:4	ms_run[1]:scan=1634	8.8745597	2	2289.156802	2288.172235	K	V	285	306
PSM	LCYVALDFEQEMAMVASSSSLEK	3500	sp|P0CG39|POTEJ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20	2-UNIMOD:4	ms_run[1]:scan=6863	37.575161	3	2606.190563	2607.190663	K	S	879	902
PSM	GGGGGGSPGPTAGPEPLSLPGILHFIQHEWAR	3501	sp|Q9NRL3|STRN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=4576	24.888051	4	3147.583739	3148.584266	K	F	47	79
PSM	SINPDEAVAYGAAVQAAILMGDK	3502	sp|P0DMV8|HS71A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=7453	40.884894	3	2306.173688	2303.146748	K	S	362	385
PSM	TWYVQATCATQGTGLYEGLDWLSNELSK	3503	sp|P18085|ARF4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20	8-UNIMOD:4	ms_run[1]:scan=4227	22.977504	3	3190.496956	3190.491731	R	R	152	180
PSM	AAPEINNLIEEATEFIK	3504	sp|Q8IVP5|FUND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=3233	17.53	3	1900.9782	1900.9782	K	Q	120	137
PSM	AGQLTSEEDTLTLVTADHSHVFSFGGYTLR	3505	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6958	38.12	4	3251.5735	3251.5735	R	G	360	390
PSM	AKEYITPFIRPVMQALLHIIR	3506	sp|O95373|IPO7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=963	5.1982	4	2508.4403	2508.4403	K	E	531	552
PSM	APSNTFHPQDFSDVISFILYGNSHR	3507	sp|Q96Q15-3|SMG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=1042	5.62	4	2848.3569	2848.3569	K	T	222	247
PSM	AQHIVPCTISQLLSATLVDEVFR	3508	sp|P15927|RFA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19	7-UNIMOD:4	ms_run[2]:scan=2790	15.128	2	2596.3683	2596.3683	R	I	43	66
PSM	ASFANEDGQVSPGSLLLAGAIAGMPAASLVTPADVIK	3509	sp|Q9UJS0|CMC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4275	23.248	3	3537.8389	3537.8389	K	T	509	546
PSM	DSWNAGIMTVMSALSVAPSK	3510	sp|Q5XKP0|MIC13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=3047	16.531	3	2064.002	2064.0020	R	A	82	102
PSM	EINTQILFWIQEITEMDKK	3511	sp|Q5JUR7|TEX30_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4893	26.598	3	2378.2192	2378.2192	K	C	207	226
PSM	ENGIQDMEQFYELWLK	3512	sp|Q8IWR0-2|Z3H7A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5265	28.676	2	2041.9455	2041.9455	K	S	3	19
PSM	ESQPLLGTVIDGMLLLK	3513	sp|P23141|EST1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=3707	20.118	2	1826.0223	1826.0223	R	T	314	331
PSM	FDAVSGDYYPIIYFNDYWNLQK	3514	sp|O96005-3|CLPT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=2672	14.471	2	2730.2642	2730.2642	K	D	166	188
PSM	FDGIFESLLPINGLLSGDK	3515	sp|Q9UBC2-4|EP15R_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5586	30.467	2	2034.0674	2034.0674	K	V	131	150
PSM	FMCAQLPNPVLDSISIIDTPGILSGEK	3516	sp|Q9H4M9|EHD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19	3-UNIMOD:4	ms_run[2]:scan=2945	15.963	2	2914.482	2914.4820	R	Q	136	163
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	3517	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19	27-UNIMOD:4	ms_run[2]:scan=8469	46.579	3	3512.6956	3512.6956	R	R	85	117
PSM	GIPEFWFTIFR	3518	sp|Q99733|NP1L4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=3308	17.934	2	1411.7289	1411.7289	K	N	158	169
PSM	GQNDLMGTAEDFADQFLR	3519	sp|O15260-2|SURF4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19	6-UNIMOD:35	ms_run[2]:scan=2639	14.288	2	2042.9004	2042.9004	M	V	2	20
PSM	GVPQIEVTFEIDVNGILR	3520	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4132	22.449	2	1998.0786	1998.0786	R	V	493	511
PSM	ILDNGEWTPTLQHYLSYTEESLLPVMQHLAK	3521	sp|P14635|CCNB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6556	35.859	4	3625.8127	3625.8127	K	N	355	386
PSM	IVAPELYIAVGISGAIQHLAGMK	3522	sp|P13804-2|ETFA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19	22-UNIMOD:35	ms_run[2]:scan=6378	34.849	3	2366.3032	2366.3032	K	D	220	243
PSM	KWYAEAMPFPLNFFLPGR	3523	sp|Q13505-3|MTX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=2100	11.378	3	2183.1026	2183.1026	R	M	125	143
PSM	LGACLAFLPEAFDFIARDPAETLHLSEPLGGK	3524	sp|Q86X76-5|NIT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19	4-UNIMOD:4	ms_run[2]:scan=3641	19.777	4	3454.7595	3454.7595	R	L	77	109
PSM	LGPAPLNLEVPTYEFTSDDMVIVG	3525	sp|P47985|UCRI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=185	1.0151	2	2576.272	2576.2720	R	-	251	275
PSM	LSALGNVTTCNDYVALVHPDLDRETEEILADVLK	3526	sp|P56537|IF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19	10-UNIMOD:4	ms_run[2]:scan=1142	6.179	4	3782.9037	3782.9037	R	V	101	135
PSM	QEGETSSMIFSIPYIISYVSK	3527	sp|Q6P587|FAHD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5794	31.614	2	2378.1716	2378.1716	R	I	158	179
PSM	QIIISEIISSLPSIVNDK	3528	sp|Q15397|PUM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=2659	14.403	3	1968.1143	1968.1143	K	Y	419	437
PSM	QLASGLLLVTGPLVLNR	3529	sp|Q02878|RL6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4829	26.243	2	1763.0669	1763.0669	K	V	167	184
PSM	QLASGLLLVTGPLVLNR	3530	sp|Q02878|RL6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4938	26.849	2	1763.0669	1763.0669	K	V	167	184
PSM	SALSGHLETVILGLLK	3531	sp|P07355|ANXA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7325	40.173	3	1649.9716	1649.9716	K	T	89	105
PSM	SQEPLPDDDEEFELPEFVEPFLK	3532	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=1054	5.6864	2	2748.2694	2748.2694	K	D	367	390
PSM	TEPATGFIDGDLIESFLDISRPK	3533	sp|Q16531-2|DDB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=3087	16.75	2	2520.2748	2520.2748	K	M	393	416
PSM	TIDAMDTWEDLTELGYHLADLPVEPHLGK	3534	sp|Q9H6S0|YTDC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7354	40.333	4	3278.5805	3278.5805	K	M	815	844
PSM	TYLLFFPNDEVMNQNLAYYAAMLGEEHTR	3535	sp|Q32P28-2|P3H1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=3362	18.235	4	3449.606	3449.6060	K	S	326	355
PSM	VILHLKEDQTEYLEER	3536	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6979	38.241	3	2014.0371	2014.0371	K	R	186	202
PSM	SDPMVQCIIEESGEHIIAGAGELHLEICLK	3537	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19	7-UNIMOD:4,28-UNIMOD:4	ms_run[1]:scan=2187	11.847459	4	3349.638356	3347.619985	K	D	530	560
PSM	CPEALFQPSFLGMESCGIHETTFNSIMK	3538	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19	1-UNIMOD:4,16-UNIMOD:4	ms_run[1]:scan=1239	6.7191293	3	3232.449729	3230.454500	R	C	257	285
PSM	GILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVK	3539	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1150	6.2265312	5	4037.897856	4035.887504	K	L	272	310
PSM	LKGYTSWAIGLSVADLAESIMK	3540	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=4149	22.545102	3	2352.245540	2352.239920	K	N	244	266
PSM	FAADIISVLAMTMSGERECLK	3541	sp|Q13200|PSMD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19	19-UNIMOD:4	ms_run[1]:scan=370	2.038421	3	2341.151117	2341.148010	R	Y	121	142
PSM	RDWYVYAFLSSLPWVGK	3542	sp|Q09161|NCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=4730	25.720805	3	2086.071924	2086.067633	R	E	166	183
PSM	EAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPK	3543	sp|O75369|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19	3-UNIMOD:35	ms_run[1]:scan=3600	19.551542	4	4608.187141	4608.182883	R	A	200	240
PSM	EAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPK	3544	sp|O75369|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=4531	24.649115	5	4593.186304	4592.187968	R	A	200	240
PSM	LFGFKEDPFVFIPEDDPLFPPIEK	3545	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=3089	16.760843	3	2835.446337	2835.441122	K	F	512	536
PSM	MNYIGQFLPGYEAPAFMDPLLPK	3546	sp|P32754|HPPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:35	ms_run[1]:scan=1510	8.1731114	3	2628.3122	2627.2802	K	L	150	173
PSM	MNYIGQFLPGYEAPAFMDPLLPK	3547	sp|P32754|HPPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:35	ms_run[1]:scan=1408	7.6367945	3	2628.3122	2627.2802	K	L	150	173
PSM	AEEGIAAGGVMDVNTALQEVLK	3548	sp|P25398|RS12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1	ms_run[1]:scan=5508	30.034201	2	2256.1309	2256.1302	M	T	2	24
PSM	LHIQNPSFSQINQLVSTIMSASTTTLR	3549	sp|P23258|TBG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=6676	36.508396	4	2985.562454	2986.554606	R	Y	218	245
PSM	FGVEQDVDMVFASFIR	3550	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=6662	36.432006	3	1858.893668	1858.892371	K	K	231	247
PSM	FTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGK	3551	sp|Q9Y3C6|PPIL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=6600	36.106721	3	3496.696590	3495.713291	K	H	92	126
PSM	QPMVPESLADYITAAYVEMR	3552	sp|P33993|MCM7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19	3-UNIMOD:35	ms_run[1]:scan=3198	17.358212	3	2300.1132	2299.0862	K	R	570	590
PSM	AVADLALIPDVDIDSDGVFK	3553	sp|Q9NRX4|PHP14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1	ms_run[1]:scan=4223	22.956179	2	2114.0808	2114.0778	M	Y	2	22
PSM	AMGIMNSFVNDIFER	3554	sp|P33778|H2B1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=861	4.6691305	2	1743.811815	1742.812012	K	I	59	74
PSM	GVPQIEVTFEIDVNGILR	3555	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=5827	31.801727	2	1999.079139	1998.078592	R	V	493	511
PSM	GIFVQSLIPFYVATSMTAPSNFLHR	3556	sp|Q3SXM5|HSDL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=3715	20.16023	3	2795.453186	2795.446893	K	C	240	265
PSM	VEVAPGYVVTVLTWPGTNPTLSSILLNSHTDVVPVFK	3557	sp|Q03154|ACY1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=5907	32.258742	3	3951.131322	3949.124093	K	E	52	89
PSM	AAFAVEPQGPALGSEPMMLGSPTSPKPGVNAQFLPGFLMGDLPAPVTPQPR	3558	sp|Q8NFH5|NUP35_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1	ms_run[1]:scan=4947	26.90202	4	5211.6277	5211.6230	M	S	2	53
PSM	CLFTLLGHLDYIR	3559	sp|P53621|COPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=6311	34.484135	2	1602.8247	1602.8223	R	T	85	98
PSM	KPDVLLYDTIFQIFNNR	3560	sp|P49662|CASP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1008	5.4324246	3	2096.114337	2095.110226	K	N	225	242
PSM	SENVQDLLLLDVTPLSLGIETAGGVMTPLIK	3561	sp|P54652|HSP72_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19		ms_run[1]:scan=3644	19.790225	3	3236.7582	3235.7622	K	R	388	419
PSM	MGVEAVIALLEATPDTPACVVSLNGNHAVR	3562	sp|Q01813|PFKAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19	19-UNIMOD:4	ms_run[1]:scan=655	3.5379966	3	3103.568168	3103.579441	R	L	325	355
PSM	MGVEAVIALLEATPDTPACVVSLNGNHAVR	3563	sp|Q01813|PFKAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19	19-UNIMOD:4	ms_run[1]:scan=667	3.6020217	4	3104.566803	3103.579441	R	L	325	355
PSM	SGTIFDNFLITDDEEYADNFGKATWGETK	3564	sp|Q96L12|CALR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=3401	18.446539	3	3284.514953	3283.483334	R	G	309	338
PSM	QVLEDFPTISLEFR	3565	sp|P37268|FDFT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:28	ms_run[1]:scan=148	0.8058245	2	1675.8472	1675.8452	R	N	120	134
PSM	QVHLLPGLWEQGWCEITAHLLALPEHDAR	3566	sp|Q9H173|SIL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19	14-UNIMOD:4	ms_run[1]:scan=4295	23.361575	5	3387.726617	3388.713901	R	E	366	395
PSM	FMPVSSLIVGVDLVPIKPLPNVVTLQQDITTER	3567	sp|Q8IY81|SPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=3547	19.262267	3	3621.002711	3618.010643	K	C	65	98
PSM	IPNFWVTTFVNHPQVSALLGEEDEEALHYLTR	3568	sp|Q01105|SET_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1608	8.7275594	4	3724.858124	3724.852562	K	V	91	123
PSM	IPNFWVTTFVNHPQVSALLGEEDEEALHYLTR	3569	sp|Q01105|SET_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1410	7.6459737	4	3724.858124	3724.852562	K	V	91	123
PSM	SENVQDLLLLDVTPLSLGIETAGGVMTVLIK	3570	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=3644	19.790225	3	3236.758634	3237.778183	K	R	385	416
PSM	LTTVLNSGFLDEWLTLEDVPSGR	3571	sp|Q9BSJ8|ESYT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=3875	21.052672	3	2563.290100	2561.301334	R	L	738	761
PSM	ENVSILAEDLEGSLASSVAGPNSESMIFETTTK	3572	sp|Q8WUM0|NU133_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=120	0.64680349	3	3426.650122	3425.639577	R	N	477	510
PSM	ADFADISILSDF	3573	sp|Q6P1K1-2|HRG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=2119	11.481	2	1312.6187	1312.6187	R	-	78	90
PSM	DFSWSPGGNIIAFWVPEDK	3574	sp|P55884|EIF3B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=4380	23.841	2	2164.0266	2164.0266	K	D	469	488
PSM	DLGVLDVIFHPTQPWVFSSGADGTVR	3575	sp|Q14137-2|BOP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=6353	34.708	2	2812.4184	2812.4184	R	L	606	632
PSM	DSLLQDGEFSMDLR	3576	sp|P07737|PROF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=7200	39.474	2	1624.7403	1624.7403	R	T	76	90
PSM	DYDSFVLPLLEDKQPCYILFR	3577	sp|Q12792|TWF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18	16-UNIMOD:4	ms_run[2]:scan=1196	6.4825	3	2630.3091	2630.3091	K	L	52	73
PSM	ECANGYLELLDHVLLTLQKPSPELK	3578	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18	2-UNIMOD:4	ms_run[2]:scan=3220	17.465	4	2879.5103	2879.5103	R	Q	2242	2267
PSM	ELNELVSAIEEHFFQPQK	3579	sp|Q96G03|PGM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=461	2.5126	3	2157.0742	2157.0742	K	Y	587	605
PSM	FGANAILGVSLAVCK	3580	sp|P06733-2|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18	14-UNIMOD:4	ms_run[2]:scan=4406	23.983	2	1518.8228	1518.8228	K	A	13	28
PSM	FLSDFRDLMSWINGIR	3581	sp|Q13813-3|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=5824	31.785	2	1968.988	1968.9880	R	G	1324	1340
PSM	GADPGMPEPTVLSLLWG	3582	sp|Q9P0U1|TOM7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18	6-UNIMOD:35	ms_run[2]:scan=4963	26.994	2	1754.8549	1754.8549	R	-	39	56
PSM	GLDVDSLVIEHIQVNK	3583	sp|P18621-2|RL17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=7155	39.221	3	1777.9574	1777.9574	K	A	68	84
PSM	GMTLVTPLQLLLFASK	3584	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18	2-UNIMOD:35	ms_run[2]:scan=2558	13.857	2	1746.9954	1746.9954	K	K	1058	1074
PSM	GMYGIENEVFLSLPCILNAR	3585	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18	15-UNIMOD:4	ms_run[2]:scan=2082	11.278	3	2295.1392	2295.1392	K	G	280	300
PSM	GPVVLAEDFLDIMGQPINPQCR	3586	sp|P21281|VATB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18	21-UNIMOD:4	ms_run[2]:scan=1793	9.7455	2	2468.2192	2468.2192	R	I	142	164
PSM	GVPQIEVTFDIDANGILNVSAVDK	3587	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=8453	46.487	2	2513.3013	2513.3013	R	S	470	494
PSM	KEGLAPPSPSLVSDLLSELNISEIQK	3588	sp|Q8TD16|BICD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=1371	7.4458	3	2763.4906	2763.4906	K	L	322	348
PSM	LCYVALDFEQEMATAASSSSLEK	3589	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18	2-UNIMOD:4	ms_run[2]:scan=1988	10.755	2	2549.1666	2549.1666	K	S	216	239
PSM	LGLALNFSVFHYEIANSPEEAISLAK	3590	sp|P31947|1433S_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=7244	39.719	3	2832.4698	2832.4698	R	T	170	196
PSM	LLIVSNPVDILTYVAWK	3591	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=6081	33.217	2	1943.1132	1943.1132	K	I	133	150
PSM	LLQDSVDFSLADAINTEFK	3592	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=2660	14.408	2	2125.0579	2125.0579	R	N	79	98
PSM	LNPQEEVDMPVFFYIDPEFAEDPR	3593	sp|Q9Y6N1|COX11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=2204	11.946	3	2896.3266	2896.3266	R	M	225	249
PSM	LWDISEVMVGLLK	3594	sp|Q9HBH5|RDH14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=5442	29.67	2	1501.8214	1501.8214	K	-	324	337
PSM	NYQFDFLRPQHSLFNYFTKLVEQYTK	3595	sp|Q15459-2|SF3A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=5502	30	5	3325.656	3325.6560	R	I	127	153
PSM	QIGLDQIWDDLR	3596	sp|Q13616|CUL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=2627	14.217	2	1470.7467	1470.7467	K	A	14	26
PSM	QSTCSPGDHIIEITEVEEDLFPAETVELLR	3597	sp|P28290-2|ITPI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18	4-UNIMOD:4	ms_run[2]:scan=120	0.6468	3	3426.6501	3426.6501	K	E	456	486
PSM	SFAPILPHLAEEVFQHIPYIK	3598	sp|Q9NSE4|SYIM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=2170	11.752	3	2448.3206	2448.3206	R	E	833	854
PSM	VANILINLYGMTAVLSR	3599	sp|Q9H845|ACAD9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=1084	5.8541	3	1847.0339	1847.0339	R	A	533	550
PSM	VVIGMDVAASEFFR	3600	sp|P06733-2|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=1341	7.2785	2	1539.7755	1539.7755	K	S	147	161
PSM	WLPAGDALLQMITIHLPSPVTAQK	3601	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18	11-UNIMOD:35	ms_run[1]:scan=6167	33.697136	3	2615.417822	2615.414531	R	Y	343	367
PSM	SDPMVQCIIEESGEHIIAGAGELHLEICLK	3602	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18	7-UNIMOD:4,28-UNIMOD:4	ms_run[1]:scan=2060	11.151865	3	3348.629128	3347.619985	K	D	530	560
PSM	MTQIMFETFNTPAMYVAIQAVLSLYASGR	3603	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18		ms_run[1]:scan=8711	47.963099	3	3253.6002	3252.6012	K	T	119	148
PSM	VFIMDSCDELIPEYLNFIR	3604	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18	7-UNIMOD:4	ms_run[1]:scan=919	4.9822141	2	2374.140682	2373.138492	R	G	360	379
PSM	DMAIATGGAVFGEEGLTLNLEDVQPHDLGK	3605	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=4235	23.022535	3	3096.509716	3096.507381	K	V	315	345
PSM	DMAIATGGAVFGEEGLTLNLEDVQPHDLGK	3606	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18	2-UNIMOD:35	ms_run[1]:scan=8587	47.253659	3	3113.505392	3112.502296	K	V	315	345
PSM	CGEEIAVQFVDMVK	3607	sp|O43175|SERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=2481	13.423624	2	1606.7384	1606.7366	R	G	295	309
PSM	DLADELALVDVIEDKLK	3608	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1270	6.8959378	2	1898.026984	1898.024825	K	G	43	60
PSM	GLYGIKDDVFLSVPCILGQNGISDLVK	3609	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18	15-UNIMOD:4	ms_run[1]:scan=1169	6.3331709	3	2921.540972	2919.541582	K	V	279	306
PSM	DDVFLSVPCILGQNGISDLVK	3610	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18	9-UNIMOD:4	ms_run[1]:scan=2160	11.698234	3	2289.158842	2288.172235	K	V	285	306
PSM	VTPQSLFILFGVYGDVQR	3611	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1083	5.8484914	3	2038.089261	2038.088763	R	V	349	367
PSM	EGIPVMRPLWVQYPQDVTTFNIDDQYLLGDALLVHPVSDSGAHGVQVYLPGQGEVWYDIQSYQK	3612	sp|Q14697|GANAB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18		ms_run[1]:scan=5136	27.978215	5	7243.5592	7243.5702	R	H	721	785
PSM	TPIIIIPAATTSLITMLNAK	3613	sp|Q6P1J9|CDC73_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1639	8.9026055	3	2081.219187	2081.217000	R	D	359	379
PSM	MELITILEK	3614	sp|Q14974|IMB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1	ms_run[1]:scan=5230	28.479794	2	1130.6264	1130.6252	-	T	1	10
PSM	WFDIGCLVVEDPVHGIHLETFTQATPVPLEFVQQAQSLTPQDYNLR	3615	sp|Q96M27|PRRC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18	6-UNIMOD:4	ms_run[1]:scan=7002	38.369447	4	5307.6290	5307.6334	K	W	343	389
PSM	ITPLEIEVLEETVQTMDTS	3616	sp|Q99436|PSB7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18	16-UNIMOD:35	ms_run[1]:scan=4014	21.826797	2	2165.0862	2163.0502	K	-	259	278
PSM	VLLVSPELQAAVEEILPSLKK	3617	sp|O14975|S27A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=2120	11.486384	3	2276.347626	2275.340286	K	D	154	175
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	3618	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=8353	45.917786	3	3585.665704	3585.694213	R	R	85	117
PSM	DFVSEQLTSLLVNGVQLPALGENKK	3619	sp|P54136|SYRC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=3255	17.648593	3	2699.444204	2698.454147	K	V	169	194
PSM	KLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTALPDEDDDL	3620	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18	13-UNIMOD:35	ms_run[1]:scan=1601	8.6880575	4	5402.6059	5402.6097	R	-	167	217
PSM	GVPQIEVTFEIDVNGILR	3621	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=5190	28.279459	2	1999.075578	1998.078592	R	V	493	511
PSM	LQEDPPAGVSGAPSENNIMVWNAVIFGPEGTPFEDGTFK	3622	sp|P49459|UBE2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18	19-UNIMOD:35	ms_run[1]:scan=1831	9.9344518	3	4134.973116	4132.936428	R	L	16	55
PSM	GPGTSFEFALAIVEALNGKEVAAQVK	3623	sp|Q99497|PARK7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=4450	24.224094	3	2646.396906	2645.406468	R	A	157	183
PSM	KPDVLLYDTIFQIFNNR	3624	sp|P49662|CASP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1171	6.3443937	3	2096.114337	2095.110226	K	N	225	242
PSM	ERWENPLMGWASTADPLSNMVLTFSTK	3625	sp|O43181|NDUS4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=6314	34.501066	3	3079.471432	3080.473578	R	E	105	132
PSM	MKHDDTTISSWLQSLASFCGAVFR	3626	sp|Q8NI27|THOC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:35,19-UNIMOD:4	ms_run[1]:scan=3634	19.73534	4	2773.304999	2772.299971	R	K	628	652
PSM	DMAIATGGAVFGEEGLTLNLEDVQPHDLGK	3627	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=8910	48.988108	3	3099.517599	3096.507381	K	V	315	345
PSM	MTQIMFEAFNTPAMYVAIQAVLSLYASGR	3628	sp|Q562R1|ACTBL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18	5-UNIMOD:35,14-UNIMOD:35	ms_run[1]:scan=8711	47.963099	3	3253.601525	3254.581415	K	T	120	149
PSM	LCYVALDFEQEMATAASSSSLEK	3629	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18	2-UNIMOD:4	ms_run[1]:scan=4663	25.356934	2	2551.169720	2549.166557	K	S	216	239
PSM	ATSPADALQYLLQFAR	3630	sp|Q96HW7|INT4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=5187	28.262561	2	1763.926397	1763.920634	K	K	46	62
PSM	VLPGAFDNLLEWPFAR	3631	sp|Q9BUZ4|TRAF4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1115	6.0308958	2	1844.965799	1843.962105	R	R	369	385
PSM	NNFSDTGNFGFGIQEHIDLGIK	3632	sp|P62913|RL11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=7139	39.134028	3	2422.162352	2422.155339	K	Y	97	119
PSM	AQLVVIAHDVDPIELVVFLPALCR	3633	sp|P62424|RL7A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17	23-UNIMOD:4	ms_run[2]:scan=3685	19.992	3	2686.488	2686.4880	K	K	152	176
PSM	ATENTVNPCPDDTLISFLPLAHMFER	3634	sp|P33121-2|ACSL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17	9-UNIMOD:4	ms_run[2]:scan=3816	20.72	3	2987.4157	2987.4157	K	V	303	329
PSM	CMQLTDFILK	3635	sp|P50914|RL14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:4	ms_run[2]:scan=198	1.0907	2	1267.6305	1267.6305	K	F	54	64
PSM	DFVSEQLTSLLVNGVQLPALGENKK	3636	sp|P54136-2|SYRC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=2891	15.67	4	2698.4541	2698.4541	K	V	97	122
PSM	DKPSGDTAAVFEEGGDVDDLLDMI	3637	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=3595	19.526	2	2508.1214	2508.1214	K	-	709	733
PSM	DMAIATGGAVFGEEGLTLNLEDVQPHDLGK	3638	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17	2-UNIMOD:35	ms_run[2]:scan=8458	46.516	3	3112.5023	3112.5023	K	V	315	345
PSM	DTELAEELLQWFLQEEK	3639	sp|Q00610-2|CLH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=7592	41.66	3	2120.0314	2120.0314	K	R	1546	1563
PSM	DVPSLGVLQEGLLCQGDSLGEVQDLLVR	3640	sp|Q9UIF9-2|BAZ2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17	14-UNIMOD:4	ms_run[2]:scan=4881	26.528	3	3008.5489	3008.5489	K	L	848	876
PSM	GPEYLTQMWHFMCDALIK	3641	sp|O00410-2|IPO5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17	13-UNIMOD:4	ms_run[2]:scan=3365	18.252	3	2239.0264	2239.0264	R	A	678	696
PSM	LCYVALDFEQEMATAASSSSLEK	3642	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17	2-UNIMOD:4	ms_run[2]:scan=5200	28.335	2	2549.1666	2549.1666	K	S	216	239
PSM	MEYEWKPDEQGLQQILQLLK	3643	sp|Q92973-3|TNPO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=818	4.4398	3	2488.2672	2488.2672	K	E	9	29
PSM	NILDDFREAYFWLR	3644	sp|Q8TCJ2|STT3B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=4673	25.413	2	1856.921	1856.9210	R	Q	579	593
PSM	STTTIGLVQALGAHLYQNVFACVR	3645	sp|P11586|C1TC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17	22-UNIMOD:4	ms_run[2]:scan=3531	19.176	3	2618.3639	2618.3639	K	Q	387	411
PSM	VQLLDYVISSFYPEIQAAHASDSVQR	3646	sp|Q9BVL4|SELO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=3985	21.674	3	2935.4716	2935.4716	R	N	281	307
PSM	VVIGMDVAASEFFR	3647	sp|P06733-2|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=7120	39.028	2	1539.7755	1539.7755	K	S	147	161
PSM	YLTLDIFAGPPNYPFSDEY	3648	sp|Q04828|AK1C1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=5104	27.799	2	2221.0256	2221.0256	R	-	305	324
PSM	WLPAGDALLQMITIHLPSPVTAQK	3649	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17	11-UNIMOD:35	ms_run[1]:scan=5862	32.00071	3	2615.417822	2615.414531	R	Y	343	367
PSM	WLPAGDALLQMITIHLPSPVTAQK	3650	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17	11-UNIMOD:35	ms_run[1]:scan=4691	25.509388	3	2615.417328	2615.414531	R	Y	343	367
PSM	MTQIMFETFNTPAMYVAIQAVLSLYASGR	3651	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=8620	47.442424	3	3254.622199	3252.602150	K	T	119	148
PSM	LCYVALDFEQEMATAASSSSLEK	3652	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17	2-UNIMOD:4	ms_run[1]:scan=6104	33.34238	2	2551.1682	2549.1662	K	S	216	239
PSM	IDLRPVLGEGVPILASFLR	3653	sp|Q86VP6|CAND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=5560	30.325114	2	2064.209692	2064.209546	K	K	642	661
PSM	FLVVLNFGDVGLSAGLQASDLPASASLPAK	3654	sp|P08195|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=4322	23.513767	3	2958.596380	2956.590974	R	A	563	593
PSM	SENVQDLLLLDVTPLSLGIETAGGVMTVLIK	3655	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17		ms_run[1]:scan=3591	19.503409	4	3237.7652	3237.7772	K	R	385	416
PSM	GAFGDMLDTPDPYVELFISTTPDSR	3656	sp|P47712|PA24A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17	6-UNIMOD:35	ms_run[1]:scan=2099	11.372271	3	2760.2962	2759.2632	K	K	33	58
PSM	GIEAGSEDIDILPNGLAFFSVGLK	3657	sp|Q15165|PON2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1041	5.6144435	2	2462.258804	2461.274057	K	F	47	71
PSM	GQNDLMGTAEDFADQFLR	3658	sp|O15260|SURF4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1,6-UNIMOD:35	ms_run[1]:scan=2705	14.653767	3	2085.9322	2084.9102	M	V	2	20
PSM	LILSETSIFDVLPNFFYHSNQVVR	3659	sp|Q13085|ACACA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=5628	30.687785	3	2839.484886	2837.475216	K	M	1123	1147
PSM	ESDDPMAYIHFTAEGEVTFK	3660	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=7011	38.422593	3	2286.018847	2286.015065	K	S	365	385
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	3661	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17	7-UNIMOD:35,13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=3454	18.749058	4	3601.714710	3601.689128	R	R	85	117
PSM	KLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTALPDEDDDL	3662	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17	23-UNIMOD:35	ms_run[1]:scan=6295	34.397607	6	5404.6492	5402.6092	R	-	167	217
PSM	GGLRPGSLDAEIDLLSSTLAELNGGR	3663	sp|Q15654|TRIP6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=3527	19.150902	3	2611.350998	2610.361309	R	G	86	112
PSM	HLYTADMFTHGIQSAAHFVMFFAPWCGHCQR	3664	sp|Q8NBS9|TXND5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17	20-UNIMOD:35,26-UNIMOD:4,29-UNIMOD:4	ms_run[1]:scan=1019	5.4905872	4	3738.654658	3738.652974	K	L	64	95
PSM	LDDIHPFYADLMNILYDK	3665	sp|Q9BZE4|NOG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1686	9.1658869	3	2195.064277	2195.060893	K	D	72	90
PSM	KNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGK	3666	sp|Q09028|RBBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17		ms_run[1]:scan=4922	26.759173	5	3953.0215	3953.0181	K	D	26	60
PSM	ATSPADALQYLLQFAR	3667	sp|Q96HW7|INT4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=4938	26.848868	2	1763.926397	1763.920634	K	K	46	62
PSM	QIVWNGPVGVFEWEAFAR	3668	sp|P00558|PGK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:28	ms_run[1]:scan=2142	11.603819	2	2087.0287	2087.0260	K	G	333	351
PSM	SLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMAR	3669	sp|P0DP23|CALM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17	14-UNIMOD:35	ms_run[1]:scan=5951	32.497954	3	4084.829761	4084.834013	R	K	39	76
PSM	SHCEIAVFIDGPLALADGIPFFR	3670	sp|Q86TN4|TRPT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17	3-UNIMOD:4	ms_run[1]:scan=5737	31.290143	3	2545.293572	2544.283516	R	S	171	194
PSM	IYPTIWWLFR	3671	sp|P11413|G6PD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=460	2.506942	2	1394.764256	1393.754679	K	D	48	58
PSM	FVEQLITFLSLEDR	3672	sp|Q14997|PSME4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=18	0.079503301	2	1708.917332	1708.903587	K	K	1318	1332
PSM	ETDLLLDDSLVSIFGNR	3673	sp|P30044|PRDX5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1523	8.2460261	2	1904.967076	1905.968373	K	R	160	177
PSM	DDVFLSVPCILGQNGISDLVK	3674	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17	9-UNIMOD:4	ms_run[1]:scan=2127	11.522373	2	2289.156926	2288.172235	K	V	285	306
PSM	VWVNGNKPGFIQFLGETQFAPGQWAGIVLDEPIGK	3675	sp|P30622|CLIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=5082	27.674854	3	3814.960224	3811.972618	R	N	64	99
PSM	LCYVALDFENEMATAASSSSLEK	3676	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17	2-UNIMOD:4,12-UNIMOD:35	ms_run[1]:scan=6104	33.34238	2	2551.168615	2551.145822	K	S	218	241
PSM	GDIPDLSQAPSSLLDALEQHLASLEGK	3677	sp|Q13492|PICAL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=7562	41.490934	3	2805.455063	2803.423969	R	K	262	289
PSM	SENVQDLLLLDVTPLSLGIETAGGVMTPLIK	3678	sp|P54652|HSP72_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=3591	19.503409	4	3237.766308	3235.762533	K	R	388	419
PSM	SELLFPSDVQTLSTGEPLELPELGCVEMTDLK	3679	sp|Q15003|CND2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17	25-UNIMOD:4,28-UNIMOD:35	ms_run[1]:scan=173	0.94887862	3	3565.768025	3562.731035	R	A	272	304
PSM	KAENPQCLLGDFVTEFFK	3680	sp|Q15042|RB3GP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17	7-UNIMOD:4	ms_run[1]:scan=3589	19.492158	3	2144.052361	2142.045577	R	I	316	334
PSM	AFDTFLDSLQEFPWVR	3681	sp|P78560-2|CRADD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=6424	35.107	2	1969.9574	1969.9574	K	E	68	84
PSM	ASSSAGNLGVLIPVIAVLTR	3682	sp|P42356|PI4KA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=3682	19.975	2	1937.131	1937.1310	K	R	760	780
PSM	DFVSEQLTSLLVNGVQLPALGENKK	3683	sp|P54136-2|SYRC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=2967	16.087	2	2698.4541	2698.4541	K	V	97	122
PSM	DMAIATGGAVFGEEGLTLNLEDVQPHDLGK	3684	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=5451	29.721	3	3096.5074	3096.5074	K	V	315	345
PSM	EKVETELQGVCDTVLGLLDSHLIK	3685	sp|P31947|1433S_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	16	11-UNIMOD:4	ms_run[2]:scan=4395	23.919	2	2695.4102	2695.4102	R	E	86	110
PSM	EQLIIPQVPLFNILAK	3686	sp|Q53GS9-2|SNUT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=654	3.5324	2	1835.0921	1835.0921	K	F	303	319
PSM	ESASSILASFGLSNEDLEELSRYPDEQLTPENMPLILR	3687	sp|Q14966-2|ZN638_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=6320	34.535	3	4263.0893	4263.0893	K	D	138	176
PSM	EVGDGTTSVVIIAAELLK	3688	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=360	1.9858	3	1814.0037	1814.0037	K	N	85	103
PSM	FGVEQDVDMVFASFIR	3689	sp|P14618-3|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=7211	39.539	3	1858.8924	1858.8924	K	K	216	232
PSM	GFDPSSPVLHELTFQAMSYDLLPIENDVYKYETSGIGEAR	3690	sp|P61764|STXB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=6937	38	4	4488.1471	4488.1471	R	V	236	276
PSM	GFGFVTFSSMAEVDAAMAARPHSIDGR	3691	sp|P22626-2|ROA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=7146	39.17	4	2826.3218	2826.3218	R	V	51	78
PSM	GPVVPAFALWDGELLTHSGLEVPEGL	3692	sp|Q8WW59|SPRY4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=7205	39.505	3	2702.3956	2702.3956	R	-	182	208
PSM	GSEFLVPISGFYCQLCEEFLGDPISGEQHVK	3693	sp|Q5VUA4|ZN318_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	16	13-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=5642	30.764	3	3541.6534	3541.6534	K	G	1126	1157
PSM	IAAGETIALLFELAR	3694	sp|Q12894|IFRD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=2969	16.098	2	1586.9032	1586.9032	R	D	342	357
PSM	ILSISADIETIGEILKK	3695	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=725	3.922	3	1842.0714	1842.0714	R	I	87	104
PSM	ITPLEIEVLEETVQTMDTS	3696	sp|Q99436|PSB7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=3957	21.513	3	2147.0555	2147.0555	K	-	259	278
PSM	LQYDVYQYFLPENDLTEEMLLK	3697	sp|Q9NS93|TM7S3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=1053	5.6807	2	2763.3353	2763.3353	R	H	192	214
PSM	MALIQLGSVEEAIQALIELHNHDLGENHHLR	3698	sp|O95758-7|PTBP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=1702	9.2585	6	3499.7994	3499.7994	K	V	419	450
PSM	RPGAFAIYLEPWHLDIFEFLDLKK	3699	sp|P23921|RIR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=5016	27.296	4	2917.5531	2917.5531	K	N	293	317
PSM	SFATFLSHVLDLVSHPR	3700	sp|Q9P2D3-2|HTR5B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=5703	31.099	3	1925.0159	1925.0159	R	A	326	343
PSM	SLGYDLPMVEEGEPDPEFEAILDTVDPNR	3701	sp|Q13813-3|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=4014	21.827	3	3246.4915	3246.4915	R	D	2334	2363
PSM	SLPLCLQLYAPGLSPDTIMECAMGDR	3702	sp|P13284|GILT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	16	5-UNIMOD:4,21-UNIMOD:4	ms_run[2]:scan=657	3.5493	2	2907.3639	2907.3639	R	G	158	184
PSM	SQLQDLVEFPYVNLHNEVVGIIESR	3703	sp|Q12769|NU160_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=2473	13.382	3	2897.4923	2897.4923	R	A	1045	1070
PSM	TAFYSFYLPIAAAMYMAGIDGEKEHANAK	3704	sp|P14324-2|FPPS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=3137	17.021	3	3179.5096	3179.5096	K	K	201	230
PSM	THIDAIILALPEDLQGILLK	3705	sp|Q8IWF6|DEN6A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=5486	29.915	3	2185.2722	2185.2722	R	T	585	605
PSM	TLSSSTQASIEIDSLYEGIDFYTSITR	3706	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=4132	22.449	3	2996.4502	2996.4502	R	A	273	300
PSM	VASNPYTWFTMEALEETWR	3707	sp|Q13813-3|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=1097	5.9298	3	2330.0678	2330.0678	R	N	2142	2161
PSM	VASVYEAPGFFLDLEPIPGALDAVR	3708	sp|Q8TCD5-2|NT5C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=1207	6.547	2	2645.3741	2645.3741	K	E	61	86
PSM	VPSALVTLHMLLCSIPLSGR	3709	sp|Q69YN4-2|VIR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	16	13-UNIMOD:4	ms_run[2]:scan=4927	26.787	3	2163.1908	2163.1908	R	L	1033	1053
PSM	YGSYNVFWTSNPGLPLLTEMVK	3710	sp|Q13724-2|MOGS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=789	4.278	2	2515.2457	2515.2457	K	S	151	173
PSM	DVLIQGLIDENPGLQLIIR	3711	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=3482	18.901498	2	2118.207414	2118.204855	K	N	2504	2523
PSM	GPSIALDTACSSSLMALQNAYQAIHSGQCPAAIVGGINVLLKPNTSVQFLR	3712	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16	10-UNIMOD:4,29-UNIMOD:4	ms_run[1]:scan=5818	31.751133	5	5338.7252	5338.7259	R	L	152	203
PSM	ALGLGVEQLPVVFEDVVLHQATILPK	3713	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=7401	40.597054	2	2786.579821	2784.578953	R	T	902	928
PSM	GILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVK	3714	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=7165	39.27732	5	4034.893974	4035.887504	K	L	272	310
PSM	VVIGMDVAASEFFR	3715	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=9331	51.040434	2	1540.780534	1539.775550	K	S	240	254
PSM	CLHPLLVVVSCLTR	3716	sp|Q7L2E3|DHX30_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:385,1-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=1491	8.0723384	2	1648.8823	1648.8788	R	D	895	909
PSM	AGWNAYIDNLMADGTCQDAAIVGYK	3717	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=5872	32.059404	3	2759.2302	2758.2362	M	D	2	27
PSM	WYQADSPPADLLLTEEEFLSFLHPEHSR	3718	sp|Q9BRK5|CAB45_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=6501	35.546041	3	3328.592260	3326.588408	R	G	204	232
PSM	VGSAADIPINISETDLSLLTATVVPPSGR	3719	sp|P21333|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=55	0.292143	2	2893.545017	2892.544418	K	E	1965	1994
PSM	SQVVIPILQWAIASTTLDHR	3720	sp|Q9Y5L0|TNPO3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=3919	21.302487	2	2247.236421	2247.237552	R	D	770	790
PSM	AREFGAGPLFNQILPLLMSPTLEDQER	3721	sp|O75533|SF3B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=2505	13.558706	3	3041.569672	3041.564442	K	H	523	550
PSM	SDPLCVLLQDVGGGSWAELGR	3722	sp|Q99829|CPNE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16	5-UNIMOD:4	ms_run[1]:scan=5977	32.630957	3	2228.090451	2228.089567	K	T	26	47
PSM	NPVNYFAEVEQIAFDPSNMPPGIEASPDK	3723	sp|P04040|CATA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=491	2.6524816	3	3176.481963	3175.480832	R	M	321	350
PSM	AEISELPSIVQDLANGNITWADVEAR	3724	sp|P41250|GARS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=4266	23.197102	3	2810.412035	2810.408653	R	Y	697	723
PSM	QFGFIVLTTSAGIMDHEEAR	3725	sp|P62244|RS15A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:28	ms_run[1]:scan=922	4.9990974	2	2204.0617	2204.0567	R	R	98	118
PSM	FGVEQDVDMVFASFIR	3726	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=6906	37.819796	3	1858.893668	1858.892371	K	K	231	247
PSM	VLELPYQGEELSMVILLPDDIEDESTGLK	3727	sp|P30740|ILEU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16	13-UNIMOD:35	ms_run[1]:scan=5126	27.924308	3	3262.665229	3260.626159	R	K	216	245
PSM	CLQLLRPGGILAVLR	3728	sp|Q86VU5|CMTD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=4362	23.737802	2	1660.9825	1660.9805	R	V	198	213
PSM	HLYTADMFTHGIQSAAHFVMFFAPWCGHCQR	3729	sp|Q8NBS9|TXND5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16	20-UNIMOD:35,26-UNIMOD:4,29-UNIMOD:4	ms_run[1]:scan=1091	5.8960602	5	3738.656841	3738.652974	K	L	64	95
PSM	SHHWCIQGCSAVTGENLLPGIDWLLDDISSR	3730	sp|P36404|ARL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16	5-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=556	2.9924922	4	3535.662887	3535.661273	R	I	149	180
PSM	SHHWCIQGCSAVTGENLLPGIDWLLDDISSR	3731	sp|P36404|ARL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16	5-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=382	2.1033668	4	3535.662887	3535.661273	R	I	149	180
PSM	EGSGGGGGMDDIFSHIFGGGLFGFMGNQSR	3732	sp|O60884|DNJA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16	25-UNIMOD:35	ms_run[1]:scan=4881	26.528295	3	3006.306294	3006.302490	R	S	76	106
PSM	LAMDEIFQKPFQTLMFLVR	3733	sp|Q6DD88|ATLA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16	3-UNIMOD:35	ms_run[1]:scan=1241	6.7303439	3	2343.220314	2342.216682	R	D	195	214
PSM	VSNSPSQAIEVVELASAFSLPICEGLTQR	3734	sp|Q96EY7|PTCD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16	23-UNIMOD:4	ms_run[1]:scan=6928	37.946476	3	3100.558638	3101.570316	K	V	620	649
PSM	TMETLHLEYFEEAVNYLLSHPEVK	3735	sp|Q86TX2|ACOT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=3702	20.087455	4	2890.406463	2891.405147	K	G	199	223
PSM	VFPDKEVMLDAALALAAEISSK	3736	sp|Q13011|ECH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=6102	33.33113	3	2317.227748	2317.223936	R	S	246	268
PSM	LKGYTNWAIGLSVADLIESMLK	3737	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16	20-UNIMOD:35	ms_run[1]:scan=1273	6.9128357	3	2436.274324	2437.292684	K	N	245	267
PSM	IPNFWVTTFVNHPQVSALLGEEDEEALHYLTR	3738	sp|Q01105|SET_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1509	8.1674967	4	3724.858124	3724.852562	K	V	91	123
PSM	LADQCTGLQGFLVFHSFGGGTGSGFTSLLMER	3739	sp|Q71U36|TBA1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16	5-UNIMOD:4	ms_run[1]:scan=7425	40.736921	3	3388.610867	3389.617283	K	L	125	157
PSM	AADHLEALAAIEDFFLEHEALGISMAK	3740	sp|Q13144|EI2BE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=5327	29.027296	3	2914.453387	2911.442596	R	V	639	666
PSM	NNFSDTGNFGFGIQEHIDLGIK	3741	sp|P62913|RL11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=7033	38.53903	3	2422.162352	2422.155339	K	Y	97	119
PSM	AASQSTQVPTITEGVAAALLLLK	3742	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=5365	29.239	2	2281.2893	2281.2893	K	L	476	499
PSM	CEYLMELMTPAACPEPPPEAPTEDDHDEL	3743	sp|P14314-2|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=4856	26.386	3	3356.3869	3356.3869	R	-	497	526
PSM	DKEPEVVFIGDSLVQLMHQCEIWR	3744	sp|Q15102|PA1B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	15	20-UNIMOD:4	ms_run[2]:scan=3861	20.973	4	2927.431	2927.4310	K	E	36	60
PSM	DKPSGDTAAVFEEGGDVDDLLDMI	3745	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=3514	19.08	3	2508.1214	2508.1214	K	-	709	733
PSM	EIGLWFHPEELVDYTSCAQNWIYE	3746	sp|P15531|NDKA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	15	17-UNIMOD:4	ms_run[2]:scan=6119	33.429	3	2998.3484	2998.3484	K	-	129	153
PSM	ESEIIDFFLGASLKDEVLK	3747	sp|P15880|RS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=1240	6.7247	3	2152.1304	2152.1304	K	I	90	109
PSM	FGYDDDLDLTPEYLFPLLK	3748	sp|Q8IXI2-4|MIRO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6871	37.62	2	2273.1144	2273.1144	R	I	274	293
PSM	GFFELFPSLSHNLLVD	3749	sp|Q9ULA0|DNPEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=3849	20.907	2	1833.9301	1833.9301	K	-	460	476
PSM	GHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYK	3750	sp|P04179-4|SODM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	15	8-UNIMOD:4	ms_run[2]:scan=5349	29.149	3	4292.1728	4292.1728	R	N	111	149
PSM	HADKEDLVILFADSYDVLFASGPR	3751	sp|Q02809|PLOD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=2602	14.086	4	2677.3388	2677.3388	K	E	88	112
PSM	IVAFADAAVEPIDFPIAPVYAASMVLK	3752	sp|P24752|THIL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6581	35.999	2	2817.5027	2817.5027	R	D	312	339
PSM	LDWNTDAASLIGEELQVDFLDHVPLTTHNFAR	3753	sp|P04049|RAF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6061	33.104	4	3636.7849	3636.7849	R	K	112	144
PSM	LGAGYPMGPFELLDYVGLDTTK	3754	sp|Q16836|HCDH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=5811	31.712	2	2356.1661	2356.1661	K	F	250	272
PSM	LLEETQLDMNEFDNLLQPIIDTCTK	3755	sp|Q8IWX8|CHERP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	15	23-UNIMOD:4	ms_run[2]:scan=3475	18.866	2	2992.4409	2992.4409	K	D	146	171
PSM	LSALGNVTTCNDYVALVHPDLDRETEEILADVLK	3756	sp|P56537|IF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	15	10-UNIMOD:4	ms_run[2]:scan=1206	6.5413	3	3782.9037	3782.9037	R	V	101	135
PSM	NAYAVLYDIILKNFEK	3757	sp|Q06323|PSME1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=1625	8.8231	3	1913.0299	1913.0299	R	L	221	237
PSM	NNSNDIVNAIMELTM	3758	sp|Q13765|NACA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	15	15-UNIMOD:35	ms_run[2]:scan=4100	22.284	2	1693.7651	1693.7651	K	-	201	216
PSM	QELPFMATENIIMAMVK	3759	sp|P30566-2|PUR8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6160	33.66	2	1964.9774	1964.9774	R	A	375	392
PSM	SSVSGIVATVFGATGFLGR	3760	sp|Q16795|NDUA9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=2013	10.887	3	1824.9734	1824.9734	R	Y	49	68
PSM	YPDSHQLFVGNLPHDIDENELKEFFMSFGNVVELR	3761	sp|Q9UN86-2|G3BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=5780	31.535	5	4134.9786	4134.9786	R	I	294	329
PSM	GPSIALDTACSSSLMALQNAYQAIHSGQCPAAIVGGINVLLKPNTSVQFLR	3762	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15	10-UNIMOD:4,29-UNIMOD:4	ms_run[1]:scan=5719	31.186343	4	5338.7218	5338.7259	R	L	152	203
PSM	GLIAEAAQLGPVGGVFNLAVVLR	3763	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=4648	25.274167	2	2263.305157	2263.305238	R	D	1954	1977
PSM	MTQIMFETFNTPAMYVAIQAVLSLYASGR	3764	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15		ms_run[1]:scan=8409	46.240159	3	3254.5882	3252.6012	K	T	119	148
PSM	CPEALFQPSFLGMESCGIHETTFNSIMK	3765	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15	1-UNIMOD:385,1-UNIMOD:4,16-UNIMOD:4	ms_run[1]:scan=1144	6.1924917	3	3214.4192	3213.4272	R	C	257	285
PSM	GILEEPLPSTSSEEEDPLAGISLPEGVDPSFLAALPDDIRR	3766	sp|Q7Z6Z7|HUWE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1160	6.2826708	3	4331.171583	4331.169658	R	E	2942	2983
PSM	GILEEPLPSTSSEEEDPLAGISLPEGVDPSFLAALPDDIRR	3767	sp|Q7Z6Z7|HUWE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1260	6.8371106	3	4331.171583	4331.169658	R	E	2942	2983
PSM	CLELFSELAEDK	3768	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15	1-UNIMOD:4	ms_run[1]:scan=6237	34.081484	2	1452.681879	1452.680647	K	E	412	424
PSM	FGANAILGVSLAVCK	3769	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15	14-UNIMOD:4	ms_run[1]:scan=6800	37.214984	2	1518.826897	1518.822835	K	A	106	121
PSM	HIADLAGNSEVILPVPAFNVINGGSHAGNK	3770	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=6992	38.31407	4	3011.555938	3010.562468	R	L	133	163
PSM	TMADSSYNLEVQNILSFLK	3771	sp|Q96AC1|FERM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=2611	14.129946	2	2172.079911	2172.077271	K	M	479	498
PSM	IGYNPDTVAFVPISGWNGDNMLEPSANMPWFK	3772	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15	21-UNIMOD:35	ms_run[1]:scan=2508	13.577877	3	3583.689601	3582.658813	K	G	181	213
PSM	SDIVSRALDLFSDNAPPPELLEIINEDIAK	3773	sp|Q15084|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=6399	34.965012	5	3294.715892	3293.703104	R	R	259	289
PSM	SNFFYAIQFVLSDEFSHLRPEQR	3774	sp|Q9UQE7|SMC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=6680	36.533808	3	2830.389259	2829.387464	K	L	39	62
PSM	GMYGIENEVFLSLPCILNAR	3775	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15	15-UNIMOD:4	ms_run[1]:scan=3032	16.44378	2	2296.133334	2295.139160	K	G	280	300
PSM	ILSISADIETIGEILKK	3776	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=260	1.4287249	3	1843.072390	1842.071381	R	I	87	104
PSM	AQLGVQAFADALLIIPK	3777	sp|P40227|TCPZ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1009	5.4380414	2	1767.031514	1767.029457	R	V	433	450
PSM	AQLGVQAFADALLIIPK	3778	sp|P40227|TCPZ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1276	6.93199	2	1768.036052	1767.029457	R	V	433	450
PSM	QICLVMLETLSQSPQGR	3779	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15	1-UNIMOD:28,3-UNIMOD:4	ms_run[1]:scan=1965	10.624273	2	1942.9702	1941.9642	K	V	161	178
PSM	EFEPLLNWMK	3780	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15	1-UNIMOD:27	ms_run[1]:scan=4129	22.432625	2	1287.6327	1287.6317	K	D	614	624
PSM	ASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGK	3781	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15	45-UNIMOD:4,48-UNIMOD:4	ms_run[1]:scan=5257	28.631482	5	5807.8692	5806.8792	R	I	13	68
PSM	LSEEELLDKLEIFFGK	3782	sp|P80217|IN35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=2830	15.332919	3	1909.011891	1909.008447	R	T	146	162
PSM	FFGPNAEISQPPALSQLVNLYLGR	3783	sp|Q9BQ70|TCF25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=4051	22.026955	3	2630.406046	2630.385673	R	S	482	506
PSM	TLFSFLGEIEELR	3784	sp|Q8WXA9-2|SREK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=2001	10.822288	2	1552.816544	1552.813710	R	L	37	50
PSM	NYLPAINGIVFLVDCADHER	3785	sp|Q9Y6B6|SAR1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15	15-UNIMOD:4	ms_run[1]:scan=1220	6.6188148	3	2316.126546	2315.136852	K	L	88	108
PSM	MILELFSKVPSLVGSFIR	3786	sp|P78417|GSTO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15	1-UNIMOD:35	ms_run[1]:scan=880	4.7696346	3	2051.152395	2051.148920	K	S	115	133
PSM	LCYVALDFEQEMAMVASSSSLEK	3787	sp|P0CG39|POTEJ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15	2-UNIMOD:4	ms_run[1]:scan=9254	50.656494	3	2609.207480	2607.190663	K	S	879	902
PSM	GPGTSFEFALAIVEALNGK	3788	sp|Q99497|PARK7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=6918	37.89009	3	1920.987650	1919.999279	R	E	157	176
PSM	MTQIMFEAFNTPAMYVAIQAVLSLYASGR	3789	sp|Q562R1|ACTBL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15	5-UNIMOD:35,14-UNIMOD:35	ms_run[1]:scan=8409	46.240159	3	3254.589514	3254.581415	K	T	120	149
PSM	DDVFLSVPCILGQNGISDLVK	3790	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15	9-UNIMOD:4	ms_run[1]:scan=3244	17.586735	2	2289.157027	2288.172235	K	V	285	306
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	3791	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=3685	19.991825	4	3584.688076	3585.694213	R	R	85	117
PSM	LNLIHSEISNLAGFEVEAIINPTNADIDLKDDLGNTLEK	3792	sp|O75367|H2AY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=1146	6.2040001	4	4248.185858	4248.180164	K	K	197	236
PSM	CIPYAVLLEALALR	3793	sp|Q9UBW8|CSN7A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:4	ms_run[2]:scan=1886	10.213	2	1600.9011	1600.9011	K	N	110	124
PSM	ELLSTITDPSVIVMADWLK	3794	sp|Q9BZF1-3|OSBL8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	14		ms_run[2]:scan=3336	18.094	2	2130.1282	2130.1282	K	I	96	115
PSM	FDLLFIMLDQMDPEQDREISDHVLR	3795	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	14		ms_run[2]:scan=3190	17.316	3	3074.4841	3074.4841	R	M	479	504
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	3796	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	14	13-UNIMOD:4,27-UNIMOD:4	ms_run[2]:scan=8546	47.02	3	3585.6942	3585.6942	R	R	85	117
PSM	GEGILITSHGELQYYLSLLNQQLPIESQMVSK	3797	sp|O75643|U520_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	14		ms_run[2]:scan=2654	14.375	3	3587.8545	3587.8545	K	L	865	897
PSM	KIDQSEFEGFEYINPLLMSAEECV	3798	sp|P41743|KPCI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	14	23-UNIMOD:4	ms_run[2]:scan=930	5.0418	2	2847.2983	2847.2983	R	-	573	597
PSM	KWYAEAMPFPLNFFLPGR	3799	sp|Q13505-3|MTX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	14		ms_run[2]:scan=1652	8.9723	3	2183.1026	2183.1026	R	M	125	143
PSM	LEPTLENLENLDVSAFQAPEDLLDGCR	3800	sp|Q92547|TOPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	14	26-UNIMOD:4	ms_run[2]:scan=673	3.636	3	3057.4601	3057.4601	K	I	337	364
PSM	LSIQPLTQEEFDFVLSLEEKEPS	3801	sp|Q9P016|THYN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	14		ms_run[2]:scan=307	1.6915	2	2677.3374	2677.3374	R	-	203	226
PSM	NSPLTVPMFLSLFSR	3802	sp|Q9BQG0|MBB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	14		ms_run[2]:scan=3100	16.823	3	1707.9018	1707.9018	R	H	990	1005
PSM	PITEMLPGILSQLGADSLTSLR	3803	sp|Q96K17-2|BT3L4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	14		ms_run[2]:scan=5485	29.909	2	2311.2457	2311.2457	K	K	35	57
PSM	QLEDLVIEAVYADVLR	3804	sp|Q9UBW8|CSN7A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	14		ms_run[2]:scan=6067	33.135	3	1844.9884	1844.9884	R	G	127	143
PSM	VFTPEEAVNFILSCLEDEKIQTR	3805	sp|Q9H0C8|ILKAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	14	14-UNIMOD:4	ms_run[2]:scan=4805	26.124	2	2737.3633	2737.3633	K	E	331	354
PSM	VIHDNFGIVEGLMTTVHAITATQK	3806	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	14		ms_run[2]:scan=219	1.2038	4	2594.3527	2594.3527	K	T	163	187
PSM	VLDVSNSFAVPFDEDDKDDSVWFLDHDYLENMYGMFK	3807	sp|P51665|PSMD7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	14		ms_run[2]:scan=5213	28.398	3	4401.9399	4401.9399	K	K	47	84
PSM	VQITAIGDVLGPSINGLASLIR	3808	sp|Q6YHK3-2|CD109_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	14		ms_run[2]:scan=5067	27.586	3	2206.2685	2206.2685	R	M	818	840
PSM	VSADGSQEPTHDILQMLSDLQESVASSRPQEVSAYLTR	3809	sp|Q6NXE6-2|ARMC6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	14		ms_run[2]:scan=5144	28.026	4	4144.0019	4144.0019	K	F	54	92
PSM	WGFIPLVIYLGFKR	3810	sp|Q9P0U1|TOM7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	14		ms_run[2]:scan=2977	16.145	2	1707.9865	1707.9865	R	G	25	39
PSM	STAISLFYELSENDLNFIK	3811	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=4155	22.578929	2	2203.105608	2203.104866	K	Q	72	91
PSM	LCYVALDFEQEMATAASSSSLEK	3812	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14	2-UNIMOD:4	ms_run[1]:scan=6642	36.320831	2	2551.165331	2549.166557	K	S	216	239
PSM	VILHLKEDQTEYLEER	3813	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=6884	37.693196	3	2014.039133	2014.037121	K	R	160	176
PSM	AGQLTSEEDTLTLVTADHSHVFSFGGYTLR	3814	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=7200	39.474197	4	3251.579804	3251.573486	R	G	360	390
PSM	GILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVK	3815	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=2252	12.211607	5	4036.892520	4035.887504	K	L	272	310
PSM	IDLRPVLGEGVPILASFLR	3816	sp|Q86VP6|CAND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=5451	29.721051	2	2064.209692	2064.209546	K	K	642	661
PSM	DYTRPDLPSGDSQPSLDQTMAAAFGLSVPNVHGALAPLAIPSAAAAAAAAGR	3817	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14		ms_run[1]:scan=723	3.910805	5	5057.5385	5057.5300	R	I	274	326
PSM	TLSSSTQASIEIDSLYEGIDFYTSITR	3818	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14		ms_run[1]:scan=8379	46.065932	3	2997.4342	2996.4502	R	A	273	300
PSM	SENVQDLLLLDVTPLSLGIETAGGVMTVLIK	3819	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=3624	19.681609	4	3237.766308	3237.778183	K	R	385	416
PSM	GMTLVTPLQLLLFASK	3820	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14	2-UNIMOD:35	ms_run[1]:scan=2624	14.200593	3	1747.999092	1746.995380	K	K	1058	1074
PSM	SLLVPSDFLSVHLSWLSAFPLSQPFSLHHPSR	3821	sp|Q8N163|CCAR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=4669	25.390384	5	3600.891228	3600.888160	R	I	249	281
PSM	DFPFELIPEPPEGGLPGPWALHR	3822	sp|Q96KG9|SCYL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=68	0.36534094	3	2571.305129	2570.295795	R	G	11	34
PSM	EFEPLLNWMK	3823	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:27	ms_run[1]:scan=4091	22.236681	2	1287.6327	1287.6317	K	D	614	624
PSM	LVFCLLELLSR	3824	sp|Q8TEQ6|GEMI5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14	4-UNIMOD:4	ms_run[1]:scan=1668	9.0649077	2	1361.773649	1361.774094	R	H	1119	1130
PSM	ASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGK	3825	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14	45-UNIMOD:4,48-UNIMOD:4	ms_run[1]:scan=4393	23.907942	4	5806.8709	5806.8792	R	I	13	68
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	3826	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14	27-UNIMOD:4	ms_run[1]:scan=8765	48.270089	3	3515.709538	3512.695593	R	R	85	117
PSM	NGSITQIPILTMPNDDITHPIPDLTGYITEGQIYVDR	3827	sp|P21281|VATB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=3364	18.246581	4	4111.052464	4110.061963	R	Q	345	382
PSM	ESTITLQQAEYEFLSFVR	3828	sp|Q9Y3B8|ORN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=5263	28.665071	3	2160.076384	2160.073900	K	Q	112	130
PSM	GGFNKPGGPMDEGPDLDLGPPVDPDEDSDNSAIYVQGLNDSVTLDDLADFFK	3829	sp|Q01844|EWS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14	10-UNIMOD:35	ms_run[1]:scan=5927	32.371229	4	5480.4622	5480.4673	R	Q	331	383
PSM	GVPQIEVTFEIDVNGILR	3830	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=5653	30.823729	2	1999.079139	1998.078592	R	V	493	511
PSM	MILELFSKVPSLVGSFIR	3831	sp|P78417|GSTO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=5863	32.008648	3	2035.155667	2035.154005	K	S	115	133
PSM	EHILPSLAHLLPALDCLEGSTPGL	3832	sp|Q9BSH5|HDHD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14	16-UNIMOD:4	ms_run[1]:scan=52	0.2729387	3	2553.339621	2552.330860	K	-	228	252
PSM	CYFYLLISK	3833	sp|Q9P287|BCCIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=640	3.4550027	2	1188.5896	1188.5884	K	T	216	225
PSM	IKDYLEELWVQAQYITDAEGLPK	3834	sp|Q63HN8|RN213_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=2453	13.282041	3	2722.395111	2721.390149	K	K	3715	3738
PSM	AGLEPFFDFIVSINGSR	3835	sp|Q9H8Y8|GORS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=7182	39.370433	2	1867.949121	1867.946849	R	L	31	48
PSM	YQLLQLVEPFGVISNHLILNK	3836	sp|P43243|MATR3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=1165	6.3107688	3	2438.357584	2437.373317	R	I	413	434
PSM	GVPQIEVTFEIDVNGILR	3837	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=5507	30.028551	2	1999.064484	1998.078592	R	V	493	511
PSM	QGLNGVPILSEEELSLLDEFYK	3838	sp|Q14444|CAPR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=5471	29.834509	3	2494.260844	2492.268637	K	L	170	192
PSM	NAISLPTIGGSQALMLPLLSPVTFNSKQESFGPAK	3839	sp|Q9UKI2|BORG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14	15-UNIMOD:35	ms_run[1]:scan=7510	41.214044	4	3628.913224	3628.917471	K	L	105	140
PSM	AADVLVYLADDTVVPLAVENLPSLSAHELHR	3840	sp|Q9BZ67-3|FRMD8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	13		ms_run[2]:scan=302	1.6634	4	3326.7511	3326.7511	R	A	29	60
PSM	ADIIVSELLGSFADNELSPECLDGAQHFLK	3841	sp|O14744-4|ANM5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	13	21-UNIMOD:4	ms_run[2]:scan=2657	14.391	4	3287.602	3287.6020	K	D	258	288
PSM	ADLNIILSSPEQLELFLLAQQK	3842	sp|Q9BQG0|MBB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	13		ms_run[2]:scan=5093	27.737	4	2482.3683	2482.3683	K	V	203	225
PSM	AFAASLLDYIGSQAQYLHTFMAITHAAK	3843	sp|O75165|DJC13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	13		ms_run[2]:scan=6702	36.658	4	3038.5324	3038.5324	K	V	1709	1737
PSM	AVGNIVTGDDIQTQVILNCSALPCLLHLLSSPK	3844	sp|O60684|IMA7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	13	19-UNIMOD:4,24-UNIMOD:4	ms_run[2]:scan=5234	28.502	4	3545.8586	3545.8586	R	E	317	350
PSM	ENVNSLLPVFEEFLK	3845	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	13		ms_run[2]:scan=2866	15.527	2	1776.9298	1776.9298	K	N	1290	1305
PSM	FAADIISVLAMTMSGER	3846	sp|Q13200|PSMD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	13		ms_run[2]:scan=6539	35.759	3	1810.8957	1810.8957	R	E	121	138
PSM	ISFDEFVYIFQEVK	3847	sp|P13797-3|PLST_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	13		ms_run[2]:scan=4065	22.104	2	1762.8818	1762.8818	K	S	27	41
PSM	QDQIQQVVNHGLVPFLVSVLSK	3848	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	13		ms_run[2]:scan=5475	29.857	2	2447.3536	2447.3536	R	A	367	389
PSM	QPPWCDPLGPFVVGGEDLDPFGPR	3849	sp|Q92530|PSMF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	13	5-UNIMOD:4	ms_run[2]:scan=714	3.8607	3	2651.2479	2651.2479	R	R	181	205
PSM	SASYKPVFVTEITDDLHFYVQDVETGTQLEK	3850	sp|Q7KZF4|SND1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	13		ms_run[2]:scan=7361	40.37	4	3558.7406	3558.7406	R	L	679	710
PSM	SNVIDSMLFVFGYR	3851	sp|Q9NTJ3-2|SMC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	13		ms_run[2]:scan=4981	27.095	2	1646.8127	1646.8127	K	A	120	134
PSM	TSSCPVIFILDEFDLFAHHK	3852	sp|O43929-2|ORC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	13	4-UNIMOD:4	ms_run[2]:scan=5345	29.129	3	2375.162	2375.1620	R	N	65	85
PSM	VLTDSGSLDSTIPGIENTITVTTEQLTTASFPVGSK	3853	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	13		ms_run[2]:scan=6688	36.581	3	3678.8727	3678.8727	K	K	210	246
PSM	VNPCIGGVILFHETLYQK	3854	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	13	4-UNIMOD:4	ms_run[2]:scan=7269	39.856	3	2087.0874	2087.0874	R	A	70	88
PSM	YNVYPTYDFACPIVDSIEGVTHALR	3855	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	13	11-UNIMOD:4	ms_run[2]:scan=1964	10.619	2	2899.3851	2899.3851	K	T	371	396
PSM	CPEALFQPSFLGMESCGIHETTFNSIMK	3856	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13	1-UNIMOD:385,1-UNIMOD:4,16-UNIMOD:4	ms_run[1]:scan=3008	16.312338	3	3213.4320	3213.4274	R	C	257	285
PSM	DMAIATGGAVFGEEGLTLNLEDVQPHDLGK	3857	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13	2-UNIMOD:35	ms_run[1]:scan=8302	45.627771	3	3112.499045	3112.502296	K	V	315	345
PSM	LEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICR	3858	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13	34-UNIMOD:4,47-UNIMOD:4	ms_run[1]:scan=7006	38.391895	4	5516.5806	5516.5886	K	R	167	215
PSM	GLYGIKDDVFLSVPCILGQNGISDLVK	3859	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13	15-UNIMOD:4	ms_run[1]:scan=543	2.9245817	3	2920.530832	2919.541582	K	V	279	306
PSM	ALDLFSDNAPPPELLEIINEDIAK	3860	sp|Q15084|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13		ms_run[1]:scan=6231	34.047734	4	2637.368952	2636.358515	R	R	265	289
PSM	NEILTAILASLTAR	3861	sp|Q9C0B1|FTO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13		ms_run[1]:scan=4330	23.557671	2	1484.856822	1484.856243	R	Q	432	446
PSM	DGTVLCELINALYPEGQAPVK	3862	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13	6-UNIMOD:4	ms_run[1]:scan=7115	39.000466	3	2286.158679	2286.156584	K	K	58	79
PSM	QMFFVISLDPPIK	3863	sp|Q08945|SSRP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13	1-UNIMOD:28	ms_run[1]:scan=6108	33.367417	2	1516.8001	1516.7994	R	Q	252	265
PSM	TVPPAVTGITFLSGGQSEEEASINLNAINK	3864	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13		ms_run[1]:scan=8291	45.566017	3	3056.542076	3056.566610	R	C	260	290
PSM	GIPEFWFTIFR	3865	sp|Q99733|NP1L4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13		ms_run[1]:scan=3409	18.491435	2	1411.730325	1411.728858	K	N	158	169
PSM	NGTLNIKQDDPFELFIAATNIR	3866	sp|Q9H0A0|NAT10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13		ms_run[1]:scan=1803	9.7961393	3	2490.281786	2489.291438	K	Y	82	104
PSM	LAPPLVTLLSAEPELQYVALR	3867	sp|Q10567|AP1B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13		ms_run[1]:scan=4064	22.098776	3	2293.314654	2292.309320	K	N	284	305
PSM	FCSFDGANENVWHVLEVESNSPAALAGLRPHSDYIIGADTVMNESEDLFSLIETHEAKPLK	3868	sp|Q9H8Y8|GORS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13	2-UNIMOD:4	ms_run[1]:scan=7527	41.307594	7	6770.2642	6769.2372	R	L	102	163
PSM	ASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGK	3869	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13	36-UNIMOD:35,45-UNIMOD:4,48-UNIMOD:4	ms_run[1]:scan=1692	9.1997161	4	5822.8665	5822.8741	R	I	13	68
PSM	ASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGK	3870	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13	45-UNIMOD:4,48-UNIMOD:4	ms_run[1]:scan=4224	22.964135	5	5806.8802	5806.8792	R	I	13	68
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	3871	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=8131	44.659415	3	3587.677175	3585.694213	R	R	85	117
PSM	LSALGNVTTCNDYVALVHPDLDRETEEILADVLK	3872	sp|P56537|IF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13	10-UNIMOD:4	ms_run[1]:scan=1440	7.799332	4	3782.902764	3782.903671	R	V	101	135
PSM	QQQDLVAFLQLVGCSLQGGCPGPEDAGSK	3873	sp|O60443|GSDME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13	14-UNIMOD:4,20-UNIMOD:4	ms_run[1]:scan=5569	30.37538	3	3058.445766	3058.448821	R	Q	352	381
PSM	CEMLFEDLLLNEIPEKK	3874	sp|Q5SWX8|ODR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=6325	34.565478	2	2104.0332	2103.0262	R	D	317	334
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	3875	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13	27-UNIMOD:4	ms_run[1]:scan=8415	46.271786	3	3438.688191	3436.697307	R	R	85	117
PSM	VPGINPSFVFLQLYHSPFFGDESNKPILLPNESQSFER	3876	sp|P49815|TSC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13		ms_run[1]:scan=989	5.3293911	4	4350.176359	4349.179710	K	S	1492	1530
PSM	SGTIFDNFLITDDEEYADNFGKATWGETK	3877	sp|Q96L12|CALR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13		ms_run[1]:scan=3622	19.673456	3	3284.514953	3283.483334	R	G	309	338
PSM	SVLISQSVINYVEEENIPALK	3878	sp|Q9ULH0|KDIS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13	1-UNIMOD:1	ms_run[1]:scan=7196	39.451733	3	2386.2716	2386.2626	M	A	2	23
PSM	AAPGEAPPELLCLVSHFYPSGGLEVEWELR	3879	sp|O15533|TPSN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13	12-UNIMOD:4	ms_run[1]:scan=5443	29.676078	3	3323.629927	3322.633250	R	G	304	334
PSM	HTGIKIVQQIAILMGCAILPHLR	3880	sp|O75533|SF3B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13	16-UNIMOD:4	ms_run[1]:scan=11	0.042465718	3	2582.470124	2581.471274	R	S	662	685
PSM	IPNIYAIGDVVAGPMLAHK	3881	sp|P09622|DLDH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13	15-UNIMOD:35	ms_run[1]:scan=7574	41.554692	2	1993.048214	1994.065919	K	A	347	366
PSM	LPELGDLGQFFRSLSATTLDSGGAR	3882	sp|Q9UKU0-7|ACSL6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13		ms_run[1]:scan=2235	12.121903	3	2606.317998	2607.329280	R	R	12	37
PSM	VFTPEEAVNFILSCLEDEKIQTR	3883	sp|Q9H0C8|ILKAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13	14-UNIMOD:4	ms_run[1]:scan=4760	25.876437	3	2738.364817	2737.363283	K	E	331	354
PSM	DFPFELIPEPPEGGLPGPWALHR	3884	sp|Q96KG9-5|SCYL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	12		ms_run[2]:scan=314	1.7335	3	2570.2958	2570.2958	R	G	11	34
PSM	DFQQYLPLVIEPLIK	3885	sp|O60518|RNBP6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	12		ms_run[2]:scan=1566	8.4871	3	1815.0182	1815.0182	K	T	626	641
PSM	DSGTLTLGLLLRPEGLTSVLELGPEADQPEAAK	3886	sp|Q9H6R4-3|NOL6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	12		ms_run[2]:scan=2596	14.054	3	3389.793	3389.7930	K	F	546	579
PSM	DVPGTLLNIALLNLGSSDPSLR	3887	sp|P21359-2|NF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	12		ms_run[2]:scan=6907	37.825	3	2264.2376	2264.2376	K	S	1828	1850
PSM	EDGSFSAFGNYDPSGSTWLSAFVLR	3888	sp|Q6YHK3-2|CD109_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	12		ms_run[2]:scan=4828	26.237	2	2709.2347	2709.2347	R	C	893	918
PSM	FGVEQDVDMVFASFIR	3889	sp|P14618-3|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	12		ms_run[2]:scan=7000	38.358	3	1858.8924	1858.8924	K	K	216	232
PSM	FLSQLIQKFISVLK	3890	sp|O60306|AQR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	12		ms_run[2]:scan=5374	29.292	2	1663.0073	1663.0073	R	S	221	235
PSM	FVLQLLELFDSEDPRER	3891	sp|Q13362-2|2A5G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	12		ms_run[2]:scan=76	0.41036	3	2105.0793	2105.0793	K	D	163	180
PSM	GFFELFPSLSHNLLVD	3892	sp|Q9ULA0|DNPEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	12		ms_run[2]:scan=3740	20.306	2	1833.9301	1833.9301	K	-	460	476
PSM	GQGNFFSFLPVLNWASMHR	3893	sp|O94901-6|SUN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	12		ms_run[2]:scan=1606	8.7185	3	2207.0735	2207.0735	R	T	207	226
PSM	IGALLPYFVYVVSGVK	3894	sp|Q9Y6J9|TAF6L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	12		ms_run[2]:scan=3362	18.235	2	1723.9913	1723.9913	K	S	189	205
PSM	ITPLEIEVLEETVQTMDTS	3895	sp|Q99436|PSB7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	12		ms_run[2]:scan=4070	22.132	2	2147.0555	2147.0555	K	-	259	278
PSM	IVLATNIAETSITINDIVHVVDSGLHK	3896	sp|Q7L2E3-3|DHX30_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	12		ms_run[2]:scan=3457	18.764	4	2871.5706	2871.5706	K	E	688	715
PSM	LEQFVSILMASIPLPDKAS	3897	sp|P00491|PNPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	12		ms_run[2]:scan=5509	30.04	2	2058.1071	2058.1071	K	-	271	290
PSM	LLEDLMDELLEAR	3898	sp|Q9Y4R8|TELO2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	12		ms_run[2]:scan=2569	13.912	2	1558.7913	1558.7913	R	S	786	799
PSM	LLQDSVDFSLADAINTEFK	3899	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	12		ms_run[2]:scan=5753	31.382	2	2125.0579	2125.0579	R	N	79	98
PSM	NLPFPTYFPDGDEEELPEDLYDENVCQPGAPSITFA	3900	sp|P09001|RM03_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	12	26-UNIMOD:4	ms_run[2]:scan=4440	24.169	3	4085.8041	4085.8041	K	-	313	349
PSM	QDDPFELFIAATNIR	3901	sp|Q9H0A0-2|NAT10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	12		ms_run[2]:scan=225	1.2372	3	1748.8733	1748.8733	K	Y	17	32
PSM	QLLAEESLPTTPFYFILGK	3902	sp|Q8IWA0|WDR75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	12		ms_run[2]:scan=41	0.21123	3	2166.1613	2166.1613	K	H	683	702
PSM	QLYEPLVMQLIHWFTNNKK	3903	sp|P78527-2|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	12		ms_run[2]:scan=6864	37.583	4	2401.2617	2401.2617	R	F	982	1001
PSM	QYPEFPWTDVQAEIFR	3904	sp|Q14166|TTL12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	12		ms_run[2]:scan=5733	31.268	2	2024.9632	2024.9632	K	A	538	554
PSM	RFLDFITNIFA	3905	sp|Q8TBX8-2|PI42C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	12		ms_run[2]:scan=5070	27.602	2	1355.7238	1355.7238	K	-	363	374
PSM	VHGSSEAFWILVEDVDSEVILHHEYFLLK	3906	sp|O75643|U520_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	12		ms_run[2]:scan=5640	30.753	5	3410.7187	3410.7187	K	A	1214	1243
PSM	VLILGSGGLSIGQAGEFDYSGSQAVK	3907	sp|P31327|CPSM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	12		ms_run[2]:scan=7169	39.3	3	2552.3122	2552.3122	K	A	425	451
PSM	VRLPLEELELLLED	3908	sp|Q9H7Z3|NRDE2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	12		ms_run[2]:scan=5972	32.604	2	1679.9346	1679.9346	R	-	1151	1165
PSM	WLPAGDALLQMITIHLPSPVTAQK	3909	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12	11-UNIMOD:35	ms_run[1]:scan=5761	31.426923	3	2615.417822	2615.414531	R	Y	343	367
PSM	GILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVK	3910	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12		ms_run[1]:scan=7263	39.82192	5	4034.893974	4035.887504	K	L	272	310
PSM	LQLETEIEALKEELLFMK	3911	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12		ms_run[1]:scan=2153	11.66254	3	2177.175575	2176.170109	R	K	197	215
PSM	DFLDEYIFLAVGR	3912	sp|O00571|DDX3X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12		ms_run[1]:scan=5335	29.074498	2	1556.789415	1556.787495	R	V	395	408
PSM	ILSISADIETIGEILK	3913	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12		ms_run[1]:scan=3993	21.715872	2	1714.981546	1713.976418	R	K	87	103
PSM	TIHGLIYNALKLFMEMNQK	3914	sp|Q14738|2A5D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12		ms_run[1]:scan=3661	19.873805	3	2264.191982	2263.185716	K	L	461	480
PSM	QAFQGDSIPVFDLLILGVGPDGHTCSLFPDHPLLQER	3915	sp|O95336|6PGL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12	25-UNIMOD:4	ms_run[1]:scan=4964	27.000008	4	4088.051145	4088.046587	R	E	132	169
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	3916	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12	7-UNIMOD:35,27-UNIMOD:4	ms_run[1]:scan=8785	48.378079	3	3530.691061	3528.690508	R	R	85	117
PSM	SLIDQFFGVEFETTMK	3917	sp|P54578|UBP14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12		ms_run[1]:scan=1077	5.8147747	2	1891.922215	1890.907352	K	C	241	257
PSM	YTFHGDPHATFAAFFGGSNPFEIFFGR	3918	sp|Q9UDY4|DNJB4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12		ms_run[1]:scan=7373	40.437125	4	3037.4112	3036.3982	R	R	88	115
PSM	VASVMQEYTQSGGVRPFGVSLLICGWNEGRPYLFQSDPSGAYFAWK	3919	sp|P25787|PSA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12	24-UNIMOD:4	ms_run[1]:scan=2530	13.701177	4	5154.4774	5154.4791	R	A	114	160
PSM	ENPFLTNGITSCSLPRPTPQASFLPENAFSANLNFFPTPNPDPFRDDPFTQPDQSTPSSFDSLK	3920	sp|P98082|DAB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12	12-UNIMOD:4	ms_run[1]:scan=1953	10.559275	5	7112.3402	7112.3512	R	S	252	316
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	3921	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12	27-UNIMOD:4	ms_run[1]:scan=8252	45.344413	3	3438.684945	3436.697307	R	R	85	117
PSM	SGTIFDNFLITDDEEYADNFGKATWGETK	3922	sp|Q96L12|CALR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12		ms_run[1]:scan=3500	19.002883	3	3284.514953	3283.483334	R	G	309	338
PSM	NTPLHYAAASGMKACVELLVK	3923	sp|Q9P2G1|AKIB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12	12-UNIMOD:35,15-UNIMOD:4	ms_run[1]:scan=3272	17.736145	3	2289.1592	2288.1652	K	H	146	167
PSM	GTDGVEYLLIPVDNGTLTDFLEKEEEEA	3924	sp|Q13416|ORC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12		ms_run[1]:scan=5706	31.115702	3	3095.4992	3095.4702	K	-	550	578
PSM	QLFSSLFSGILK	3925	sp|P78527|PRKDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12		ms_run[1]:scan=7589	41.639875	2	1341.758829	1338.754738	K	E	2807	2819
PSM	TWWNQFSVTALQLLQANR	3926	sp|Q99536|VAT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12		ms_run[1]:scan=5238	28.524988	3	2178.131428	2175.122522	R	A	304	322
PSM	ELDLSLNELGDLGVLLLCEGLR	3927	sp|P59046|NAL12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12	18-UNIMOD:4	ms_run[1]:scan=39	0.19998028	3	2443.307883	2440.288327	R	H	888	910
PSM	MALIQLGSVEEAIQALIELHNHDLGENHHLR	3928	sp|O95758|PTBP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12		ms_run[1]:scan=1723	9.3695953	5	3498.800104	3499.799421	K	V	514	545
PSM	TALLAIIGFMPTKGEGAIGSLDYTPEER	3929	sp|Q9Y385|UB2J1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12	10-UNIMOD:35	ms_run[1]:scan=3856	20.945447	4	2968.548220	2965.510676	R	R	110	138
PSM	DDVFLSVPCILGQNGISDLVK	3930	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12	9-UNIMOD:4	ms_run[1]:scan=1536	8.3155803	2	2289.156802	2288.172235	K	V	285	306
PSM	FMPVSSLIVGVDLVPIKPLPNVVTLQQDITTER	3931	sp|Q8IY81|SPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12		ms_run[1]:scan=3649	19.818496	3	3621.002711	3618.010643	K	C	65	98
PSM	AQHIVPCTISQLLSATLVDEVFR	3932	sp|P15927|RFA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12	7-UNIMOD:4	ms_run[1]:scan=2908	15.757344	3	2596.373698	2596.368309	R	I	43	66
PSM	TTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHVEMHLR	3933	sp|Q15393|SF3B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12		ms_run[1]:scan=5174	28.192036	5	4736.359914	4737.353728	K	S	1107	1150
PSM	GFTDADNTWEPEENLDCPELIEAFLNSQK	3934	sp|Q13185|CBX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12	17-UNIMOD:4	ms_run[1]:scan=1390	7.5440278	3	3382.478443	3381.498333	K	A	53	82
PSM	AAETTVVEVEEIVDIGAFAPEDIHIPQIYVHR	3935	sp|P55809|SCOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	11		ms_run[2]:scan=1539	8.3325	3	3559.8199	3559.8199	K	L	237	269
PSM	AFVHWYVGEGMEEGEFSEAR	3936	sp|P68363-2|TBA1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	11		ms_run[2]:scan=9375	51.256	3	2329.011	2329.0110	R	E	287	307
PSM	DCQPLLSSLSNLAEQLQAAQNLR	3937	sp|Q9NX04-2|CA109_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	11	2-UNIMOD:4	ms_run[2]:scan=5356	29.188	3	2568.2966	2568.2966	R	F	34	57
PSM	DKPSGDTAAVFEEGGDVDDLLDMI	3938	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	11		ms_run[2]:scan=3738	20.292	2	2508.1214	2508.1214	K	-	709	733
PSM	EEIVQFFSGLEIVPNGITLPVDPEGK	3939	sp|P52597|HNRPF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	11		ms_run[2]:scan=5277	28.746	2	2826.4691	2826.4691	K	I	125	151
PSM	EVFPFPEVSQDELNEINQFLGPVEK	3940	sp|Q9H845|ACAD9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	11		ms_run[2]:scan=6812	37.285	2	2903.4229	2903.4229	K	F	52	77
PSM	FGANAILGVSLAVCK	3941	sp|P06733-2|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	11	14-UNIMOD:4	ms_run[2]:scan=6508	35.583	2	1518.8228	1518.8228	K	A	13	28
PSM	LSSSLAAMLIGILHMR	3942	sp|Q9NXF1-2|TEX10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	11		ms_run[2]:scan=4318	23.491	3	1711.9477	1711.9477	R	S	648	664
PSM	NEANQPLCLPALLIYTEASDYIPDDHQDYAEALINPIK	3943	sp|Q01970-2|PLCB3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	11	8-UNIMOD:4	ms_run[2]:scan=6376	34.838	3	4327.0995	4327.0995	R	H	760	798
PSM	QTINQLLAEMDGFKPNEGVIIIGATNFPEALDNALIRPGR	3944	sp|Q96TA2-3|YMEL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	11		ms_run[2]:scan=5739	31.301	4	4335.2685	4335.2685	R	F	368	408
PSM	SLVALALIFAIQK	3945	sp|Q9UQE7|SMC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	11		ms_run[2]:scan=1581	8.5703	2	1385.8646	1385.8646	K	C	1121	1134
PSM	TPMGLLLEALGQEQEAGS	3946	sp|O60831|PRAF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	11		ms_run[2]:scan=4741	25.781	2	1842.9033	1842.9033	R	-	161	179
PSM	VEEVIDKFNTMAIIDGK	3947	sp|Q70Z35-3|PREX2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	11		ms_run[2]:scan=6827	37.372	2	1920.9867	1920.9867	K	K	788	805
PSM	VPAFEGDDGFCVFESNAIAYYVSNEELR	3948	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	11	11-UNIMOD:4	ms_run[2]:scan=3336	18.094	3	3197.4288	3197.4288	K	G	58	86
PSM	VTLSALDTSESSFTPLVVIELAQDVKEETK	3949	sp|Q9NW15-2|ANO10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	11		ms_run[2]:scan=3036	16.466	3	3248.6915	3248.6915	K	E	3	33
PSM	YGSYNVFWTSNPGLPLLTEMVK	3950	sp|Q13724-2|MOGS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	11		ms_run[2]:scan=752	4.0716	3	2515.2457	2515.2457	K	S	151	173
PSM	DMAIATGGAVFGEEGLTLNLEDVQPHDLGK	3951	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	11		ms_run[1]:scan=8656	47.647905	3	3096.517093	3096.507381	K	V	315	345
PSM	SKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICR	3952	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	11	36-UNIMOD:4,49-UNIMOD:4	ms_run[1]:scan=7159	39.243141	4	5731.6972	5731.7152	K	R	165	215
PSM	SDIVSRALDLFSDNAPPPELLEIINEDIAK	3953	sp|Q15084|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	11		ms_run[1]:scan=6231	34.047734	5	3294.7152	3293.7022	R	R	259	289
PSM	VANILINLYGMTAVLSR	3954	sp|Q9H845|ACAD9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	11		ms_run[1]:scan=1184	6.4174231	3	1847.035598	1847.033890	R	A	533	550
PSM	SQVVIPILQWAIASTTLDHR	3955	sp|Q9Y5L0|TNPO3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	11		ms_run[1]:scan=3784	20.540888	2	2247.236421	2247.237552	R	D	770	790
PSM	KLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTALPDEDDDL	3956	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	11		ms_run[1]:scan=6505	35.566252	4	5386.6133	5386.6148	R	-	167	217
PSM	EQLIIPQVPLFNILAK	3957	sp|Q53GS9|SNUT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	11		ms_run[1]:scan=677	3.6585635	2	1835.094399	1835.092057	K	F	406	422
PSM	YLSLQQMQELSNILNLSYKQVK	3958	sp|Q8N7R0|NANG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	11	7-UNIMOD:35	ms_run[1]:scan=6834	37.410469	4	2657.421176	2655.394189	K	T	62	84
PSM	ESNTPAPSTQGLPDSWGIIAEPR	3959	sp|O14654|IRS4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	11		ms_run[1]:scan=7263	39.82192	3	2422.1592	2422.1762	R	Q	930	953
PSM	ELLTFLESSTGSPEEPNKFHSLPR	3960	sp|Q9C0D6|FHDC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	11		ms_run[1]:scan=5382	29.33333	4	2715.353986	2714.355161	R	S	550	574
PSM	GPALDLMHIVQADNPSISVEECLEAFK	3961	sp|Q9UL42|PNMA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	11	7-UNIMOD:35,22-UNIMOD:4	ms_run[1]:scan=7507	41.19718	3	2998.451688	2998.441610	R	Q	212	239
PSM	WPTFGSAFFEVKQTSEPSYPDVILIAINR	3962	sp|Q6PIF6|MYO7B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	11		ms_run[1]:scan=7329	40.195158	4	3311.6602	3311.6862	R	H	2004	2033
PSM	LTGVSISQVNHKPLR	3963	sp|O75955|FLOT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	11		ms_run[1]:scan=759	4.1108782	2	1647.930581	1647.942039	R	T	411	426
PSM	FLILITDGEAQDIVKEPAVVLR	3964	sp|A6NMZ7|CO6A6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	11		ms_run[1]:scan=1165	6.3107688	3	2438.3572	2438.3782	K	Q	725	747
PSM	EIVEMNEIEEGK	3965	sp|Q9H2G2|SLK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	11	5-UNIMOD:35	ms_run[1]:scan=6340	34.637105	2	1435.655100	1434.654826	K	N	604	616
PSM	GVPQIEVTFDIDANGILNVSAVDK	3966	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	11		ms_run[1]:scan=8408	46.232205	3	2515.293008	2513.301334	R	S	470	494
PSM	GAAEALLFRLQTALQAQNR	3967	sp|Q9NRC6|SPTN5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	11		ms_run[1]:scan=1135	6.1396395	2	2072.119927	2070.133421	R	R	364	383
PSM	HLYTADMFTHGIQSAAHFVMFFAPWCGHCQR	3968	sp|Q8NBS9|TXND5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	11	26-UNIMOD:4,29-UNIMOD:4	ms_run[1]:scan=3142	17.049161	5	3722.660375	3722.658059	K	L	64	95
PSM	QILDTPEMPLEITRSFIQNR	3969	sp|Q9NWW7|CB042_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	11		ms_run[1]:scan=2023	10.943246	3	2399.233403	2400.247131	K	D	445	465
PSM	LWSEEQPAHPLQVGAVYLGEEELLHDPMGQDR	3970	sp|Q96J42|TXD15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	11		ms_run[1]:scan=245	1.3479892	3	3644.712976	3642.741297	R	A	42	74
PSM	DALEFWLQAGVDGFQVR	3971	sp|P08195|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	11		ms_run[1]:scan=5285	28.790186	3	1948.967236	1949.963562	K	D	332	349
PSM	QEGCQDIATQLISNMDIDVILGGGR	3972	sp|P05187|PPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	11	4-UNIMOD:4	ms_run[1]:scan=5992	32.711552	3	2701.277651	2702.300365	R	K	202	227
PSM	HLLDQIQTLMLQNR	3973	sp|Q3V6T2|GRDN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	11		ms_run[1]:scan=1128	6.1026687	3	1723.917160	1721.924674	R	T	1326	1340
PSM	SLTPVTLVLAEDGTIVDDDDYFLCLPSNTK	3974	sp|O00273|DFFA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	11	24-UNIMOD:4	ms_run[1]:scan=2109	11.425942	3	3309.624958	3310.616657	K	F	55	85
PSM	VDTIGQMSCNPSFGGIGKGHLMR	3975	sp|Q9Y2Z2|MTO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	11	7-UNIMOD:35,9-UNIMOD:4,22-UNIMOD:35	ms_run[1]:scan=577	3.1073131	3	2495.140322	2493.156284	R	E	69	92
PSM	IQVIDISMILAEAIR	3976	sp|P60891|PRPS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	11		ms_run[1]:scan=6780	37.102575	2	1686.972974	1683.959328	K	R	287	302
PSM	CPEALFQPSFLGMESCGIHETTFNSIMK	3977	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	11	1-UNIMOD:4,16-UNIMOD:4	ms_run[1]:scan=689	3.7246633	3	3231.450718	3230.454500	R	C	257	285