MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000208 -- new
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220618\20220618002634800212^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\111222_HL02.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220618\20220618002634800212^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\111222_HL02.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Acetyl (Protein N-term),Label:13C(6) (K),Label:13C(6)15N(4) (R),Oxidation (M)
MTD	software[1]-setting	maxMissedCleavages=1
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=40
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Label:13C(6) (K),Label:13C(6)15N(4) (R),Acetyl (Protein N-term)
MTD	software[2]-setting	TOL(-)=20
MTD	software[2]-setting	TOL(+)=20
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=1000
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=1
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Acetyl (Protein N-term),Label:13C(6) (K),Label:13C(6)15N(4) (R),Oxidation (M)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=1
MTD	software[3]-setting	peptide_mass_tolerance=20
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:1, Acetyl,]
MTD	variable_mod[1]-site	N-term
MTD	variable_mod[1]-position	Protein N-term
MTD	variable_mod[2]	[UNIMOD, UNIMOD:188, Label:13C(6),]
MTD	variable_mod[2]-site	K
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:267, Label:13C(6)15N(4),]
MTD	variable_mod[3]-site	R
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[4]-site	M
MTD	variable_mod[4]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q96H79|ZCCHL_HUMAN	Zinc finger CCCH-type antiviral protein 1-like OS=Homo sapiens OX=9606 GN=ZC3HAV1L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	53.0	null	269-UNIMOD:28	0.08	53.0	1	1	1
PRT	sp|O00429-3|DNM1L_HUMAN	Isoform 2 of Dynamin-1-like protein OS=Homo sapiens OX=9606 GN=DNM1L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	null	564-UNIMOD:267,680-UNIMOD:35	0.06	51.0	3	2	0
PRT	sp|Q08211|DHX9_HUMAN	ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	50.0	null	141-UNIMOD:267,434-UNIMOD:267,249-UNIMOD:28	0.04	50.0	7	3	1
PRT	sp|P13646-3|K1C13_HUMAN	Isoform 3 of Keratin, type I cytoskeletal 13 OS=Homo sapiens OX=9606 GN=KRT13	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	null	21-UNIMOD:4,27-UNIMOD:267,175-UNIMOD:267	0.08	50.0	2	2	1
PRT	sp|P49790-2|NU153_HUMAN	Isoform 2 of Nuclear pore complex protein Nup153 OS=Homo sapiens OX=9606 GN=NUP153	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null	883-UNIMOD:188	0.03	49.0	3	2	1
PRT	sp|P05783|K1C18_HUMAN	Keratin, type I cytoskeletal 18 OS=Homo sapiens OX=9606 GN=KRT18 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	49.0	null	74-UNIMOD:35,58-UNIMOD:35,81-UNIMOD:188,45-UNIMOD:267,370-UNIMOD:188,27-UNIMOD:267,149-UNIMOD:267,359-UNIMOD:28,314-UNIMOD:267,176-UNIMOD:28,186-UNIMOD:267,381-UNIMOD:267,196-UNIMOD:267	0.30	49.0	36	9	1
PRT	sp|P51617-4|IRAK1_HUMAN	Isoform 4 of Interleukin-1 receptor-associated kinase 1 OS=Homo sapiens OX=9606 GN=IRAK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null	521-UNIMOD:267	0.05	49.0	3	2	1
PRT	sp|Q99714-2|HCD2_HUMAN	Isoform 2 of 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Homo sapiens OX=9606 GN=HSD17B10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	52-UNIMOD:188	0.10	48.0	3	1	0
PRT	sp|O75369-6|FLNB_HUMAN	Isoform 6 of Filamin-B OS=Homo sapiens OX=9606 GN=FLNB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	2430-UNIMOD:267,1372-UNIMOD:188,2154-UNIMOD:267,2361-UNIMOD:188,2236-UNIMOD:188,2050-UNIMOD:188,2004-UNIMOD:267,1996-UNIMOD:35,1617-UNIMOD:4,1629-UNIMOD:188	0.05	48.0	14	8	4
PRT	sp|P51991-2|ROA3_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	354-UNIMOD:267	0.06	48.0	2	1	0
PRT	sp|Q9Y490|TLN1_HUMAN	Talin-1 OS=Homo sapiens OX=9606 GN=TLN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	732-UNIMOD:4,741-UNIMOD:267,2398-UNIMOD:267,1618-UNIMOD:267,1780-UNIMOD:188,1415-UNIMOD:188,956-UNIMOD:4,957-UNIMOD:188,2291-UNIMOD:188,2115-UNIMOD:188,1555-UNIMOD:267	0.07	48.0	21	11	2
PRT	sp|P14618|KPYM_HUMAN	Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	48.0	null	187-UNIMOD:28,188-UNIMOD:188,206-UNIMOD:188,224-UNIMOD:188,186-UNIMOD:188,423-UNIMOD:4,424-UNIMOD:4,43-UNIMOD:267,151-UNIMOD:188	0.19	48.0	16	8	4
PRT	sp|Q9BQE3|TBA1C_HUMAN	Tubulin alpha-1C chain OS=Homo sapiens OX=9606 GN=TUBA1C PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	60-UNIMOD:188,376-UNIMOD:4,390-UNIMOD:267	0.12	47.0	9	3	1
PRT	sp|P09211|GSTP1_HUMAN	Glutathione S-transferase P OS=Homo sapiens OX=9606 GN=GSTP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	47.0	null	209-UNIMOD:188,71-UNIMOD:267,48-UNIMOD:4,55-UNIMOD:188	0.22	47.0	18	4	1
PRT	sp|P55735-2|SEC13_HUMAN	Isoform 2 of Protein SEC13 homolog OS=Homo sapiens OX=9606 GN=SEC13	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	220-UNIMOD:4,225-UNIMOD:267,231-UNIMOD:4,242-UNIMOD:188,173-UNIMOD:4,178-UNIMOD:188	0.17	46.0	5	3	1
PRT	sp|Q14C86-3|GAPD1_HUMAN	Isoform 3 of GTPase-activating protein and VPS9 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=GAPVD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	568-UNIMOD:4,582-UNIMOD:267,404-UNIMOD:267	0.04	46.0	6	3	1
PRT	sp|P29401|TKT_HUMAN	Transketolase OS=Homo sapiens OX=9606 GN=TKT PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	302-UNIMOD:267	0.03	46.0	3	1	0
PRT	sp|Q8TD30|ALAT2_HUMAN	Alanine aminotransferase 2 OS=Homo sapiens OX=9606 GN=GPT2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	142-UNIMOD:4,158-UNIMOD:4	0.09	46.0	3	3	3
PRT	sp|P06576|ATPB_HUMAN	ATP synthase subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	46.0	null	345-UNIMOD:267,342-UNIMOD:35,279-UNIMOD:267,406-UNIMOD:267,113-UNIMOD:35,121-UNIMOD:267,155-UNIMOD:267,145-UNIMOD:35,198-UNIMOD:188	0.21	46.0	18	7	2
PRT	sp|P62829|RL23_HUMAN	60S ribosomal protein L23 OS=Homo sapiens OX=9606 GN=RPL23 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	46.0	null	28-UNIMOD:4,35-UNIMOD:188	0.15	46.0	6	1	0
PRT	sp|Q8IWZ3|ANKH1_HUMAN	Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ANKHD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	1274-UNIMOD:267	0.02	46.0	3	2	1
PRT	sp|Q14566|MCM6_HUMAN	DNA replication licensing factor MCM6 OS=Homo sapiens OX=9606 GN=MCM6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	1-UNIMOD:1,120-UNIMOD:267	0.05	46.0	4	3	2
PRT	sp|Q14697|GANAB_HUMAN	Neutral alpha-glucosidase AB OS=Homo sapiens OX=9606 GN=GANAB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	338-UNIMOD:35,354-UNIMOD:267	0.02	46.0	2	1	0
PRT	sp|P17655|CAN2_HUMAN	Calpain-2 catalytic subunit OS=Homo sapiens OX=9606 GN=CAPN2 PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	82-UNIMOD:4,94-UNIMOD:267	0.03	46.0	2	1	0
PRT	sp|O43399-2|TPD54_HUMAN	Isoform 2 of Tumor protein D54 OS=Homo sapiens OX=9606 GN=TPD52L2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	34-UNIMOD:267,22-UNIMOD:35,133-UNIMOD:267	0.19	45.0	5	2	1
PRT	sp|O95865|DDAH2_HUMAN	N(G),N(G)-dimethylarginine dimethylaminohydrolase 2 OS=Homo sapiens OX=9606 GN=DDAH2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.08	45.0	1	1	1
PRT	sp|P09110-2|THIK_HUMAN	Isoform 2 of 3-ketoacyl-CoA thiolase, peroxisomal OS=Homo sapiens OX=9606 GN=ACAA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	121-UNIMOD:267	0.06	45.0	2	1	0
PRT	sp|Q92620-2|PRP16_HUMAN	Isoform 2 of Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Homo sapiens OX=9606 GN=DHX38	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.04	45.0	1	1	1
PRT	sp|Q9HC38|GLOD4_HUMAN	Glyoxalase domain-containing protein 4 OS=Homo sapiens OX=9606 GN=GLOD4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	116-UNIMOD:267,197-UNIMOD:4	0.11	45.0	4	2	1
PRT	sp|P52209-2|6PGD_HUMAN	Isoform 2 of 6-phosphogluconate dehydrogenase, decarboxylating OS=Homo sapiens OX=9606 GN=PGD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	94-UNIMOD:267,389-UNIMOD:4,394-UNIMOD:267	0.07	45.0	3	2	1
PRT	sp|Q9Y5X1|SNX9_HUMAN	Sorting nexin-9 OS=Homo sapiens OX=9606 GN=SNX9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	136-UNIMOD:267	0.04	45.0	2	1	0
PRT	sp|Q8N6H7-3|ARFG2_HUMAN	Isoform 3 of ADP-ribosylation factor GTPase-activating protein 2 OS=Homo sapiens OX=9606 GN=ARFGAP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	88-UNIMOD:188	0.08	45.0	4	1	0
PRT	sp|Q7KZ85|SPT6H_HUMAN	Transcription elongation factor SPT6 OS=Homo sapiens OX=9606 GN=SUPT6H PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	1155-UNIMOD:188	0.02	45.0	3	2	1
PRT	sp|P17858|PFKAL_HUMAN	ATP-dependent 6-phosphofructokinase, liver type OS=Homo sapiens OX=9606 GN=PFKL PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	35-UNIMOD:267,708-UNIMOD:4,713-UNIMOD:188	0.05	44.0	4	2	0
PRT	sp|P05387|RLA2_HUMAN	60S acidic ribosomal protein P2 OS=Homo sapiens OX=9606 GN=RPLP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	99-UNIMOD:188,21-UNIMOD:188,61-UNIMOD:188	0.44	44.0	7	3	0
PRT	sp|Q9BST9|RTKN_HUMAN	Rhotekin OS=Homo sapiens OX=9606 GN=RTKN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	306-UNIMOD:4,317-UNIMOD:267	0.06	44.0	3	2	1
PRT	sp|O43707|ACTN4_HUMAN	Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	883-UNIMOD:35,899-UNIMOD:188,622-UNIMOD:188,351-UNIMOD:4,363-UNIMOD:188,757-UNIMOD:267,879-UNIMOD:4,882-UNIMOD:267,166-UNIMOD:188,767-UNIMOD:35,771-UNIMOD:267	0.11	44.0	16	7	2
PRT	sp|P16435|NCPR_HUMAN	NADPH--cytochrome P450 reductase OS=Homo sapiens OX=9606 GN=POR PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	597-UNIMOD:267	0.05	44.0	3	2	1
PRT	sp|Q5T4S7-3|UBR4_HUMAN	Isoform 3 of E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	255-UNIMOD:188	0.00	44.0	2	1	0
PRT	sp|Q15005|SPCS2_HUMAN	Signal peptidase complex subunit 2 OS=Homo sapiens OX=9606 GN=SPCS2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	44.0	null	17-UNIMOD:4,26-UNIMOD:4,32-UNIMOD:267,10-UNIMOD:267	0.15	44.0	3	2	1
PRT	sp|Q9BZE9-4|ASPC1_HUMAN	Isoform 4 of Tether containing UBX domain for GLUT4 OS=Homo sapiens OX=9606 GN=ASPSCR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.09	44.0	2	1	0
PRT	sp|P24928|RPB1_HUMAN	DNA-directed RNA polymerase II subunit RPB1 OS=Homo sapiens OX=9606 GN=POLR2A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	382-UNIMOD:267	0.02	44.0	3	2	1
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.13	44.0	2	2	2
PRT	sp|P36578|RL4_HUMAN	60S ribosomal protein L4 OS=Homo sapiens OX=9606 GN=RPL4 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	44.0	null	50-UNIMOD:28,125-UNIMOD:4,138-UNIMOD:35,140-UNIMOD:188,208-UNIMOD:4,219-UNIMOD:188,2-UNIMOD:1,3-UNIMOD:4	0.17	44.0	10	4	2
PRT	sp|Q16531|DDB1_HUMAN	DNA damage-binding protein 1 OS=Homo sapiens OX=9606 GN=DDB1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	44.0	null	370-UNIMOD:28,378-UNIMOD:4,383-UNIMOD:188,388-UNIMOD:267	0.03	44.0	5	3	1
PRT	sp|P25398|RS12_HUMAN	40S ribosomal protein S12 OS=Homo sapiens OX=9606 GN=RPS12 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44.0	null	46-UNIMOD:28,50-UNIMOD:4,56-UNIMOD:4,63-UNIMOD:188,60-UNIMOD:35	0.14	44.0	4	1	0
PRT	sp|P07108|ACBP_HUMAN	Acyl-CoA-binding protein OS=Homo sapiens OX=9606 GN=DBI PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44.0	null	34-UNIMOD:28,44-UNIMOD:267,53-UNIMOD:188,47-UNIMOD:35	0.24	44.0	5	1	0
PRT	sp|P11166|GTR1_HUMAN	Solute carrier family 2, facilitated glucose transporter member 1 OS=Homo sapiens OX=9606 GN=SLC2A1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44.0	null	469-UNIMOD:28,477-UNIMOD:188	0.05	44.0	2	1	0
PRT	sp|Q13263-2|TIF1B_HUMAN	Isoform 2 of Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	2-UNIMOD:1,685-UNIMOD:267,283-UNIMOD:188,425-UNIMOD:188,401-UNIMOD:267,31-UNIMOD:188,32-UNIMOD:267	0.15	43.0	13	6	1
PRT	sp|O75414-2|NDK6_HUMAN	Isoform 2 of Nucleoside diphosphate kinase 6 OS=Homo sapiens OX=9606 GN=NME6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	96-UNIMOD:4,100-UNIMOD:4	0.21	43.0	1	1	1
PRT	sp|Q6P1L8|RM14_HUMAN	39S ribosomal protein L14, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL14 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	118-UNIMOD:267	0.14	43.0	2	1	0
PRT	sp|P32969|RL9_HUMAN	60S ribosomal protein L9 OS=Homo sapiens OX=9606 GN=RPL9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	184-UNIMOD:188	0.10	43.0	1	1	1
PRT	sp|Q16555-2|DPYL2_HUMAN	Isoform 2 of Dihydropyrimidinase-related protein 2 OS=Homo sapiens OX=9606 GN=DPYSL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	58-UNIMOD:188,47-UNIMOD:35,42-UNIMOD:35,415-UNIMOD:188	0.06	43.0	5	2	0
PRT	sp|Q9Y3F4|STRAP_HUMAN	Serine-threonine kinase receptor-associated protein OS=Homo sapiens OX=9606 GN=STRAP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	290-UNIMOD:267	0.05	43.0	2	1	0
PRT	sp|Q15046|SYK_HUMAN	Lysine--tRNA ligase OS=Homo sapiens OX=9606 GN=KARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	579-UNIMOD:188,420-UNIMOD:267,565-UNIMOD:188	0.10	43.0	8	4	1
PRT	sp|Q92974-3|ARHG2_HUMAN	Isoform 3 of Rho guanine nucleotide exchange factor 2 OS=Homo sapiens OX=9606 GN=ARHGEF2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	307-UNIMOD:4,713-UNIMOD:267	0.03	43.0	2	2	2
PRT	sp|Q6F5E8-2|CARL2_HUMAN	Isoform 2 of Capping protein, Arp2/3 and myosin-I linker protein 2 OS=Homo sapiens OX=9606 GN=CARMIL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	1303-UNIMOD:4	0.03	43.0	2	2	2
PRT	sp|Q92734-4|TFG_HUMAN	Isoform 4 of Protein TFG OS=Homo sapiens OX=9606 GN=TFG	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	203-UNIMOD:267	0.09	43.0	1	1	1
PRT	sp|Q15758|AAAT_HUMAN	Neutral amino acid transporter B(0) OS=Homo sapiens OX=9606 GN=SLC1A5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	522-UNIMOD:188,537-UNIMOD:188,189-UNIMOD:267	0.09	43.0	12	3	0
PRT	sp|P17987|TCPA_HUMAN	T-complex protein 1 subunit alpha OS=Homo sapiens OX=9606 GN=TCP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	466-UNIMOD:188,385-UNIMOD:4,390-UNIMOD:267,357-UNIMOD:4,199-UNIMOD:188,365-UNIMOD:188,443-UNIMOD:267	0.15	43.0	10	6	2
PRT	sp|Q8NHH9-3|ATLA2_HUMAN	Isoform 3 of Atlastin-2 OS=Homo sapiens OX=9606 GN=ATL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	220-UNIMOD:267	0.05	43.0	1	1	1
PRT	sp|P52701|MSH6_HUMAN	DNA mismatch repair protein Msh6 OS=Homo sapiens OX=9606 GN=MSH6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	88-UNIMOD:4,99-UNIMOD:188,988-UNIMOD:267	0.03	43.0	4	2	0
PRT	sp|Q9UNM6|PSD13_HUMAN	26S proteasome non-ATPase regulatory subunit 13 OS=Homo sapiens OX=9606 GN=PSMD13 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	270-UNIMOD:267,313-UNIMOD:188,132-UNIMOD:188	0.11	43.0	8	3	0
PRT	sp|P68366-2|TBA4A_HUMAN	Isoform 2 of Tubulin alpha-4A chain OS=Homo sapiens OX=9606 GN=TUBA4A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	39-UNIMOD:4,361-UNIMOD:4,355-UNIMOD:188,362-UNIMOD:35,375-UNIMOD:267,45-UNIMOD:188,64-UNIMOD:267	0.17	43.0	15	4	1
PRT	sp|Q9BYG3|MK67I_HUMAN	MKI67 FHA domain-interacting nucleolar phosphoprotein OS=Homo sapiens OX=9606 GN=NIFK PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	43.0	null	237-UNIMOD:4,244-UNIMOD:267,192-UNIMOD:188	0.11	43.0	4	2	0
PRT	sp|P57740|NU107_HUMAN	Nuclear pore complex protein Nup107 OS=Homo sapiens OX=9606 GN=NUP107 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	48-UNIMOD:267	0.02	43.0	2	1	0
PRT	sp|Q02252-2|MMSA_HUMAN	Isoform 2 of Methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial OS=Homo sapiens OX=9606 GN=ALDH6A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.04	43.0	1	1	1
PRT	sp|O00303|EIF3F_HUMAN	Eukaryotic translation initiation factor 3 subunit F OS=Homo sapiens OX=9606 GN=EIF3F PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	43.0	null	278-UNIMOD:267	0.05	43.0	4	1	0
PRT	sp|Q9UJU6|DBNL_HUMAN	Drebrin-like protein OS=Homo sapiens OX=9606 GN=DBNL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	42.0	null	61-UNIMOD:188,164-UNIMOD:188,18-UNIMOD:267,246-UNIMOD:267	0.19	42.0	8	5	2
PRT	sp|Q86SX6|GLRX5_HUMAN	Glutaredoxin-related protein 5, mitochondrial OS=Homo sapiens OX=9606 GN=GLRX5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	67-UNIMOD:4,78-UNIMOD:267	0.13	42.0	4	1	0
PRT	sp|Q9BTD8-4|RBM42_HUMAN	Isoform 4 of RNA-binding protein 42 OS=Homo sapiens OX=9606 GN=RBM42	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	351-UNIMOD:4,365-UNIMOD:267	0.04	42.0	2	1	0
PRT	sp|Q3ZCQ8-2|TIM50_HUMAN	Isoform 2 of Mitochondrial import inner membrane translocase subunit TIM50 OS=Homo sapiens OX=9606 GN=TIMM50	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	216-UNIMOD:267	0.06	42.0	3	2	1
PRT	sp|P07954-2|FUMH_HUMAN	Isoform Cytoplasmic of Fumarate hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=FH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	243-UNIMOD:267,328-UNIMOD:188,325-UNIMOD:35,129-UNIMOD:188	0.12	42.0	8	3	0
PRT	sp|P13489|RINI_HUMAN	Ribonuclease inhibitor OS=Homo sapiens OX=9606 GN=RNH1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	95-UNIMOD:4,96-UNIMOD:4,102-UNIMOD:4,110-UNIMOD:267	0.08	42.0	4	2	1
PRT	sp|Q15691|MARE1_HUMAN	Microtubule-associated protein RP/EB family member 1 OS=Homo sapiens OX=9606 GN=MAPRE1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	42.0	null	228-UNIMOD:4,241-UNIMOD:267,131-UNIMOD:28,148-UNIMOD:188,150-UNIMOD:188	0.15	42.0	3	2	1
PRT	sp|P09651-3|ROA1_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	265-UNIMOD:267,140-UNIMOD:267	0.11	42.0	4	2	0
PRT	sp|P10412|H14_HUMAN	Histone H1.4 OS=Homo sapiens OX=9606 GN=H1-4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	2-UNIMOD:1,17-UNIMOD:188,21-UNIMOD:188,46-UNIMOD:188	0.16	42.0	4	2	0
PRT	sp|Q13310-3|PABP4_HUMAN	Isoform 3 of Polyadenylate-binding protein 4 OS=Homo sapiens OX=9606 GN=PABPC4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	67-UNIMOD:267,128-UNIMOD:4,129-UNIMOD:188,339-UNIMOD:4	0.08	42.0	5	3	0
PRT	sp|Q15436-2|SC23A_HUMAN	Isoform 2 of Protein transport protein Sec23A OS=Homo sapiens OX=9606 GN=SEC23A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	230-UNIMOD:4,242-UNIMOD:4,402-UNIMOD:267	0.07	42.0	3	2	1
PRT	sp|O14828-2|SCAM3_HUMAN	Isoform 2 of Secretory carrier-associated membrane protein 3 OS=Homo sapiens OX=9606 GN=SCAMP3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	319-UNIMOD:267	0.11	42.0	3	2	1
PRT	sp|O15127|SCAM2_HUMAN	Secretory carrier-associated membrane protein 2 OS=Homo sapiens OX=9606 GN=SCAMP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	312-UNIMOD:267	0.06	42.0	2	1	0
PRT	sp|P19367-4|HXK1_HUMAN	Isoform 4 of Hexokinase-1 OS=Homo sapiens OX=9606 GN=HK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	527-UNIMOD:267	0.04	42.0	3	2	1
PRT	sp|P40925-2|MDHC_HUMAN	Isoform 2 of Malate dehydrogenase, cytoplasmic OS=Homo sapiens OX=9606 GN=MDH1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	48-UNIMOD:4,53-UNIMOD:188,90-UNIMOD:188	0.11	42.0	4	2	0
PRT	sp|Q7Z460-4|CLAP1_HUMAN	Isoform 4 of CLIP-associating protein 1 OS=Homo sapiens OX=9606 GN=CLASP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	1367-UNIMOD:4,1383-UNIMOD:188,453-UNIMOD:4	0.02	42.0	4	2	1
PRT	sp|P78347-2|GTF2I_HUMAN	Isoform 2 of General transcription factor II-I OS=Homo sapiens OX=9606 GN=GTF2I	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	661-UNIMOD:267	0.02	42.0	2	1	0
PRT	sp|P84098|RL19_HUMAN	60S ribosomal protein L19 OS=Homo sapiens OX=9606 GN=RPL19 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	38-UNIMOD:267,162-UNIMOD:267	0.14	42.0	3	2	1
PRT	sp|Q96KR1|ZFR_HUMAN	Zinc finger RNA-binding protein OS=Homo sapiens OX=9606 GN=ZFR PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	null	384-UNIMOD:385,384-UNIMOD:4,387-UNIMOD:4,391-UNIMOD:4,402-UNIMOD:267	0.02	42.0	2	1	0
PRT	sp|P55011-3|S12A2_HUMAN	Isoform 2 of Solute carrier family 12 member 2 OS=Homo sapiens OX=9606 GN=SLC12A2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	51-UNIMOD:267	0.04	41.0	3	2	1
PRT	sp|P00558|PGK1_HUMAN	Phosphoglycerate kinase 1 OS=Homo sapiens OX=9606 GN=PGK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null	108-UNIMOD:4,123-UNIMOD:267,367-UNIMOD:4,379-UNIMOD:4,380-UNIMOD:4,382-UNIMOD:188	0.09	41.0	9	2	1
PRT	sp|P05388-2|RLA0_HUMAN	Isoform 2 of 60S acidic ribosomal protein P0 OS=Homo sapiens OX=9606 GN=RPLP0	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	119-UNIMOD:4,134-UNIMOD:188,27-UNIMOD:4,26-UNIMOD:188	0.18	41.0	5	3	1
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	1448-UNIMOD:4,1459-UNIMOD:4,1461-UNIMOD:267,2043-UNIMOD:267,310-UNIMOD:267,235-UNIMOD:188	0.03	41.0	10	6	3
PRT	sp|P52597|HNRPF_HUMAN	Heterogeneous nuclear ribonucleoprotein F OS=Homo sapiens OX=9606 GN=HNRNPF PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	167-UNIMOD:188,316-UNIMOD:267	0.09	41.0	5	2	1
PRT	sp|Q9Y446|PKP3_HUMAN	Plakophilin-3 OS=Homo sapiens OX=9606 GN=PKP3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null	569-UNIMOD:4,575-UNIMOD:267,241-UNIMOD:267,529-UNIMOD:4,532-UNIMOD:267	0.06	41.0	6	3	1
PRT	sp|Q9H0D6-2|XRN2_HUMAN	Isoform 2 of 5'-3' exoribonuclease 2 OS=Homo sapiens OX=9606 GN=XRN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	83-UNIMOD:4,96-UNIMOD:188,390-UNIMOD:35,612-UNIMOD:188,382-UNIMOD:267	0.08	41.0	7	4	1
PRT	sp|P62701|RS4X_HUMAN	40S ribosomal protein S4, X isoform OS=Homo sapiens OX=9606 GN=RPS4X PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	181-UNIMOD:4,191-UNIMOD:267,182-UNIMOD:35	0.07	41.0	3	1	0
PRT	sp|Q04323|UBXN1_HUMAN	UBX domain-containing protein 1 OS=Homo sapiens OX=9606 GN=UBXN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	266-UNIMOD:267	0.07	41.0	5	1	0
PRT	sp|P07814|SYEP_HUMAN	Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	41.0	null	680-UNIMOD:4,692-UNIMOD:4,693-UNIMOD:188,182-UNIMOD:28,435-UNIMOD:188	0.03	41.0	4	3	2
PRT	sp|P13637-3|AT1A3_HUMAN	Isoform 3 of Sodium/potassium-transporting ATPase subunit alpha-3 OS=Homo sapiens OX=9606 GN=ATP1A3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.02	41.0	1	1	0
PRT	sp|Q92945|FUBP2_HUMAN	Far upstream element-binding protein 2 OS=Homo sapiens OX=9606 GN=KHSRP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	109-UNIMOD:188,646-UNIMOD:188,462-UNIMOD:267,190-UNIMOD:267	0.10	41.0	8	4	0
PRT	sp|P25705-2|ATPA_HUMAN	Isoform 2 of ATP synthase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	23-UNIMOD:267	0.03	41.0	2	1	0
PRT	sp|O00231|PSD11_HUMAN	26S proteasome non-ATPase regulatory subunit 11 OS=Homo sapiens OX=9606 GN=PSMD11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	260-UNIMOD:35,274-UNIMOD:188,337-UNIMOD:267,59-UNIMOD:188	0.10	41.0	7	3	0
PRT	sp|Q9Y3B2|EXOS1_HUMAN	Exosome complex component CSL4 OS=Homo sapiens OX=9606 GN=EXOSC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	15-UNIMOD:4,29-UNIMOD:267	0.09	41.0	2	1	0
PRT	sp|P55209-3|NP1L1_HUMAN	Isoform 3 of Nucleosome assembly protein 1-like 1 OS=Homo sapiens OX=9606 GN=NAP1L1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	31-UNIMOD:267,75-UNIMOD:188	0.09	41.0	4	2	0
PRT	sp|Q15165-3|PON2_HUMAN	Isoform 3 of Serum paraoxonase/arylesterase 2 OS=Homo sapiens OX=9606 GN=PON2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	293-UNIMOD:267	0.05	41.0	2	1	0
PRT	sp|P09382|LEG1_HUMAN	Galectin-1 OS=Homo sapiens OX=9606 GN=LGALS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	128-UNIMOD:188	0.13	41.0	1	1	1
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null	225-UNIMOD:267,287-UNIMOD:267,556-UNIMOD:267,928-UNIMOD:188,263-UNIMOD:188,2717-UNIMOD:188	0.03	41.0	9	6	3
PRT	sp|O60488-2|ACSL4_HUMAN	Isoform Short of Long-chain-fatty-acid--CoA ligase 4 OS=Homo sapiens OX=9606 GN=ACSL4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	649-UNIMOD:188,554-UNIMOD:4,561-UNIMOD:4,453-UNIMOD:4,454-UNIMOD:4,457-UNIMOD:188	0.07	41.0	5	3	1
PRT	sp|P07910-4|HNRPC_HUMAN	Isoform 4 of Heterogeneous nuclear ribonucleoproteins C1/C2 OS=Homo sapiens OX=9606 GN=HNRNPC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	74-UNIMOD:35,89-UNIMOD:188	0.07	41.0	5	1	0
PRT	sp|O43660-2|PLRG1_HUMAN	Isoform 2 of Pleiotropic regulator 1 OS=Homo sapiens OX=9606 GN=PLRG1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.04	41.0	1	1	1
PRT	sp|O14579|COPE_HUMAN	Coatomer subunit epsilon OS=Homo sapiens OX=9606 GN=COPE PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	34-UNIMOD:4,40-UNIMOD:267,211-UNIMOD:188,299-UNIMOD:267	0.16	41.0	7	3	1
PRT	sp|P07384|CAN1_HUMAN	Calpain-1 catalytic subunit OS=Homo sapiens OX=9606 GN=CAPN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	104-UNIMOD:267,46-UNIMOD:267,351-UNIMOD:4,359-UNIMOD:188	0.06	41.0	5	3	1
PRT	sp|Q13177|PAK2_HUMAN	Serine/threonine-protein kinase PAK 2 OS=Homo sapiens OX=9606 GN=PAK2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	417-UNIMOD:267	0.03	41.0	2	1	0
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	41.0	null	284-UNIMOD:267,203-UNIMOD:28,391-UNIMOD:267,108-UNIMOD:28,121-UNIMOD:188,122-UNIMOD:267,218-UNIMOD:267	0.19	41.0	13	10	7
PRT	sp|Q3YEC7|RABL6_HUMAN	Rab-like protein 6 OS=Homo sapiens OX=9606 GN=RABL6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	719-UNIMOD:267	0.03	41.0	2	1	0
PRT	sp|Q9NX24|NHP2_HUMAN	H/ACA ribonucleoprotein complex subunit 2 OS=Homo sapiens OX=9606 GN=NHP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	41-UNIMOD:267	0.13	41.0	2	1	0
PRT	sp|P46777|RL5_HUMAN	60S ribosomal protein L5 OS=Homo sapiens OX=9606 GN=RPL5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	100-UNIMOD:4,107-UNIMOD:267	0.06	41.0	2	1	0
PRT	sp|Q9UBT2|SAE2_HUMAN	SUMO-activating enzyme subunit 2 OS=Homo sapiens OX=9606 GN=UBA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	210-UNIMOD:267,19-UNIMOD:267	0.05	41.0	3	2	1
PRT	sp|P07339|CATD_HUMAN	Cathepsin D OS=Homo sapiens OX=9606 GN=CTSD PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	41.0	null	177-UNIMOD:28,184-UNIMOD:188,194-UNIMOD:188,329-UNIMOD:4,331-UNIMOD:188,326-UNIMOD:35	0.09	41.0	6	2	0
PRT	sp|Q9UHX1-2|PUF60_HUMAN	Isoform 2 of Poly(U)-binding-splicing factor PUF60 OS=Homo sapiens OX=9606 GN=PUF60	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	null	86-UNIMOD:28,104-UNIMOD:267	0.04	41.0	2	1	0
PRT	sp|P85298-2|RHG08_HUMAN	Isoform 2 of Rho GTPase-activating protein 8 OS=Homo sapiens OX=9606 GN=ARHGAP8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	2-UNIMOD:1	0.06	40.0	1	1	1
PRT	sp|P61158|ARP3_HUMAN	Actin-related protein 3 OS=Homo sapiens OX=9606 GN=ACTR3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	40.0	null	2-UNIMOD:1,8-UNIMOD:4,12-UNIMOD:4,18-UNIMOD:188,34-UNIMOD:4,38-UNIMOD:188,255-UNIMOD:28,264-UNIMOD:188,265-UNIMOD:188,4-UNIMOD:267	0.12	40.0	8	4	1
PRT	sp|P22314-2|UBA1_HUMAN	Isoform 2 of Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	282-UNIMOD:188,344-UNIMOD:267,653-UNIMOD:267,41-UNIMOD:267,328-UNIMOD:267,981-UNIMOD:267,762-UNIMOD:188	0.11	40.0	19	7	0
PRT	sp|Q9BPX3|CND3_HUMAN	Condensin complex subunit 3 OS=Homo sapiens OX=9606 GN=NCAPG PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	486-UNIMOD:267,835-UNIMOD:4,843-UNIMOD:4,708-UNIMOD:267,848-UNIMOD:267	0.05	40.0	6	3	0
PRT	sp|O15027-2|SC16A_HUMAN	Isoform 2 of Protein transport protein Sec16A OS=Homo sapiens OX=9606 GN=SEC16A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	107-UNIMOD:4,118-UNIMOD:267,1562-UNIMOD:267	0.02	40.0	4	2	0
PRT	sp|O00299|CLIC1_HUMAN	Chloride intracellular channel protein 1 OS=Homo sapiens OX=9606 GN=CLIC1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	178-UNIMOD:4,113-UNIMOD:188,183-UNIMOD:188	0.15	40.0	5	2	0
PRT	sp|P50995-2|ANX11_HUMAN	Isoform 2 of Annexin A11 OS=Homo sapiens OX=9606 GN=ANXA11	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	193-UNIMOD:4,197-UNIMOD:267,261-UNIMOD:4,269-UNIMOD:267	0.10	40.0	7	3	1
PRT	sp|O00116|ADAS_HUMAN	Alkyldihydroxyacetonephosphate synthase, peroxisomal OS=Homo sapiens OX=9606 GN=AGPS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	603-UNIMOD:267	0.03	40.0	3	1	0
PRT	sp|P16152-2|CBR1_HUMAN	Isoform 2 of Carbonyl reductase [NADPH] 1 OS=Homo sapiens OX=9606 GN=CBR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	58-UNIMOD:267,2-UNIMOD:1,96-UNIMOD:188,15-UNIMOD:188	0.29	40.0	6	3	0
PRT	sp|Q15738|NSDHL_HUMAN	Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Homo sapiens OX=9606 GN=NSDHL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	79-UNIMOD:267,1-UNIMOD:1,10-UNIMOD:267,15-UNIMOD:267	0.10	40.0	4	2	0
PRT	sp|P04406-2|G3P_HUMAN	Isoform 2 of Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	110-UNIMOD:4,114-UNIMOD:4,120-UNIMOD:188,205-UNIMOD:4,206-UNIMOD:267,173-UNIMOD:188	0.22	40.0	9	4	0
PRT	sp|Q15819|UB2V2_HUMAN	Ubiquitin-conjugating enzyme E2 variant 2 OS=Homo sapiens OX=9606 GN=UBE2V2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	101-UNIMOD:267	0.12	40.0	2	1	0
PRT	sp|P30260|CDC27_HUMAN	Cell division cycle protein 27 homolog OS=Homo sapiens OX=9606 GN=CDC27 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	99-UNIMOD:188	0.02	40.0	2	1	0
PRT	sp|O94992|HEXI1_HUMAN	Protein HEXIM1 OS=Homo sapiens OX=9606 GN=HEXIM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	40.0	null	285-UNIMOD:28	0.09	40.0	2	2	2
PRT	sp|Q8IY95-2|TM192_HUMAN	Isoform 2 of Transmembrane protein 192 OS=Homo sapiens OX=9606 GN=TMEM192	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	262-UNIMOD:4,266-UNIMOD:267	0.06	40.0	2	1	0
PRT	sp|Q92575|UBXN4_HUMAN	UBX domain-containing protein 4 OS=Homo sapiens OX=9606 GN=UBXN4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	346-UNIMOD:267	0.04	40.0	2	1	0
PRT	sp|Q08AM6|VAC14_HUMAN	Protein VAC14 homolog OS=Homo sapiens OX=9606 GN=VAC14 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	719-UNIMOD:4	0.02	40.0	1	1	1
PRT	sp|Q8NCF5|NF2IP_HUMAN	NFATC2-interacting protein OS=Homo sapiens OX=9606 GN=NFATC2IP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.04	40.0	1	1	1
PRT	sp|Q99459|CDC5L_HUMAN	Cell division cycle 5-like protein OS=Homo sapiens OX=9606 GN=CDC5L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.03	40.0	2	2	2
PRT	sp|P63220|RS21_HUMAN	40S ribosomal protein S21 OS=Homo sapiens OX=9606 GN=RPS21 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	1-UNIMOD:1,1-UNIMOD:35,15-UNIMOD:267,16-UNIMOD:188,62-UNIMOD:35,71-UNIMOD:267	0.34	40.0	8	2	0
PRT	sp|P35579|MYH9_HUMAN	Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	40.0	null	941-UNIMOD:35,959-UNIMOD:267,1358-UNIMOD:28,755-UNIMOD:267	0.02	40.0	5	3	1
PRT	sp|P02545-2|LMNA_HUMAN	Isoform C of Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	352-UNIMOD:35,366-UNIMOD:188,541-UNIMOD:267,60-UNIMOD:267	0.12	40.0	8	5	1
PRT	sp|Q8WUM4-2|PDC6I_HUMAN	Isoform 2 of Programmed cell death 6-interacting protein OS=Homo sapiens OX=9606 GN=PDCD6IP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	229-UNIMOD:188	0.04	40.0	3	2	1
PRT	sp|Q5QJE6|TDIF2_HUMAN	Deoxynucleotidyltransferase terminal-interacting protein 2 OS=Homo sapiens OX=9606 GN=DNTTIP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	338-UNIMOD:267,374-UNIMOD:267	0.04	40.0	4	2	0
PRT	sp|P08727|K1C19_HUMAN	Keratin, type I cytoskeletal 19 OS=Homo sapiens OX=9606 GN=KRT19 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	40.0	null	24-UNIMOD:267,8-UNIMOD:28,264-UNIMOD:267,111-UNIMOD:188,381-UNIMOD:267	0.22	40.0	11	7	5
PRT	sp|Q8NFH5-2|NUP35_HUMAN	Isoform 2 of Nucleoporin NUP35 OS=Homo sapiens OX=9606 GN=NUP35	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	94-UNIMOD:267	0.06	40.0	2	1	0
PRT	sp|Q13596-2|SNX1_HUMAN	Isoform 1A of Sorting nexin-1 OS=Homo sapiens OX=9606 GN=SNX1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.04	40.0	1	1	1
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	254-UNIMOD:267,312-UNIMOD:267,28-UNIMOD:267,206-UNIMOD:267	0.16	40.0	23	4	0
PRT	sp|Q99798|ACON_HUMAN	Aconitate hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=ACO2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	385-UNIMOD:4,395-UNIMOD:267,648-UNIMOD:267,424-UNIMOD:267	0.06	40.0	5	3	1
PRT	sp|Q12906-5|ILF3_HUMAN	Isoform 5 of Interleukin enhancer-binding factor 3 OS=Homo sapiens OX=9606 GN=ILF3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	474-UNIMOD:267,465-UNIMOD:35	0.05	40.0	4	2	1
PRT	sp|Q15365|PCBP1_HUMAN	Poly(rC)-binding protein 1 OS=Homo sapiens OX=9606 GN=PCBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	194-UNIMOD:4,200-UNIMOD:267,186-UNIMOD:35,109-UNIMOD:4,115-UNIMOD:188,325-UNIMOD:267,54-UNIMOD:4,57-UNIMOD:267,355-UNIMOD:4	0.21	40.0	14	5	2
PRT	sp|O14907|TX1B3_HUMAN	Tax1-binding protein 3 OS=Homo sapiens OX=9606 GN=TAX1BP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	76-UNIMOD:188	0.15	40.0	2	1	0
PRT	sp|O95573|ACSL3_HUMAN	Long-chain-fatty-acid--CoA ligase 3 OS=Homo sapiens OX=9606 GN=ACSL3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	561-UNIMOD:4,573-UNIMOD:4,575-UNIMOD:188	0.03	40.0	2	1	0
PRT	sp|P34932|HSP74_HUMAN	Heat shock 70 kDa protein 4 OS=Homo sapiens OX=9606 GN=HSPA4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	40.0	null	417-UNIMOD:4,422-UNIMOD:188,234-UNIMOD:267,669-UNIMOD:28,84-UNIMOD:188,674-UNIMOD:188,679-UNIMOD:188	0.12	40.0	11	7	4
PRT	sp|O00410-2|IPO5_HUMAN	Isoform 2 of Importin-5 OS=Homo sapiens OX=9606 GN=IPO5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	360-UNIMOD:4,74-UNIMOD:188,673-UNIMOD:4,675-UNIMOD:267,206-UNIMOD:4,216-UNIMOD:267,366-UNIMOD:35,189-UNIMOD:188,500-UNIMOD:4,376-UNIMOD:188,50-UNIMOD:4,58-UNIMOD:267	0.10	40.0	14	7	1
PRT	sp|Q08J23-3|NSUN2_HUMAN	Isoform 3 of RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	437-UNIMOD:4,442-UNIMOD:4,382-UNIMOD:267,31-UNIMOD:4,35-UNIMOD:4,42-UNIMOD:267,363-UNIMOD:4,366-UNIMOD:267	0.12	40.0	7	4	1
PRT	sp|P05023|AT1A1_HUMAN	Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	647-UNIMOD:267,459-UNIMOD:4,463-UNIMOD:4,464-UNIMOD:4,468-UNIMOD:188	0.03	40.0	2	2	0
PRT	sp|Q9NSK0-5|KLC4_HUMAN	Isoform 5 of Kinesin light chain 4 OS=Homo sapiens OX=9606 GN=KLC4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	303-UNIMOD:267	0.04	39.0	2	1	0
PRT	sp|Q96GD0|PLPP_HUMAN	Pyridoxal phosphate phosphatase OS=Homo sapiens OX=9606 GN=PDXP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	26-UNIMOD:4	0.06	39.0	1	1	1
PRT	sp|Q53GS9-2|SNUT2_HUMAN	Isoform 2 of U4/U6.U5 tri-snRNP-associated protein 2 OS=Homo sapiens OX=9606 GN=USP39	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	128-UNIMOD:188	0.04	39.0	2	1	0
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	39.0	null	447-UNIMOD:4,462-UNIMOD:188,442-UNIMOD:4,446-UNIMOD:267,237-UNIMOD:4,249-UNIMOD:188,218-UNIMOD:188,233-UNIMOD:188,72-UNIMOD:188,237-UNIMOD:385,250-UNIMOD:188,405-UNIMOD:188,429-UNIMOD:267	0.19	39.0	20	9	0
PRT	sp|Q93008-1|USP9X_HUMAN	Isoform 2 of Probable ubiquitin carboxyl-terminal hydrolase FAF-X OS=Homo sapiens OX=9606 GN=USP9X	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	577-UNIMOD:4,592-UNIMOD:267	0.01	39.0	1	1	1
PRT	sp|P30050|RL12_HUMAN	60S ribosomal protein L12 OS=Homo sapiens OX=9606 GN=RPL12 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	141-UNIMOD:4,146-UNIMOD:267,17-UNIMOD:4,31-UNIMOD:188	0.30	39.0	5	3	1
PRT	sp|Q13501|SQSTM_HUMAN	Sequestosome-1 OS=Homo sapiens OX=9606 GN=SQSTM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	26-UNIMOD:4,27-UNIMOD:4,44-UNIMOD:4,46-UNIMOD:267,238-UNIMOD:188	0.11	39.0	4	2	1
PRT	sp|P21333-2|FLNA_HUMAN	Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1399-UNIMOD:188,2353-UNIMOD:188,478-UNIMOD:4,483-UNIMOD:4,484-UNIMOD:267,76-UNIMOD:267,2256-UNIMOD:267,400-UNIMOD:188,1477-UNIMOD:188,1260-UNIMOD:4,299-UNIMOD:188,297-UNIMOD:35,2593-UNIMOD:4,2492-UNIMOD:188	0.07	39.0	19	11	4
PRT	sp|Q06210-2|GFPT1_HUMAN	Isoform 2 of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Homo sapiens OX=9606 GN=GFPT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	456-UNIMOD:267,602-UNIMOD:4,612-UNIMOD:267	0.04	39.0	4	2	0
PRT	sp|Q86SJ2|AMGO2_HUMAN	Amphoterin-induced protein 2 OS=Homo sapiens OX=9606 GN=AMIGO2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.04	39.0	1	1	1
PRT	sp|Q04637-6|IF4G1_HUMAN	Isoform E of Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	863-UNIMOD:188	0.01	39.0	2	1	0
PRT	sp|P58546|MTPN_HUMAN	Myotrophin OS=Homo sapiens OX=9606 GN=MTPN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null	114-UNIMOD:188,2-UNIMOD:1,2-UNIMOD:4,4-UNIMOD:188,11-UNIMOD:188	0.36	39.0	5	3	1
PRT	sp|Q96PK6-2|RBM14_HUMAN	Isoform 2 of RNA-binding protein 14 OS=Homo sapiens OX=9606 GN=RBM14	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	90-UNIMOD:4,96-UNIMOD:267	0.11	39.0	2	1	0
PRT	sp|P17066|HSP76_HUMAN	Heat shock 70 kDa protein 6 OS=Homo sapiens OX=9606 GN=HSPA6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	189-UNIMOD:267	0.05	39.0	3	2	1
PRT	sp|Q12768|WASC5_HUMAN	WASH complex subunit 5 OS=Homo sapiens OX=9606 GN=WASHC5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	786-UNIMOD:4,791-UNIMOD:267,324-UNIMOD:267	0.03	39.0	3	2	1
PRT	sp|Q8IX12-2|CCAR1_HUMAN	Isoform 2 of Cell division cycle and apoptosis regulator protein 1 OS=Homo sapiens OX=9606 GN=CCAR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	206-UNIMOD:188,358-UNIMOD:4,361-UNIMOD:4	0.03	39.0	3	2	1
PRT	sp|Q6XQN6|PNCB_HUMAN	Nicotinate phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=NAPRT PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	477-UNIMOD:4,484-UNIMOD:4,494-UNIMOD:267	0.06	39.0	3	2	1
PRT	sp|P23246-2|SFPQ_HUMAN	Isoform Short of Splicing factor, proline- and glutamine-rich OS=Homo sapiens OX=9606 GN=SFPQ	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	314-UNIMOD:188,330-UNIMOD:188	0.04	39.0	4	2	0
PRT	sp|Q5T7V8-2|GORAB_HUMAN	Isoform 2 of RAB6-interacting golgin OS=Homo sapiens OX=9606 GN=GORAB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	95-UNIMOD:188	0.09	39.0	2	1	0
PRT	sp|O60664-4|PLIN3_HUMAN	Isoform 4 of Perilipin-3 OS=Homo sapiens OX=9606 GN=PLIN3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	183-UNIMOD:188	0.07	39.0	3	2	1
PRT	sp|P26599|PTBP1_HUMAN	Polypyrimidine tract-binding protein 1 OS=Homo sapiens OX=9606 GN=PTBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	250-UNIMOD:4,251-UNIMOD:4,254-UNIMOD:267	0.03	39.0	3	1	0
PRT	sp|O43815-2|STRN_HUMAN	Isoform 2 of Striatin OS=Homo sapiens OX=9606 GN=STRN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	563-UNIMOD:188	0.03	39.0	2	1	0
PRT	sp|Q96JJ7-2|TMX3_HUMAN	Isoform 2 of Protein disulfide-isomerase TMX3 OS=Homo sapiens OX=9606 GN=TMX3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	82-UNIMOD:35,97-UNIMOD:267	0.09	39.0	2	1	0
PRT	sp|Q8WYA6|CTBL1_HUMAN	Beta-catenin-like protein 1 OS=Homo sapiens OX=9606 GN=CTNNBL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1-UNIMOD:1	0.03	39.0	1	1	1
PRT	sp|Q07021|C1QBP_HUMAN	Complement component 1 Q subcomponent-binding protein, mitochondrial OS=Homo sapiens OX=9606 GN=C1QBP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null	105-UNIMOD:35,119-UNIMOD:188	0.06	39.0	8	1	0
PRT	sp|P31939-2|PUR9_HUMAN	Isoform 2 of Bifunctional purine biosynthesis protein PURH OS=Homo sapiens OX=9606 GN=ATIC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	311-UNIMOD:35,324-UNIMOD:4,330-UNIMOD:188,38-UNIMOD:188,450-UNIMOD:267,63-UNIMOD:267	0.12	39.0	8	4	0
PRT	sp|P55072|TERA_HUMAN	Transitional endoplasmic reticulum ATPase OS=Homo sapiens OX=9606 GN=VCP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null	678-UNIMOD:35,691-UNIMOD:4,693-UNIMOD:267,105-UNIMOD:4,109-UNIMOD:188,535-UNIMOD:4,543-UNIMOD:188,599-UNIMOD:267,572-UNIMOD:4,287-UNIMOD:267,651-UNIMOD:188,584-UNIMOD:188	0.13	39.0	15	7	2
PRT	sp|Q02218-2|ODO1_HUMAN	Isoform 2 of 2-oxoglutarate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=OGDH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	101-UNIMOD:267,798-UNIMOD:4,809-UNIMOD:188	0.04	39.0	3	2	1
PRT	sp|Q9H444|CHM4B_HUMAN	Charged multivesicular body protein 4b OS=Homo sapiens OX=9606 GN=CHMP4B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	93-UNIMOD:267	0.08	39.0	2	1	0
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	39.0	null	148-UNIMOD:35,464-UNIMOD:188,96-UNIMOD:188,182-UNIMOD:28,185-UNIMOD:188,197-UNIMOD:267,60-UNIMOD:267,152-UNIMOD:188,113-UNIMOD:188,74-UNIMOD:267	0.16	39.0	16	7	1
PRT	sp|Q96JH7|VCIP1_HUMAN	Deubiquitinating protein VCIP135 OS=Homo sapiens OX=9606 GN=VCPIP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	331-UNIMOD:188	0.02	39.0	2	1	0
PRT	sp|P46782|RS5_HUMAN	40S ribosomal protein S5 OS=Homo sapiens OX=9606 GN=RPS5 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	172-UNIMOD:4,2-UNIMOD:1,18-UNIMOD:188,22-UNIMOD:188,182-UNIMOD:188	0.19	39.0	7	2	0
PRT	sp|Q969X6-2|UTP4_HUMAN	Isoform 2 of U3 small nucleolar RNA-associated protein 4 homolog OS=Homo sapiens OX=9606 GN=UTP4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	519-UNIMOD:267,67-UNIMOD:4	0.05	39.0	3	2	1
PRT	sp|P78527|PRKDC_HUMAN	DNA-dependent protein kinase catalytic subunit OS=Homo sapiens OX=9606 GN=PRKDC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null	1292-UNIMOD:188,2619-UNIMOD:267,3669-UNIMOD:188,4106-UNIMOD:4,4119-UNIMOD:267,2342-UNIMOD:4,3781-UNIMOD:4,3784-UNIMOD:267,2120-UNIMOD:267,2000-UNIMOD:267,3708-UNIMOD:267,868-UNIMOD:188,3665-UNIMOD:35,2347-UNIMOD:188,1499-UNIMOD:4,1507-UNIMOD:4,1508-UNIMOD:188	0.05	39.0	23	12	5
PRT	sp|P30038|AL4A1_HUMAN	Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ALDH4A1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.03	39.0	1	1	1
PRT	sp|Q9UKG1|DP13A_HUMAN	DCC-interacting protein 13-alpha OS=Homo sapiens OX=9606 GN=APPL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	407-UNIMOD:267	0.03	39.0	2	1	0
PRT	sp|P11388|TOP2A_HUMAN	DNA topoisomerase 2-alpha OS=Homo sapiens OX=9606 GN=TOP2A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null	96-UNIMOD:188	0.03	39.0	4	3	2
PRT	sp|P60174|TPIS_HUMAN	Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	39.0	null	212-UNIMOD:188,79-UNIMOD:4,120-UNIMOD:35,70-UNIMOD:188,90-UNIMOD:267,122-UNIMOD:188,255-UNIMOD:4,256-UNIMOD:188,104-UNIMOD:4,106-UNIMOD:188,57-UNIMOD:28	0.32	39.0	16	6	2
PRT	sp|Q99460-2|PSMD1_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PSMD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	659-UNIMOD:4,660-UNIMOD:4,666-UNIMOD:188	0.02	39.0	2	1	0
PRT	sp|P13667|PDIA4_HUMAN	Protein disulfide-isomerase A4 OS=Homo sapiens OX=9606 GN=PDIA4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null	288-UNIMOD:188,141-UNIMOD:188	0.11	39.0	7	5	3
PRT	sp|O95415|BRI3_HUMAN	Brain protein I3 OS=Homo sapiens OX=9606 GN=BRI3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	78-UNIMOD:4,81-UNIMOD:4,82-UNIMOD:267	0.14	39.0	2	1	0
PRT	sp|Q9NW13|RBM28_HUMAN	RNA-binding protein 28 OS=Homo sapiens OX=9606 GN=RBM28 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	null	392-UNIMOD:385,392-UNIMOD:4,406-UNIMOD:188,410-UNIMOD:267	0.03	39.0	2	1	0
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	39.0	null	357-UNIMOD:4,358-UNIMOD:188	0.08	39.0	3	2	1
PRT	sp|P35232|PHB_HUMAN	Prohibitin OS=Homo sapiens OX=9606 GN=PHB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	239-UNIMOD:267,117-UNIMOD:267,93-UNIMOD:267	0.17	38.0	6	3	1
PRT	sp|P31040-3|SDHA_HUMAN	Isoform 3 of Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Homo sapiens OX=9606 GN=SDHA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	89-UNIMOD:4,391-UNIMOD:4,393-UNIMOD:188,509-UNIMOD:4,517-UNIMOD:267,180-UNIMOD:267	0.12	38.0	6	4	1
PRT	sp|Q02978|M2OM_HUMAN	Mitochondrial 2-oxoglutarate/malate carrier protein OS=Homo sapiens OX=9606 GN=SLC25A11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	2-UNIMOD:1	0.05	38.0	1	1	1
PRT	sp|O15160-2|RPAC1_HUMAN	Isoform 2 of DNA-directed RNA polymerases I and III subunit RPAC1 OS=Homo sapiens OX=9606 GN=POLR1C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	256-UNIMOD:4,270-UNIMOD:188	0.05	38.0	2	1	0
PRT	sp|P06744|G6PI_HUMAN	Glucose-6-phosphate isomerase OS=Homo sapiens OX=9606 GN=GPI PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	362-UNIMOD:188	0.05	38.0	3	2	1
PRT	sp|P09525|ANXA4_HUMAN	Annexin A4 OS=Homo sapiens OX=9606 GN=ANXA4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null	108-UNIMOD:4,116-UNIMOD:267,270-UNIMOD:267	0.20	38.0	7	4	2
PRT	sp|Q7Z4W1|DCXR_HUMAN	L-xylulose reductase OS=Homo sapiens OX=9606 GN=DCXR PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	138-UNIMOD:4	0.07	38.0	1	1	1
PRT	sp|Q99729-3|ROAA_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein A/B OS=Homo sapiens OX=9606 GN=HNRNPAB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	271-UNIMOD:188,169-UNIMOD:188	0.12	38.0	3	2	1
PRT	sp|Q8TEU7-6|RPGF6_HUMAN	Isoform 6 of Rap guanine nucleotide exchange factor 6 OS=Homo sapiens OX=9606 GN=RAPGEF6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.02	38.0	1	1	1
PRT	sp|P27708|PYR1_HUMAN	CAD protein OS=Homo sapiens OX=9606 GN=CAD PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	2003-UNIMOD:188,515-UNIMOD:267	0.02	38.0	3	2	1
PRT	sp|Q9H2P0|ADNP_HUMAN	Activity-dependent neuroprotector homeobox protein OS=Homo sapiens OX=9606 GN=ADNP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	367-UNIMOD:188,728-UNIMOD:188	0.03	38.0	4	2	0
PRT	sp|Q9UI10-3|EI2BD_HUMAN	Isoform 3 of Translation initiation factor eIF-2B subunit delta OS=Homo sapiens OX=9606 GN=EIF2B4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	224-UNIMOD:267	0.03	38.0	1	1	1
PRT	sp|Q16644|MAPK3_HUMAN	MAP kinase-activated protein kinase 3 OS=Homo sapiens OX=9606 GN=MAPKAPK3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	278-UNIMOD:188	0.05	38.0	1	1	1
PRT	sp|O60613|SEP15_HUMAN	Selenoprotein F OS=Homo sapiens OX=9606 GN=SELENOF PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	148-UNIMOD:188	0.10	38.0	1	1	1
PRT	sp|Q6P1X6-2|CH082_HUMAN	Isoform 2 of UPF0598 protein C8orf82 OS=Homo sapiens OX=9606 GN=C8orf82	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	122-UNIMOD:4	0.09	38.0	1	1	1
PRT	sp|O00178|GTPB1_HUMAN	GTP-binding protein 1 OS=Homo sapiens OX=9606 GN=GTPBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null	80-UNIMOD:267	0.03	38.0	2	1	0
PRT	sp|Q1KMD3|HNRL2_HUMAN	Heterogeneous nuclear ribonucleoprotein U-like protein 2 OS=Homo sapiens OX=9606 GN=HNRNPUL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null	538-UNIMOD:4,546-UNIMOD:267,494-UNIMOD:267	0.04	38.0	4	2	0
PRT	sp|Q7KZF4|SND1_HUMAN	Staphylococcal nuclease domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SND1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	586-UNIMOD:188,651-UNIMOD:188	0.05	38.0	4	3	2
PRT	sp|Q9UJZ1-2|STML2_HUMAN	Isoform 2 of Stomatin-like protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=STOML2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	51-UNIMOD:267	0.06	38.0	3	1	0
PRT	sp|P13798|ACPH_HUMAN	Acylamino-acid-releasing enzyme OS=Homo sapiens OX=9606 GN=APEH PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	30-UNIMOD:4,44-UNIMOD:267	0.03	38.0	2	1	0
PRT	sp|P22102|PUR2_HUMAN	Trifunctional purine biosynthetic protein adenosine-3 OS=Homo sapiens OX=9606 GN=GART PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	41-UNIMOD:4,44-UNIMOD:188	0.02	38.0	2	1	0
PRT	sp|O00267-2|SPT5H_HUMAN	Isoform 2 of Transcription elongation factor SPT5 OS=Homo sapiens OX=9606 GN=SUPT5H	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	361-UNIMOD:267	0.02	38.0	2	1	0
PRT	sp|Q9UJ70|NAGK_HUMAN	N-acetyl-D-glucosamine kinase OS=Homo sapiens OX=9606 GN=NAGK PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	85-UNIMOD:267,232-UNIMOD:267	0.09	38.0	3	2	1
PRT	sp|P49189-2|AL9A1_HUMAN	Isoform 2 of 4-trimethylaminobutyraldehyde dehydrogenase OS=Homo sapiens OX=9606 GN=ALDH9A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	197-UNIMOD:4,204-UNIMOD:188,169-UNIMOD:188	0.11	38.0	3	3	1
PRT	sp|Q8NHQ9|DDX55_HUMAN	ATP-dependent RNA helicase DDX55 OS=Homo sapiens OX=9606 GN=DDX55 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.03	38.0	1	1	1
PRT	sp|P62195-2|PRS8_HUMAN	Isoform 2 of 26S proteasome regulatory subunit 8 OS=Homo sapiens OX=9606 GN=PSMC5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	265-UNIMOD:35,279-UNIMOD:188	0.04	38.0	1	1	1
PRT	sp|P49840|GSK3A_HUMAN	Glycogen synthase kinase-3 alpha OS=Homo sapiens OX=9606 GN=GSK3A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	380-UNIMOD:4,391-UNIMOD:267,113-UNIMOD:267	0.07	38.0	3	2	1
PRT	sp|Q02446|SP4_HUMAN	Transcription factor Sp4 OS=Homo sapiens OX=9606 GN=SP4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	55-UNIMOD:4	0.03	38.0	1	1	1
PRT	sp|P33991|MCM4_HUMAN	DNA replication licensing factor MCM4 OS=Homo sapiens OX=9606 GN=MCM4 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	627-UNIMOD:188	0.02	38.0	2	1	0
PRT	sp|Q14690|RRP5_HUMAN	Protein RRP5 homolog OS=Homo sapiens OX=9606 GN=PDCD11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1000-UNIMOD:188,151-UNIMOD:4,642-UNIMOD:188	0.02	38.0	6	3	1
PRT	sp|Q9H4L5-8|OSBL3_HUMAN	Isoform 2d of Oxysterol-binding protein-related protein 3 OS=Homo sapiens OX=9606 GN=OSBPL3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	491-UNIMOD:267	0.03	38.0	2	1	0
PRT	sp|P40227-2|TCPZ_HUMAN	Isoform 2 of T-complex protein 1 subunit zeta OS=Homo sapiens OX=9606 GN=CCT6A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	420-UNIMOD:188,262-UNIMOD:188,82-UNIMOD:188	0.08	38.0	6	3	0
PRT	sp|P49419-4|AL7A1_HUMAN	Isoform 4 of Alpha-aminoadipic semialdehyde dehydrogenase OS=Homo sapiens OX=9606 GN=ALDH7A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	280-UNIMOD:188	0.03	38.0	2	1	0
PRT	sp|O60313-13|OPA1_HUMAN	Isoform 7 of Dynamin-like 120 kDa protein, mitochondrial OS=Homo sapiens OX=9606 GN=OPA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	116-UNIMOD:188	0.02	38.0	2	1	0
PRT	sp|P22314|UBA1_HUMAN	Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	null	448-UNIMOD:28	0.02	38.0	1	1	1
PRT	sp|P31040|SDHA_HUMAN	Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Homo sapiens OX=9606 GN=SDHA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	89-UNIMOD:4,92-UNIMOD:188	0.03	38.0	1	1	0
PRT	sp|Q9Y6N5|SQOR_HUMAN	Sulfide:quinone oxidoreductase, mitochondrial OS=Homo sapiens OX=9606 GN=SQOR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null	95-UNIMOD:28	0.11	38.0	4	3	2
PRT	sp|O43592|XPOT_HUMAN	Exportin-T OS=Homo sapiens OX=9606 GN=XPOT PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	38.0	null	38-UNIMOD:4,45-UNIMOD:267	0.02	38.0	2	1	0
PRT	sp|Q8IXI1|MIRO2_HUMAN	Mitochondrial Rho GTPase 2 OS=Homo sapiens OX=9606 GN=RHOT2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	38.0	null	543-UNIMOD:4,544-UNIMOD:267	0.03	38.0	4	1	0
PRT	sp|Q12931-2|TRAP1_HUMAN	Isoform 2 of Heat shock protein 75 kDa, mitochondrial OS=Homo sapiens OX=9606 GN=TRAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	143-UNIMOD:188	0.02	37.0	2	1	0
PRT	sp|P08865|RSSA_HUMAN	40S ribosomal protein SA OS=Homo sapiens OX=9606 GN=RPSA PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	80-UNIMOD:267,2-UNIMOD:1,163-UNIMOD:4	0.16	37.0	4	3	2
PRT	sp|Q14232|EI2BA_HUMAN	Translation initiation factor eIF-2B subunit alpha OS=Homo sapiens OX=9606 GN=EIF2B1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	88-UNIMOD:188	0.05	37.0	2	1	0
PRT	sp|P47755|CAZA2_HUMAN	F-actin-capping protein subunit alpha-2 OS=Homo sapiens OX=9606 GN=CAPZA2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	193-UNIMOD:188	0.06	37.0	2	1	0
PRT	sp|Q92572|AP3S1_HUMAN	AP-3 complex subunit sigma-1 OS=Homo sapiens OX=9606 GN=AP3S1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	33-UNIMOD:267	0.08	37.0	2	1	0
PRT	sp|Q9NW13-2|RBM28_HUMAN	Isoform 2 of RNA-binding protein 28 OS=Homo sapiens OX=9606 GN=RBM28	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	237-UNIMOD:4,250-UNIMOD:188,251-UNIMOD:4,265-UNIMOD:188,31-UNIMOD:188	0.08	37.0	6	3	1
PRT	sp|Q15181|IPYR_HUMAN	Inorganic pyrophosphatase OS=Homo sapiens OX=9606 GN=PPA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	242-UNIMOD:4,253-UNIMOD:188	0.06	37.0	2	1	0
PRT	sp|P35237|SPB6_HUMAN	Serpin B6 OS=Homo sapiens OX=9606 GN=SERPINB6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	61-UNIMOD:188,299-UNIMOD:188	0.08	37.0	4	2	0
PRT	sp|Q15084-3|PDIA6_HUMAN	Isoform 3 of Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	406-UNIMOD:267,129-UNIMOD:267	0.11	37.0	6	3	0
PRT	sp|P61978-3|HNRPK_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	372-UNIMOD:188,195-UNIMOD:188	0.08	37.0	4	2	0
PRT	sp|Q13126-7|MTAP_HUMAN	Isoform 7 of S-methyl-5'-thioadenosine phosphorylase OS=Homo sapiens OX=9606 GN=MTAP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	29-UNIMOD:267	0.13	37.0	4	2	1
PRT	sp|P62241|RS8_HUMAN	40S ribosomal protein S8 OS=Homo sapiens OX=9606 GN=RPS8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	71-UNIMOD:4,72-UNIMOD:4,74-UNIMOD:267,170-UNIMOD:188,100-UNIMOD:4,110-UNIMOD:267	0.28	37.0	6	4	2
PRT	sp|Q13185|CBX3_HUMAN	Chromobox protein homolog 3 OS=Homo sapiens OX=9606 GN=CBX3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	140-UNIMOD:35,141-UNIMOD:188	0.09	37.0	3	1	0
PRT	sp|Q9Y2B0|CNPY2_HUMAN	Protein canopy homolog 2 OS=Homo sapiens OX=9606 GN=CNPY2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.09	37.0	1	1	1
PRT	sp|P54886-2|P5CS_HUMAN	Isoform Short of Delta-1-pyrroline-5-carboxylate synthase OS=Homo sapiens OX=9606 GN=ALDH18A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	110-UNIMOD:267	0.02	37.0	2	1	0
PRT	sp|P54105|ICLN_HUMAN	Methylosome subunit pICln OS=Homo sapiens OX=9606 GN=CLNS1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.08	37.0	1	1	1
PRT	sp|Q8WXF1-2|PSPC1_HUMAN	Isoform 2 of Paraspeckle component 1 OS=Homo sapiens OX=9606 GN=PSPC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	99-UNIMOD:188,115-UNIMOD:267	0.07	37.0	5	2	0
PRT	sp|O95352-3|ATG7_HUMAN	Isoform 3 of Ubiquitin-like modifier-activating enzyme ATG7 OS=Homo sapiens OX=9606 GN=ATG7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	511-UNIMOD:4,514-UNIMOD:4,525-UNIMOD:267	0.03	37.0	2	1	0
PRT	sp|O75165|DJC13_HUMAN	DnaJ homolog subfamily C member 13 OS=Homo sapiens OX=9606 GN=DNAJC13 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	1455-UNIMOD:267,600-UNIMOD:35	0.02	37.0	4	3	2
PRT	sp|P11586|C1TC_HUMAN	C-1-tetrahydrofolate synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=MTHFD1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	1-UNIMOD:1,386-UNIMOD:188,324-UNIMOD:267	0.06	37.0	6	4	2
PRT	sp|P30101|PDIA3_HUMAN	Protein disulfide-isomerase A3 OS=Homo sapiens OX=9606 GN=PDIA3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	434-UNIMOD:35,448-UNIMOD:267,482-UNIMOD:267	0.06	37.0	4	2	0
PRT	sp|Q00839-2|HNRPU_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	571-UNIMOD:267,414-UNIMOD:188	0.05	37.0	4	3	2
PRT	sp|P12956|XRCC6_HUMAN	X-ray repair cross-complementing protein 6 OS=Homo sapiens OX=9606 GN=XRCC6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	37.0	null	317-UNIMOD:188,326-UNIMOD:28,331-UNIMOD:188,338-UNIMOD:188,46-UNIMOD:188,389-UNIMOD:385,389-UNIMOD:4,392-UNIMOD:188,398-UNIMOD:4,399-UNIMOD:267	0.11	37.0	9	5	1
PRT	sp|A0FGR8-2|ESYT2_HUMAN	Isoform 2 of Extended synaptotagmin-2 OS=Homo sapiens OX=9606 GN=ESYT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	67-UNIMOD:267,798-UNIMOD:267	0.05	37.0	5	3	0
PRT	sp|O15355|PPM1G_HUMAN	Protein phosphatase 1G OS=Homo sapiens OX=9606 GN=PPM1G PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	425-UNIMOD:188	0.03	37.0	2	1	0
PRT	sp|P12270|TPR_HUMAN	Nucleoprotein TPR OS=Homo sapiens OX=9606 GN=TPR PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	1527-UNIMOD:267,1377-UNIMOD:267,594-UNIMOD:267,552-UNIMOD:267	0.03	37.0	9	5	1
PRT	sp|P0DMV8-2|HS71A_HUMAN	Isoform 2 of Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	71-UNIMOD:188,495-UNIMOD:188	0.05	37.0	3	2	1
PRT	sp|P24752|THIL_HUMAN	Acetyl-CoA acetyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=ACAT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	119-UNIMOD:4,124-UNIMOD:188,78-UNIMOD:188	0.08	37.0	4	2	0
PRT	sp|Q96AE4|FUBP1_HUMAN	Far upstream element-binding protein 1 OS=Homo sapiens OX=9606 GN=FUBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.04	37.0	1	1	1
PRT	sp|P41567|EIF1_HUMAN	Eukaryotic translation initiation factor 1 OS=Homo sapiens OX=9606 GN=EIF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	2-UNIMOD:1,18-UNIMOD:188	0.16	37.0	2	1	0
PRT	sp|P12429|ANXA3_HUMAN	Annexin A3 OS=Homo sapiens OX=9606 GN=ANXA3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	120-UNIMOD:267	0.13	37.0	5	3	2
PRT	sp|P82909|RT36_HUMAN	28S ribosomal protein S36, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS36 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	78-UNIMOD:188	0.18	37.0	2	1	0
PRT	sp|Q5T6F2|UBAP2_HUMAN	Ubiquitin-associated protein 2 OS=Homo sapiens OX=9606 GN=UBAP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	441-UNIMOD:267	0.01	37.0	1	1	1
PRT	sp|Q01130-2|SRSF2_HUMAN	Isoform 2 of Serine/arginine-rich splicing factor 2 OS=Homo sapiens OX=9606 GN=SRSF2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	2-UNIMOD:1	0.08	37.0	1	1	1
PRT	sp|O75487-2|GPC4_HUMAN	Isoform 2 of Glypican-4 OS=Homo sapiens OX=9606 GN=GPC4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.03	37.0	1	1	1
PRT	sp|Q9P2E9|RRBP1_HUMAN	Ribosome-binding protein 1 OS=Homo sapiens OX=9606 GN=RRBP1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	797-UNIMOD:267	0.01	37.0	2	1	0
PRT	sp|P36957|ODO2_HUMAN	Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial OS=Homo sapiens OX=9606 GN=DLST PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	88-UNIMOD:267,345-UNIMOD:267	0.06	37.0	3	2	1
PRT	sp|Q13405|RM49_HUMAN	39S ribosomal protein L49, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL49 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	148-UNIMOD:267	0.16	37.0	3	2	1
PRT	sp|Q01082|SPTB2_HUMAN	Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	2206-UNIMOD:267,1295-UNIMOD:35,1307-UNIMOD:267,736-UNIMOD:267,1717-UNIMOD:267,1245-UNIMOD:267,2191-UNIMOD:267,2088-UNIMOD:267,1080-UNIMOD:267	0.04	37.0	13	8	3
PRT	sp|Q8IXM2-2|BAP18_HUMAN	Isoform 2 of Chromatin complexes subunit BAP18 OS=Homo sapiens OX=9606 GN=BAP18	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.11	37.0	1	1	0
PRT	sp|Q9Y265|RUVB1_HUMAN	RuvB-like 1 OS=Homo sapiens OX=9606 GN=RUVBL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	37.0	null	94-UNIMOD:4,107-UNIMOD:188,46-UNIMOD:267,169-UNIMOD:28,33-UNIMOD:188	0.13	37.0	8	5	2
PRT	sp|P09104-2|ENOG_HUMAN	Isoform 2 of Gamma-enolase OS=Homo sapiens OX=9606 GN=ENO2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	242-UNIMOD:267	0.04	37.0	2	1	0
PRT	sp|P27338-2|AOFB_HUMAN	Isoform 2 of Amine oxidase [flavin-containing] B OS=Homo sapiens OX=9606 GN=MAOB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	51-UNIMOD:267	0.04	37.0	1	1	1
PRT	sp|Q9Y263|PLAP_HUMAN	Phospholipase A-2-activating protein OS=Homo sapiens OX=9606 GN=PLAA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	499-UNIMOD:267	0.03	37.0	1	1	1
PRT	sp|Q68CZ2|TENS3_HUMAN	Tensin-3 OS=Homo sapiens OX=9606 GN=TNS3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	null	592-UNIMOD:28	0.01	37.0	1	1	1
PRT	sp|O60318|GANP_HUMAN	Germinal-center associated nuclear protein OS=Homo sapiens OX=9606 GN=MCM3AP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	1377-UNIMOD:4	0.01	37.0	1	1	1
PRT	sp|Q12959|DLG1_HUMAN	Disks large homolog 1 OS=Homo sapiens OX=9606 GN=DLG1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	null	628-UNIMOD:28,644-UNIMOD:188,645-UNIMOD:267	0.02	37.0	1	1	1
PRT	sp|Q9UKV3-3|ACINU_HUMAN	Isoform 3 of Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	465-UNIMOD:4,479-UNIMOD:188	0.03	36.0	2	1	0
PRT	sp|Q8IVM0|CCD50_HUMAN	Coiled-coil domain-containing protein 50 OS=Homo sapiens OX=9606 GN=CCDC50 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	36.0	null	2-UNIMOD:1,10-UNIMOD:188,15-UNIMOD:188	0.05	36.0	2	1	0
PRT	sp|Q9H223|EHD4_HUMAN	EH domain-containing protein 4 OS=Homo sapiens OX=9606 GN=EHD4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	29-UNIMOD:267,392-UNIMOD:188	0.05	36.0	4	2	0
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	297-UNIMOD:188,77-UNIMOD:267,58-UNIMOD:188,350-UNIMOD:188,73-UNIMOD:35,354-UNIMOD:4,359-UNIMOD:267	0.16	36.0	27	5	0
PRT	sp|P68371|TBB4B_HUMAN	Tubulin beta-4B chain OS=Homo sapiens OX=9606 GN=TUBB4B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	36.0	null	297-UNIMOD:188,73-UNIMOD:35,77-UNIMOD:267,293-UNIMOD:35,58-UNIMOD:188,354-UNIMOD:4	0.12	36.0	15	4	0
PRT	sp|Q6P2E9|EDC4_HUMAN	Enhancer of mRNA-decapping protein 4 OS=Homo sapiens OX=9606 GN=EDC4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	2-UNIMOD:1,4-UNIMOD:4,17-UNIMOD:267,1128-UNIMOD:188	0.02	36.0	5	2	0
PRT	sp|P19338|NUCL_HUMAN	Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	36.0	null	624-UNIMOD:188,296-UNIMOD:28,297-UNIMOD:188,318-UNIMOD:188	0.12	36.0	7	6	5
PRT	sp|Q15149-7|PLEC_HUMAN	Isoform 7 of Plectin OS=Homo sapiens OX=9606 GN=PLEC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	3902-UNIMOD:4,3005-UNIMOD:188,3781-UNIMOD:267,2639-UNIMOD:267,2260-UNIMOD:267,3624-UNIMOD:267,3912-UNIMOD:188,1676-UNIMOD:267,2202-UNIMOD:267,1685-UNIMOD:267,1815-UNIMOD:267,1970-UNIMOD:267,967-UNIMOD:4,970-UNIMOD:267,1394-UNIMOD:267,4430-UNIMOD:267,3215-UNIMOD:188	0.05	36.0	28	19	10
PRT	sp|P15924-2|DESP_HUMAN	Isoform DPII of Desmoplakin OS=Homo sapiens OX=9606 GN=DSP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1831-UNIMOD:188,1782-UNIMOD:188,1504-UNIMOD:188,1184-UNIMOD:267	0.03	36.0	7	4	2
PRT	sp|P08621-4|RU17_HUMAN	Isoform 4 of U1 small nuclear ribonucleoprotein 70 kDa OS=Homo sapiens OX=9606 GN=SNRNP70	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	315-UNIMOD:267	0.06	36.0	2	1	0
PRT	sp|P52292|IMA1_HUMAN	Importin subunit alpha-1 OS=Homo sapiens OX=9606 GN=KPNA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	101-UNIMOD:267	0.04	36.0	1	1	1
PRT	sp|O00515|LAD1_HUMAN	Ladinin-1 OS=Homo sapiens OX=9606 GN=LAD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	428-UNIMOD:4,441-UNIMOD:188	0.03	36.0	2	1	0
PRT	sp|Q96M27-4|PRRC1_HUMAN	Isoform 4 of Protein PRRC1 OS=Homo sapiens OX=9606 GN=PRRC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	218-UNIMOD:188	0.05	36.0	2	1	0
PRT	sp|P45974-2|UBP5_HUMAN	Isoform Short of Ubiquitin carboxyl-terminal hydrolase 5 OS=Homo sapiens OX=9606 GN=USP5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	628-UNIMOD:188	0.04	36.0	3	2	1
PRT	sp|O14686|KMT2D_HUMAN	Histone-lysine N-methyltransferase 2D OS=Homo sapiens OX=9606 GN=KMT2D PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	5314-UNIMOD:4	0.00	36.0	1	1	1
PRT	sp|Q14103-4|HNRPD_HUMAN	Isoform 4 of Heterogeneous nuclear ribonucleoprotein D0 OS=Homo sapiens OX=9606 GN=HNRNPD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	178-UNIMOD:188,107-UNIMOD:4	0.09	36.0	6	2	0
PRT	sp|Q8TCS8|PNPT1_HUMAN	Polyribonucleotide nucleotidyltransferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=PNPT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	206-UNIMOD:267	0.02	36.0	1	1	1
PRT	sp|Q8N6R0-2|EFNMT_HUMAN	Isoform 5 of eEF1A lysine and N-terminal methyltransferase OS=Homo sapiens OX=9606 GN=EEF1AKNMT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	371-UNIMOD:267	0.04	36.0	2	1	0
PRT	sp|P04792|HSPB1_HUMAN	Heat shock protein beta-1 OS=Homo sapiens OX=9606 GN=HSPB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	188-UNIMOD:267,89-UNIMOD:267	0.14	36.0	4	2	0
PRT	sp|P07195|LDHB_HUMAN	L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	234-UNIMOD:35,244-UNIMOD:188	0.09	36.0	3	2	1
PRT	sp|P33992|MCM5_HUMAN	DNA replication licensing factor MCM5 OS=Homo sapiens OX=9606 GN=MCM5 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	642-UNIMOD:267,308-UNIMOD:267,337-UNIMOD:188,397-UNIMOD:4,407-UNIMOD:188	0.08	36.0	9	4	0
PRT	sp|P35251-2|RFC1_HUMAN	Isoform 2 of Replication factor C subunit 1 OS=Homo sapiens OX=9606 GN=RFC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	176-UNIMOD:267	0.02	36.0	2	1	0
PRT	sp|Q9Y6M1-1|IF2B2_HUMAN	Isoform 2 of Insulin-like growth factor 2 mRNA-binding protein 2 OS=Homo sapiens OX=9606 GN=IGF2BP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	20-UNIMOD:267	0.03	36.0	2	1	0
PRT	sp|P30520|PURA2_HUMAN	Adenylosuccinate synthetase isozyme 2 OS=Homo sapiens OX=9606 GN=ADSS2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	181-UNIMOD:35,182-UNIMOD:4,194-UNIMOD:267,441-UNIMOD:188	0.11	36.0	6	3	1
PRT	sp|Q9BXV9|GON7_HUMAN	EKC/KEOPS complex subunit GON7 OS=Homo sapiens OX=9606 GN=GON7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1-UNIMOD:1,13-UNIMOD:188,16-UNIMOD:188	0.17	36.0	2	1	0
PRT	sp|P62191-2|PRS4_HUMAN	Isoform 2 of 26S proteasome regulatory subunit 4 OS=Homo sapiens OX=9606 GN=PSMC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	299-UNIMOD:35,314-UNIMOD:188,176-UNIMOD:267	0.08	36.0	3	2	1
PRT	sp|Q9BT78|CSN4_HUMAN	COP9 signalosome complex subunit 4 OS=Homo sapiens OX=9606 GN=COPS4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	137-UNIMOD:188,107-UNIMOD:267,255-UNIMOD:4,266-UNIMOD:188	0.13	36.0	7	4	1
PRT	sp|Q14739|LBR_HUMAN	Delta(14)-sterol reductase LBR OS=Homo sapiens OX=9606 GN=LBR PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	372-UNIMOD:267	0.05	36.0	3	2	1
PRT	sp|Q15393|SF3B3_HUMAN	Splicing factor 3B subunit 3 OS=Homo sapiens OX=9606 GN=SF3B3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	706-UNIMOD:35	0.02	36.0	3	2	1
PRT	sp|P55060|XPO2_HUMAN	Exportin-2 OS=Homo sapiens OX=9606 GN=CSE1L PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	344-UNIMOD:4,346-UNIMOD:188,268-UNIMOD:188	0.04	36.0	4	2	0
PRT	sp|Q16540|RM23_HUMAN	39S ribosomal protein L23, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL23 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	69-UNIMOD:267	0.10	36.0	2	1	0
PRT	sp|Q92973-2|TNPO1_HUMAN	Isoform 2 of Transportin-1 OS=Homo sapiens OX=9606 GN=TNPO1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	95-UNIMOD:4,107-UNIMOD:267,696-UNIMOD:188,675-UNIMOD:4,777-UNIMOD:267	0.06	36.0	7	4	1
PRT	sp|P18754|RCC1_HUMAN	Regulator of chromosome condensation OS=Homo sapiens OX=9606 GN=RCC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	163-UNIMOD:35,176-UNIMOD:188	0.04	36.0	3	1	0
PRT	sp|P26640|SYVC_HUMAN	Valine--tRNA ligase OS=Homo sapiens OX=9606 GN=VARS1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	137-UNIMOD:267,917-UNIMOD:4,461-UNIMOD:267,923-UNIMOD:267	0.05	36.0	7	4	1
PRT	sp|P78540|ARGI2_HUMAN	Arginase-2, mitochondrial OS=Homo sapiens OX=9606 GN=ARG2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	105-UNIMOD:267	0.05	36.0	1	1	1
PRT	sp|Q9UNZ2-4|NSF1C_HUMAN	Isoform 2 of NSFL1 cofactor p47 OS=Homo sapiens OX=9606 GN=NSFL1C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	337-UNIMOD:267,124-UNIMOD:188	0.12	36.0	4	3	2
PRT	sp|Q14694|UBP10_HUMAN	Ubiquitin carboxyl-terminal hydrolase 10 OS=Homo sapiens OX=9606 GN=USP10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	254-UNIMOD:4,261-UNIMOD:267,376-UNIMOD:188	0.05	36.0	3	2	1
PRT	sp|P51148|RAB5C_HUMAN	Ras-related protein Rab-5C OS=Homo sapiens OX=9606 GN=RAB5C PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	36.0	null	180-UNIMOD:188,176-UNIMOD:35,210-UNIMOD:267,122-UNIMOD:28,135-UNIMOD:188,141-UNIMOD:188,169-UNIMOD:35	0.29	36.0	8	4	3
PRT	sp|O95347|SMC2_HUMAN	Structural maintenance of chromosomes protein 2 OS=Homo sapiens OX=9606 GN=SMC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	38-UNIMOD:188,308-UNIMOD:267	0.03	36.0	4	2	0
PRT	sp|P48507|GSH0_HUMAN	Glutamate--cysteine ligase regulatory subunit OS=Homo sapiens OX=9606 GN=GCLM PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	64-UNIMOD:267	0.06	36.0	2	1	0
PRT	sp|P18206|VINC_HUMAN	Vinculin OS=Homo sapiens OX=9606 GN=VCL PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	261-UNIMOD:188	0.04	36.0	4	3	2
PRT	sp|P40926|MDHM_HUMAN	Malate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=MDH2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	229-UNIMOD:267,285-UNIMOD:4,296-UNIMOD:188,257-UNIMOD:267,89-UNIMOD:4,91-UNIMOD:188,315-UNIMOD:35,324-UNIMOD:188,185-UNIMOD:188,93-UNIMOD:4	0.29	36.0	23	7	3
PRT	sp|P48147|PPCE_HUMAN	Prolyl endopeptidase OS=Homo sapiens OX=9606 GN=PREP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	128-UNIMOD:267	0.03	36.0	3	1	0
PRT	sp|Q9UKL0|RCOR1_HUMAN	REST corepressor 1 OS=Homo sapiens OX=9606 GN=RCOR1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	122-UNIMOD:188	0.04	36.0	2	1	0
PRT	sp|P00374|DYR_HUMAN	Dihydrofolate reductase OS=Homo sapiens OX=9606 GN=DHFR PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	7-UNIMOD:4,19-UNIMOD:188	0.10	36.0	1	1	1
PRT	sp|Q96EK6|GNA1_HUMAN	Glucosamine 6-phosphate N-acetyltransferase OS=Homo sapiens OX=9606 GN=GNPNAT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	72-UNIMOD:35,73-UNIMOD:188	0.10	36.0	2	1	0
PRT	sp|P37108|SRP14_HUMAN	Signal recognition particle 14 kDa protein OS=Homo sapiens OX=9606 GN=SRP14 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	36.0	null	15-UNIMOD:267	0.11	36.0	4	2	1
PRT	sp|P49748-2|ACADV_HUMAN	Isoform 2 of Very long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADVL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	309-UNIMOD:188,294-UNIMOD:267	0.05	36.0	4	2	0
PRT	sp|Q8WVV4-1|POF1B_HUMAN	Isoform 1 of Protein POF1B OS=Homo sapiens OX=9606 GN=POF1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.03	36.0	1	1	1
PRT	sp|Q13263|TIF1B_HUMAN	Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	36.0	null	524-UNIMOD:267,122-UNIMOD:28,124-UNIMOD:4,127-UNIMOD:188,135-UNIMOD:35,136-UNIMOD:267	0.04	36.0	4	2	0
PRT	sp|P11142|HSP7C_HUMAN	Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	36.0	null	71-UNIMOD:188,156-UNIMOD:28,159-UNIMOD:188,171-UNIMOD:267,550-UNIMOD:188,549-UNIMOD:35,49-UNIMOD:267	0.14	36.0	13	7	2
PRT	sp|Q71U36|TBA1A_HUMAN	Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	370-UNIMOD:188	0.09	36.0	3	2	0
PRT	sp|P29692-3|EF1D_HUMAN	Isoform 3 of Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	null	39-UNIMOD:28	0.09	36.0	1	1	1
PRT	sp|P15311|EZRI_HUMAN	Ezrin OS=Homo sapiens OX=9606 GN=EZR PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	36.0	null	427-UNIMOD:188,530-UNIMOD:28,542-UNIMOD:267	0.06	36.0	4	3	2
PRT	sp|P53621|COPA_HUMAN	Coatomer subunit alpha OS=Homo sapiens OX=9606 GN=COPA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	36.0	null	343-UNIMOD:28,350-UNIMOD:188,358-UNIMOD:267,975-UNIMOD:4,985-UNIMOD:267,261-UNIMOD:28,271-UNIMOD:188,274-UNIMOD:267	0.04	36.0	4	3	2
PRT	sp|Q9H0A0|NAT10_HUMAN	RNA cytidine acetyltransferase OS=Homo sapiens OX=9606 GN=NAT10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	36.0	null	735-UNIMOD:28,746-UNIMOD:4,750-UNIMOD:188,21-UNIMOD:267	0.03	36.0	4	2	1
PRT	sp|P14406|CX7A2_HUMAN	Cytochrome c oxidase subunit 7A2, mitochondrial OS=Homo sapiens OX=9606 GN=COX7A2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	36.0	null	32-UNIMOD:28,46-UNIMOD:188	0.19	36.0	3	2	1
PRT	sp|P25205|MCM3_HUMAN	DNA replication licensing factor MCM3 OS=Homo sapiens OX=9606 GN=MCM3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	36.0	null	446-UNIMOD:385,446-UNIMOD:4,458-UNIMOD:267	0.04	36.0	4	3	2
PRT	sp|P31942|HNRH3_HUMAN	Heterogeneous nuclear ribonucleoprotein H3 OS=Homo sapiens OX=9606 GN=HNRNPH3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	222-UNIMOD:267	0.05	36.0	5	1	0
PRT	sp|P35241|RADI_HUMAN	Radixin OS=Homo sapiens OX=9606 GN=RDX PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	null	527-UNIMOD:28,539-UNIMOD:267,543-UNIMOD:188	0.03	36.0	2	1	0
PRT	sp|Q6PD62|CTR9_HUMAN	RNA polymerase-associated protein CTR9 homolog OS=Homo sapiens OX=9606 GN=CTR9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	null	816-UNIMOD:28,817-UNIMOD:4,830-UNIMOD:267	0.01	36.0	2	1	0
PRT	sp|P53597|SUCA_HUMAN	Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=SUCLG1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	null	67-UNIMOD:28,81-UNIMOD:188	0.05	36.0	2	1	0
PRT	sp|O15511|ARPC5_HUMAN	Actin-related protein 2/3 complex subunit 5 OS=Homo sapiens OX=9606 GN=ARPC5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	null	48-UNIMOD:28,60-UNIMOD:188,67-UNIMOD:188	0.14	36.0	2	1	0
PRT	sp|P10253|LYAG_HUMAN	Lysosomal alpha-glucosidase OS=Homo sapiens OX=9606 GN=GAA PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	837-UNIMOD:267	0.02	35.0	2	1	0
PRT	sp|Q9UJX3-2|APC7_HUMAN	Isoform 2 of Anaphase-promoting complex subunit 7 OS=Homo sapiens OX=9606 GN=ANAPC7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	379-UNIMOD:188	0.03	35.0	2	1	0
PRT	sp|Q9H3U1-2|UN45A_HUMAN	Isoform 2 of Protein unc-45 homolog A OS=Homo sapiens OX=9606 GN=UNC45A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	405-UNIMOD:4,411-UNIMOD:4,416-UNIMOD:267,714-UNIMOD:267	0.04	35.0	2	2	2
PRT	sp|Q9NU22|MDN1_HUMAN	Midasin OS=Homo sapiens OX=9606 GN=MDN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	1394-UNIMOD:4	0.00	35.0	1	1	1
PRT	sp|P55084-2|ECHB_HUMAN	Isoform 2 of Trifunctional enzyme subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=HADHB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	383-UNIMOD:267	0.03	35.0	2	1	0
PRT	sp|Q01780-2|EXOSX_HUMAN	Isoform 2 of Exosome component 10 OS=Homo sapiens OX=9606 GN=EXOSC10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	64-UNIMOD:267,37-UNIMOD:188	0.06	35.0	4	3	1
PRT	sp|O95670-2|VATG2_HUMAN	Isoform 2 of V-type proton ATPase subunit G 2 OS=Homo sapiens OX=9606 GN=ATP6V1G2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	2-UNIMOD:1	0.22	35.0	1	1	1
PRT	sp|Q32P41|TRM5_HUMAN	tRNA (guanine(37)-N1)-methyltransferase OS=Homo sapiens OX=9606 GN=TRMT5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	202-UNIMOD:267	0.03	35.0	2	1	0
PRT	sp|Q15050|RRS1_HUMAN	Ribosome biogenesis regulatory protein homolog OS=Homo sapiens OX=9606 GN=RRS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	52-UNIMOD:4,66-UNIMOD:267,141-UNIMOD:267	0.08	35.0	4	2	0
PRT	sp|Q5JTV8|TOIP1_HUMAN	Torsin-1A-interacting protein 1 OS=Homo sapiens OX=9606 GN=TOR1AIP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	424-UNIMOD:4	0.03	35.0	1	1	1
PRT	sp|P49736|MCM2_HUMAN	DNA replication licensing factor MCM2 OS=Homo sapiens OX=9606 GN=MCM2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	35.0	null	624-UNIMOD:4,636-UNIMOD:267,562-UNIMOD:267	0.05	35.0	5	3	1
PRT	sp|Q6P2Q9|PRP8_HUMAN	Pre-mRNA-processing-splicing factor 8 OS=Homo sapiens OX=9606 GN=PRPF8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	1190-UNIMOD:4,1194-UNIMOD:4,1195-UNIMOD:267,1384-UNIMOD:267	0.01	35.0	4	2	0
PRT	sp|Q969G9|NKD1_HUMAN	Protein naked cuticle homolog 1 OS=Homo sapiens OX=9606 GN=NKD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.04	35.0	1	1	1
PRT	sp|P00533|EGFR_HUMAN	Epidermal growth factor receptor OS=Homo sapiens OX=9606 GN=EGFR PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	705-UNIMOD:267	0.02	35.0	1	1	1
PRT	sp|P46379-4|BAG6_HUMAN	Isoform 4 of Large proline-rich protein BAG6 OS=Homo sapiens OX=9606 GN=BAG6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	704-UNIMOD:267	0.02	35.0	2	1	0
PRT	sp|P35998|PRS7_HUMAN	26S proteasome regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PSMC2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	297-UNIMOD:267,377-UNIMOD:4,386-UNIMOD:267	0.06	35.0	4	2	0
PRT	sp|Q8NC51-4|PAIRB_HUMAN	Isoform 4 of Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	32-UNIMOD:188	0.10	35.0	3	2	1
PRT	sp|Q86YS7|C2CD5_HUMAN	C2 domain-containing protein 5 OS=Homo sapiens OX=9606 GN=C2CD5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	449-UNIMOD:4	0.02	35.0	1	1	1
PRT	sp|Q14204|DYHC1_HUMAN	Cytoplasmic dynein 1 heavy chain 1 OS=Homo sapiens OX=9606 GN=DYNC1H1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	1878-UNIMOD:188,2576-UNIMOD:267,1707-UNIMOD:188,2349-UNIMOD:188	0.02	35.0	9	6	3
PRT	sp|O95816|BAG2_HUMAN	BAG family molecular chaperone regulator 2 OS=Homo sapiens OX=9606 GN=BAG2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	35.0	null	162-UNIMOD:4,168-UNIMOD:188,71-UNIMOD:28,209-UNIMOD:267	0.26	35.0	4	4	4
PRT	sp|P12004|PCNA_HUMAN	Proliferating cell nuclear antigen OS=Homo sapiens OX=9606 GN=PCNA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	35.0	null	62-UNIMOD:385,62-UNIMOD:4,64-UNIMOD:267,77-UNIMOD:188,181-UNIMOD:188,81-UNIMOD:4,91-UNIMOD:267,254-UNIMOD:188	0.22	35.0	12	5	0
PRT	sp|Q13155-2|AIMP2_HUMAN	Isoform 2 of Aminoacyl tRNA synthase complex-interacting multifunctional protein 2 OS=Homo sapiens OX=9606 GN=AIMP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	136-UNIMOD:4,146-UNIMOD:267,237-UNIMOD:4	0.13	35.0	3	2	1
PRT	sp|P53041|PPP5_HUMAN	Serine/threonine-protein phosphatase 5 OS=Homo sapiens OX=9606 GN=PPP5C PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	68-UNIMOD:267,425-UNIMOD:267	0.07	35.0	4	2	0
PRT	sp|Q9Y295|DRG1_HUMAN	Developmentally-regulated GTP-binding protein 1 OS=Homo sapiens OX=9606 GN=DRG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	315-UNIMOD:267,171-UNIMOD:267	0.08	35.0	3	2	1
PRT	sp|P62942|FKB1A_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Homo sapiens OX=9606 GN=FKBP1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	67-UNIMOD:35,14-UNIMOD:267	0.27	35.0	3	2	1
PRT	sp|P12814-2|ACTN1_HUMAN	Isoform 2 of Alpha-actinin-1 OS=Homo sapiens OX=9606 GN=ACTN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	480-UNIMOD:4,360-UNIMOD:35,370-UNIMOD:4,376-UNIMOD:188,492-UNIMOD:188	0.04	35.0	4	2	0
PRT	sp|O00567|NOP56_HUMAN	Nucleolar protein 56 OS=Homo sapiens OX=9606 GN=NOP56 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	384-UNIMOD:4,396-UNIMOD:188,415-UNIMOD:267,333-UNIMOD:188	0.07	35.0	6	3	1
PRT	sp|P30040|ERP29_HUMAN	Endoplasmic reticulum resident protein 29 OS=Homo sapiens OX=9606 GN=ERP29 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	223-UNIMOD:267,48-UNIMOD:188	0.11	35.0	5	2	1
PRT	sp|P34897-3|GLYM_HUMAN	Isoform 3 of Serine hydroxymethyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=SHMT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	193-UNIMOD:267,70-UNIMOD:4,74-UNIMOD:188,175-UNIMOD:188,388-UNIMOD:188,347-UNIMOD:267	0.14	35.0	10	5	0
PRT	sp|P27824-3|CALX_HUMAN	Isoform 3 of Calnexin OS=Homo sapiens OX=9606 GN=CANX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	350-UNIMOD:188	0.03	35.0	3	1	0
PRT	sp|P18124|RL7_HUMAN	60S ribosomal protein L7 OS=Homo sapiens OX=9606 GN=RPL7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	148-UNIMOD:188,177-UNIMOD:267	0.11	35.0	4	2	0
PRT	sp|P41091|IF2G_HUMAN	Eukaryotic translation initiation factor 2 subunit 3 OS=Homo sapiens OX=9606 GN=EIF2S3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	434-UNIMOD:4,440-UNIMOD:188	0.06	35.0	3	2	1
PRT	sp|O75947-2|ATP5H_HUMAN	Isoform 2 of ATP synthase subunit d, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5PD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	58-UNIMOD:188	0.13	35.0	2	1	0
PRT	sp|Q13435|SF3B2_HUMAN	Splicing factor 3B subunit 2 OS=Homo sapiens OX=9606 GN=SF3B2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	163-UNIMOD:267	0.02	35.0	3	1	0
PRT	sp|Q14980-4|NUMA1_HUMAN	Isoform 4 of Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	631-UNIMOD:267	0.02	35.0	3	2	0
PRT	sp|P33993-2|MCM7_HUMAN	Isoform 2 of DNA replication licensing factor MCM7 OS=Homo sapiens OX=9606 GN=MCM7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	89-UNIMOD:188	0.07	35.0	3	2	1
PRT	sp|P00491|PNPH_HUMAN	Purine nucleoside phosphorylase OS=Homo sapiens OX=9606 GN=PNP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	219-UNIMOD:35,229-UNIMOD:267	0.07	35.0	3	1	0
PRT	sp|P23528|COF1_HUMAN	Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	164-UNIMOD:188,2-UNIMOD:1,13-UNIMOD:188,19-UNIMOD:188	0.28	35.0	4	3	2
PRT	sp|P20073-2|ANXA7_HUMAN	Isoform 2 of Annexin A7 OS=Homo sapiens OX=9606 GN=ANXA7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	341-UNIMOD:4,349-UNIMOD:267	0.06	35.0	3	2	1
PRT	sp|Q9UPN9-2|TRI33_HUMAN	Isoform Beta of E3 ubiquitin-protein ligase TRIM33 OS=Homo sapiens OX=9606 GN=TRIM33	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.01	35.0	1	1	1
PRT	sp|O43776|SYNC_HUMAN	Asparagine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=NARS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	35.0	null	438-UNIMOD:4,439-UNIMOD:267,401-UNIMOD:188,427-UNIMOD:35,391-UNIMOD:35	0.05	35.0	9	2	0
PRT	sp|O15067|PUR4_HUMAN	Phosphoribosylformylglycinamidine synthase OS=Homo sapiens OX=9606 GN=PFAS PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	108-UNIMOD:4,109-UNIMOD:267,270-UNIMOD:4	0.02	35.0	3	2	1
PRT	sp|Q9BQS8|FYCO1_HUMAN	FYVE and coiled-coil domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FYCO1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	652-UNIMOD:267	0.01	35.0	1	1	1
PRT	sp|P60842|IF4A1_HUMAN	Eukaryotic initiation factor 4A-I OS=Homo sapiens OX=9606 GN=EIF4A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	178-UNIMOD:35,187-UNIMOD:35,190-UNIMOD:267,334-UNIMOD:267	0.06	35.0	9	2	0
PRT	sp|Q5TBC7|B2L15_HUMAN	Bcl-2-like protein 15 OS=Homo sapiens OX=9606 GN=BCL2L15 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	59-UNIMOD:35,73-UNIMOD:188,100-UNIMOD:4,110-UNIMOD:267	0.18	35.0	3	2	1
PRT	sp|P42704|LPPRC_HUMAN	Leucine-rich PPR motif-containing protein, mitochondrial OS=Homo sapiens OX=9606 GN=LRPPRC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	1164-UNIMOD:35,1176-UNIMOD:188,989-UNIMOD:267	0.02	35.0	5	2	0
PRT	sp|Q12769|NU160_HUMAN	Nuclear pore complex protein Nup160 OS=Homo sapiens OX=9606 GN=NUP160 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	717-UNIMOD:4	0.01	35.0	1	1	1
PRT	sp|Q14683|SMC1A_HUMAN	Structural maintenance of chromosomes protein 1A OS=Homo sapiens OX=9606 GN=SMC1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	769-UNIMOD:35,781-UNIMOD:4,782-UNIMOD:267,1222-UNIMOD:188	0.04	35.0	4	3	2
PRT	sp|P09327|VILI_HUMAN	Villin-1 OS=Homo sapiens OX=9606 GN=VIL1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	392-UNIMOD:35,529-UNIMOD:188,549-UNIMOD:188,620-UNIMOD:267	0.08	35.0	10	5	1
PRT	sp|Q8WZA9|IRGQ_HUMAN	Immunity-related GTPase family Q protein OS=Homo sapiens OX=9606 GN=IRGQ PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	368-UNIMOD:188	0.02	35.0	1	1	1
PRT	sp|P28331-3|NDUS1_HUMAN	Isoform 3 of NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	388-UNIMOD:188	0.03	35.0	3	1	0
PRT	sp|Q92609|TBCD5_HUMAN	TBC1 domain family member 5 OS=Homo sapiens OX=9606 GN=TBC1D5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|O75116|ROCK2_HUMAN	Rho-associated protein kinase 2 OS=Homo sapiens OX=9606 GN=ROCK2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	1339-UNIMOD:188	0.01	35.0	1	1	1
PRT	sp|P25786|PSA1_HUMAN	Proteasome subunit alpha type-1 OS=Homo sapiens OX=9606 GN=PSMA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	18-UNIMOD:267	0.06	35.0	2	1	0
PRT	sp|P13647|K2C5_HUMAN	Keratin, type II cytoskeletal 5 OS=Homo sapiens OX=9606 GN=KRT5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	407-UNIMOD:4,420-UNIMOD:267,55-UNIMOD:4,63-UNIMOD:267,29-UNIMOD:267,343-UNIMOD:188,255-UNIMOD:188,585-UNIMOD:267,209-UNIMOD:188	0.16	35.0	9	7	6
PRT	sp|P26196|DDX6_HUMAN	Probable ATP-dependent RNA helicase DDX6 OS=Homo sapiens OX=9606 GN=DDX6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.07	35.0	2	2	2
PRT	sp|P80217|IN35_HUMAN	Interferon-induced 35 kDa protein OS=Homo sapiens OX=9606 GN=IFI35 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	35.0	null	2-UNIMOD:1,18-UNIMOD:267	0.06	35.0	2	1	0
PRT	sp|P39687|AN32A_HUMAN	Acidic leucine-rich nuclear phosphoprotein 32 family member A OS=Homo sapiens OX=9606 GN=ANP32A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	123-UNIMOD:4,132-UNIMOD:267	0.12	35.0	3	2	1
PRT	sp|P05787|K2C8_HUMAN	Keratin, type II cytoskeletal 8 OS=Homo sapiens OX=9606 GN=KRT8 PE=1 SV=7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	136-UNIMOD:35,148-UNIMOD:267,139-UNIMOD:35,225-UNIMOD:267,264-UNIMOD:188,341-UNIMOD:267,362-UNIMOD:267	0.21	35.0	39	8	3
PRT	sp|Q96FV9|THOC1_HUMAN	THO complex subunit 1 OS=Homo sapiens OX=9606 GN=THOC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	373-UNIMOD:267	0.04	35.0	3	2	1
PRT	sp|Q8WWI1-3|LMO7_HUMAN	Isoform 3 of LIM domain only protein 7 OS=Homo sapiens OX=9606 GN=LMO7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	357-UNIMOD:267	0.01	35.0	2	1	0
PRT	sp|P29350-2|PTN6_HUMAN	Isoform 3 of Tyrosine-protein phosphatase non-receptor type 6 OS=Homo sapiens OX=9606 GN=PTPN6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.03	35.0	1	1	0
PRT	sp|Q9UK58-4|CCNL1_HUMAN	Isoform 2 of Cyclin-L1 OS=Homo sapiens OX=9606 GN=CCNL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	178-UNIMOD:188	0.07	35.0	1	1	1
PRT	sp|Q99700-2|ATX2_HUMAN	Isoform 2 of Ataxin-2 OS=Homo sapiens OX=9606 GN=ATXN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|Q9NP81|SYSM_HUMAN	Serine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=SARS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	402-UNIMOD:267	0.03	35.0	2	1	0
PRT	sp|Q9Y5L4|TIM13_HUMAN	Mitochondrial import inner membrane translocase subunit Tim13 OS=Homo sapiens OX=9606 GN=TIMM13 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	35.0	null	41-UNIMOD:267,50-UNIMOD:385,50-UNIMOD:4	0.33	35.0	3	2	1
PRT	sp|Q02880-2|TOP2B_HUMAN	Isoform Beta-1 of DNA topoisomerase 2-beta OS=Homo sapiens OX=9606 GN=TOP2B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	1451-UNIMOD:188	0.02	35.0	3	2	1
PRT	sp|Q9UPN3-4|MACF1_HUMAN	Isoform 5 of Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	2861-UNIMOD:267	0.00	35.0	2	1	0
PRT	sp|Q9P2I0|CPSF2_HUMAN	Cleavage and polyadenylation specificity factor subunit 2 OS=Homo sapiens OX=9606 GN=CPSF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	335-UNIMOD:4,339-UNIMOD:267	0.02	35.0	1	1	1
PRT	sp|Q92900-2|RENT1_HUMAN	Isoform 2 of Regulator of nonsense transcripts 1 OS=Homo sapiens OX=9606 GN=UPF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	1	1	0
PRT	sp|P49354-2|FNTA_HUMAN	Isoform 2 of Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha OS=Homo sapiens OX=9606 GN=FNTA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	186-UNIMOD:267	0.04	35.0	1	1	1
PRT	sp|P62736|ACTA_HUMAN	Actin, aortic smooth muscle OS=Homo sapiens OX=9606 GN=ACTA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	256-UNIMOD:267	0.05	35.0	9	1	0
PRT	sp|Q13813|SPTN1_HUMAN	Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	null	743-UNIMOD:28,756-UNIMOD:188	0.01	35.0	2	1	0
PRT	sp|Q9BQ39|DDX50_HUMAN	ATP-dependent RNA helicase DDX50 OS=Homo sapiens OX=9606 GN=DDX50 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	null	413-UNIMOD:28,417-UNIMOD:4	0.02	35.0	1	1	1
PRT	sp|Q7L014|DDX46_HUMAN	Probable ATP-dependent RNA helicase DDX46 OS=Homo sapiens OX=9606 GN=DDX46 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	35.0	null	455-UNIMOD:267,903-UNIMOD:188	0.03	35.0	5	2	0
PRT	sp|P09960|LKHA4_HUMAN	Leukotriene A-4 hydrolase OS=Homo sapiens OX=9606 GN=LTA4H PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	null	80-UNIMOD:28,83-UNIMOD:188,97-UNIMOD:188	0.03	35.0	3	1	0
PRT	sp|Q9UET6|TRM7_HUMAN	Putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase OS=Homo sapiens OX=9606 GN=FTSJ1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	49-UNIMOD:4	0.06	35.0	1	1	0
PRT	sp|Q9Y3A3|PHOCN_HUMAN	MOB-like protein phocein OS=Homo sapiens OX=9606 GN=MOB4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	null	176-UNIMOD:28,188-UNIMOD:4,190-UNIMOD:267	0.07	35.0	2	1	0
PRT	sp|P61962|DCAF7_HUMAN	DDB1- and CUL4-associated factor 7 OS=Homo sapiens OX=9606 GN=DCAF7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null		0.05	35.0	1	1	1
PRT	sp|P36405|ARL3_HUMAN	ADP-ribosylation factor-like protein 3 OS=Homo sapiens OX=9606 GN=ARL3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	null	36-UNIMOD:28	0.11	35.0	1	1	1
PRT	sp|Q92890|UFD1_HUMAN	Ubiquitin recognition factor in ER-associated degradation protein 1 OS=Homo sapiens OX=9606 GN=UFD1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	null	25-UNIMOD:385,25-UNIMOD:4	0.06	35.0	1	1	1
PRT	sp|P36873|PP1G_HUMAN	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Homo sapiens OX=9606 GN=PPP1CC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	2-UNIMOD:1,155-UNIMOD:4,158-UNIMOD:4,168-UNIMOD:188,36-UNIMOD:267	0.14	34.0	4	3	2
PRT	sp|Q9NRF9|DPOE3_HUMAN	DNA polymerase epsilon subunit 3 OS=Homo sapiens OX=9606 GN=POLE3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	2-UNIMOD:1,4-UNIMOD:267,17-UNIMOD:267	0.12	34.0	2	1	0
PRT	sp|Q99439|CNN2_HUMAN	Calponin-2 OS=Homo sapiens OX=9606 GN=CNN2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	215-UNIMOD:4,227-UNIMOD:267,164-UNIMOD:4,174-UNIMOD:188,145-UNIMOD:188	0.13	34.0	3	3	3
PRT	sp|O60684|IMA7_HUMAN	Importin subunit alpha-7 OS=Homo sapiens OX=9606 GN=KPNA6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	357-UNIMOD:4,368-UNIMOD:267	0.03	34.0	2	1	0
PRT	sp|P22234|PUR6_HUMAN	Multifunctional protein ADE2 OS=Homo sapiens OX=9606 GN=PAICS PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	215-UNIMOD:267,2-UNIMOD:1,11-UNIMOD:188,12-UNIMOD:188	0.06	34.0	6	2	0
PRT	sp|P17844-2|DDX5_HUMAN	Isoform 2 of Probable ATP-dependent RNA helicase DDX5 OS=Homo sapiens OX=9606 GN=DDX5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	112-UNIMOD:4	0.06	34.0	2	2	2
PRT	sp|Q08380|LG3BP_HUMAN	Galectin-3-binding protein OS=Homo sapiens OX=9606 GN=LGALS3BP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	36-UNIMOD:267	0.05	34.0	3	2	1
PRT	sp|P52732|KIF11_HUMAN	Kinesin-like protein KIF11 OS=Homo sapiens OX=9606 GN=KIF11 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	773-UNIMOD:4,784-UNIMOD:267	0.03	34.0	2	2	2
PRT	sp|Q6NYC1-2|JMJD6_HUMAN	Isoform 2 of Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6 OS=Homo sapiens OX=9606 GN=JMJD6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	167-UNIMOD:188	0.04	34.0	2	1	0
PRT	sp|Q9Y5J1|UTP18_HUMAN	U3 small nucleolar RNA-associated protein 18 homolog OS=Homo sapiens OX=9606 GN=UTP18 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	435-UNIMOD:267,233-UNIMOD:267	0.06	34.0	4	2	0
PRT	sp|Q13838|DX39B_HUMAN	Spliceosome RNA helicase DDX39B OS=Homo sapiens OX=9606 GN=DDX39B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	398-UNIMOD:188,256-UNIMOD:188	0.07	34.0	3	2	1
PRT	sp|P14550|AK1A1_HUMAN	Aldo-keto reductase family 1 member A1 OS=Homo sapiens OX=9606 GN=AKR1A1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	2-UNIMOD:1,5-UNIMOD:4,13-UNIMOD:188,308-UNIMOD:188	0.13	34.0	5	3	1
PRT	sp|Q9UI30-2|TR112_HUMAN	Isoform 2 of Multifunctional methyltransferase subunit TRM112-like protein OS=Homo sapiens OX=9606 GN=TRMT112	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	77-UNIMOD:267	0.13	34.0	2	1	0
PRT	sp|Q92499|DDX1_HUMAN	ATP-dependent RNA helicase DDX1 OS=Homo sapiens OX=9606 GN=DDX1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	110-UNIMOD:4,111-UNIMOD:4,114-UNIMOD:267	0.02	34.0	3	1	0
PRT	sp|P16615-5|AT2A2_HUMAN	Isoform 5 of Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Homo sapiens OX=9606 GN=ATP2A2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	650-UNIMOD:188	0.01	34.0	2	1	0
PRT	sp|O60701-3|UGDH_HUMAN	Isoform 3 of UDP-glucose 6-dehydrogenase OS=Homo sapiens OX=9606 GN=UGDH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	123-UNIMOD:188,93-UNIMOD:267	0.11	34.0	5	3	1
PRT	sp|Q9H1Y0|ATG5_HUMAN	Autophagy protein 5 OS=Homo sapiens OX=9606 GN=ATG5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	19-UNIMOD:4	0.06	34.0	1	1	1
PRT	sp|Q9UM54-5|MYO6_HUMAN	Isoform 5 of Unconventional myosin-VI OS=Homo sapiens OX=9606 GN=MYO6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	196-UNIMOD:188	0.01	34.0	2	1	0
PRT	sp|Q9HCE1|MOV10_HUMAN	Helicase MOV-10 OS=Homo sapiens OX=9606 GN=MOV10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	34.0	null	508-UNIMOD:267	0.03	34.0	2	2	2
PRT	sp|P13804|ETFA_HUMAN	Electron transfer flavoprotein subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ETFA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	53-UNIMOD:4,59-UNIMOD:188,139-UNIMOD:188	0.08	34.0	5	2	0
PRT	sp|P35270|SPRE_HUMAN	Sepiapterin reductase OS=Homo sapiens OX=9606 GN=SPR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	109-UNIMOD:188,205-UNIMOD:35,210-UNIMOD:267	0.13	34.0	5	2	0
PRT	sp|O95793-2|STAU1_HUMAN	Isoform Short of Double-stranded RNA-binding protein Staufen homolog 1 OS=Homo sapiens OX=9606 GN=STAU1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	484-UNIMOD:267	0.03	34.0	2	1	0
PRT	sp|O00499-9|BIN1_HUMAN	Isoform BIN1-10-13 of Myc box-dependent-interacting protein 1 OS=Homo sapiens OX=9606 GN=BIN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	241-UNIMOD:188	0.04	34.0	2	1	0
PRT	sp|P48449-2|ERG7_HUMAN	Isoform 2 of Lanosterol synthase OS=Homo sapiens OX=9606 GN=LSS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	180-UNIMOD:267	0.02	34.0	2	1	0
PRT	sp|Q9NR30-2|DDX21_HUMAN	Isoform 2 of Nucleolar RNA helicase 2 OS=Homo sapiens OX=9606 GN=DDX21	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	223-UNIMOD:4,236-UNIMOD:267	0.05	34.0	2	2	2
PRT	sp|P45880|VDAC2_HUMAN	Voltage-dependent anion-selective channel protein 2 OS=Homo sapiens OX=9606 GN=VDAC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	120-UNIMOD:188,13-UNIMOD:4,2-UNIMOD:1,8-UNIMOD:4,10-UNIMOD:267	0.13	34.0	4	3	2
PRT	sp|Q01469|FABP5_HUMAN	Fatty acid-binding protein 5 OS=Homo sapiens OX=9606 GN=FABP5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	120-UNIMOD:4,127-UNIMOD:4	0.11	34.0	1	1	1
PRT	sp|Q9H9B4|SFXN1_HUMAN	Sideroflexin-1 OS=Homo sapiens OX=9606 GN=SFXN1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	48-UNIMOD:267,214-UNIMOD:267	0.08	34.0	3	2	1
PRT	sp|P61204|ARF3_HUMAN	ADP-ribosylation factor 3 OS=Homo sapiens OX=9606 GN=ARF3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	73-UNIMOD:188	0.08	34.0	2	1	0
PRT	sp|O75396|SC22B_HUMAN	Vesicle-trafficking protein SEC22b OS=Homo sapiens OX=9606 GN=SEC22B PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	147-UNIMOD:267	0.07	34.0	2	1	0
PRT	sp|Q9BYT8|NEUL_HUMAN	Neurolysin, mitochondrial OS=Homo sapiens OX=9606 GN=NLN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	217-UNIMOD:188	0.02	34.0	3	1	0
PRT	sp|Q9Y5X3|SNX5_HUMAN	Sorting nexin-5 OS=Homo sapiens OX=9606 GN=SNX5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	397-UNIMOD:4,402-UNIMOD:188,2-UNIMOD:1,67-UNIMOD:267	0.12	34.0	4	3	2
PRT	sp|P08240-2|SRPRA_HUMAN	Isoform 2 of Signal recognition particle receptor subunit alpha OS=Homo sapiens OX=9606 GN=SRPRA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	496-UNIMOD:267	0.02	34.0	2	1	0
PRT	sp|Q12888|TP53B_HUMAN	TP53-binding protein 1 OS=Homo sapiens OX=9606 GN=TP53BP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	1858-UNIMOD:267	0.01	34.0	2	1	0
PRT	sp|Q99832-3|TCPH_HUMAN	Isoform 3 of T-complex protein 1 subunit eta OS=Homo sapiens OX=9606 GN=CCT7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	406-UNIMOD:4,419-UNIMOD:188,301-UNIMOD:4,313-UNIMOD:267,343-UNIMOD:267,186-UNIMOD:188	0.11	34.0	7	4	1
PRT	sp|Q03518|TAP1_HUMAN	Antigen peptide transporter 1 OS=Homo sapiens OX=9606 GN=TAP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	653-UNIMOD:267	0.02	34.0	1	1	1
PRT	sp|Q92841-1|DDX17_HUMAN	Isoform 2 of Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens OX=9606 GN=DDX17	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	605-UNIMOD:267	0.02	34.0	2	1	0
PRT	sp|Q00341|VIGLN_HUMAN	Vigilin OS=Homo sapiens OX=9606 GN=HDLBP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	2-UNIMOD:1,255-UNIMOD:267,16-UNIMOD:267	0.02	34.0	4	2	0
PRT	sp|Q9BRA2|TXD17_HUMAN	Thioredoxin domain-containing protein 17 OS=Homo sapiens OX=9606 GN=TXNDC17 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	43-UNIMOD:4,46-UNIMOD:4,54-UNIMOD:267	0.12	34.0	2	1	0
PRT	sp|P33316-2|DUT_HUMAN	Isoform 2 of Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=DUT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	78-UNIMOD:4,81-UNIMOD:267	0.09	34.0	2	1	0
PRT	sp|P35611-2|ADDA_HUMAN	Isoform 2 of Alpha-adducin OS=Homo sapiens OX=9606 GN=ADD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	497-UNIMOD:188,348-UNIMOD:188,525-UNIMOD:4,531-UNIMOD:267	0.09	34.0	5	3	1
PRT	sp|O60826|CCD22_HUMAN	Coiled-coil domain-containing protein 22 OS=Homo sapiens OX=9606 GN=CCDC22 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	369-UNIMOD:4,370-UNIMOD:267	0.02	34.0	1	1	1
PRT	sp|O15400-2|STX7_HUMAN	Isoform 2 of Syntaxin-7 OS=Homo sapiens OX=9606 GN=STX7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	49-UNIMOD:267	0.07	34.0	2	1	0
PRT	sp|Q16630-3|CPSF6_HUMAN	Isoform 3 of Cleavage and polyadenylation specificity factor subunit 6 OS=Homo sapiens OX=9606 GN=CPSF6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	347-UNIMOD:267	0.06	34.0	3	2	0
PRT	sp|Q9H7Z7|PGES2_HUMAN	Prostaglandin E synthase 2 OS=Homo sapiens OX=9606 GN=PTGES2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	266-UNIMOD:267	0.04	34.0	2	1	0
PRT	sp|P26038|MOES_HUMAN	Moesin OS=Homo sapiens OX=9606 GN=MSN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	427-UNIMOD:267,533-UNIMOD:267	0.05	34.0	4	2	0
PRT	sp|Q6P158-2|DHX57_HUMAN	Isoform 2 of Putative ATP-dependent RNA helicase DHX57 OS=Homo sapiens OX=9606 GN=DHX57	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	592-UNIMOD:188	0.03	34.0	1	1	1
PRT	sp|Q8TEQ6|GEMI5_HUMAN	Gem-associated protein 5 OS=Homo sapiens OX=9606 GN=GEMIN5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	1386-UNIMOD:267	0.01	34.0	2	1	0
PRT	sp|P04181|OAT_HUMAN	Ornithine aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=OAT PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	46-UNIMOD:267,372-UNIMOD:267	0.06	34.0	4	2	0
PRT	sp|P50991-2|TCPD_HUMAN	Isoform 2 of T-complex protein 1 subunit delta OS=Homo sapiens OX=9606 GN=CCT4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	176-UNIMOD:267,265-UNIMOD:4,272-UNIMOD:188,349-UNIMOD:4,354-UNIMOD:188	0.07	34.0	4	3	1
PRT	sp|P00492|HPRT_HUMAN	Hypoxanthine-guanine phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=HPRT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	128-UNIMOD:188	0.06	34.0	2	1	0
PRT	sp|O95757|HS74L_HUMAN	Heat shock 70 kDa protein 4L OS=Homo sapiens OX=9606 GN=HSPA4L PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.05	34.0	3	3	3
PRT	sp|Q9P2M7-2|CING_HUMAN	Isoform 2 of Cingulin OS=Homo sapiens OX=9606 GN=CGN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|P02786|TFR1_HUMAN	Transferrin receptor protein 1 OS=Homo sapiens OX=9606 GN=TFRC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	508-UNIMOD:188	0.02	34.0	2	1	0
PRT	sp|P33993|MCM7_HUMAN	DNA replication licensing factor MCM7 OS=Homo sapiens OX=9606 GN=MCM7 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	null	287-UNIMOD:28,302-UNIMOD:267	0.02	34.0	2	1	0
PRT	sp|P49792|RBP2_HUMAN	E3 SUMO-protein ligase RanBP2 OS=Homo sapiens OX=9606 GN=RANBP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	34.0	null	286-UNIMOD:188,596-UNIMOD:267	0.01	34.0	4	3	2
PRT	sp|Q08945|SSRP1_HUMAN	FACT complex subunit SSRP1 OS=Homo sapiens OX=9606 GN=SSRP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	34.0	null	200-UNIMOD:4,54-UNIMOD:267,396-UNIMOD:188	0.06	34.0	6	3	0
PRT	sp|P04843|RPN1_HUMAN	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Homo sapiens OX=9606 GN=RPN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	34.0	null	152-UNIMOD:28,169-UNIMOD:188,536-UNIMOD:267	0.05	34.0	3	2	1
PRT	sp|Q6PGP7|TTC37_HUMAN	Tetratricopeptide repeat protein 37 OS=Homo sapiens OX=9606 GN=TTC37 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	34.0	null	349-UNIMOD:267,392-UNIMOD:188	0.02	34.0	3	2	1
PRT	sp|Q8WXX5|DNJC9_HUMAN	DnaJ homolog subfamily C member 9 OS=Homo sapiens OX=9606 GN=DNAJC9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	34.0	null	228-UNIMOD:28,229-UNIMOD:188,241-UNIMOD:188	0.10	34.0	3	2	1
PRT	sp|P78356|PI42B_HUMAN	Phosphatidylinositol 5-phosphate 4-kinase type-2 beta OS=Homo sapiens OX=9606 GN=PIP4K2B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null		0.04	34.0	1	1	1
PRT	sp|Q9NV06|DCA13_HUMAN	DDB1- and CUL4-associated factor 13 OS=Homo sapiens OX=9606 GN=DCAF13 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	87-UNIMOD:4	0.03	34.0	1	1	1
PRT	sp|Q8N1G4|LRC47_HUMAN	Leucine-rich repeat-containing protein 47 OS=Homo sapiens OX=9606 GN=LRRC47 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	34.0	null	102-UNIMOD:267	0.03	34.0	2	1	0
PRT	sp|Q07065|CKAP4_HUMAN	Cytoskeleton-associated protein 4 OS=Homo sapiens OX=9606 GN=CKAP4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	null	147-UNIMOD:28	0.03	34.0	1	1	1
PRT	sp|P01024|CO3_HUMAN	Complement C3 OS=Homo sapiens OX=9606 GN=C3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null		0.01	34.0	1	1	1
PRT	sp|P29083|T2EA_HUMAN	General transcription factor IIE subunit 1 OS=Homo sapiens OX=9606 GN=GTF2E1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	2-UNIMOD:1	0.04	33.0	1	1	1
PRT	sp|Q92598-2|HS105_HUMAN	Isoform Beta of Heat shock protein 105 kDa OS=Homo sapiens OX=9606 GN=HSPH1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	33-UNIMOD:267,310-UNIMOD:4,316-UNIMOD:188,471-UNIMOD:188	0.05	33.0	7	3	0
PRT	sp|Q9H974-2|QTRT2_HUMAN	Isoform 2 of Queuine tRNA-ribosyltransferase accessory subunit 2 OS=Homo sapiens OX=9606 GN=QTRT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	20-UNIMOD:4,28-UNIMOD:4,29-UNIMOD:188	0.07	33.0	2	1	0
PRT	sp|Q9UMX0-3|UBQL1_HUMAN	Isoform 3 of Ubiquilin-1 OS=Homo sapiens OX=9606 GN=UBQLN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	96-UNIMOD:267	0.04	33.0	1	1	0
PRT	sp|Q9BVA1|TBB2B_HUMAN	Tubulin beta-2B chain OS=Homo sapiens OX=9606 GN=TUBB2B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	293-UNIMOD:35,297-UNIMOD:188	0.04	33.0	4	1	0
PRT	sp|P06239-2|LCK_HUMAN	Isoform Short of Tyrosine-protein kinase Lck OS=Homo sapiens OX=9606 GN=LCK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.06	33.0	2	1	0
PRT	sp|Q86VP6|CAND1_HUMAN	Cullin-associated NEDD8-dissociated protein 1 OS=Homo sapiens OX=9606 GN=CAND1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	33.0	null	2-UNIMOD:1,14-UNIMOD:188,826-UNIMOD:188,36-UNIMOD:188,1023-UNIMOD:267	0.04	33.0	10	4	1
PRT	sp|Q16513-3|PKN2_HUMAN	Isoform 3 of Serine/threonine-protein kinase N2 OS=Homo sapiens OX=9606 GN=PKN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	2-UNIMOD:1	0.02	33.0	1	1	1
PRT	sp|Q9UET6-2|TRM7_HUMAN	Isoform 2 of Putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase OS=Homo sapiens OX=9606 GN=FTSJ1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	49-UNIMOD:4,62-UNIMOD:188	0.06	33.0	1	1	0
PRT	sp|Q9BSJ8|ESYT1_HUMAN	Extended synaptotagmin-1 OS=Homo sapiens OX=9606 GN=ESYT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	522-UNIMOD:4,530-UNIMOD:267	0.03	33.0	3	2	1
PRT	sp|P30048-2|PRDX3_HUMAN	Isoform 2 of Thioredoxin-dependent peroxide reductase, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	166-UNIMOD:267	0.06	33.0	2	1	0
PRT	sp|P82663|RT25_HUMAN	28S ribosomal protein S25, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS25 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	33.0	null	139-UNIMOD:4,141-UNIMOD:4,149-UNIMOD:4,157-UNIMOD:188,24-UNIMOD:188	0.20	33.0	3	2	1
PRT	sp|Q99471|PFD5_HUMAN	Prefoldin subunit 5 OS=Homo sapiens OX=9606 GN=PFDN5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.10	33.0	1	1	1
PRT	sp|Q8IWE4|DCNL3_HUMAN	DCN1-like protein 3 OS=Homo sapiens OX=9606 GN=DCUN1D3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	115-UNIMOD:4,119-UNIMOD:4,126-UNIMOD:267	0.05	33.0	1	1	1
PRT	sp|P49770|EI2BB_HUMAN	Translation initiation factor eIF-2B subunit beta OS=Homo sapiens OX=9606 GN=EIF2B2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	305-UNIMOD:188	0.05	33.0	2	1	0
PRT	sp|P20290|BTF3_HUMAN	Transcription factor BTF3 OS=Homo sapiens OX=9606 GN=BTF3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	22-UNIMOD:4,35-UNIMOD:267	0.08	33.0	2	1	0
PRT	sp|O75153|CLU_HUMAN	Clustered mitochondria protein homolog OS=Homo sapiens OX=9606 GN=CLUH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	184-UNIMOD:4,195-UNIMOD:267,117-UNIMOD:267	0.04	33.0	5	3	1
PRT	sp|P07355|ANXA2_HUMAN	Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	133-UNIMOD:4,135-UNIMOD:267,63-UNIMOD:267,245-UNIMOD:267,145-UNIMOD:267,324-UNIMOD:188	0.20	33.0	17	5	1
PRT	sp|Q9H910-2|JUPI2_HUMAN	Isoform 2 of Jupiter microtubule associated homolog 2 OS=Homo sapiens OX=9606 GN=JPT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	65-UNIMOD:267	0.09	33.0	2	1	0
PRT	sp|Q6NXG1-2|ESRP1_HUMAN	Isoform 2 of Epithelial splicing regulatory protein 1 OS=Homo sapiens OX=9606 GN=ESRP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	322-UNIMOD:188	0.03	33.0	2	1	0
PRT	sp|P63096-2|GNAI1_HUMAN	Isoform 2 of Guanine nucleotide-binding protein G(i) subunit alpha-1 OS=Homo sapiens OX=9606 GN=GNAI1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	124-UNIMOD:267	0.05	33.0	2	1	0
PRT	sp|Q13325-2|IFIT5_HUMAN	Isoform 2 of Interferon-induced protein with tetratricopeptide repeats 5 OS=Homo sapiens OX=9606 GN=IFIT5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	428-UNIMOD:4	0.04	33.0	1	1	1
PRT	sp|P49915-2|GUAA_HUMAN	Isoform 2 of GMP synthase [glutamine-hydrolyzing] OS=Homo sapiens OX=9606 GN=GMPS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	586-UNIMOD:188	0.03	33.0	2	1	0
PRT	sp|Q27J81|INF2_HUMAN	Inverted formin-2 OS=Homo sapiens OX=9606 GN=INF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	101-UNIMOD:4,104-UNIMOD:4,106-UNIMOD:267,889-UNIMOD:188	0.02	33.0	4	2	0
PRT	sp|P33176|KINH_HUMAN	Kinesin-1 heavy chain OS=Homo sapiens OX=9606 GN=KIF5B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	33.0	null	956-UNIMOD:267,844-UNIMOD:188,699-UNIMOD:28,709-UNIMOD:267	0.04	33.0	5	3	1
PRT	sp|P49588|SYAC_HUMAN	Alanine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=AARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	33.0	null	901-UNIMOD:4,903-UNIMOD:4,912-UNIMOD:267,255-UNIMOD:35,165-UNIMOD:188	0.06	33.0	6	4	2
PRT	sp|P07199|CENPB_HUMAN	Major centromere autoantigen B OS=Homo sapiens OX=9606 GN=CENPB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|P08559-3|ODPA_HUMAN	Isoform 3 of Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial OS=Homo sapiens OX=9606 GN=PDHA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	58-UNIMOD:267,230-UNIMOD:4,232-UNIMOD:267	0.07	33.0	4	2	0
PRT	sp|Q15233|NONO_HUMAN	Non-POU domain-containing octamer-binding protein OS=Homo sapiens OX=9606 GN=NONO PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.04	33.0	1	1	1
PRT	sp|P42285|MTREX_HUMAN	Exosome RNA helicase MTR4 OS=Homo sapiens OX=9606 GN=MTREX PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	995-UNIMOD:267	0.02	33.0	2	2	2
PRT	sp|P78371-2|TCPB_HUMAN	Isoform 2 of T-complex protein 1 subunit beta OS=Homo sapiens OX=9606 GN=CCT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	341-UNIMOD:267	0.07	33.0	2	2	2
PRT	sp|Q5VTR2|BRE1A_HUMAN	E3 ubiquitin-protein ligase BRE1A OS=Homo sapiens OX=9606 GN=RNF20 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	49-UNIMOD:267	0.01	33.0	1	1	1
PRT	sp|Q13561|DCTN2_HUMAN	Dynactin subunit 2 OS=Homo sapiens OX=9606 GN=DCTN2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	175-UNIMOD:188,282-UNIMOD:267	0.09	33.0	3	2	1
PRT	sp|O00159-2|MYO1C_HUMAN	Isoform 2 of Unconventional myosin-Ic OS=Homo sapiens OX=9606 GN=MYO1C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	126-UNIMOD:4,131-UNIMOD:267	0.01	33.0	2	1	0
PRT	sp|O00154-2|BACH_HUMAN	Isoform 2 of Cytosolic acyl coenzyme A thioester hydrolase OS=Homo sapiens OX=9606 GN=ACOT7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	222-UNIMOD:267,37-UNIMOD:35,48-UNIMOD:267	0.11	33.0	3	2	1
PRT	sp|Q71UM5|RS27L_HUMAN	40S ribosomal protein S27-like OS=Homo sapiens OX=9606 GN=RPS27L PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	36-UNIMOD:188	0.17	33.0	2	1	0
PRT	sp|P51149|RAB7A_HUMAN	Ras-related protein Rab-7a OS=Homo sapiens OX=9606 GN=RAB7A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	69-UNIMOD:267,171-UNIMOD:267,21-UNIMOD:188,48-UNIMOD:188	0.26	33.0	7	4	1
PRT	sp|Q15366-7|PCBP2_HUMAN	Isoform 7 of Poly(rC)-binding protein 2 OS=Homo sapiens OX=9606 GN=PCBP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	109-UNIMOD:4,115-UNIMOD:188,286-UNIMOD:267,158-UNIMOD:4,160-UNIMOD:188	0.14	33.0	5	3	1
PRT	sp|Q8TDB8-4|GTR14_HUMAN	Isoform 4 of Solute carrier family 2, facilitated glucose transporter member 14 OS=Homo sapiens OX=9606 GN=SLC2A14	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	158-UNIMOD:188	0.04	33.0	1	1	1
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	278-UNIMOD:35,189-UNIMOD:188,193-UNIMOD:188,291-UNIMOD:267	0.18	33.0	7	2	0
PRT	sp|Q8IVT2|MISP_HUMAN	Mitotic interactor and substrate of PLK1 OS=Homo sapiens OX=9606 GN=MISP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	587-UNIMOD:267	0.03	33.0	2	1	0
PRT	sp|P14735|IDE_HUMAN	Insulin-degrading enzyme OS=Homo sapiens OX=9606 GN=IDE PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|Q9BX66-8|SRBS1_HUMAN	Isoform 8 of Sorbin and SH3 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SORBS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	725-UNIMOD:267,565-UNIMOD:188,477-UNIMOD:188	0.06	33.0	3	3	3
PRT	sp|P62851|RS25_HUMAN	40S ribosomal protein S25 OS=Homo sapiens OX=9606 GN=RPS25 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	114-UNIMOD:188,94-UNIMOD:188	0.20	33.0	4	2	0
PRT	sp|Q9NRL2-2|BAZ1A_HUMAN	Isoform 2 of Bromodomain adjacent to zinc finger domain protein 1A OS=Homo sapiens OX=9606 GN=BAZ1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	515-UNIMOD:4,522-UNIMOD:267	0.01	33.0	2	1	0
PRT	sp|O43865|SAHH2_HUMAN	S-adenosylhomocysteine hydrolase-like protein 1 OS=Homo sapiens OX=9606 GN=AHCYL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	2-UNIMOD:1,17-UNIMOD:188,20-UNIMOD:188,272-UNIMOD:4,284-UNIMOD:188	0.07	33.0	3	2	1
PRT	sp|P05023-3|AT1A1_HUMAN	Isoform 3 of Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	209-UNIMOD:267,413-UNIMOD:188,60-UNIMOD:188,456-UNIMOD:188,428-UNIMOD:4,432-UNIMOD:4,433-UNIMOD:4	0.07	33.0	10	5	1
PRT	sp|Q6IAN0|DRS7B_HUMAN	Dehydrogenase/reductase SDR family member 7B OS=Homo sapiens OX=9606 GN=DHRS7B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	282-UNIMOD:188	0.05	33.0	2	1	0
PRT	sp|Q29RF7-3|PDS5A_HUMAN	Isoform 2 of Sister chromatid cohesion protein PDS5 homolog A OS=Homo sapiens OX=9606 GN=PDS5A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	581-UNIMOD:4,583-UNIMOD:4,584-UNIMOD:188	0.03	33.0	1	1	1
PRT	sp|P07737|PROF1_HUMAN	Profilin-1 OS=Homo sapiens OX=9606 GN=PFN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.11	33.0	1	1	1
PRT	sp|Q14966-5|ZN638_HUMAN	Isoform 5 of Zinc finger protein 638 OS=Homo sapiens OX=9606 GN=ZNF638	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	331-UNIMOD:267	0.01	33.0	2	1	0
PRT	sp|Q9NQR4|NIT2_HUMAN	Omega-amidase NIT2 OS=Homo sapiens OX=9606 GN=NIT2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	146-UNIMOD:4,147-UNIMOD:267,44-UNIMOD:4,52-UNIMOD:188	0.12	33.0	4	2	0
PRT	sp|O95373|IPO7_HUMAN	Importin-7 OS=Homo sapiens OX=9606 GN=IPO7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	415-UNIMOD:4,1002-UNIMOD:267,412-UNIMOD:35,427-UNIMOD:267	0.03	33.0	4	2	1
PRT	sp|P52888|THOP1_HUMAN	Thimet oligopeptidase OS=Homo sapiens OX=9606 GN=THOP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	301-UNIMOD:188	0.02	33.0	3	1	0
PRT	sp|P20340-3|RAB6A_HUMAN	Isoform 3 of Ras-related protein Rab-6A OS=Homo sapiens OX=9606 GN=RAB6A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	79-UNIMOD:267,73-UNIMOD:35	0.14	33.0	3	1	0
PRT	sp|Q9NX47|MARH5_HUMAN	E3 ubiquitin-protein ligase MARCHF5 OS=Homo sapiens OX=9606 GN=MARCHF5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	65-UNIMOD:4,68-UNIMOD:4,78-UNIMOD:188	0.06	33.0	2	1	0
PRT	sp|P62826|RAN_HUMAN	GTP-binding nuclear protein Ran OS=Homo sapiens OX=9606 GN=RAN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	112-UNIMOD:4,120-UNIMOD:4,23-UNIMOD:188,71-UNIMOD:188,152-UNIMOD:188	0.23	33.0	7	4	1
PRT	sp|Q96S99|PKHF1_HUMAN	Pleckstrin homology domain-containing family F member 1 OS=Homo sapiens OX=9606 GN=PLEKHF1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	2-UNIMOD:1,14-UNIMOD:267	0.05	33.0	1	1	1
PRT	sp|Q5VYK3|ECM29_HUMAN	Proteasome adapter and scaffold protein ECM29 OS=Homo sapiens OX=9606 GN=ECPAS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	243-UNIMOD:4,244-UNIMOD:188,1796-UNIMOD:188	0.02	33.0	4	2	0
PRT	sp|P62913-2|RL11_HUMAN	Isoform 2 of 60S ribosomal protein L11 OS=Homo sapiens OX=9606 GN=RPL11	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	51-UNIMOD:188	0.08	33.0	2	1	0
PRT	sp|P61604|CH10_HUMAN	10 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPE1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	54-UNIMOD:188	0.15	33.0	2	1	0
PRT	sp|Q4G0J3-3|LARP7_HUMAN	Isoform 3 of La-related protein 7 OS=Homo sapiens OX=9606 GN=LARP7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	465-UNIMOD:188	0.03	33.0	1	1	1
PRT	sp|P23229-7|ITA6_HUMAN	Isoform 7 of Integrin alpha-6 OS=Homo sapiens OX=9606 GN=ITGA6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	494-UNIMOD:188	0.02	33.0	2	1	0
PRT	sp|Q6PJG6|BRAT1_HUMAN	BRCA1-associated ATM activator 1 OS=Homo sapiens OX=9606 GN=BRAT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	529-UNIMOD:267	0.03	33.0	3	2	1
PRT	sp|O00410|IPO5_HUMAN	Importin-5 OS=Homo sapiens OX=9606 GN=IPO5 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	727-UNIMOD:35,733-UNIMOD:4,735-UNIMOD:267,110-UNIMOD:4	0.02	33.0	2	2	0
PRT	sp|Q03252|LMNB2_HUMAN	Lamin-B2 OS=Homo sapiens OX=9606 GN=LMNB2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	33.0	null	506-UNIMOD:28,212-UNIMOD:385,212-UNIMOD:4,222-UNIMOD:267,223-UNIMOD:188,181-UNIMOD:267	0.06	33.0	6	4	2
PRT	sp|Q99729-2|ROAA_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A/B OS=Homo sapiens OX=9606 GN=HNRNPAB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	169-UNIMOD:188	0.05	33.0	1	1	0
PRT	sp|P49189|AL9A1_HUMAN	4-trimethylaminobutyraldehyde dehydrogenase OS=Homo sapiens OX=9606 GN=ALDH9A1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	267-UNIMOD:4,239-UNIMOD:188	0.06	33.0	2	2	0
PRT	sp|P01130|LDLR_HUMAN	Low-density lipoprotein receptor OS=Homo sapiens OX=9606 GN=LDLR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	null	377-UNIMOD:385,377-UNIMOD:4,379-UNIMOD:4	0.02	33.0	1	1	1
PRT	sp|P29317|EPHA2_HUMAN	Ephrin type-A receptor 2 OS=Homo sapiens OX=9606 GN=EPHA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	616-UNIMOD:28,617-UNIMOD:188,629-UNIMOD:188	0.02	33.0	5	2	0
PRT	sp|Q16630|CPSF6_HUMAN	Cleavage and polyadenylation specificity factor subunit 6 OS=Homo sapiens OX=9606 GN=CPSF6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	418-UNIMOD:35,138-UNIMOD:188	0.05	33.0	2	2	0
PRT	sp|Q13011|ECH1_HUMAN	Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial OS=Homo sapiens OX=9606 GN=ECH1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	33.0	null	232-UNIMOD:35,187-UNIMOD:4,196-UNIMOD:188	0.08	33.0	3	2	1
PRT	sp|Q9H4A3|WNK1_HUMAN	Serine/threonine-protein kinase WNK1 OS=Homo sapiens OX=9606 GN=WNK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	50-UNIMOD:267	0.01	33.0	1	1	0
PRT	sp|Q16181|SEPT7_HUMAN	Septin-7 OS=Homo sapiens OX=9606 GN=SEPTIN7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	null	403-UNIMOD:28,408-UNIMOD:188,416-UNIMOD:267	0.03	33.0	2	1	0
PRT	sp|P04062|GLCM_HUMAN	Lysosomal acid glucosylceramidase OS=Homo sapiens OX=9606 GN=GBA PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|Q8IWX8|CHERP_HUMAN	Calcium homeostasis endoplasmic reticulum protein OS=Homo sapiens OX=9606 GN=CHERP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	33.0	null	718-UNIMOD:267	0.02	33.0	4	1	0
PRT	sp|Q9BVP2|GNL3_HUMAN	Guanine nucleotide-binding protein-like 3 OS=Homo sapiens OX=9606 GN=GNL3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	null	158-UNIMOD:385,158-UNIMOD:4,171-UNIMOD:188,172-UNIMOD:188	0.03	33.0	2	1	0
PRT	sp|Q9UBW8|CSN7A_HUMAN	COP9 signalosome complex subunit 7a OS=Homo sapiens OX=9606 GN=COPS7A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	null	20-UNIMOD:188	0.05	33.0	1	1	1
PRT	sp|Q13283|G3BP1_HUMAN	Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens OX=9606 GN=G3BP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	109-UNIMOD:35	0.04	33.0	1	1	1
PRT	sp|Q8N163-2|CCAR2_HUMAN	Isoform 2 of Cell cycle and apoptosis regulator protein 2 OS=Homo sapiens OX=9606 GN=CCAR2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|P06396-2|GELS_HUMAN	Isoform 2 of Gelsolin OS=Homo sapiens OX=9606 GN=GSN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	546-UNIMOD:188	0.02	32.0	2	1	0
PRT	sp|Q96LA8-2|ANM6_HUMAN	Isoform 2 of Protein arginine N-methyltransferase 6 OS=Homo sapiens OX=9606 GN=PRMT6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.05	32.0	1	1	1
PRT	sp|Q9P2R3|ANFY1_HUMAN	Rabankyrin-5 OS=Homo sapiens OX=9606 GN=ANKFY1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	742-UNIMOD:4,746-UNIMOD:267	0.01	32.0	2	1	0
PRT	sp|Q9Y230|RUVB2_HUMAN	RuvB-like 2 OS=Homo sapiens OX=9606 GN=RUVBL2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	2-UNIMOD:1,83-UNIMOD:188,227-UNIMOD:4,234-UNIMOD:188	0.12	32.0	7	4	1
PRT	sp|P19388|RPAB1_HUMAN	DNA-directed RNA polymerases I, II, and III subunit RPABC1 OS=Homo sapiens OX=9606 GN=POLR2E PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	115-UNIMOD:188,1-UNIMOD:1	0.13	32.0	3	2	1
PRT	sp|O76094-2|SRP72_HUMAN	Isoform 2 of Signal recognition particle subunit SRP72 OS=Homo sapiens OX=9606 GN=SRP72	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	262-UNIMOD:4	0.02	32.0	1	1	1
PRT	sp|P21980|TGM2_HUMAN	Protein-glutamine gamma-glutamyltransferase 2 OS=Homo sapiens OX=9606 GN=TGM2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	580-UNIMOD:267,230-UNIMOD:4,240-UNIMOD:267,10-UNIMOD:4,19-UNIMOD:267,370-UNIMOD:4,371-UNIMOD:4,377-UNIMOD:267	0.09	32.0	4	4	4
PRT	sp|Q15019|SEPT2_HUMAN	Septin-2 OS=Homo sapiens OX=9606 GN=SEPTIN2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	66-UNIMOD:267,128-UNIMOD:267,249-UNIMOD:188	0.13	32.0	5	3	1
PRT	sp|Q15637-4|SF01_HUMAN	Isoform 4 of Splicing factor 1 OS=Homo sapiens OX=9606 GN=SF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	2-UNIMOD:1	0.03	32.0	1	1	1
PRT	sp|P48059|LIMS1_HUMAN	LIM and senescent cell antigen-like-containing domain protein 1 OS=Homo sapiens OX=9606 GN=LIMS1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	272-UNIMOD:4,275-UNIMOD:4,278-UNIMOD:4,281-UNIMOD:4,284-UNIMOD:188	0.05	32.0	2	1	0
PRT	sp|P78406|RAE1L_HUMAN	mRNA export factor OS=Homo sapiens OX=9606 GN=RAE1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	68-UNIMOD:4,80-UNIMOD:188,143-UNIMOD:4,151-UNIMOD:188	0.08	32.0	3	2	1
PRT	sp|P05141|ADT2_HUMAN	ADP/ATP translocase 2 OS=Homo sapiens OX=9606 GN=SLC25A5 PE=1 SV=7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	23-UNIMOD:188	0.05	32.0	2	1	0
PRT	sp|O95104-3|SCAF4_HUMAN	Isoform 3 of SR-related and CTD-associated factor 4 OS=Homo sapiens OX=9606 GN=SCAF4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	778-UNIMOD:267	0.02	32.0	2	1	0
PRT	sp|Q9NP84-2|TNR12_HUMAN	Isoform 2 of Tumor necrosis factor receptor superfamily member 12A OS=Homo sapiens OX=9606 GN=TNFRSF12A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	74-UNIMOD:188,87-UNIMOD:4	0.24	32.0	2	1	0
PRT	sp|Q9UKK9|NUDT5_HUMAN	ADP-sugar pyrophosphatase OS=Homo sapiens OX=9606 GN=NUDT5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	70-UNIMOD:267	0.07	32.0	2	1	0
PRT	sp|O15212|PFD6_HUMAN	Prefoldin subunit 6 OS=Homo sapiens OX=9606 GN=PFDN6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	117-UNIMOD:267,100-UNIMOD:28	0.15	32.0	4	2	1
PRT	sp|Q9BXP5-5|SRRT_HUMAN	Isoform 5 of Serrate RNA effector molecule homolog OS=Homo sapiens OX=9606 GN=SRRT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	828-UNIMOD:267	0.04	32.0	3	2	0
PRT	sp|P40121-2|CAPG_HUMAN	Isoform 2 of Macrophage-capping protein OS=Homo sapiens OX=9606 GN=CAPG	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	112-UNIMOD:267	0.09	32.0	3	2	0
PRT	sp|Q13557-8|KCC2D_HUMAN	Isoform Delta 6 of Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Homo sapiens OX=9606 GN=CAMK2D	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|O14972-2|VP26C_HUMAN	Isoform 2 of Vacuolar protein sorting-associated protein 26C OS=Homo sapiens OX=9606 GN=VPS26C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	141-UNIMOD:188	0.07	32.0	1	1	1
PRT	sp|Q9NTJ3-2|SMC4_HUMAN	Isoform 2 of Structural maintenance of chromosomes protein 4 OS=Homo sapiens OX=9606 GN=SMC4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	401-UNIMOD:267,445-UNIMOD:267	0.02	32.0	3	2	1
PRT	sp|P51858|HDGF_HUMAN	Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	96-UNIMOD:188,208-UNIMOD:267	0.12	32.0	5	2	0
PRT	sp|P05166|PCCB_HUMAN	Propionyl-CoA carboxylase beta chain, mitochondrial OS=Homo sapiens OX=9606 GN=PCCB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|P98172|EFNB1_HUMAN	Ephrin-B1 OS=Homo sapiens OX=9606 GN=EFNB1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	307-UNIMOD:267,43-UNIMOD:188	0.10	32.0	2	2	2
PRT	sp|P57737-2|CORO7_HUMAN	Isoform 2 of Coronin-7 OS=Homo sapiens OX=9606 GN=CORO7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	420-UNIMOD:4,423-UNIMOD:188	0.02	32.0	2	1	0
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	448-UNIMOD:267	0.02	32.0	1	1	1
PRT	sp|Q02809|PLOD1_HUMAN	Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 OS=Homo sapiens OX=9606 GN=PLOD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|Q8WVX9|FACR1_HUMAN	Fatty acyl-CoA reductase 1 OS=Homo sapiens OX=9606 GN=FAR1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	90-UNIMOD:188	0.03	32.0	3	1	0
PRT	sp|O43615|TIM44_HUMAN	Mitochondrial import inner membrane translocase subunit TIM44 OS=Homo sapiens OX=9606 GN=TIMM44 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	379-UNIMOD:35,381-UNIMOD:188	0.03	32.0	1	1	1
PRT	sp|P19823|ITIH2_HUMAN	Inter-alpha-trypsin inhibitor heavy chain H2 OS=Homo sapiens OX=9606 GN=ITIH2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|O94905|ERLN2_HUMAN	Erlin-2 OS=Homo sapiens OX=9606 GN=ERLIN2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	253-UNIMOD:267	0.04	32.0	2	1	0
PRT	sp|Q02750-2|MP2K1_HUMAN	Isoform 2 of Dual specificity mitogen-activated protein kinase kinase 1 OS=Homo sapiens OX=9606 GN=MAP2K1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|Q9UDY2-5|ZO2_HUMAN	Isoform A3 of Tight junction protein ZO-2 OS=Homo sapiens OX=9606 GN=TJP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	759-UNIMOD:188,149-UNIMOD:267	0.03	32.0	3	2	1
PRT	sp|O00592-2|PODXL_HUMAN	Isoform 2 of Podocalyxin OS=Homo sapiens OX=9606 GN=PODXL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	379-UNIMOD:188	0.03	32.0	1	1	1
PRT	sp|Q14008-2|CKAP5_HUMAN	Isoform 2 of Cytoskeleton-associated protein 5 OS=Homo sapiens OX=9606 GN=CKAP5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	1822-UNIMOD:267,1523-UNIMOD:188	0.01	32.0	3	2	1
PRT	sp|Q6UB35|C1TM_HUMAN	Monofunctional C1-tetrahydrofolate synthase, mitochondrial OS=Homo sapiens OX=9606 GN=MTHFD1L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	575-UNIMOD:267	0.01	32.0	2	1	0
PRT	sp|P61088|UBE2N_HUMAN	Ubiquitin-conjugating enzyme E2 N OS=Homo sapiens OX=9606 GN=UBE2N PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	68-UNIMOD:188,64-UNIMOD:35	0.11	32.0	4	1	0
PRT	sp|Q12996|CSTF3_HUMAN	Cleavage stimulation factor subunit 3 OS=Homo sapiens OX=9606 GN=CSTF3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	330-UNIMOD:267	0.02	32.0	2	1	0
PRT	sp|P62873-2|GBB1_HUMAN	Isoform 2 of Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homo sapiens OX=9606 GN=GNB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	204-UNIMOD:4,209-UNIMOD:188,78-UNIMOD:188	0.07	32.0	4	2	0
PRT	sp|P50990|TCPQ_HUMAN	T-complex protein 1 subunit theta OS=Homo sapiens OX=9606 GN=CCT8 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	74-UNIMOD:267,421-UNIMOD:188	0.05	32.0	2	2	2
PRT	sp|Q16543|CDC37_HUMAN	Hsp90 co-chaperone Cdc37 OS=Homo sapiens OX=9606 GN=CDC37 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	307-UNIMOD:188,247-UNIMOD:28,260-UNIMOD:188,262-UNIMOD:267	0.10	32.0	3	2	1
PRT	sp|P62258|1433E_HUMAN	14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	97-UNIMOD:4,98-UNIMOD:4,106-UNIMOD:188,141-UNIMOD:267	0.10	32.0	4	2	0
PRT	sp|Q9UG63|ABCF2_HUMAN	ATP-binding cassette sub-family F member 2 OS=Homo sapiens OX=9606 GN=ABCF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	586-UNIMOD:4,588-UNIMOD:188	0.02	32.0	2	1	0
PRT	sp|Q96CS3|FAF2_HUMAN	FAS-associated factor 2 OS=Homo sapiens OX=9606 GN=FAF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	32-UNIMOD:4,33-UNIMOD:267,194-UNIMOD:4,205-UNIMOD:267	0.08	32.0	2	2	2
PRT	sp|Q9BWE0|REPI1_HUMAN	Replication initiator 1 OS=Homo sapiens OX=9606 GN=REPIN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	33-UNIMOD:188	0.03	32.0	2	1	0
PRT	sp|Q9GZN8|CT027_HUMAN	UPF0687 protein C20orf27 OS=Homo sapiens OX=9606 GN=C20orf27 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	105-UNIMOD:188	0.09	32.0	2	1	0
PRT	sp|P82650-2|RT22_HUMAN	Isoform 2 of 28S ribosomal protein S22, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS22	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	115-UNIMOD:267	0.08	32.0	1	1	0
PRT	sp|Q02790|FKBP4_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Homo sapiens OX=9606 GN=FKBP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	342-UNIMOD:4,344-UNIMOD:188	0.03	32.0	2	1	0
PRT	sp|Q6RFH5-2|WDR74_HUMAN	Isoform 2 of WD repeat-containing protein 74 OS=Homo sapiens OX=9606 GN=WDR74	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	354-UNIMOD:267	0.04	32.0	2	1	0
PRT	sp|Q9Y4E1-5|WAC2C_HUMAN	Isoform 5 of WASH complex subunit 2C OS=Homo sapiens OX=9606 GN=WASHC2C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	341-UNIMOD:188	0.03	32.0	2	2	2
PRT	sp|P24666|PPAC_HUMAN	Low molecular weight phosphotyrosine protein phosphatase OS=Homo sapiens OX=9606 GN=ACP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	41-UNIMOD:267,124-UNIMOD:188	0.16	32.0	3	2	1
PRT	sp|P09455|RET1_HUMAN	Retinol-binding protein 1 OS=Homo sapiens OX=9606 GN=RBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	11-UNIMOD:35,22-UNIMOD:267	0.10	32.0	4	1	0
PRT	sp|P61970|NTF2_HUMAN	Nuclear transport factor 2 OS=Homo sapiens OX=9606 GN=NUTF2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	114-UNIMOD:4,120-UNIMOD:267	0.12	32.0	2	1	0
PRT	sp|O60506-4|HNRPQ_HUMAN	Isoform 4 of Heterogeneous nuclear ribonucleoprotein Q OS=Homo sapiens OX=9606 GN=SYNCRIP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	321-UNIMOD:188,81-UNIMOD:188	0.06	32.0	5	2	1
PRT	sp|O43390-3|HNRPR_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein R OS=Homo sapiens OX=9606 GN=HNRNPR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	321-UNIMOD:188	0.05	32.0	7	2	1
PRT	sp|Q00610-2|CLH1_HUMAN	Isoform 2 of Clathrin heavy chain 1 OS=Homo sapiens OX=9606 GN=CLTC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	366-UNIMOD:267,1102-UNIMOD:4,1113-UNIMOD:188,892-UNIMOD:267,491-UNIMOD:4,500-UNIMOD:188	0.03	32.0	7	4	1
PRT	sp|P51648|AL3A2_HUMAN	Aldehyde dehydrogenase family 3 member A2 OS=Homo sapiens OX=9606 GN=ALDH3A2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|Q9NQ88|TIGAR_HUMAN	Fructose-2,6-bisphosphatase TIGAR OS=Homo sapiens OX=9606 GN=TIGAR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.05	32.0	1	1	1
PRT	sp|O14662-6|STX16_HUMAN	Isoform 6 of Syntaxin-16 OS=Homo sapiens OX=9606 GN=STX16	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	202-UNIMOD:267	0.06	32.0	1	1	1
PRT	sp|Q96KP4|CNDP2_HUMAN	Cytosolic non-specific dipeptidase OS=Homo sapiens OX=9606 GN=CNDP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.05	32.0	2	2	2
PRT	sp|P37802|TAGL2_HUMAN	Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	102-UNIMOD:267,171-UNIMOD:188,196-UNIMOD:267,90-UNIMOD:35,153-UNIMOD:188	0.29	32.0	10	4	0
PRT	sp|Q14653|IRF3_HUMAN	Interferon regulatory factor 3 OS=Homo sapiens OX=9606 GN=IRF3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	222-UNIMOD:4,227-UNIMOD:267	0.04	32.0	1	1	1
PRT	sp|Q9UBI6|GBG12_HUMAN	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12 OS=Homo sapiens OX=9606 GN=GNG12 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	64-UNIMOD:188	0.24	32.0	2	1	0
PRT	sp|P16402|H13_HUMAN	Histone H1.3 OS=Homo sapiens OX=9606 GN=H1-3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	2-UNIMOD:1	0.10	32.0	1	1	1
PRT	sp|Q15750-2|TAB1_HUMAN	Isoform 2 of TGF-beta-activated kinase 1 and MAP3K7-binding protein 1 OS=Homo sapiens OX=9606 GN=TAB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	128-UNIMOD:188	0.03	32.0	2	1	0
PRT	sp|Q8NCD3-3|HJURP_HUMAN	Isoform 3 of Holliday junction recognition protein OS=Homo sapiens OX=9606 GN=HJURP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	578-UNIMOD:4	0.03	32.0	1	1	1
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	41-UNIMOD:267,94-UNIMOD:4,103-UNIMOD:188	0.11	32.0	3	2	1
PRT	sp|P48047|ATPO_HUMAN	ATP synthase subunit O, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5PO PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	188-UNIMOD:267	0.06	32.0	1	1	1
PRT	sp|Q9BTL3|RAMAC_HUMAN	RNA guanine-N7 methyltransferase activating subunit OS=Homo sapiens OX=9606 GN=RAMAC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	2-UNIMOD:1	0.15	32.0	2	1	0
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	412-UNIMOD:385,412-UNIMOD:4	0.04	32.0	3	2	1
PRT	sp|Q9Y613|FHOD1_HUMAN	FH1/FH2 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FHOD1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	904-UNIMOD:267	0.01	32.0	2	1	0
PRT	sp|Q9P2J5|SYLC_HUMAN	Leucine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=LARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	39-UNIMOD:188	0.02	32.0	3	2	1
PRT	sp|P00338-3|LDHA_HUMAN	Isoform 3 of L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	192-UNIMOD:4,198-UNIMOD:267,344-UNIMOD:267	0.07	32.0	4	2	0
PRT	sp|P51659-3|DHB4_HUMAN	Isoform 3 of Peroxisomal multifunctional enzyme type 2 OS=Homo sapiens OX=9606 GN=HSD17B4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	537-UNIMOD:267	0.02	32.0	2	1	0
PRT	sp|O95831-3|AIFM1_HUMAN	Isoform 3 of Apoptosis-inducing factor 1, mitochondrial OS=Homo sapiens OX=9606 GN=AIFM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	374-UNIMOD:188,105-UNIMOD:188,333-UNIMOD:188	0.09	32.0	5	4	3
PRT	sp|Q14166|TTL12_HUMAN	Tubulin--tyrosine ligase-like protein 12 OS=Homo sapiens OX=9606 GN=TTLL12 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	612-UNIMOD:4,614-UNIMOD:267,525-UNIMOD:28,528-UNIMOD:4,537-UNIMOD:188	0.05	32.0	4	2	0
PRT	sp|P23526-2|SAHH_HUMAN	Isoform 2 of Adenosylhomocysteinase OS=Homo sapiens OX=9606 GN=AHCY	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	158-UNIMOD:188	0.03	32.0	2	1	0
PRT	sp|P22059|OSBP1_HUMAN	Oxysterol-binding protein 1 OS=Homo sapiens OX=9606 GN=OSBP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	667-UNIMOD:267	0.02	32.0	2	1	0
PRT	sp|E9PRG8|CK098_HUMAN	Uncharacterized protein C11orf98 OS=Homo sapiens OX=9606 GN=C11orf98 PE=4 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	48-UNIMOD:267	0.11	32.0	2	1	0
PRT	sp|Q15149|PLEC_HUMAN	Plectin OS=Homo sapiens OX=9606 GN=PLEC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	32.0	null	2317-UNIMOD:28,2318-UNIMOD:188,2329-UNIMOD:267,4071-UNIMOD:4,4081-UNIMOD:188,1823-UNIMOD:28,1824-UNIMOD:267,1833-UNIMOD:188,3839-UNIMOD:28,3848-UNIMOD:188,3849-UNIMOD:188	0.02	32.0	5	5	4
PRT	sp|Q58FG1|HS904_HUMAN	Putative heat shock protein HSP 90-alpha A4 OS=Homo sapiens OX=9606 GN=HSP90AA4P PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	40-UNIMOD:188,38-UNIMOD:35	0.03	32.0	3	1	0
PRT	sp|Q9Y5B9|SP16H_HUMAN	FACT complex subunit SPT16 OS=Homo sapiens OX=9606 GN=SUPT16H PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	32.0	null	596-UNIMOD:188	0.03	32.0	3	2	1
PRT	sp|P62820|RAB1A_HUMAN	Ras-related protein Rab-1A OS=Homo sapiens OX=9606 GN=RAB1A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	32.0	null	104-UNIMOD:28,176-UNIMOD:35,187-UNIMOD:188,156-UNIMOD:188	0.23	32.0	4	3	2
PRT	sp|Q9BXP5|SRRT_HUMAN	Serrate RNA effector molecule homolog OS=Homo sapiens OX=9606 GN=SRRT PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	758-UNIMOD:188	0.02	32.0	1	1	0
PRT	sp|Q8IXM2|BAP18_HUMAN	Chromatin complexes subunit BAP18 OS=Homo sapiens OX=9606 GN=BAP18 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	21-UNIMOD:188	0.09	32.0	1	1	0
PRT	sp|Q9NQ39|RS10L_HUMAN	Putative 40S ribosomal protein S10-like OS=Homo sapiens OX=9606 GN=RPS10P5 PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	164-UNIMOD:267	0.09	32.0	2	1	0
PRT	sp|P43304|GPDM_HUMAN	Glycerol-3-phosphate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=GPD2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	null	270-UNIMOD:385,270-UNIMOD:4,271-UNIMOD:188,282-UNIMOD:267	0.02	32.0	2	1	0
PRT	sp|Q9H583|HEAT1_HUMAN	HEAT repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=HEATR1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	2030-UNIMOD:267,649-UNIMOD:188	0.01	31.0	3	2	1
PRT	sp|P26639|SYTC_HUMAN	Threonine--tRNA ligase 1, cytoplasmic OS=Homo sapiens OX=9606 GN=TARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	454-UNIMOD:267	0.04	31.0	3	2	1
PRT	sp|Q96N66-3|MBOA7_HUMAN	Isoform 3 of Lysophospholipid acyltransferase 7 OS=Homo sapiens OX=9606 GN=MBOAT7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	280-UNIMOD:4	0.05	31.0	1	1	1
PRT	sp|Q9NVH1-3|DJC11_HUMAN	Isoform 3 of DnaJ homolog subfamily C member 11 OS=Homo sapiens OX=9606 GN=DNAJC11	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	466-UNIMOD:4,471-UNIMOD:188	0.03	31.0	2	1	0
PRT	sp|P83731|RL24_HUMAN	60S ribosomal protein L24 OS=Homo sapiens OX=9606 GN=RPL24 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	91-UNIMOD:35,93-UNIMOD:188	0.09	31.0	3	1	0
PRT	sp|P37837|TALDO_HUMAN	Transaldolase OS=Homo sapiens OX=9606 GN=TALDO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	250-UNIMOD:4,258-UNIMOD:188,154-UNIMOD:188	0.08	31.0	4	2	0
PRT	sp|P26641|EF1G_HUMAN	Elongation factor 1-gamma OS=Homo sapiens OX=9606 GN=EEF1G PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	30-UNIMOD:267	0.03	31.0	2	1	0
PRT	sp|P39880-9|CUX1_HUMAN	Isoform 11 of Homeobox protein cut-like 1 OS=Homo sapiens OX=9606 GN=CUX1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	250-UNIMOD:267	0.02	31.0	1	1	1
PRT	sp|Q9H4A4|AMPB_HUMAN	Aminopeptidase B OS=Homo sapiens OX=9606 GN=RNPEP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	2-UNIMOD:1,14-UNIMOD:267,151-UNIMOD:4,161-UNIMOD:188	0.05	31.0	3	2	1
PRT	sp|Q96KP1|EXOC2_HUMAN	Exocyst complex component 2 OS=Homo sapiens OX=9606 GN=EXOC2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	263-UNIMOD:267	0.02	31.0	2	1	0
PRT	sp|Q9UHN6-2|CEIP2_HUMAN	Isoform 2 of Cell surface hyaluronidase OS=Homo sapiens OX=9606 GN=CEMIP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.01	31.0	1	1	1
PRT	sp|Q969V3-2|NCLN_HUMAN	Isoform 2 of Nicalin OS=Homo sapiens OX=9606 GN=NCLN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	207-UNIMOD:267	0.02	31.0	2	1	0
PRT	sp|O60287|NPA1P_HUMAN	Nucleolar pre-ribosomal-associated protein 1 OS=Homo sapiens OX=9606 GN=URB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	1222-UNIMOD:4	0.01	31.0	1	1	1
PRT	sp|O75368|SH3L1_HUMAN	SH3 domain-binding glutamic acid-rich-like protein OS=Homo sapiens OX=9606 GN=SH3BGRL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.17	31.0	1	1	1
PRT	sp|Q8WUM0|NU133_HUMAN	Nuclear pore complex protein Nup133 OS=Homo sapiens OX=9606 GN=NUP133 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	691-UNIMOD:267	0.01	31.0	2	1	0
PRT	sp|Q9UHB9-4|SRP68_HUMAN	Isoform 4 of Signal recognition particle subunit SRP68 OS=Homo sapiens OX=9606 GN=SRP68	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	524-UNIMOD:4,532-UNIMOD:188,483-UNIMOD:267	0.05	31.0	4	2	0
PRT	sp|P36776-3|LONM_HUMAN	Isoform 3 of Lon protease homolog, mitochondrial OS=Homo sapiens OX=9606 GN=LONP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	505-UNIMOD:188	0.03	31.0	3	2	1
PRT	sp|Q14847-3|LASP1_HUMAN	Isoform 3 of LIM and SH3 domain protein 1 OS=Homo sapiens OX=9606 GN=LASP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	53-UNIMOD:267	0.07	31.0	2	1	0
PRT	sp|Q9H0W8-2|SMG9_HUMAN	Isoform 2 of Protein SMG9 OS=Homo sapiens OX=9606 GN=SMG9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	264-UNIMOD:267	0.03	31.0	2	1	0
PRT	sp|O00233-2|PSMD9_HUMAN	Isoform p27-S of 26S proteasome non-ATPase regulatory subunit 9 OS=Homo sapiens OX=9606 GN=PSMD9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	59-UNIMOD:4,64-UNIMOD:267	0.08	31.0	2	1	0
PRT	sp|Q96JB5-3|CK5P3_HUMAN	Isoform 3 of CDK5 regulatory subunit-associated protein 3 OS=Homo sapiens OX=9606 GN=CDK5RAP3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.05	31.0	1	1	0
PRT	sp|Q13576-3|IQGA2_HUMAN	Isoform 3 of Ras GTPase-activating-like protein IQGAP2 OS=Homo sapiens OX=9606 GN=IQGAP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	1000-UNIMOD:188	0.01	31.0	1	1	1
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	400-UNIMOD:267,112-UNIMOD:188	0.04	31.0	4	2	1
PRT	sp|P29692|EF1D_HUMAN	Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	95-UNIMOD:267,107-UNIMOD:188,232-UNIMOD:188,2-UNIMOD:1,10-UNIMOD:188	0.17	31.0	7	4	1
PRT	sp|Q15029-2|U5S1_HUMAN	Isoform 2 of 116 kDa U5 small nuclear ribonucleoprotein component OS=Homo sapiens OX=9606 GN=EFTUD2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.01	31.0	1	1	1
PRT	sp|Q14498-3|RBM39_HUMAN	Isoform 3 of RNA-binding protein 39 OS=Homo sapiens OX=9606 GN=RBM39	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	267-UNIMOD:267	0.03	31.0	1	1	1
PRT	sp|O60783|RT14_HUMAN	28S ribosomal protein S14, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS14 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	80-UNIMOD:267	0.13	31.0	2	1	0
PRT	sp|Q9Y224|RTRAF_HUMAN	RNA transcription, translation and transport factor protein OS=Homo sapiens OX=9606 GN=RTRAF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.07	31.0	1	1	1
PRT	sp|Q13404-6|UB2V1_HUMAN	Isoform 4 of Ubiquitin-conjugating enzyme E2 variant 1 OS=Homo sapiens OX=9606 GN=UBE2V1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	59-UNIMOD:267	0.17	31.0	1	1	1
PRT	sp|P08134|RHOC_HUMAN	Rho-related GTP-binding protein RhoC OS=Homo sapiens OX=9606 GN=RHOC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	159-UNIMOD:4,162-UNIMOD:188,16-UNIMOD:4,18-UNIMOD:188	0.13	31.0	6	2	0
PRT	sp|P35626|ARBK2_HUMAN	Beta-adrenergic receptor kinase 2 OS=Homo sapiens OX=9606 GN=GRK3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	340-UNIMOD:4	0.02	31.0	1	1	1
PRT	sp|P14635-2|CCNB1_HUMAN	Isoform 2 of G2/mitotic-specific cyclin-B1 OS=Homo sapiens OX=9606 GN=CCNB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	391-UNIMOD:188	0.05	31.0	3	1	0
PRT	sp|P11216|PYGB_HUMAN	Glycogen phosphorylase, brain form OS=Homo sapiens OX=9606 GN=PYGB PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	185-UNIMOD:267,290-UNIMOD:188	0.03	31.0	5	2	0
PRT	sp|Q9BZX2|UCK2_HUMAN	Uridine-cytidine kinase 2 OS=Homo sapiens OX=9606 GN=UCK2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.05	31.0	1	1	1
PRT	sp|Q14974|IMB1_HUMAN	Importin subunit beta-1 OS=Homo sapiens OX=9606 GN=KPNB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	206-UNIMOD:188	0.02	31.0	5	1	0
PRT	sp|Q8NB49-2|AT11C_HUMAN	Isoform 2 of Phospholipid-transporting ATPase IG OS=Homo sapiens OX=9606 GN=ATP11C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	706-UNIMOD:188	0.01	31.0	2	1	0
PRT	sp|Q96ME7-3|ZN512_HUMAN	Isoform 3 of Zinc finger protein 512 OS=Homo sapiens OX=9606 GN=ZNF512	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|O75691|UTP20_HUMAN	Small subunit processome component 20 homolog OS=Homo sapiens OX=9606 GN=UTP20 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	1204-UNIMOD:188	0.01	31.0	1	1	1
PRT	sp|Q9H1A3-2|METL9_HUMAN	Isoform 2 of Methyltransferase-like protein 9 OS=Homo sapiens OX=9606 GN=METTL9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	161-UNIMOD:188	0.04	31.0	1	1	1
PRT	sp|P16144-4|ITB4_HUMAN	Isoform Beta-4D of Integrin beta-4 OS=Homo sapiens OX=9606 GN=ITGB4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	1072-UNIMOD:267,1636-UNIMOD:188	0.02	31.0	3	2	1
PRT	sp|O14763-2|TR10B_HUMAN	Isoform Short of Tumor necrosis factor receptor superfamily member 10B OS=Homo sapiens OX=9606 GN=TNFRSF10B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	310-UNIMOD:267	0.04	31.0	2	1	0
PRT	sp|Q9NW08-2|RPC2_HUMAN	Isoform 2 of DNA-directed RNA polymerase III subunit RPC2 OS=Homo sapiens OX=9606 GN=POLR3B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	103-UNIMOD:4,114-UNIMOD:188	0.01	31.0	2	1	0
PRT	sp|O15118-2|NPC1_HUMAN	Isoform 2 of NPC intracellular cholesterol transporter 1 OS=Homo sapiens OX=9606 GN=NPC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	408-UNIMOD:267	0.01	31.0	2	1	0
PRT	sp|Q01518-2|CAP1_HUMAN	Isoform 2 of Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	112-UNIMOD:188,355-UNIMOD:4	0.05	31.0	3	2	1
PRT	sp|Q15075|EEA1_HUMAN	Early endosome antigen 1 OS=Homo sapiens OX=9606 GN=EEA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.01	31.0	1	1	1
PRT	sp|Q5UIP0-2|RIF1_HUMAN	Isoform 2 of Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	2389-UNIMOD:188,312-UNIMOD:4,315-UNIMOD:188	0.01	31.0	2	2	1
PRT	sp|Q8N138-4|ORML3_HUMAN	Isoform 2 of ORM1-like protein 3 OS=Homo sapiens OX=9606 GN=ORMDL3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	1-UNIMOD:1,15-UNIMOD:267	0.12	31.0	1	1	1
PRT	sp|P55036|PSMD4_HUMAN	26S proteasome non-ATPase regulatory subunit 4 OS=Homo sapiens OX=9606 GN=PSMD4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	365-UNIMOD:188,272-UNIMOD:267	0.06	31.0	3	2	1
PRT	sp|P01130-2|LDLR_HUMAN	Isoform 2 of Low-density lipoprotein receptor OS=Homo sapiens OX=9606 GN=LDLR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	652-UNIMOD:188,211-UNIMOD:4,213-UNIMOD:4	0.05	31.0	3	2	1
PRT	sp|P45973|CBX5_HUMAN	Chromobox protein homolog 5 OS=Homo sapiens OX=9606 GN=CBX5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	59-UNIMOD:4,68-UNIMOD:188	0.07	31.0	2	1	0
PRT	sp|Q9Y6E0-2|STK24_HUMAN	Isoform A of Serine/threonine-protein kinase 24 OS=Homo sapiens OX=9606 GN=STK24	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	349-UNIMOD:267	0.03	31.0	1	1	1
PRT	sp|Q00653-3|NFKB2_HUMAN	Isoform 3 of Nuclear factor NF-kappa-B p100 subunit OS=Homo sapiens OX=9606 GN=NFKB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	114-UNIMOD:4,120-UNIMOD:4,127-UNIMOD:188	0.04	31.0	1	1	1
PRT	sp|Q7L5N1|CSN6_HUMAN	COP9 signalosome complex subunit 6 OS=Homo sapiens OX=9606 GN=COPS6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	143-UNIMOD:4,153-UNIMOD:188	0.04	31.0	2	1	0
PRT	sp|P46060|RAGP1_HUMAN	Ran GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RANGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	274-UNIMOD:4,251-UNIMOD:188,26-UNIMOD:188	0.07	31.0	5	3	1
PRT	sp|Q9NVM9-2|INT13_HUMAN	Isoform 2 of Integrator complex subunit 13 OS=Homo sapiens OX=9606 GN=INTS13	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	305-UNIMOD:4	0.03	31.0	1	1	1
PRT	sp|O60437|PEPL_HUMAN	Periplakin OS=Homo sapiens OX=9606 GN=PPL PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	587-UNIMOD:267	0.01	31.0	1	1	1
PRT	sp|Q5JTZ9|SYAM_HUMAN	Alanine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=AARS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	790-UNIMOD:267	0.04	31.0	3	3	3
PRT	sp|P53992|SC24C_HUMAN	Protein transport protein Sec24C OS=Homo sapiens OX=9606 GN=SEC24C PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	969-UNIMOD:267	0.03	31.0	3	2	1
PRT	sp|P20339-2|RAB5A_HUMAN	Isoform 2 of Ras-related protein Rab-5A OS=Homo sapiens OX=9606 GN=RAB5A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	181-UNIMOD:267,120-UNIMOD:188	0.27	31.0	7	4	0
PRT	sp|Q9NR45|SIAS_HUMAN	Sialic acid synthase OS=Homo sapiens OX=9606 GN=NANS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	145-UNIMOD:188,333-UNIMOD:188,283-UNIMOD:4,287-UNIMOD:4,290-UNIMOD:188	0.12	31.0	8	3	0
PRT	sp|Q92979|NEP1_HUMAN	Ribosomal RNA small subunit methyltransferase NEP1 OS=Homo sapiens OX=9606 GN=EMG1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	125-UNIMOD:267	0.11	31.0	3	2	1
PRT	sp|O43395|PRPF3_HUMAN	U4/U6 small nuclear ribonucleoprotein Prp3 OS=Homo sapiens OX=9606 GN=PRPF3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	37-UNIMOD:4	0.05	31.0	2	2	2
PRT	sp|Q9BQ67|GRWD1_HUMAN	Glutamate-rich WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=GRWD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	172-UNIMOD:188	0.04	31.0	2	1	0
PRT	sp|Q9BR76|COR1B_HUMAN	Coronin-1B OS=Homo sapiens OX=9606 GN=CORO1B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	41-UNIMOD:4	0.05	31.0	2	2	2
PRT	sp|Q9HCC0-2|MCCB_HUMAN	Isoform 2 of Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Homo sapiens OX=9606 GN=MCCC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	500-UNIMOD:267	0.03	31.0	2	1	0
PRT	sp|Q16629-3|SRSF7_HUMAN	Isoform 3 of Serine/arginine-rich splicing factor 7 OS=Homo sapiens OX=9606 GN=SRSF7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	24-UNIMOD:188	0.10	31.0	2	1	0
PRT	sp|Q86XL3-2|ANKL2_HUMAN	Isoform 2 of Ankyrin repeat and LEM domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ANKLE2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	350-UNIMOD:4,351-UNIMOD:267	0.03	31.0	1	1	1
PRT	sp|Q15006|EMC2_HUMAN	ER membrane protein complex subunit 2 OS=Homo sapiens OX=9606 GN=EMC2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	212-UNIMOD:267	0.05	31.0	2	1	0
PRT	sp|P60709|ACTB_HUMAN	Actin, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=ACTB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	31.0	null	360-UNIMOD:28,372-UNIMOD:267,206-UNIMOD:267	0.07	31.0	4	2	0
PRT	sp|Q9C075|K1C23_HUMAN	Keratin, type I cytoskeletal 23 OS=Homo sapiens OX=9606 GN=KRT23 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	321-UNIMOD:267,314-UNIMOD:35,413-UNIMOD:4,420-UNIMOD:188,409-UNIMOD:267	0.09	31.0	4	3	2
PRT	sp|P49419|AL7A1_HUMAN	Alpha-aminoadipic semialdehyde dehydrogenase OS=Homo sapiens OX=9606 GN=ALDH7A1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	null	376-UNIMOD:28,389-UNIMOD:188,390-UNIMOD:188	0.03	31.0	2	1	0
PRT	sp|Q96C19|EFHD2_HUMAN	EF-hand domain-containing protein D2 OS=Homo sapiens OX=9606 GN=EFHD2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	null	103-UNIMOD:28,108-UNIMOD:267,118-UNIMOD:188	0.07	31.0	2	1	0
PRT	sp|Q96CW1|AP2M1_HUMAN	AP-2 complex subunit mu OS=Homo sapiens OX=9606 GN=AP2M1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	null	239-UNIMOD:28,246-UNIMOD:4,251-UNIMOD:4,253-UNIMOD:267	0.04	31.0	2	1	0
PRT	sp|P49748|ACADV_HUMAN	Very long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADVL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	331-UNIMOD:188	0.02	31.0	1	1	0
PRT	sp|P20585|MSH3_HUMAN	DNA mismatch repair protein Msh3 OS=Homo sapiens OX=9606 GN=MSH3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	null	166-UNIMOD:385,166-UNIMOD:4,178-UNIMOD:188	0.01	31.0	2	1	0
PRT	sp|Q96JB5|CK5P3_HUMAN	CDK5 regulatory subunit-associated protein 3 OS=Homo sapiens OX=9606 GN=CDK5RAP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	350-UNIMOD:267	0.03	31.0	1	1	0
PRT	sp|Q8NI60|COQ8A_HUMAN	Atypical kinase COQ8A, mitochondrial OS=Homo sapiens OX=9606 GN=COQ8A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|Q9NZW5|MPP6_HUMAN	MAGUK p55 subfamily member 6 OS=Homo sapiens OX=9606 GN=MPP6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|Q9Y5X2|SNX8_HUMAN	Sorting nexin-8 OS=Homo sapiens OX=9606 GN=SNX8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	258-UNIMOD:188	0.03	30.0	2	1	0
PRT	sp|P60900-2|PSA6_HUMAN	Isoform 2 of Proteasome subunit alpha type-6 OS=Homo sapiens OX=9606 GN=PSMA6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	24-UNIMOD:267	0.06	30.0	2	1	0
PRT	sp|Q9BQB6-3|VKOR1_HUMAN	Isoform 3 of Vitamin K epoxide reductase complex subunit 1 OS=Homo sapiens OX=9606 GN=VKORC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	43-UNIMOD:4,51-UNIMOD:4	0.15	30.0	1	1	1
PRT	sp|Q5T8P6-6|RBM26_HUMAN	Isoform 6 of RNA-binding protein 26 OS=Homo sapiens OX=9606 GN=RBM26	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	53-UNIMOD:4,63-UNIMOD:188	0.12	30.0	3	1	0
PRT	sp|P50579|MAP2_HUMAN	Methionine aminopeptidase 2 OS=Homo sapiens OX=9606 GN=METAP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	170-UNIMOD:267,121-UNIMOD:4,436-UNIMOD:4,448-UNIMOD:4,131-UNIMOD:188	0.12	30.0	4	3	2
PRT	sp|Q9NZZ3-2|CHMP5_HUMAN	Isoform 2 of Charged multivesicular body protein 5 OS=Homo sapiens OX=9606 GN=CHMP5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	20-UNIMOD:4,27-UNIMOD:267	0.10	30.0	2	1	0
PRT	sp|Q9NNW5|WDR6_HUMAN	WD repeat-containing protein 6 OS=Homo sapiens OX=9606 GN=WDR6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	26-UNIMOD:4,30-UNIMOD:267	0.02	30.0	1	1	1
PRT	sp|Q9UKU7-2|ACAD8_HUMAN	Isoform 2 of Isobutyryl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACAD8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	124-UNIMOD:4,131-UNIMOD:267	0.05	30.0	1	1	1
PRT	sp|Q96A65-2|EXOC4_HUMAN	Isoform 2 of Exocyst complex component 4 OS=Homo sapiens OX=9606 GN=EXOC4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.04	30.0	1	1	1
PRT	sp|Q12965|MYO1E_HUMAN	Unconventional myosin-Ie OS=Homo sapiens OX=9606 GN=MYO1E PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	160-UNIMOD:188	0.03	30.0	2	2	2
PRT	sp|Q9H4A3-2|WNK1_HUMAN	Isoform 2 of Serine/threonine-protein kinase WNK1 OS=Homo sapiens OX=9606 GN=WNK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	1609-UNIMOD:188	0.01	30.0	3	2	0
PRT	sp|P01893|HLAH_HUMAN	Putative HLA class I histocompatibility antigen, alpha chain H OS=Homo sapiens OX=9606 GN=HLA-H PE=5 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	59-UNIMOD:267	0.04	30.0	1	1	1
PRT	sp|Q8N392-2|RHG18_HUMAN	Isoform 2 of Rho GTPase-activating protein 18 OS=Homo sapiens OX=9606 GN=ARHGAP18	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|P43243|MATR3_HUMAN	Matrin-3 OS=Homo sapiens OX=9606 GN=MATR3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	120-UNIMOD:267,806-UNIMOD:4,542-UNIMOD:267	0.05	30.0	3	3	3
PRT	sp|P00441|SODC_HUMAN	Superoxide dismutase [Cu-Zn] OS=Homo sapiens OX=9606 GN=SOD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	24-UNIMOD:188	0.10	30.0	1	1	1
PRT	sp|Q9NZM1-2|MYOF_HUMAN	Isoform 2 of Myoferlin OS=Homo sapiens OX=9606 GN=MYOF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	138-UNIMOD:267	0.01	30.0	3	2	1
PRT	sp|P04083|ANXA1_HUMAN	Annexin A1 OS=Homo sapiens OX=9606 GN=ANXA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	228-UNIMOD:267,124-UNIMOD:267,144-UNIMOD:267	0.13	30.0	5	3	2
PRT	sp|Q13442|HAP28_HUMAN	28 kDa heat- and acid-stable phosphoprotein OS=Homo sapiens OX=9606 GN=PDAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	88-UNIMOD:267	0.08	30.0	1	1	1
PRT	sp|Q9Y2L1-2|RRP44_HUMAN	Isoform 2 of Exosome complex exonuclease RRP44 OS=Homo sapiens OX=9606 GN=DIS3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	519-UNIMOD:4	0.03	30.0	2	2	2
PRT	sp|P50416-2|CPT1A_HUMAN	Isoform 2 of Carnitine O-palmitoyltransferase 1, liver isoform OS=Homo sapiens OX=9606 GN=CPT1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	379-UNIMOD:267	0.02	30.0	2	1	0
PRT	sp|Q07020-2|RL18_HUMAN	Isoform 2 of 60S ribosomal protein L18 OS=Homo sapiens OX=9606 GN=RPL18	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.09	30.0	2	1	0
PRT	sp|O60294|TYW4_HUMAN	tRNA wybutosine-synthesizing protein 4 OS=Homo sapiens OX=9606 GN=LCMT2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	534-UNIMOD:267	0.02	30.0	1	1	1
PRT	sp|Q7Z3T8|ZFY16_HUMAN	Zinc finger FYVE domain-containing protein 16 OS=Homo sapiens OX=9606 GN=ZFYVE16 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	1032-UNIMOD:188	0.01	30.0	2	1	0
PRT	sp|Q9Y3B4|SF3B6_HUMAN	Splicing factor 3B subunit 6 OS=Homo sapiens OX=9606 GN=SF3B6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.10	30.0	1	1	1
PRT	sp|Q2PPJ7-3|RGPA2_HUMAN	Isoform 3 of Ral GTPase-activating protein subunit alpha-2 OS=Homo sapiens OX=9606 GN=RALGAPA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|Q9NVN8|GNL3L_HUMAN	Guanine nucleotide-binding protein-like 3-like protein OS=Homo sapiens OX=9606 GN=GNL3L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	341-UNIMOD:267	0.03	30.0	2	1	0
PRT	sp|P62750|RL23A_HUMAN	60S ribosomal protein L23a OS=Homo sapiens OX=9606 GN=RPL23A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	152-UNIMOD:188	0.12	30.0	2	1	0
PRT	sp|Q96B54|ZN428_HUMAN	Zinc finger protein 428 OS=Homo sapiens OX=9606 GN=ZNF428 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	114-UNIMOD:4,115-UNIMOD:4,129-UNIMOD:267	0.10	30.0	1	1	1
PRT	sp|Q00796-2|DHSO_HUMAN	Isoform 2 of Sorbitol dehydrogenase OS=Homo sapiens OX=9606 GN=SORD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	38-UNIMOD:267	0.18	30.0	1	1	0
PRT	sp|Q5TDH0-2|DDI2_HUMAN	Isoform 2 of Protein DDI1 homolog 2 OS=Homo sapiens OX=9606 GN=DDI2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	205-UNIMOD:188	0.07	30.0	2	1	0
PRT	sp|O95834|EMAL2_HUMAN	Echinoderm microtubule-associated protein-like 2 OS=Homo sapiens OX=9606 GN=EML2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	341-UNIMOD:267	0.02	30.0	2	1	0
PRT	sp|Q8NBF2-2|NHLC2_HUMAN	Isoform 2 of NHL repeat-containing protein 2 OS=Homo sapiens OX=9606 GN=NHLRC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	250-UNIMOD:4	0.04	30.0	1	1	1
PRT	sp|Q15024|EXOS7_HUMAN	Exosome complex component RRP42 OS=Homo sapiens OX=9606 GN=EXOSC7 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	199-UNIMOD:4,204-UNIMOD:4,205-UNIMOD:188	0.05	30.0	1	1	1
PRT	sp|Q15185-2|TEBP_HUMAN	Isoform 2 of Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	40-UNIMOD:4,48-UNIMOD:188	0.11	30.0	2	1	0
PRT	sp|Q53T59|H1BP3_HUMAN	HCLS1-binding protein 3 OS=Homo sapiens OX=9606 GN=HS1BP3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	246-UNIMOD:267	0.05	30.0	1	1	1
PRT	sp|P16070-18|CD44_HUMAN	Isoform 18 of CD44 antigen OS=Homo sapiens OX=9606 GN=CD44	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	292-UNIMOD:267	0.04	30.0	1	1	0
PRT	sp|P63151|2ABA_HUMAN	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	117-UNIMOD:188,62-UNIMOD:188	0.06	30.0	3	2	1
PRT	sp|P35222|CTNB1_HUMAN	Catenin beta-1 OS=Homo sapiens OX=9606 GN=CTNNB1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	170-UNIMOD:188	0.04	30.0	2	2	2
PRT	sp|Q8IWJ2|GCC2_HUMAN	GRIP and coiled-coil domain-containing protein 2 OS=Homo sapiens OX=9606 GN=GCC2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	245-UNIMOD:188	0.01	30.0	1	1	1
PRT	sp|P13861-2|KAP2_HUMAN	Isoform 2 of cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	158-UNIMOD:267	0.05	30.0	2	1	0
PRT	sp|Q9H1K1-2|ISCU_HUMAN	Isoform 2 of Iron-sulfur cluster assembly enzyme ISCU, mitochondrial OS=Homo sapiens OX=9606 GN=ISCU	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	44-UNIMOD:4,49-UNIMOD:188	0.13	30.0	2	1	0
PRT	sp|O60884|DNJA2_HUMAN	DnaJ homolog subfamily A member 2 OS=Homo sapiens OX=9606 GN=DNAJA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	143-UNIMOD:4,146-UNIMOD:4,152-UNIMOD:188	0.03	30.0	2	1	0
PRT	sp|P42167-3|LAP2B_HUMAN	Isoform Zeta of Lamina-associated polypeptide 2, isoforms beta/gamma OS=Homo sapiens OX=9606 GN=TMPO	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	13-UNIMOD:188	0.05	30.0	2	1	0
PRT	sp|P35221|CTNA1_HUMAN	Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	357-UNIMOD:267,2-UNIMOD:1,300-UNIMOD:267,12-UNIMOD:188	0.05	30.0	5	3	1
PRT	sp|P42772-2|CDN2B_HUMAN	Isoform 2 of Cyclin-dependent kinase 4 inhibitor B OS=Homo sapiens OX=9606 GN=CDKN2B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.19	30.0	1	1	1
PRT	sp|Q9UIG0-2|BAZ1B_HUMAN	Isoform 2 of Tyrosine-protein kinase BAZ1B OS=Homo sapiens OX=9606 GN=BAZ1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	1041-UNIMOD:4,1052-UNIMOD:267	0.02	30.0	3	2	1
PRT	sp|O94855|SC24D_HUMAN	Protein transport protein Sec24D OS=Homo sapiens OX=9606 GN=SEC24D PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	780-UNIMOD:4	0.01	30.0	1	1	1
PRT	sp|P35613-3|BASI_HUMAN	Isoform 3 of Basigin OS=Homo sapiens OX=9606 GN=BSG	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	48-UNIMOD:188	0.09	30.0	2	1	0
PRT	sp|P28288-2|ABCD3_HUMAN	Isoform 2 of ATP-binding cassette sub-family D member 3 OS=Homo sapiens OX=9606 GN=ABCD3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	362-UNIMOD:4,367-UNIMOD:4,369-UNIMOD:188	0.03	30.0	2	1	0
PRT	sp|P53396|ACLY_HUMAN	ATP-citrate synthase OS=Homo sapiens OX=9606 GN=ACLY PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	676-UNIMOD:267,97-UNIMOD:188	0.02	30.0	4	2	0
PRT	sp|Q9H299|SH3L3_HUMAN	SH3 domain-binding glutamic acid-rich-like protein 3 OS=Homo sapiens OX=9606 GN=SH3BGRL3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:1	0.16	30.0	1	1	1
PRT	sp|Q9H0S4-2|DDX47_HUMAN	Isoform 2 of Probable ATP-dependent RNA helicase DDX47 OS=Homo sapiens OX=9606 GN=DDX47	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	276-UNIMOD:267	0.03	30.0	1	1	0
PRT	sp|P24534|EF1B_HUMAN	Elongation factor 1-beta OS=Homo sapiens OX=9606 GN=EEF1B2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	176-UNIMOD:188	0.06	30.0	3	1	0
PRT	sp|Q9NV31|IMP3_HUMAN	U3 small nucleolar ribonucleoprotein protein IMP3 OS=Homo sapiens OX=9606 GN=IMP3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.08	30.0	1	1	1
PRT	sp|Q9UJS0|CMC2_HUMAN	Calcium-binding mitochondrial carrier protein Aralar2 OS=Homo sapiens OX=9606 GN=SLC25A13 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	467-UNIMOD:267	0.07	30.0	3	3	3
PRT	sp|Q9NX40-3|OCAD1_HUMAN	Isoform 3 of OCIA domain-containing protein 1 OS=Homo sapiens OX=9606 GN=OCIAD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	55-UNIMOD:35,64-UNIMOD:188	0.10	30.0	3	1	0
PRT	sp|P04439|HLAA_HUMAN	HLA class I histocompatibility antigen, A alpha chain OS=Homo sapiens OX=9606 GN=HLA-A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	68-UNIMOD:267	0.07	30.0	3	2	1
PRT	sp|P49368-2|TCPG_HUMAN	Isoform 2 of T-complex protein 1 subunit gamma OS=Homo sapiens OX=9606 GN=CCT3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	480-UNIMOD:267,417-UNIMOD:4,423-UNIMOD:267,411-UNIMOD:267	0.07	30.0	6	3	0
PRT	sp|O94903|PLPHP_HUMAN	Pyridoxal phosphate homeostasis protein OS=Homo sapiens OX=9606 GN=PLPBP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	76-UNIMOD:188	0.05	30.0	2	1	0
PRT	sp|P49711|CTCF_HUMAN	Transcriptional repressor CTCF OS=Homo sapiens OX=9606 GN=CTCF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	268-UNIMOD:4,271-UNIMOD:4,275-UNIMOD:4	0.02	30.0	1	1	1
PRT	sp|P55786-2|PSA_HUMAN	Isoform 2 of Puromycin-sensitive aminopeptidase OS=Homo sapiens OX=9606 GN=NPEPPS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	807-UNIMOD:4,808-UNIMOD:4,819-UNIMOD:188,111-UNIMOD:188,783-UNIMOD:188	0.05	30.0	5	3	1
PRT	sp|Q96A35|RM24_HUMAN	39S ribosomal protein L24, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL24 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	205-UNIMOD:188	0.06	30.0	2	1	0
PRT	sp|Q06787-8|FMR1_HUMAN	Isoform 8 of Synaptic functional regulator FMR1 OS=Homo sapiens OX=9606 GN=FMR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	558-UNIMOD:267	0.02	30.0	1	1	1
PRT	sp|Q14152|EIF3A_HUMAN	Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens OX=9606 GN=EIF3A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	502-UNIMOD:267,351-UNIMOD:188,532-UNIMOD:188,23-UNIMOD:188,489-UNIMOD:267	0.04	30.0	7	5	3
PRT	sp|Q9BW27-2|NUP85_HUMAN	Isoform 2 of Nuclear pore complex protein Nup85 OS=Homo sapiens OX=9606 GN=NUP85	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.04	30.0	1	1	1
PRT	sp|Q8NFH3|NUP43_HUMAN	Nucleoporin Nup43 OS=Homo sapiens OX=9606 GN=NUP43 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	196-UNIMOD:188	0.04	30.0	2	1	0
PRT	sp|Q7L5N7|PCAT2_HUMAN	Lysophosphatidylcholine acyltransferase 2 OS=Homo sapiens OX=9606 GN=LPCAT2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	223-UNIMOD:4,226-UNIMOD:267	0.04	30.0	1	1	1
PRT	sp|Q9Y305-3|ACOT9_HUMAN	Isoform 3 of Acyl-coenzyme A thioesterase 9, mitochondrial OS=Homo sapiens OX=9606 GN=ACOT9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.04	30.0	1	1	1
PRT	sp|Q5JSH3-3|WDR44_HUMAN	Isoform 3 of WD repeat-containing protein 44 OS=Homo sapiens OX=9606 GN=WDR44	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|P51610-2|HCFC1_HUMAN	Isoform 2 of Host cell factor 1 OS=Homo sapiens OX=9606 GN=HCFC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	539-UNIMOD:267	0.01	30.0	1	1	1
PRT	sp|P61247|RS3A_HUMAN	40S ribosomal protein S3a OS=Homo sapiens OX=9606 GN=RPS3A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	252-UNIMOD:267	0.06	30.0	1	1	1
PRT	sp|Q9NX58|LYAR_HUMAN	Cell growth-regulating nucleolar protein OS=Homo sapiens OX=9606 GN=LYAR PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	6-UNIMOD:4,9-UNIMOD:4,14-UNIMOD:188,109-UNIMOD:267	0.08	30.0	4	2	0
PRT	sp|Q06265|EXOS9_HUMAN	Exosome complex component RRP45 OS=Homo sapiens OX=9606 GN=EXOSC9 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	61-UNIMOD:4,67-UNIMOD:188,267-UNIMOD:188	0.06	30.0	4	2	0
PRT	sp|Q15717|ELAV1_HUMAN	ELAV-like protein 1 OS=Homo sapiens OX=9606 GN=ELAVL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	147-UNIMOD:267	0.07	30.0	3	2	1
PRT	sp|Q9BV57|MTND_HUMAN	1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase OS=Homo sapiens OX=9606 GN=ADI1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	15-UNIMOD:267	0.08	30.0	2	1	0
PRT	sp|Q86WQ0|NR2CA_HUMAN	Nuclear receptor 2C2-associated protein OS=Homo sapiens OX=9606 GN=NR2C2AP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	126-UNIMOD:267,2-UNIMOD:1,7-UNIMOD:4,13-UNIMOD:267	0.19	30.0	3	2	1
PRT	sp|O75489|NDUS3_HUMAN	NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	231-UNIMOD:267	0.05	30.0	2	1	0
PRT	sp|P62491-2|RB11A_HUMAN	Isoform 2 of Ras-related protein Rab-11A OS=Homo sapiens OX=9606 GN=RAB11A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	24-UNIMOD:188,72-UNIMOD:267,2-UNIMOD:1	0.23	30.0	4	3	2
PRT	sp|P84103-2|SRSF3_HUMAN	Isoform 2 of Serine/arginine-rich splicing factor 3 OS=Homo sapiens OX=9606 GN=SRSF3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.10	30.0	1	1	0
PRT	sp|Q12840|KIF5A_HUMAN	Kinesin heavy chain isoform 5A OS=Homo sapiens OX=9606 GN=KIF5A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	842-UNIMOD:188	0.01	30.0	1	1	0
PRT	sp|O00429|DNM1L_HUMAN	Dynamin-1-like protein OS=Homo sapiens OX=9606 GN=DNM1L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	706-UNIMOD:35,709-UNIMOD:267	0.02	30.0	1	1	0
PRT	sp|P45974|UBP5_HUMAN	Ubiquitin carboxyl-terminal hydrolase 5 OS=Homo sapiens OX=9606 GN=USP5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	null	511-UNIMOD:28,516-UNIMOD:188,524-UNIMOD:267	0.02	30.0	2	1	0
PRT	sp|P46013|KI67_HUMAN	Proliferation marker protein Ki-67 OS=Homo sapiens OX=9606 GN=MKI67 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	null	3014-UNIMOD:385,3014-UNIMOD:4,3029-UNIMOD:188,3030-UNIMOD:188,1440-UNIMOD:28,1441-UNIMOD:188,1452-UNIMOD:188	0.01	30.0	2	2	2
PRT	sp|P31943|HNRH1_HUMAN	Heterogeneous nuclear ribonucleoprotein H OS=Homo sapiens OX=9606 GN=HNRNPH1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	30.0	null	14-UNIMOD:188,316-UNIMOD:267	0.07	30.0	7	2	0
PRT	sp|Q86XP3|DDX42_HUMAN	ATP-dependent RNA helicase DDX42 OS=Homo sapiens OX=9606 GN=DDX42 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null		0.04	30.0	1	1	0
PRT	sp|P47897|SYQ_HUMAN	Glutamine--tRNA ligase OS=Homo sapiens OX=9606 GN=QARS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	601-UNIMOD:188	0.02	30.0	1	1	0
PRT	sp|Q9H081|MIS12_HUMAN	Protein MIS12 homolog OS=Homo sapiens OX=9606 GN=MIS12 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	null	136-UNIMOD:28	0.08	30.0	1	1	1
PRT	sp|Q92900|RENT1_HUMAN	Regulator of nonsense transcripts 1 OS=Homo sapiens OX=9606 GN=UPF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	null	311-UNIMOD:188	0.02	30.0	1	1	0
PRT	sp|Q8IWS0|PHF6_HUMAN	PHD finger protein 6 OS=Homo sapiens OX=9606 GN=PHF6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null		0.05	30.0	1	1	1
PRT	sp|P82650|RT22_HUMAN	28S ribosomal protein S22, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS22 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null		0.04	30.0	1	1	0
PRT	sp|Q12834|CDC20_HUMAN	Cell division cycle protein 20 homolog OS=Homo sapiens OX=9606 GN=CDC20 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	97-UNIMOD:188	0.03	30.0	1	1	1
PRT	sp|P05067|A4_HUMAN	Amyloid-beta precursor protein OS=Homo sapiens OX=9606 GN=APP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	null	117-UNIMOD:385,117-UNIMOD:4,133-UNIMOD:4	0.02	30.0	1	1	1
PRT	sp|Q9NX40|OCAD1_HUMAN	OCIA domain-containing protein 1 OS=Homo sapiens OX=9606 GN=OCIAD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null		0.08	30.0	1	1	0
PRT	sp|P46783|RS10_HUMAN	40S ribosomal protein S10 OS=Homo sapiens OX=9606 GN=RPS10 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.09	29.0	1	1	0
PRT	sp|Q9UHD1|CHRD1_HUMAN	Cysteine and histidine-rich domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CHORDC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	321-UNIMOD:188,59-UNIMOD:4,61-UNIMOD:188	0.10	29.0	4	2	0
PRT	sp|P20618|PSB1_HUMAN	Proteasome subunit beta type-1 OS=Homo sapiens OX=9606 GN=PSMB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	184-UNIMOD:188	0.09	29.0	1	1	1
PRT	sp|Q9NRX4|PHP14_HUMAN	14 kDa phosphohistidine phosphatase OS=Homo sapiens OX=9606 GN=PHPT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	112-UNIMOD:188,69-UNIMOD:4,71-UNIMOD:4,73-UNIMOD:4,78-UNIMOD:267	0.23	29.0	4	2	0
PRT	sp|Q02241-3|KIF23_HUMAN	Isoform 3 of Kinesin-like protein KIF23 OS=Homo sapiens OX=9606 GN=KIF23	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	353-UNIMOD:188,416-UNIMOD:188	0.04	29.0	3	2	1
PRT	sp|P56537|IF6_HUMAN	Eukaryotic translation initiation factor 6 OS=Homo sapiens OX=9606 GN=EIF6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	11-UNIMOD:4,15-UNIMOD:4,18-UNIMOD:188,95-UNIMOD:267	0.11	29.0	3	2	1
PRT	sp|Q9H2U1-3|DHX36_HUMAN	Isoform 3 of ATP-dependent DNA/RNA helicase DHX36 OS=Homo sapiens OX=9606 GN=DHX36	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	633-UNIMOD:267	0.02	29.0	2	1	0
PRT	sp|P56134-3|ATPK_HUMAN	Isoform 3 of ATP synthase subunit f, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5MF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1,7-UNIMOD:4,14-UNIMOD:188,16-UNIMOD:188	0.29	29.0	2	1	0
PRT	sp|P50395|GDIB_HUMAN	Rab GDP dissociation inhibitor beta OS=Homo sapiens OX=9606 GN=GDI2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	379-UNIMOD:188,402-UNIMOD:267,279-UNIMOD:28,282-UNIMOD:4	0.09	29.0	5	3	1
PRT	sp|Q9BQ52-4|RNZ2_HUMAN	Isoform 4 of Zinc phosphodiesterase ELAC protein 2 OS=Homo sapiens OX=9606 GN=ELAC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	381-UNIMOD:4,384-UNIMOD:188	0.02	29.0	2	1	0
PRT	sp|Q9H9E3-3|COG4_HUMAN	Isoform 3 of Conserved oligomeric Golgi complex subunit 4 OS=Homo sapiens OX=9606 GN=COG4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	292-UNIMOD:267,512-UNIMOD:188	0.04	29.0	3	2	1
PRT	sp|O43795|MYO1B_HUMAN	Unconventional myosin-Ib OS=Homo sapiens OX=9606 GN=MYO1B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	156-UNIMOD:188	0.02	29.0	2	1	0
PRT	sp|P62333|PRS10_HUMAN	26S proteasome regulatory subunit 10B OS=Homo sapiens OX=9606 GN=PSMC6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	161-UNIMOD:267	0.04	29.0	2	1	0
PRT	sp|P23396|RS3_HUMAN	40S ribosomal protein S3 OS=Homo sapiens OX=9606 GN=RPS3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	90-UNIMOD:188,27-UNIMOD:267	0.10	29.0	3	2	1
PRT	sp|P30044-4|PRDX5_HUMAN	Isoform 4 of Peroxiredoxin-5, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	102-UNIMOD:188	0.10	29.0	3	1	0
PRT	sp|P18031|PTN1_HUMAN	Tyrosine-protein phosphatase non-receptor type 1 OS=Homo sapiens OX=9606 GN=PTPN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	279-UNIMOD:188	0.03	29.0	1	1	1
PRT	sp|O75526|RMXL2_HUMAN	RNA-binding motif protein, X-linked-like-2 OS=Homo sapiens OX=9606 GN=RBMXL2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	1	1	0
PRT	sp|P53999|TCP4_HUMAN	Activated RNA polymerase II transcriptional coactivator p15 OS=Homo sapiens OX=9606 GN=SUB1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	114-UNIMOD:188,54-UNIMOD:28,63-UNIMOD:35	0.24	29.0	3	2	1
PRT	sp|Q12913|PTPRJ_HUMAN	Receptor-type tyrosine-protein phosphatase eta OS=Homo sapiens OX=9606 GN=PTPRJ PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|Q9H6T3|RPAP3_HUMAN	RNA polymerase II-associated protein 3 OS=Homo sapiens OX=9606 GN=RPAP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|P55884|EIF3B_HUMAN	Eukaryotic translation initiation factor 3 subunit B OS=Homo sapiens OX=9606 GN=EIF3B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	548-UNIMOD:267	0.02	29.0	1	1	1
PRT	sp|Q13813-3|SPTN1_HUMAN	Isoform 3 of Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	1599-UNIMOD:267,1538-UNIMOD:267	0.01	29.0	3	2	1
PRT	sp|Q96QD9-3|UIF_HUMAN	Isoform 3 of UAP56-interacting factor OS=Homo sapiens OX=9606 GN=FYTTD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	218-UNIMOD:188	0.06	29.0	1	1	1
PRT	sp|Q01105-3|SET_HUMAN	Isoform 3 of Protein SET OS=Homo sapiens OX=9606 GN=SET	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.06	29.0	1	1	1
PRT	sp|O60879-2|DIAP2_HUMAN	Isoform 2 of Protein diaphanous homolog 2 OS=Homo sapiens OX=9606 GN=DIAPH2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	655-UNIMOD:4,659-UNIMOD:267	0.01	29.0	2	1	0
PRT	sp|P20700|LMNB1_HUMAN	Lamin-B1 OS=Homo sapiens OX=9606 GN=LMNB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	29.0	null	198-UNIMOD:4,208-UNIMOD:267,198-UNIMOD:385,330-UNIMOD:188,209-UNIMOD:188,312-UNIMOD:188	0.09	29.0	9	5	1
PRT	sp|O43175|SERA_HUMAN	D-3-phosphoglycerate dehydrogenase OS=Homo sapiens OX=9606 GN=PHGDH PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	33-UNIMOD:188,18-UNIMOD:4,19-UNIMOD:4,20-UNIMOD:267,247-UNIMOD:267	0.07	29.0	5	3	1
PRT	sp|Q9UQ80-2|PA2G4_HUMAN	Isoform 2 of Proliferation-associated protein 2G4 OS=Homo sapiens OX=9606 GN=PA2G4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	290-UNIMOD:188	0.04	29.0	3	1	0
PRT	sp|Q14194|DPYL1_HUMAN	Dihydropyrimidinase-related protein 1 OS=Homo sapiens OX=9606 GN=CRMP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	463-UNIMOD:188	0.02	29.0	2	1	0
PRT	sp|P28072|PSB6_HUMAN	Proteasome subunit beta type-6 OS=Homo sapiens OX=9606 GN=PSMB6 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	220-UNIMOD:267,230-UNIMOD:188	0.09	29.0	4	2	1
PRT	sp|Q13951|PEBB_HUMAN	Core-binding factor subunit beta OS=Homo sapiens OX=9606 GN=CBFB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	124-UNIMOD:4	0.08	29.0	1	1	1
PRT	sp|Q9C0C9|UBE2O_HUMAN	(E3-independent) E2 ubiquitin-conjugating enzyme OS=Homo sapiens OX=9606 GN=UBE2O PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	182-UNIMOD:4	0.01	29.0	1	1	1
PRT	sp|P55769|NH2L1_HUMAN	NHP2-like protein 1 OS=Homo sapiens OX=9606 GN=SNU13 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	30-UNIMOD:4,33-UNIMOD:188,125-UNIMOD:267	0.20	29.0	4	2	0
PRT	sp|Q15057|ACAP2_HUMAN	Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ACAP2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	468-UNIMOD:4,477-UNIMOD:267,465-UNIMOD:188	0.03	29.0	3	2	1
PRT	sp|P10301|RRAS_HUMAN	Ras-related protein R-Ras OS=Homo sapiens OX=9606 GN=RRAS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	188-UNIMOD:267	0.06	29.0	2	1	0
PRT	sp|Q9NS69|TOM22_HUMAN	Mitochondrial import receptor subunit TOM22 homolog OS=Homo sapiens OX=9606 GN=TOMM22 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	117-UNIMOD:267	0.09	29.0	2	1	0
PRT	sp|Q96QK1|VPS35_HUMAN	Vacuolar protein sorting-associated protein 35 OS=Homo sapiens OX=9606 GN=VPS35 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	237-UNIMOD:267	0.02	29.0	4	1	0
PRT	sp|P50914|RL14_HUMAN	60S ribosomal protein L14 OS=Homo sapiens OX=9606 GN=RPL14 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	75-UNIMOD:28	0.12	29.0	2	2	2
PRT	sp|P13995-2|MTDC_HUMAN	Isoform 2 of Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=MTHFD2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	197-UNIMOD:267	0.05	29.0	2	1	0
PRT	sp|Q16718-2|NDUA5_HUMAN	Isoform 2 of NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 OS=Homo sapiens OX=9606 GN=NDUFA5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.23	29.0	2	2	2
PRT	sp|O75534-2|CSDE1_HUMAN	Isoform 2 of Cold shock domain-containing protein E1 OS=Homo sapiens OX=9606 GN=CSDE1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	738-UNIMOD:267	0.02	29.0	1	1	1
PRT	sp|P30153|2AAA_HUMAN	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R1A PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	174-UNIMOD:4,182-UNIMOD:267	0.02	29.0	2	1	0
PRT	sp|Q7Z417|NUFP2_HUMAN	Nuclear fragile X mental retardation-interacting protein 2 OS=Homo sapiens OX=9606 GN=NUFIP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	122-UNIMOD:267	0.02	29.0	2	1	0
PRT	sp|P62834|RAP1A_HUMAN	Ras-related protein Rap-1A OS=Homo sapiens OX=9606 GN=RAP1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	139-UNIMOD:4,141-UNIMOD:4,149-UNIMOD:188	0.08	29.0	2	1	0
PRT	sp|Q9Y4W2-4|LAS1L_HUMAN	Isoform 4 of Ribosomal biogenesis protein LAS1L OS=Homo sapiens OX=9606 GN=LAS1L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	96-UNIMOD:267	0.06	29.0	2	1	0
PRT	sp|P47756-2|CAPZB_HUMAN	Isoform 2 of F-actin-capping protein subunit beta OS=Homo sapiens OX=9606 GN=CAPZB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.10	29.0	2	2	2
PRT	sp|P61201|CSN2_HUMAN	COP9 signalosome complex subunit 2 OS=Homo sapiens OX=9606 GN=COPS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	123-UNIMOD:188	0.03	29.0	2	1	0
PRT	sp|O43813|LANC1_HUMAN	Glutathione S-transferase LANCL1 OS=Homo sapiens OX=9606 GN=LANCL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	27-UNIMOD:267	0.03	29.0	2	1	0
PRT	sp|O94832|MYO1D_HUMAN	Unconventional myosin-Id OS=Homo sapiens OX=9606 GN=MYO1D PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	143-UNIMOD:4,152-UNIMOD:188,994-UNIMOD:188	0.02	29.0	3	2	1
PRT	sp|P06132|DCUP_HUMAN	Uroporphyrinogen decarboxylase OS=Homo sapiens OX=9606 GN=UROD PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	65-UNIMOD:4,66-UNIMOD:4,74-UNIMOD:267	0.04	29.0	2	1	0
PRT	sp|Q9UBK9|UXT_HUMAN	Protein UXT OS=Homo sapiens OX=9606 GN=UXT PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	126-UNIMOD:188	0.09	29.0	1	1	1
PRT	sp|P46821|MAP1B_HUMAN	Microtubule-associated protein 1B OS=Homo sapiens OX=9606 GN=MAP1B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	414-UNIMOD:188,190-UNIMOD:4,197-UNIMOD:188	0.01	29.0	2	2	2
PRT	sp|P46776|RL27A_HUMAN	60S ribosomal protein L27a OS=Homo sapiens OX=9606 GN=RPL27A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	105-UNIMOD:267	0.08	29.0	2	1	0
PRT	sp|P49441|INPP_HUMAN	Inositol polyphosphate 1-phosphatase OS=Homo sapiens OX=9606 GN=INPP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	62-UNIMOD:188	0.03	29.0	2	1	0
PRT	sp|P29992|GNA11_HUMAN	Guanine nucleotide-binding protein subunit alpha-11 OS=Homo sapiens OX=9606 GN=GNA11 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	144-UNIMOD:4	0.04	29.0	1	1	1
PRT	sp|Q5T1C6|THEM4_HUMAN	Acyl-coenzyme A thioesterase THEM4 OS=Homo sapiens OX=9606 GN=THEM4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.05	29.0	1	1	1
PRT	sp|P23284|PPIB_HUMAN	Peptidyl-prolyl cis-trans isomerase B OS=Homo sapiens OX=9606 GN=PPIB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	84-UNIMOD:188,180-UNIMOD:267	0.11	29.0	4	2	0
PRT	sp|Q9HBH5|RDH14_HUMAN	Retinol dehydrogenase 14 OS=Homo sapiens OX=9606 GN=RDH14 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	57-UNIMOD:267	0.04	29.0	1	1	1
PRT	sp|Q8WY22|BRI3B_HUMAN	BRI3-binding protein OS=Homo sapiens OX=9606 GN=BRI3BP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.08	29.0	1	1	1
PRT	sp|P50851-2|LRBA_HUMAN	Isoform 2 of Lipopolysaccharide-responsive and beige-like anchor protein OS=Homo sapiens OX=9606 GN=LRBA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	1905-UNIMOD:267	0.00	29.0	2	1	0
PRT	sp|Q5JVF3-3|PCID2_HUMAN	Isoform 3 of PCI domain-containing protein 2 OS=Homo sapiens OX=9606 GN=PCID2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	105-UNIMOD:188	0.03	29.0	2	1	0
PRT	sp|P27694|RFA1_HUMAN	Replication protein A 70 kDa DNA-binding subunit OS=Homo sapiens OX=9606 GN=RPA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	16-UNIMOD:188	0.03	29.0	1	1	1
PRT	sp|Q9NUP9|LIN7C_HUMAN	Protein lin-7 homolog C OS=Homo sapiens OX=9606 GN=LIN7C PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	47-UNIMOD:4,51-UNIMOD:267	0.06	29.0	2	1	0
PRT	sp|Q96GD4-3|AURKB_HUMAN	Isoform 3 of Aurora kinase B OS=Homo sapiens OX=9606 GN=AURKB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.11	29.0	1	1	1
PRT	sp|P27348|1433T_HUMAN	14-3-3 protein theta OS=Homo sapiens OX=9606 GN=YWHAQ PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	134-UNIMOD:4,138-UNIMOD:267,218-UNIMOD:35,222-UNIMOD:267,1-UNIMOD:1,3-UNIMOD:188,9-UNIMOD:188	0.13	29.0	4	3	2
PRT	sp|O75643|U520_HUMAN	U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens OX=9606 GN=SNRNP200 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	29.0	null	479-UNIMOD:188,2072-UNIMOD:188	0.02	29.0	5	4	3
PRT	sp|Q9Y4L1|HYOU1_HUMAN	Hypoxia up-regulated protein 1 OS=Homo sapiens OX=9606 GN=HYOU1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	352-UNIMOD:4,107-UNIMOD:28	0.03	29.0	2	2	1
PRT	sp|O43237|DC1L2_HUMAN	Cytoplasmic dynein 1 light intermediate chain 2 OS=Homo sapiens OX=9606 GN=DYNC1LI2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	null	104-UNIMOD:385,104-UNIMOD:4,116-UNIMOD:188	0.03	29.0	2	1	0
PRT	sp|Q9BZE4|NOG1_HUMAN	Nucleolar GTP-binding protein 1 OS=Homo sapiens OX=9606 GN=GTPBP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	null	144-UNIMOD:28	0.02	29.0	1	1	1
PRT	sp|P11387|TOP1_HUMAN	DNA topoisomerase 1 OS=Homo sapiens OX=9606 GN=TOP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	29.0	null	386-UNIMOD:4,388-UNIMOD:188	0.02	29.0	3	1	0
PRT	sp|Q92542-2|NICA_HUMAN	Isoform 2 of Nicastrin OS=Homo sapiens OX=9606 GN=NCSTN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	29.0	null	11-UNIMOD:4,383-UNIMOD:188	0.04	29.0	3	2	1
PRT	sp|Q00796|DHSO_HUMAN	Sorbitol dehydrogenase OS=Homo sapiens OX=9606 GN=SORD PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null		0.05	29.0	1	1	0
PRT	sp|P09417|DHPR_HUMAN	Dihydropteridine reductase OS=Homo sapiens OX=9606 GN=QDPR PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	null	110-UNIMOD:28	0.07	29.0	1	1	1
PRT	sp|P49720|PSB3_HUMAN	Proteasome subunit beta type-3 OS=Homo sapiens OX=9606 GN=PSMB3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	115-UNIMOD:188	0.08	29.0	1	1	1
PRT	sp|Q01780|EXOSX_HUMAN	Exosome component 10 OS=Homo sapiens OX=9606 GN=EXOSC10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	346-UNIMOD:267	0.01	29.0	1	1	0
PRT	sp|Q9BQ69|MACD1_HUMAN	ADP-ribose glycohydrolase MACROD1 OS=Homo sapiens OX=9606 GN=MACROD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	199-UNIMOD:4,200-UNIMOD:267	0.04	28.0	2	1	0
PRT	sp|Q15042-4|RB3GP_HUMAN	Isoform 3 of Rab3 GTPase-activating protein catalytic subunit OS=Homo sapiens OX=9606 GN=RAB3GAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	649-UNIMOD:4	0.01	28.0	1	1	1
PRT	sp|Q9P2N5|RBM27_HUMAN	RNA-binding protein 27 OS=Homo sapiens OX=9606 GN=RBM27 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null	49-UNIMOD:4,59-UNIMOD:188,935-UNIMOD:267	0.02	28.0	2	2	2
PRT	sp|Q9BU89|DOHH_HUMAN	Deoxyhypusine hydroxylase OS=Homo sapiens OX=9606 GN=DOHH PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	1	1	1
PRT	sp|Q16822|PCKGM_HUMAN	Phosphoenolpyruvate carboxykinase [GTP], mitochondrial OS=Homo sapiens OX=9606 GN=PCK2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|Q9HB07|MYG1_HUMAN	UPF0160 protein MYG1, mitochondrial OS=Homo sapiens OX=9606 GN=C12orf10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	253-UNIMOD:267	0.06	28.0	2	2	2
PRT	sp|Q9NS87-4|KIF15_HUMAN	Isoform 4 of Kinesin-like protein KIF15 OS=Homo sapiens OX=9606 GN=KIF15	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	638-UNIMOD:188	0.01	28.0	2	1	0
PRT	sp|Q96ME1-2|FXL18_HUMAN	Isoform 2 of F-box/LRR-repeat protein 18 OS=Homo sapiens OX=9606 GN=FBXL18	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	534-UNIMOD:267	0.03	28.0	2	1	0
PRT	sp|P06400|RB_HUMAN	Retinoblastoma-associated protein OS=Homo sapiens OX=9606 GN=RB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	438-UNIMOD:4,445-UNIMOD:267	0.02	28.0	1	1	1
PRT	sp|Q9NZL9-3|MAT2B_HUMAN	Isoform 3 of Methionine adenosyltransferase 2 subunit beta OS=Homo sapiens OX=9606 GN=MAT2B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.05	28.0	1	1	1
PRT	sp|Q9UHR4|BI2L1_HUMAN	Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 1 OS=Homo sapiens OX=9606 GN=BAIAP2L1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	313-UNIMOD:267	0.05	28.0	2	1	0
PRT	sp|Q96CW5-3|GCP3_HUMAN	Isoform 3 of Gamma-tubulin complex component 3 OS=Homo sapiens OX=9606 GN=TUBGCP3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	264-UNIMOD:188	0.03	28.0	2	1	0
PRT	sp|P13693-2|TCTP_HUMAN	Isoform 2 of Translationally-controlled tumor protein OS=Homo sapiens OX=9606 GN=TPT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.09	28.0	1	1	1
PRT	sp|P62857|RS28_HUMAN	40S ribosomal protein S28 OS=Homo sapiens OX=9606 GN=RPS28 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	63-UNIMOD:267,27-UNIMOD:4,31-UNIMOD:267,40-UNIMOD:267	0.49	28.0	3	3	3
PRT	sp|P51398-2|RT29_HUMAN	Isoform 2 of 28S ribosomal protein S29, mitochondrial OS=Homo sapiens OX=9606 GN=DAP3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	148-UNIMOD:188	0.08	28.0	3	2	1
PRT	sp|Q8N1B4-2|VPS52_HUMAN	Isoform 2 of Vacuolar protein sorting-associated protein 52 homolog OS=Homo sapiens OX=9606 GN=VPS52	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	80-UNIMOD:188	0.02	28.0	2	1	0
PRT	sp|P05455|LA_HUMAN	Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	245-UNIMOD:4,246-UNIMOD:267,165-UNIMOD:188	0.07	28.0	3	2	1
PRT	sp|O75312|ZPR1_HUMAN	Zinc finger protein ZPR1 OS=Homo sapiens OX=9606 GN=ZPR1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	152-UNIMOD:267,310-UNIMOD:267	0.05	28.0	3	2	1
PRT	sp|Q9UHV9|PFD2_HUMAN	Prefoldin subunit 2 OS=Homo sapiens OX=9606 GN=PFDN2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	32-UNIMOD:267	0.10	28.0	2	1	0
PRT	sp|P56192-2|SYMC_HUMAN	Isoform 2 of Methionine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=MARS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	388-UNIMOD:267,375-UNIMOD:188	0.05	28.0	4	2	0
PRT	sp|Q9NVH0-2|EXD2_HUMAN	Isoform 2 of Exonuclease 3'-5' domain-containing protein 2 OS=Homo sapiens OX=9606 GN=EXD2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	271-UNIMOD:188	0.03	28.0	1	1	1
PRT	sp|P08758|ANXA5_HUMAN	Annexin A5 OS=Homo sapiens OX=9606 GN=ANXA5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	18-UNIMOD:267,45-UNIMOD:267,117-UNIMOD:267	0.13	28.0	5	3	1
PRT	sp|Q00535-2|CDK5_HUMAN	Isoform 2 of Cyclin-dependent-like kinase 5 OS=Homo sapiens OX=9606 GN=CDK5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.05	28.0	1	1	1
PRT	sp|Q9NX46|ARHL2_HUMAN	ADP-ribose glycohydrolase ARH3 OS=Homo sapiens OX=9606 GN=ADPRHL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	260-UNIMOD:267	0.04	28.0	1	1	1
PRT	sp|Q15643-2|TRIPB_HUMAN	Isoform 2 of Thyroid receptor-interacting protein 11 OS=Homo sapiens OX=9606 GN=TRIP11	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	389-UNIMOD:267	0.01	28.0	1	1	1
PRT	sp|P60660-2|MYL6_HUMAN	Isoform Smooth muscle of Myosin light polypeptide 6 OS=Homo sapiens OX=9606 GN=MYL6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	32-UNIMOD:4,37-UNIMOD:267,50-UNIMOD:188	0.17	28.0	4	2	0
PRT	sp|P42345|MTOR_HUMAN	Serine/threonine-protein kinase mTOR OS=Homo sapiens OX=9606 GN=MTOR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	2166-UNIMOD:188	0.01	28.0	2	1	0
PRT	sp|Q9UHB6|LIMA1_HUMAN	LIM domain and actin-binding protein 1 OS=Homo sapiens OX=9606 GN=LIMA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	335-UNIMOD:267	0.04	28.0	2	2	2
PRT	sp|P30837|AL1B1_HUMAN	Aldehyde dehydrogenase X, mitochondrial OS=Homo sapiens OX=9606 GN=ALDH1B1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	209-UNIMOD:188	0.03	28.0	2	1	0
PRT	sp|Q6KB66-2|K2C80_HUMAN	Isoform 2 of Keratin, type II cytoskeletal 80 OS=Homo sapiens OX=9606 GN=KRT80	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	356-UNIMOD:188	0.03	28.0	1	1	1
PRT	sp|Q00688|FKBP3_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP3 OS=Homo sapiens OX=9606 GN=FKBP3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	200-UNIMOD:188	0.05	28.0	2	1	0
PRT	sp|P14868|SYDC_HUMAN	Aspartate--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=DARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	349-UNIMOD:4,356-UNIMOD:267	0.05	28.0	3	2	1
PRT	sp|P26583|HMGB2_HUMAN	High mobility group protein B2 OS=Homo sapiens OX=9606 GN=HMGB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	139-UNIMOD:188	0.06	28.0	2	1	0
PRT	sp|O43765|SGTA_HUMAN	Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Homo sapiens OX=9606 GN=SGTA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	148-UNIMOD:4,150-UNIMOD:267	0.04	28.0	2	1	0
PRT	sp|Q16763|UBE2S_HUMAN	Ubiquitin-conjugating enzyme E2 S OS=Homo sapiens OX=9606 GN=UBE2S PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	147-UNIMOD:267	0.06	28.0	1	1	1
PRT	sp|Q96JY6-4|PDLI2_HUMAN	Isoform 4 of PDZ and LIM domain protein 2 OS=Homo sapiens OX=9606 GN=PDLIM2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	1	1	1
PRT	sp|O15084-2|ANR28_HUMAN	Isoform 2 of Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens OX=9606 GN=ANKRD28	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	252-UNIMOD:267	0.02	28.0	2	1	0
PRT	sp|O00232|PSD12_HUMAN	26S proteasome non-ATPase regulatory subunit 12 OS=Homo sapiens OX=9606 GN=PSMD12 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|O95400|CD2B2_HUMAN	CD2 antigen cytoplasmic tail-binding protein 2 OS=Homo sapiens OX=9606 GN=CD2BP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	212-UNIMOD:267	0.04	28.0	1	1	1
PRT	sp|P29144|TPP2_HUMAN	Tripeptidyl-peptidase 2 OS=Homo sapiens OX=9606 GN=TPP2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|P63000|RAC1_HUMAN	Ras-related C3 botulinum toxin substrate 1 OS=Homo sapiens OX=9606 GN=RAC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	157-UNIMOD:4,147-UNIMOD:188,163-UNIMOD:267	0.14	28.0	4	2	0
PRT	sp|P26440-2|IVD_HUMAN	Isoform 2 of Isovaleryl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=IVD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|P54136-2|SYRC_HUMAN	Isoform Monomeric of Arginine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=RARS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	566-UNIMOD:4,151-UNIMOD:267,133-UNIMOD:188,450-UNIMOD:188,575-UNIMOD:188	0.08	28.0	7	4	1
PRT	sp|O15020-2|SPTN2_HUMAN	Isoform 2 of Spectrin beta chain, non-erythrocytic 2 OS=Homo sapiens OX=9606 GN=SPTBN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	1298-UNIMOD:35	0.01	28.0	2	2	2
PRT	sp|P22695|QCR2_HUMAN	Cytochrome b-c1 complex subunit 2, mitochondrial OS=Homo sapiens OX=9606 GN=UQCRC2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	192-UNIMOD:4,196-UNIMOD:267	0.03	28.0	2	1	0
PRT	sp|Q9NSD9-2|SYFB_HUMAN	Isoform 2 of Phenylalanine--tRNA ligase beta subunit OS=Homo sapiens OX=9606 GN=FARSB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	156-UNIMOD:4	0.03	28.0	1	1	1
PRT	sp|Q9NVP1|DDX18_HUMAN	ATP-dependent RNA helicase DDX18 OS=Homo sapiens OX=9606 GN=DDX18 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	329-UNIMOD:4	0.02	28.0	1	1	1
PRT	sp|Q8TBX8-3|PI42C_HUMAN	Isoform 3 of Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma OS=Homo sapiens OX=9606 GN=PIP4K2C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	122-UNIMOD:267	0.03	28.0	1	1	1
PRT	sp|Q9Y6G9|DC1L1_HUMAN	Cytoplasmic dynein 1 light intermediate chain 1 OS=Homo sapiens OX=9606 GN=DYNC1LI1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	80-UNIMOD:188	0.02	28.0	2	1	0
PRT	sp|Q14676-3|MDC1_HUMAN	Isoform 3 of Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	1788-UNIMOD:188	0.01	28.0	2	1	0
PRT	sp|P53365-2|ARFP2_HUMAN	Isoform 2 of Arfaptin-2 OS=Homo sapiens OX=9606 GN=ARFIP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	241-UNIMOD:188,165-UNIMOD:267	0.10	28.0	2	2	1
PRT	sp|Q8N684-2|CPSF7_HUMAN	Isoform 2 of Cleavage and polyadenylation specificity factor subunit 7 OS=Homo sapiens OX=9606 GN=CPSF7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|Q5T653|RM02_HUMAN	39S ribosomal protein L2, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	147-UNIMOD:267	0.04	28.0	2	1	0
PRT	sp|P08237-2|PFKAM_HUMAN	Isoform 2 of ATP-dependent 6-phosphofructokinase, muscle type OS=Homo sapiens OX=9606 GN=PFKM	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	141-UNIMOD:188	0.02	28.0	2	1	0
PRT	sp|Q15008|PSMD6_HUMAN	26S proteasome non-ATPase regulatory subunit 6 OS=Homo sapiens OX=9606 GN=PSMD6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|Q9NZR1|TMOD2_HUMAN	Tropomodulin-2 OS=Homo sapiens OX=9606 GN=TMOD2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null	251-UNIMOD:188	0.04	28.0	2	1	0
PRT	sp|P14866-2|HNRPL_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein L OS=Homo sapiens OX=9606 GN=HNRNPL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	419-UNIMOD:188	0.03	28.0	2	1	0
PRT	sp|Q96K76-2|UBP47_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 47 OS=Homo sapiens OX=9606 GN=USP47	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	600-UNIMOD:188	0.01	28.0	1	1	1
PRT	sp|P61020|RAB5B_HUMAN	Ras-related protein Rab-5B OS=Homo sapiens OX=9606 GN=RAB5B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	179-UNIMOD:188	0.07	28.0	1	1	1
PRT	sp|P13645|K1C10_HUMAN	Keratin, type I cytoskeletal 10 OS=Homo sapiens OX=9606 GN=KRT10 PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.05	28.0	1	1	1
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	226-UNIMOD:4,227-UNIMOD:188	0.04	28.0	1	1	1
PRT	sp|P62888|RL30_HUMAN	60S ribosomal protein L30 OS=Homo sapiens OX=9606 GN=RPL30 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	92-UNIMOD:4,106-UNIMOD:267	0.15	28.0	1	1	1
PRT	sp|P54577|SYYC_HUMAN	Tyrosine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=YARS1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	189-UNIMOD:267	0.02	28.0	1	1	1
PRT	sp|P11177-3|ODPB_HUMAN	Isoform 3 of Pyruvate dehydrogenase E1 component subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=PDHB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	68-UNIMOD:188	0.05	28.0	2	1	0
PRT	sp|O60306|AQR_HUMAN	RNA helicase aquarius OS=Homo sapiens OX=9606 GN=AQR PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	1138-UNIMOD:267	0.01	28.0	2	1	0
PRT	sp|Q92616|GCN1_HUMAN	eIF-2-alpha kinase activator GCN1 OS=Homo sapiens OX=9606 GN=GCN1 PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null	1731-UNIMOD:188,1794-UNIMOD:267	0.02	28.0	3	3	3
PRT	sp|Q9NR12|PDLI7_HUMAN	PDZ and LIM domain protein 7 OS=Homo sapiens OX=9606 GN=PDLIM7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	324-UNIMOD:188	0.03	28.0	2	1	0
PRT	sp|Q6FI81-2|CPIN1_HUMAN	Isoform 2 of Anamorsin OS=Homo sapiens OX=9606 GN=CIAPIN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	70-UNIMOD:4,73-UNIMOD:4	0.24	28.0	2	2	2
PRT	sp|P53618|COPB_HUMAN	Coatomer subunit beta OS=Homo sapiens OX=9606 GN=COPB1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null	623-UNIMOD:4,633-UNIMOD:188	0.04	28.0	3	2	1
PRT	sp|Q9H2M9|RBGPR_HUMAN	Rab3 GTPase-activating protein non-catalytic subunit OS=Homo sapiens OX=9606 GN=RAB3GAP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|Q9UBQ5-2|EIF3K_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit K OS=Homo sapiens OX=9606 GN=EIF3K	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.06	28.0	1	1	1
PRT	sp|O75369|FLNB_HUMAN	Filamin-B OS=Homo sapiens OX=9606 GN=FLNB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	2028-UNIMOD:267,1449-UNIMOD:188	0.01	28.0	3	2	1
PRT	sp|Q00610|CLH1_HUMAN	Clathrin heavy chain 1 OS=Homo sapiens OX=9606 GN=CLTC PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	null	188-UNIMOD:267	0.01	28.0	1	1	1
PRT	sp|P04406|G3P_HUMAN	Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	28.0	null	323-UNIMOD:267,152-UNIMOD:4,156-UNIMOD:4,247-UNIMOD:4	0.14	28.0	4	3	0
PRT	sp|Q00839|HNRPU_HUMAN	Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	null	545-UNIMOD:28	0.02	28.0	1	1	1
PRT	sp|Q99832|TCPH_HUMAN	T-complex protein 1 subunit eta OS=Homo sapiens OX=9606 GN=CCT7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	230-UNIMOD:188	0.02	28.0	1	1	0
PRT	sp|Q15084|PDIA6_HUMAN	Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	null	231-UNIMOD:267	0.04	28.0	1	1	0
PRT	sp|P49790|NU153_HUMAN	Nuclear pore complex protein Nup153 OS=Homo sapiens OX=9606 GN=NUP153 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	null	871-UNIMOD:385,871-UNIMOD:4,874-UNIMOD:4,878-UNIMOD:188,882-UNIMOD:188	0.01	28.0	1	1	1
PRT	sp|Q14980|NUMA1_HUMAN	Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	1473-UNIMOD:267	0.01	28.0	1	1	0
PRT	sp|P07910|HNRPC_HUMAN	Heterogeneous nuclear ribonucleoproteins C1/C2 OS=Homo sapiens OX=9606 GN=HNRNPC PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	28.0	null	205-UNIMOD:28,232-UNIMOD:188,243-UNIMOD:188	0.09	28.0	3	2	1
PRT	sp|O00159|MYO1C_HUMAN	Unconventional myosin-Ic OS=Homo sapiens OX=9606 GN=MYO1C PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.02	28.0	3	2	1
PRT	sp|Q14103|HNRPD_HUMAN	Heterogeneous nuclear ribonucleoprotein D0 OS=Homo sapiens OX=9606 GN=HNRNPD PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.04	28.0	1	1	0
PRT	sp|Q9UPN3|MACF1_HUMAN	Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	null	5445-UNIMOD:28,5446-UNIMOD:188,5456-UNIMOD:188	0.00	28.0	1	1	1
PRT	sp|P14649|MYL6B_HUMAN	Myosin light chain 6B OS=Homo sapiens OX=9606 GN=MYL6B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	107-UNIMOD:188	0.07	28.0	1	1	0
PRT	sp|P38159|RBMX_HUMAN	RNA-binding motif protein, X chromosome OS=Homo sapiens OX=9606 GN=RBMX PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	63-UNIMOD:188	0.04	28.0	2	1	0
PRT	sp|P49411|EFTU_HUMAN	Elongation factor Tu, mitochondrial OS=Homo sapiens OX=9606 GN=TUFM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	28.0	null	170-UNIMOD:28,182-UNIMOD:188,327-UNIMOD:267	0.06	28.0	4	2	0
PRT	sp|Q6Y7W6|GGYF2_HUMAN	GRB10-interacting GYF protein 2 OS=Homo sapiens OX=9606 GN=GIGYF2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	null	1016-UNIMOD:28,1028-UNIMOD:267	0.01	28.0	2	1	0
PRT	sp|Q14195|DPYL3_HUMAN	Dihydropyrimidinase-related protein 3 OS=Homo sapiens OX=9606 GN=DPYSL3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|P50502|F10A1_HUMAN	Hsc70-interacting protein OS=Homo sapiens OX=9606 GN=ST13 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	null	18-UNIMOD:28	0.04	28.0	1	1	1
PRT	sp|P62979|RS27A_HUMAN	Ubiquitin-40S ribosomal protein S27a OS=Homo sapiens OX=9606 GN=RPS27A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	null	144-UNIMOD:385,144-UNIMOD:4,145-UNIMOD:4,149-UNIMOD:4,152-UNIMOD:188,156-UNIMOD:188	0.09	28.0	2	1	0
PRT	sp|P21291|CSRP1_HUMAN	Cysteine and glycine-rich protein 1 OS=Homo sapiens OX=9606 GN=CSRP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	null	122-UNIMOD:385,122-UNIMOD:4,131-UNIMOD:188,137-UNIMOD:188	0.09	28.0	1	1	1
PRT	sp|Q9UJX2|CDC23_HUMAN	Cell division cycle protein 23 homolog OS=Homo sapiens OX=9606 GN=CDC23 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	null	536-UNIMOD:385,536-UNIMOD:4,537-UNIMOD:4	0.02	28.0	1	1	1
PRT	sp|P23921|RIR1_HUMAN	Ribonucleoside-diphosphate reductase large subunit OS=Homo sapiens OX=9606 GN=RRM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|O00220|TR10A_HUMAN	Tumor necrosis factor receptor superfamily member 10A OS=Homo sapiens OX=9606 GN=TNFRSF10A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	null	386-UNIMOD:28,391-UNIMOD:188,398-UNIMOD:267	0.03	28.0	1	1	1
PRT	sp|Q9UF56|FXL17_HUMAN	F-box/LRR-repeat protein 17 OS=Homo sapiens OX=9606 GN=FBXL17 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	null	629-UNIMOD:27,643-UNIMOD:188	0.02	28.0	1	1	1
PRT	sp|P18858|DNLI1_HUMAN	DNA ligase 1 OS=Homo sapiens OX=9606 GN=LIG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	28.0	null	846-UNIMOD:4,859-UNIMOD:267	0.02	28.0	2	1	0
PRT	sp|Q13445|TMED1_HUMAN	Transmembrane emp24 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=TMED1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	106-UNIMOD:4	0.06	28.0	1	1	1
PRT	sp|P63313|TYB10_HUMAN	Thymosin beta-10 OS=Homo sapiens OX=9606 GN=TMSB10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1	0.34	27.0	1	1	1
PRT	sp|Q92917|GPKOW_HUMAN	G-patch domain and KOW motifs-containing protein OS=Homo sapiens OX=9606 GN=GPKOW PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1	0.05	27.0	1	1	1
PRT	sp|O60869|EDF1_HUMAN	Endothelial differentiation-related factor 1 OS=Homo sapiens OX=9606 GN=EDF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1	0.09	27.0	1	1	1
PRT	sp|P48637-2|GSHB_HUMAN	Isoform 2 of Glutathione synthetase OS=Homo sapiens OX=9606 GN=GSS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.06	27.0	1	1	1
PRT	sp|Q92522|H1X_HUMAN	Histone H1x OS=Homo sapiens OX=9606 GN=H1FX PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.06	27.0	1	1	1
PRT	sp|O43264-2|ZW10_HUMAN	Isoform 2 of Centromere/kinetochore protein zw10 homolog OS=Homo sapiens OX=9606 GN=ZW10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	653-UNIMOD:35,667-UNIMOD:188	0.03	27.0	3	1	0
PRT	sp|P13797-3|PLST_HUMAN	Isoform 3 of Plastin-3 OS=Homo sapiens OX=9606 GN=PLS3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	485-UNIMOD:267,124-UNIMOD:35,136-UNIMOD:267	0.05	27.0	3	2	1
PRT	sp|P29590-14|PML_HUMAN	Isoform PML-14 of Protein PML OS=Homo sapiens OX=9606 GN=PML	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|P41743|KPCI_HUMAN	Protein kinase C iota type OS=Homo sapiens OX=9606 GN=PRKCI PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	258-UNIMOD:267	0.03	27.0	1	1	1
PRT	sp|P16401|H15_HUMAN	Histone H1.5 OS=Homo sapiens OX=9606 GN=H1-5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.11	27.0	2	2	2
PRT	sp|Q6ZMI0|PPR21_HUMAN	Protein phosphatase 1 regulatory subunit 21 OS=Homo sapiens OX=9606 GN=PPP1R21 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	651-UNIMOD:267	0.02	27.0	1	1	1
PRT	sp|Q15435-2|PP1R7_HUMAN	Isoform 2 of Protein phosphatase 1 regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PPP1R7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	69-UNIMOD:4,80-UNIMOD:267	0.04	27.0	2	1	0
PRT	sp|Q96I25|SPF45_HUMAN	Splicing factor 45 OS=Homo sapiens OX=9606 GN=RBM17 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	339-UNIMOD:4,354-UNIMOD:267	0.04	27.0	1	1	1
PRT	sp|Q8N1F7|NUP93_HUMAN	Nuclear pore complex protein Nup93 OS=Homo sapiens OX=9606 GN=NUP93 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null	569-UNIMOD:4,578-UNIMOD:267,42-UNIMOD:267,328-UNIMOD:4,730-UNIMOD:267	0.06	27.0	5	4	3
PRT	sp|P15882-2|CHIN_HUMAN	Isoform Alpha-1 of N-chimaerin OS=Homo sapiens OX=9606 GN=CHN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.04	27.0	1	1	1
PRT	sp|P50454|SERPH_HUMAN	Serpin H1 OS=Homo sapiens OX=9606 GN=SERPINH1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|Q9BVC6|TM109_HUMAN	Transmembrane protein 109 OS=Homo sapiens OX=9606 GN=TMEM109 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	59-UNIMOD:267	0.05	27.0	2	1	0
PRT	sp|Q9BRJ6|CG050_HUMAN	Uncharacterized protein C7orf50 OS=Homo sapiens OX=9606 GN=C7orf50 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	182-UNIMOD:267	0.08	27.0	1	1	1
PRT	sp|O60264|SMCA5_HUMAN	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Homo sapiens OX=9606 GN=SMARCA5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	616-UNIMOD:267,636-UNIMOD:267	0.02	27.0	4	2	0
PRT	sp|Q6PKG0-3|LARP1_HUMAN	Isoform 2 of La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	676-UNIMOD:188	0.01	27.0	1	1	1
PRT	sp|Q96G46-3|DUS3L_HUMAN	Isoform 3 of tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Homo sapiens OX=9606 GN=DUS3L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|Q9BRP1|PDD2L_HUMAN	Programmed cell death protein 2-like OS=Homo sapiens OX=9606 GN=PDCD2L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	260-UNIMOD:4,266-UNIMOD:267	0.03	27.0	2	1	0
PRT	sp|P48643|TCPE_HUMAN	T-complex protein 1 subunit epsilon OS=Homo sapiens OX=9606 GN=CCT5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	142-UNIMOD:267,59-UNIMOD:188	0.04	27.0	3	2	1
PRT	sp|P08183-2|MDR1_HUMAN	Isoform 2 of ATP-dependent translocase ABCB1 OS=Homo sapiens OX=9606 GN=ABCB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	841-UNIMOD:267	0.01	27.0	2	1	0
PRT	sp|P30084|ECHM_HUMAN	Enoyl-CoA hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=ECHS1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	213-UNIMOD:4,225-UNIMOD:4,228-UNIMOD:188,62-UNIMOD:4	0.13	27.0	3	2	1
PRT	sp|P22626|ROA2_HUMAN	Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	147-UNIMOD:267	0.09	27.0	4	3	2
PRT	sp|Q08257|QOR_HUMAN	Quinone oxidoreductase OS=Homo sapiens OX=9606 GN=CRYZ PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.04	27.0	1	1	1
PRT	sp|P06737-2|PYGL_HUMAN	Isoform 2 of Glycogen phosphorylase, liver form OS=Homo sapiens OX=9606 GN=PYGL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	535-UNIMOD:188	0.02	27.0	2	1	0
PRT	sp|P51532-5|SMCA4_HUMAN	Isoform 5 of Transcription activator BRG1 OS=Homo sapiens OX=9606 GN=SMARCA4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	1	1	0
PRT	sp|P06753-3|TPM3_HUMAN	Isoform 3 of Tropomyosin alpha-3 chain OS=Homo sapiens OX=9606 GN=TPM3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	65-UNIMOD:267	0.04	27.0	2	1	0
PRT	sp|Q00325-2|MPCP_HUMAN	Isoform B of Phosphate carrier protein, mitochondrial OS=Homo sapiens OX=9606 GN=SLC25A3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	200-UNIMOD:267	0.04	27.0	2	1	0
PRT	sp|P62805|H4_HUMAN	Histone H4 OS=Homo sapiens OX=9606 GN=H4C1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null	56-UNIMOD:267	0.11	27.0	5	1	0
PRT	sp|Q06203|PUR1_HUMAN	Amidophosphoribosyltransferase OS=Homo sapiens OX=9606 GN=PPAT PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	394-UNIMOD:267	0.02	27.0	2	1	0
PRT	sp|Q9BZH6|WDR11_HUMAN	WD repeat-containing protein 11 OS=Homo sapiens OX=9606 GN=WDR11 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	1071-UNIMOD:4	0.01	27.0	1	1	1
PRT	sp|Q96GG9|DCNL1_HUMAN	DCN1-like protein 1 OS=Homo sapiens OX=9606 GN=DCUN1D1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	53-UNIMOD:267	0.07	27.0	1	1	1
PRT	sp|O15371-2|EIF3D_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit D OS=Homo sapiens OX=9606 GN=EIF3D	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	325-UNIMOD:267	0.02	27.0	2	1	0
PRT	sp|Q86U90|YRDC_HUMAN	YrdC domain-containing protein, mitochondrial OS=Homo sapiens OX=9606 GN=YRDC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	248-UNIMOD:188	0.05	27.0	1	1	1
PRT	sp|P21953|ODBB_HUMAN	2-oxoisovalerate dehydrogenase subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=BCKDHB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	299-UNIMOD:4,305-UNIMOD:267,316-UNIMOD:4	0.06	27.0	2	2	2
PRT	sp|Q7Z7K6-3|CENPV_HUMAN	Isoform 3 of Centromere protein V OS=Homo sapiens OX=9606 GN=CENPV	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.05	27.0	1	1	1
PRT	sp|Q8IYB5-3|SMAP1_HUMAN	Isoform 3 of Stromal membrane-associated protein 1 OS=Homo sapiens OX=9606 GN=SMAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|Q8WUF5|IASPP_HUMAN	RelA-associated inhibitor OS=Homo sapiens OX=9606 GN=PPP1R13L PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	512-UNIMOD:267	0.03	27.0	1	1	1
PRT	sp|Q9NXG6-2|P4HTM_HUMAN	Isoform 2 of Transmembrane prolyl 4-hydroxylase OS=Homo sapiens OX=9606 GN=P4HTM	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.04	27.0	1	1	1
PRT	sp|P38117|ETFB_HUMAN	Electron transfer flavoprotein subunit beta OS=Homo sapiens OX=9606 GN=ETFB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	233-UNIMOD:267	0.05	27.0	2	1	0
PRT	sp|Q99733|NP1L4_HUMAN	Nucleosome assembly protein 1-like 4 OS=Homo sapiens OX=9606 GN=NAP1L4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	36-UNIMOD:267	0.03	27.0	2	1	0
PRT	sp|Q9HC16|ABC3G_HUMAN	DNA dC->dU-editing enzyme APOBEC-3G OS=Homo sapiens OX=9606 GN=APOBEC3G PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	136-UNIMOD:267	0.04	27.0	1	1	1
PRT	sp|Q8WXA9-2|SREK1_HUMAN	Isoform 2 of Splicing regulatory glutamine/lysine-rich protein 1 OS=Homo sapiens OX=9606 GN=SREK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	214-UNIMOD:35	0.02	27.0	1	1	1
PRT	sp|Q9Y3Q8-2|T22D4_HUMAN	Isoform 2 of TSC22 domain family protein 4 OS=Homo sapiens OX=9606 GN=TSC22D4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	127-UNIMOD:267	0.08	27.0	1	1	1
PRT	sp|Q9UJA5-4|TRM6_HUMAN	Isoform 4 of tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6 OS=Homo sapiens OX=9606 GN=TRMT6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	207-UNIMOD:267	0.03	27.0	3	1	0
PRT	sp|P04062-4|GLCM_HUMAN	Isoform 4 of Lysosomal acid glucosylceramidase OS=Homo sapiens OX=9606 GN=GBA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	360-UNIMOD:188	0.03	27.0	2	1	0
PRT	sp|P06493-2|CDK1_HUMAN	Isoform 2 of Cyclin-dependent kinase 1 OS=Homo sapiens OX=9606 GN=CDK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.05	27.0	1	1	1
PRT	sp|P62316-2|SMD2_HUMAN	Isoform 2 of Small nuclear ribonucleoprotein Sm D2 OS=Homo sapiens OX=9606 GN=SNRPD2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	36-UNIMOD:4,37-UNIMOD:267	0.10	27.0	2	1	0
PRT	sp|Q9NRG1-2|PRDC1_HUMAN	Isoform 2 of Phosphoribosyltransferase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PRTFDC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.07	27.0	1	1	1
PRT	sp|P62136-2|PP1A_HUMAN	Isoform 2 of Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Homo sapiens OX=9606 GN=PPP1CA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	47-UNIMOD:267	0.03	27.0	2	1	0
PRT	sp|Q9H0U6|RM18_HUMAN	39S ribosomal protein L18, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL18 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	125-UNIMOD:4,130-UNIMOD:267	0.06	27.0	2	1	0
PRT	sp|Q06830|PRDX1_HUMAN	Peroxiredoxin-1 OS=Homo sapiens OX=9606 GN=PRDX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	151-UNIMOD:267	0.06	27.0	2	1	0
PRT	sp|Q02952-3|AKA12_HUMAN	Isoform 3 of A-kinase anchor protein 12 OS=Homo sapiens OX=9606 GN=AKAP12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	1282-UNIMOD:188	0.01	27.0	1	1	1
PRT	sp|Q99961|SH3G1_HUMAN	Endophilin-A2 OS=Homo sapiens OX=9606 GN=SH3GL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	27.0	null	147-UNIMOD:4,149-UNIMOD:188,137-UNIMOD:28,152-UNIMOD:188	0.08	27.0	4	3	2
PRT	sp|P43246-2|MSH2_HUMAN	Isoform 2 of DNA mismatch repair protein Msh2 OS=Homo sapiens OX=9606 GN=MSH2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	16-UNIMOD:188	0.03	27.0	2	2	2
PRT	sp|O60568|PLOD3_HUMAN	Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3 OS=Homo sapiens OX=9606 GN=PLOD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	628-UNIMOD:267	0.02	27.0	1	1	1
PRT	sp|Q15007|FL2D_HUMAN	Pre-mRNA-splicing regulator WTAP OS=Homo sapiens OX=9606 GN=WTAP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	109-UNIMOD:267,173-UNIMOD:267	0.06	27.0	2	2	2
PRT	sp|Q9Y5A9|YTHD2_HUMAN	YTH domain-containing family protein 2 OS=Homo sapiens OX=9606 GN=YTHDF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1	0.02	27.0	1	1	1
PRT	sp|Q6PD74|AAGAB_HUMAN	Alpha- and gamma-adaptin-binding protein p34 OS=Homo sapiens OX=9606 GN=AAGAB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	103-UNIMOD:188	0.05	27.0	2	1	0
PRT	sp|P35659|DEK_HUMAN	Protein DEK OS=Homo sapiens OX=9606 GN=DEK PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	161-UNIMOD:4,168-UNIMOD:267	0.03	27.0	3	1	0
PRT	sp|Q8WWI1|LMO7_HUMAN	LIM domain only protein 7 OS=Homo sapiens OX=9606 GN=LMO7 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	261-UNIMOD:4,1614-UNIMOD:4,1617-UNIMOD:4	0.01	27.0	2	2	2
PRT	sp|Q15785|TOM34_HUMAN	Mitochondrial import receptor subunit TOM34 OS=Homo sapiens OX=9606 GN=TOMM34 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	293-UNIMOD:267	0.05	27.0	1	1	1
PRT	sp|Q13542|4EBP2_HUMAN	Eukaryotic translation initiation factor 4E-binding protein 2 OS=Homo sapiens OX=9606 GN=EIF4EBP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1,15-UNIMOD:267	0.13	27.0	2	1	0
PRT	sp|Q13464|ROCK1_HUMAN	Rho-associated protein kinase 1 OS=Homo sapiens OX=9606 GN=ROCK1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1	0.01	27.0	1	1	1
PRT	sp|Q86UP2-2|KTN1_HUMAN	Isoform 2 of Kinectin OS=Homo sapiens OX=9606 GN=KTN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	823-UNIMOD:188	0.01	27.0	2	1	0
PRT	sp|Q9NQG5|RPR1B_HUMAN	Regulation of nuclear pre-mRNA domain-containing protein 1B OS=Homo sapiens OX=9606 GN=RPRD1B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	126-UNIMOD:188	0.04	27.0	2	1	0
PRT	sp|P01111|RASN_HUMAN	GTPase NRas OS=Homo sapiens OX=9606 GN=NRAS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.07	27.0	1	1	1
PRT	sp|Q8NC60|NOA1_HUMAN	Nitric oxide-associated protein 1 OS=Homo sapiens OX=9606 GN=NOA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	333-UNIMOD:267	0.02	27.0	2	1	0
PRT	sp|Q9Y606-2|TRUA_HUMAN	Isoform 2 of tRNA pseudouridine synthase A OS=Homo sapiens OX=9606 GN=PUS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|O43809|CPSF5_HUMAN	Cleavage and polyadenylation specificity factor subunit 5 OS=Homo sapiens OX=9606 GN=NUDT21 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.07	27.0	2	1	0
PRT	sp|P09874|PARP1_HUMAN	Poly [ADP-ribose] polymerase 1 OS=Homo sapiens OX=9606 GN=PARP1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	119-UNIMOD:188	0.01	27.0	1	1	1
PRT	sp|O94776|MTA2_HUMAN	Metastasis-associated protein MTA2 OS=Homo sapiens OX=9606 GN=MTA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null	148-UNIMOD:267	0.02	27.0	2	1	0
PRT	sp|Q9UNX4|WDR3_HUMAN	WD repeat-containing protein 3 OS=Homo sapiens OX=9606 GN=WDR3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	454-UNIMOD:4,459-UNIMOD:4,467-UNIMOD:267	0.02	27.0	1	1	1
PRT	sp|O76096|CYTF_HUMAN	Cystatin-F OS=Homo sapiens OX=9606 GN=CST7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	54-UNIMOD:267	0.08	27.0	2	1	0
PRT	sp|P46778|RL21_HUMAN	60S ribosomal protein L21 OS=Homo sapiens OX=9606 GN=RPL21 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	146-UNIMOD:188,159-UNIMOD:35	0.12	27.0	3	1	0
PRT	sp|P50213|IDH3A_HUMAN	Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=IDH3A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	146-UNIMOD:267,77-UNIMOD:188	0.07	27.0	3	2	1
PRT	sp|Q9Y4L1-2|HYOU1_HUMAN	Isoform 2 of Hypoxia up-regulated protein 1 OS=Homo sapiens OX=9606 GN=HYOU1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	265-UNIMOD:4,271-UNIMOD:267	0.03	27.0	1	1	0
PRT	sp|Q9NPD3|EXOS4_HUMAN	Exosome complex component RRP41 OS=Homo sapiens OX=9606 GN=EXOSC4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	222-UNIMOD:267,2-UNIMOD:1	0.11	27.0	3	2	1
PRT	sp|O00763-3|ACACB_HUMAN	Isoform 3 of Acetyl-CoA carboxylase 2 OS=Homo sapiens OX=9606 GN=ACACB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	72-UNIMOD:188	0.01	27.0	2	1	0
PRT	sp|Q13428-2|TCOF_HUMAN	Isoform 2 of Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	1250-UNIMOD:267,1061-UNIMOD:188	0.01	27.0	2	2	2
PRT	sp|O95486-2|SC24A_HUMAN	Isoform 2 of Protein transport protein Sec24A OS=Homo sapiens OX=9606 GN=SEC24A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|Q6P9B6|MEAK7_HUMAN	MTOR-associated protein MEAK7 OS=Homo sapiens OX=9606 GN=MEAK7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	174-UNIMOD:188	0.03	27.0	1	1	1
PRT	sp|Q9H9G7-2|AGO3_HUMAN	Isoform 2 of Protein argonaute-3 OS=Homo sapiens OX=9606 GN=AGO3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q9C0C2-2|TB182_HUMAN	Isoform 2 of 182 kDa tankyrase-1-binding protein OS=Homo sapiens OX=9606 GN=TNKS1BP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	239-UNIMOD:267	0.02	27.0	2	1	0
PRT	sp|Q9UHD8-7|SEPT9_HUMAN	Isoform 7 of Septin-9 OS=Homo sapiens OX=9606 GN=SEPTIN9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	380-UNIMOD:267,110-UNIMOD:267	0.04	27.0	3	2	1
PRT	sp|Q9BUJ2-3|HNRL1_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 OS=Homo sapiens OX=9606 GN=HNRNPUL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	347-UNIMOD:188	0.02	27.0	2	1	0
PRT	sp|P20339|RAB5A_HUMAN	Ras-related protein Rab-5A OS=Homo sapiens OX=9606 GN=RAB5A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	179-UNIMOD:188	0.13	27.0	2	2	0
PRT	sp|Q99460|PSMD1_HUMAN	26S proteasome non-ATPase regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PSMD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	659-UNIMOD:4,660-UNIMOD:4,666-UNIMOD:188	0.02	27.0	1	1	0
PRT	sp|P08559|ODPA_HUMAN	Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial OS=Homo sapiens OX=9606 GN=PDHA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.04	27.0	1	1	0
PRT	sp|P61586|RHOA_HUMAN	Transforming protein RhoA OS=Homo sapiens OX=9606 GN=RHOA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	16-UNIMOD:4	0.06	27.0	1	1	0
PRT	sp|Q96G46|DUS3L_HUMAN	tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Homo sapiens OX=9606 GN=DUS3L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	124-UNIMOD:4,134-UNIMOD:188	0.02	27.0	1	1	1
PRT	sp|P60900|PSA6_HUMAN	Proteasome subunit alpha type-6 OS=Homo sapiens OX=9606 GN=PSMA6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.06	27.0	1	1	0
PRT	sp|Q9H0S4|DDX47_HUMAN	Probable ATP-dependent RNA helicase DDX47 OS=Homo sapiens OX=9606 GN=DDX47 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.03	27.0	1	1	0
PRT	sp|Q06323|PSME1_HUMAN	Proteasome activator complex subunit 1 OS=Homo sapiens OX=9606 GN=PSME1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	null	199-UNIMOD:28,210-UNIMOD:267	0.05	27.0	2	1	0
PRT	sp|Q9NTX5|ECHD1_HUMAN	Ethylmalonyl-CoA decarboxylase OS=Homo sapiens OX=9606 GN=ECHDC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.04	27.0	1	1	1
PRT	sp|Q06546|GABPA_HUMAN	GA-binding protein alpha chain OS=Homo sapiens OX=9606 GN=GABPA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|Q8N806|UBR7_HUMAN	Putative E3 ubiquitin-protein ligase UBR7 OS=Homo sapiens OX=9606 GN=UBR7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	412-UNIMOD:188	0.03	27.0	1	1	1
PRT	sp|P62917|RL8_HUMAN	60S ribosomal protein L8 OS=Homo sapiens OX=9606 GN=RPL8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.05	27.0	1	1	1
PRT	sp|Q9ULW0|TPX2_HUMAN	Targeting protein for Xklp2 OS=Homo sapiens OX=9606 GN=TPX2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	null	145-UNIMOD:385,145-UNIMOD:4,158-UNIMOD:188,159-UNIMOD:188	0.02	27.0	2	1	0
PRT	sp|Q9NRX1|PNO1_HUMAN	RNA-binding protein PNO1 OS=Homo sapiens OX=9606 GN=PNO1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	27.0	null	226-UNIMOD:4,236-UNIMOD:188	0.06	27.0	3	1	0
PRT	sp|Q7Z6Z7-2|HUWE1_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	717-UNIMOD:267	0.00	26.0	1	1	1
PRT	sp|Q8N5G0|SIM20_HUMAN	Small integral membrane protein 20 OS=Homo sapiens OX=9606 GN=SMIM20 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.22	26.0	1	1	1
PRT	sp|Q9ULT8|HECD1_HUMAN	E3 ubiquitin-protein ligase HECTD1 OS=Homo sapiens OX=9606 GN=HECTD1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	1995-UNIMOD:4,2005-UNIMOD:267	0.01	26.0	1	1	1
PRT	sp|P35268|RL22_HUMAN	60S ribosomal protein L22 OS=Homo sapiens OX=9606 GN=RPL22 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	65-UNIMOD:267	0.11	26.0	2	1	0
PRT	sp|Q9C0H2-3|TTYH3_HUMAN	Isoform 3 of Protein tweety homolog 3 OS=Homo sapiens OX=9606 GN=TTYH3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|P54819-3|KAD2_HUMAN	Isoform 3 of Adenylate kinase 2, mitochondrial OS=Homo sapiens OX=9606 GN=AK2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	14-UNIMOD:188	0.07	26.0	1	1	1
PRT	sp|P12694|ODBA_HUMAN	2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=BCKDHA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|Q99613-2|EIF3C_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit C OS=Homo sapiens OX=9606 GN=EIF3C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	79-UNIMOD:4,88-UNIMOD:188	0.02	26.0	3	2	1
PRT	sp|P62937|PPIA_HUMAN	Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	144-UNIMOD:267,91-UNIMOD:188	0.13	26.0	4	2	0
PRT	sp|P10599-2|THIO_HUMAN	Isoform 2 of Thioredoxin OS=Homo sapiens OX=9606 GN=TXN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	76-UNIMOD:188,74-UNIMOD:188	0.25	26.0	3	2	1
PRT	sp|P67775-2|PP2AA_HUMAN	Isoform 2 of Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Homo sapiens OX=9606 GN=PPP2CA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	20-UNIMOD:4	0.05	26.0	1	1	1
PRT	sp|A6NDU8|CE051_HUMAN	UPF0600 protein C5orf51 OS=Homo sapiens OX=9606 GN=C5orf51 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.05	26.0	1	1	1
PRT	sp|Q9BWM7|SFXN3_HUMAN	Sideroflexin-3 OS=Homo sapiens OX=9606 GN=SFXN3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.05	26.0	1	1	1
PRT	sp|Q14165|MLEC_HUMAN	Malectin OS=Homo sapiens OX=9606 GN=MLEC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	138-UNIMOD:188	0.04	26.0	1	1	1
PRT	sp|P00966|ASSY_HUMAN	Argininosuccinate synthase OS=Homo sapiens OX=9606 GN=ASS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	132-UNIMOD:4,140-UNIMOD:188	0.03	26.0	1	1	1
PRT	sp|Q8TAT6|NPL4_HUMAN	Nuclear protein localization protein 4 homolog OS=Homo sapiens OX=9606 GN=NPLOC4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	188-UNIMOD:4	0.02	26.0	1	1	1
PRT	sp|Q9Y4P3|TBL2_HUMAN	Transducin beta-like protein 2 OS=Homo sapiens OX=9606 GN=TBL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	247-UNIMOD:4,254-UNIMOD:188	0.03	26.0	1	1	1
PRT	sp|P51948-2|MAT1_HUMAN	Isoform 2 of CDK-activating kinase assembly factor MAT1 OS=Homo sapiens OX=9606 GN=MNAT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	46-UNIMOD:4,49-UNIMOD:4	0.05	26.0	1	1	1
PRT	sp|P15880|RS2_HUMAN	40S ribosomal protein S2 OS=Homo sapiens OX=9606 GN=RPS2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	229-UNIMOD:4,238-UNIMOD:188	0.04	26.0	2	1	0
PRT	sp|O76003|GLRX3_HUMAN	Glutaredoxin-3 OS=Homo sapiens OX=9606 GN=GLRX3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	319-UNIMOD:188	0.04	26.0	2	1	0
PRT	sp|Q9NRG9-2|AAAS_HUMAN	Isoform 2 of Aladin OS=Homo sapiens OX=9606 GN=AAAS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|Q9UIV1-2|CNOT7_HUMAN	Isoform 2 of CCR4-NOT transcription complex subunit 7 OS=Homo sapiens OX=9606 GN=CNOT7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	220-UNIMOD:267	0.06	26.0	1	1	0
PRT	sp|Q86XP3-2|DDX42_HUMAN	Isoform 2 of ATP-dependent RNA helicase DDX42 OS=Homo sapiens OX=9606 GN=DDX42	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.05	26.0	1	1	0
PRT	sp|O94888|UBXN7_HUMAN	UBX domain-containing protein 7 OS=Homo sapiens OX=9606 GN=UBXN7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	32-UNIMOD:188	0.04	26.0	1	1	1
PRT	sp|P08195-2|4F2_HUMAN	Isoform 2 of 4F2 cell-surface antigen heavy chain OS=Homo sapiens OX=9606 GN=SLC3A2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	423-UNIMOD:267	0.03	26.0	2	1	0
PRT	sp|Q7Z739|YTHD3_HUMAN	YTH domain-containing family protein 3 OS=Homo sapiens OX=9606 GN=YTHDF3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	206-UNIMOD:188	0.02	26.0	1	1	1
PRT	sp|Q15424-2|SAFB1_HUMAN	Isoform 2 of Scaffold attachment factor B1 OS=Homo sapiens OX=9606 GN=SAFB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	156-UNIMOD:4	0.01	26.0	1	1	1
PRT	sp|Q14203-5|DCTN1_HUMAN	Isoform 5 of Dynactin subunit 1 OS=Homo sapiens OX=9606 GN=DCTN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|Q9H9P8-2|L2HDH_HUMAN	Isoform 2 of L-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=L2HGDH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	272-UNIMOD:4,277-UNIMOD:267,243-UNIMOD:188	0.06	26.0	3	2	1
PRT	sp|O14975-2|S27A2_HUMAN	Isoform 2 of Very long-chain acyl-CoA synthetase OS=Homo sapiens OX=9606 GN=SLC27A2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	389-UNIMOD:188	0.03	26.0	1	1	1
PRT	sp|P61289|PSME3_HUMAN	Proteasome activator complex subunit 3 OS=Homo sapiens OX=9606 GN=PSME3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	36-UNIMOD:188	0.06	26.0	2	1	0
PRT	sp|P62760|VISL1_HUMAN	Visinin-like protein 1 OS=Homo sapiens OX=9606 GN=VSNL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	18-UNIMOD:188	0.06	26.0	2	1	0
PRT	sp|Q13042-4|CDC16_HUMAN	Isoform 4 of Cell division cycle protein 16 homolog OS=Homo sapiens OX=9606 GN=CDC16	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	100-UNIMOD:4,108-UNIMOD:267	0.02	26.0	1	1	1
PRT	sp|Q01658|NC2B_HUMAN	Protein Dr1 OS=Homo sapiens OX=9606 GN=DR1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	120-UNIMOD:267	0.08	26.0	1	1	1
PRT	sp|Q9Y6Y8-2|S23IP_HUMAN	Isoform 2 of SEC23-interacting protein OS=Homo sapiens OX=9606 GN=SEC23IP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	842-UNIMOD:188	0.01	26.0	2	1	0
PRT	sp|Q8WVJ2|NUDC2_HUMAN	NudC domain-containing protein 2 OS=Homo sapiens OX=9606 GN=NUDCD2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	82-UNIMOD:267	0.11	26.0	1	1	1
PRT	sp|P49756|RBM25_HUMAN	RNA-binding protein 25 OS=Homo sapiens OX=9606 GN=RBM25 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q9HD20|AT131_HUMAN	Manganese-transporting ATPase 13A1 OS=Homo sapiens OX=9606 GN=ATP13A1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null		0.01	26.0	2	1	0
PRT	sp|P08670|VIME_HUMAN	Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	155-UNIMOD:267,154-UNIMOD:35,160-UNIMOD:28,168-UNIMOD:188,170-UNIMOD:267	0.07	26.0	6	3	1
PRT	sp|Q16595-2|FRDA_HUMAN	Isoform 2 of Frataxin, mitochondrial OS=Homo sapiens OX=9606 GN=FXN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	147-UNIMOD:188	0.08	26.0	1	1	1
PRT	sp|O96019-2|ACL6A_HUMAN	Isoform 2 of Actin-like protein 6A OS=Homo sapiens OX=9606 GN=ACTL6A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	347-UNIMOD:267	0.03	26.0	2	1	0
PRT	sp|Q05655|KPCD_HUMAN	Protein kinase C delta type OS=Homo sapiens OX=9606 GN=PRKCD PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	297-UNIMOD:267	0.02	26.0	1	1	1
PRT	sp|P25789|PSA4_HUMAN	Proteasome subunit alpha type-4 OS=Homo sapiens OX=9606 GN=PSMA4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	64-UNIMOD:188	0.04	26.0	2	1	0
PRT	sp|Q8N335|GPD1L_HUMAN	Glycerol-3-phosphate dehydrogenase 1-like protein OS=Homo sapiens OX=9606 GN=GPD1L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	310-UNIMOD:267	0.04	26.0	1	1	1
PRT	sp|Q96CW6|S7A6O_HUMAN	Probable RNA polymerase II nuclear localization protein SLC7A6OS OS=Homo sapiens OX=9606 GN=SLC7A6OS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|P22223-2|CADH3_HUMAN	Isoform 2 of Cadherin-3 OS=Homo sapiens OX=9606 GN=CDH3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	363-UNIMOD:267	0.02	26.0	1	1	1
PRT	sp|O60716|CTND1_HUMAN	Catenin delta-1 OS=Homo sapiens OX=9606 GN=CTNND1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	579-UNIMOD:4,581-UNIMOD:4,584-UNIMOD:267	0.02	26.0	2	2	2
PRT	sp|P14314-2|GLU2B_HUMAN	Isoform 2 of Glucosidase 2 subunit beta OS=Homo sapiens OX=9606 GN=PRKCSH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	206-UNIMOD:188,177-UNIMOD:267	0.04	26.0	4	2	0
PRT	sp|Q9NTG7-2|SIR3_HUMAN	Isoform 2 of NAD-dependent protein deacetylase sirtuin-3, mitochondrial OS=Homo sapiens OX=9606 GN=SIRT3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.05	26.0	1	1	1
PRT	sp|O94966-4|UBP19_HUMAN	Isoform 4 of Ubiquitin carboxyl-terminal hydrolase 19 OS=Homo sapiens OX=9606 GN=USP19	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	638-UNIMOD:188	0.01	26.0	1	1	1
PRT	sp|P48444|COPD_HUMAN	Coatomer subunit delta OS=Homo sapiens OX=9606 GN=ARCN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	84-UNIMOD:267,441-UNIMOD:4,448-UNIMOD:188,45-UNIMOD:28	0.08	26.0	4	3	2
PRT	sp|O94826|TOM70_HUMAN	Mitochondrial import receptor subunit TOM70 OS=Homo sapiens OX=9606 GN=TOMM70 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	168-UNIMOD:188	0.03	26.0	3	2	1
PRT	sp|Q9Y679-3|AUP1_HUMAN	Isoform 2 of Ancient ubiquitous protein 1 OS=Homo sapiens OX=9606 GN=AUP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	243-UNIMOD:267	0.03	26.0	1	1	1
PRT	sp|P61224-2|RAP1B_HUMAN	Isoform 2 of Ras-related protein Rap-1b OS=Homo sapiens OX=9606 GN=RAP1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	94-UNIMOD:4,102-UNIMOD:188	0.10	26.0	1	1	1
PRT	sp|Q14202-2|ZMYM3_HUMAN	Isoform 2 of Zinc finger MYM-type protein 3 OS=Homo sapiens OX=9606 GN=ZMYM3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	1314-UNIMOD:4	0.01	26.0	1	1	1
PRT	sp|P23434|GCSH_HUMAN	Glycine cleavage system H protein, mitochondrial OS=Homo sapiens OX=9606 GN=GCSH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	138-UNIMOD:4	0.06	26.0	1	1	1
PRT	sp|Q9Y570-2|PPME1_HUMAN	Isoform 2 of Protein phosphatase methylesterase 1 OS=Homo sapiens OX=9606 GN=PPME1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	30-UNIMOD:188	0.06	26.0	2	1	0
PRT	sp|Q86W92-3|LIPB1_HUMAN	Isoform 3 of Liprin-beta-1 OS=Homo sapiens OX=9606 GN=PPFIBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	676-UNIMOD:267	0.02	26.0	1	1	1
PRT	sp|Q14674-2|ESPL1_HUMAN	Isoform 2 of Separin OS=Homo sapiens OX=9606 GN=ESPL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	1437-UNIMOD:188	0.01	26.0	1	1	1
PRT	sp|Q16836|HCDH_HUMAN	Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=HADH PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	202-UNIMOD:188	0.04	26.0	2	1	0
PRT	sp|A6NHQ2|FBLL1_HUMAN	rRNA/tRNA 2'-O-methyltransferase fibrillarin-like protein 1 OS=Homo sapiens OX=9606 GN=FBLL1 PE=3 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null	230-UNIMOD:267	0.04	26.0	2	1	0
PRT	sp|Q9Y2X3|NOP58_HUMAN	Nucleolar protein 58 OS=Homo sapiens OX=9606 GN=NOP58 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	278-UNIMOD:267	0.02	26.0	2	1	0
PRT	sp|O43237-2|DC1L2_HUMAN	Isoform 2 of Cytoplasmic dynein 1 light intermediate chain 2 OS=Homo sapiens OX=9606 GN=DYNC1LI2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	397-UNIMOD:267	0.03	26.0	1	1	1
PRT	sp|Q9NW82|WDR70_HUMAN	WD repeat-containing protein 70 OS=Homo sapiens OX=9606 GN=WDR70 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q9UKX7-2|NUP50_HUMAN	Isoform 2 of Nuclear pore complex protein Nup50 OS=Homo sapiens OX=9606 GN=NUP50	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	99-UNIMOD:188	0.04	26.0	1	1	1
PRT	sp|P61956-2|SUMO2_HUMAN	Isoform 2 of Small ubiquitin-related modifier 2 OS=Homo sapiens OX=9606 GN=SUMO2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	33-UNIMOD:188	0.18	26.0	2	1	0
PRT	sp|P54920|SNAA_HUMAN	Alpha-soluble NSF attachment protein OS=Homo sapiens OX=9606 GN=NAPA PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	180-UNIMOD:188	0.05	26.0	2	1	0
PRT	sp|P09497-2|CLCB_HUMAN	Isoform Non-brain of Clathrin light chain B OS=Homo sapiens OX=9606 GN=CLTB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	181-UNIMOD:4	0.05	26.0	1	1	0
PRT	sp|Q9H488-2|OFUT1_HUMAN	Isoform 2 of GDP-fucose protein O-fucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POFUT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	111-UNIMOD:188	0.06	26.0	2	1	0
PRT	sp|P61960|UFM1_HUMAN	Ubiquitin-fold modifier 1 OS=Homo sapiens OX=9606 GN=UFM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null		0.19	26.0	2	1	0
PRT	sp|P42766|RL35_HUMAN	60S ribosomal protein L35 OS=Homo sapiens OX=9606 GN=RPL35 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	20-UNIMOD:28,66-UNIMOD:188,25-UNIMOD:188,32-UNIMOD:267	0.20	26.0	5	2	0
PRT	sp|O95453-4|PARN_HUMAN	Isoform 4 of Poly(A)-specific ribonuclease PARN OS=Homo sapiens OX=9606 GN=PARN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	268-UNIMOD:188	0.04	26.0	1	1	1
PRT	sp|Q07157-2|ZO1_HUMAN	Isoform Short of Tight junction protein ZO-1 OS=Homo sapiens OX=9606 GN=TJP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	480-UNIMOD:267	0.01	26.0	1	1	1
PRT	sp|P13010|XRCC5_HUMAN	X-ray repair cross-complementing protein 5 OS=Homo sapiens OX=9606 GN=XRCC5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q96HE7|ERO1A_HUMAN	ERO1-like protein alpha OS=Homo sapiens OX=9606 GN=ERO1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	275-UNIMOD:188	0.02	26.0	2	1	0
PRT	sp|P67870|CSK2B_HUMAN	Casein kinase II subunit beta OS=Homo sapiens OX=9606 GN=CSNK2B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null	109-UNIMOD:4,111-UNIMOD:267	0.06	26.0	3	1	0
PRT	sp|P0DMV8|HS71A_HUMAN	Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	26.0	null	156-UNIMOD:28	0.05	26.0	2	2	1
PRT	sp|O14979|HNRDL_HUMAN	Heterogeneous nuclear ribonucleoprotein D-like OS=Homo sapiens OX=9606 GN=HNRNPDL PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	177-UNIMOD:4,180-UNIMOD:188	0.03	26.0	2	1	0
PRT	sp|Q92973|TNPO1_HUMAN	Transportin-1 OS=Homo sapiens OX=9606 GN=TNPO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	26.0	null	693-UNIMOD:28,704-UNIMOD:188,103-UNIMOD:4	0.03	26.0	3	2	0
PRT	sp|P62633|CNBP_HUMAN	Cellular nucleic acid-binding protein OS=Homo sapiens OX=9606 GN=CNBP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	null	140-UNIMOD:385,140-UNIMOD:4,150-UNIMOD:4,152-UNIMOD:188,119-UNIMOD:385,119-UNIMOD:4,122-UNIMOD:4,130-UNIMOD:188	0.15	26.0	2	2	2
PRT	sp|P14866|HNRPL_HUMAN	Heterogeneous nuclear ribonucleoprotein L OS=Homo sapiens OX=9606 GN=HNRNPL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	null	456-UNIMOD:28,472-UNIMOD:4,475-UNIMOD:188,481-UNIMOD:267	0.05	26.0	2	1	0
PRT	sp|P55084|ECHB_HUMAN	Trifunctional enzyme subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=HADHB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	405-UNIMOD:267	0.03	26.0	1	1	0
PRT	sp|P49916|DNLI3_HUMAN	DNA ligase 3 OS=Homo sapiens OX=9606 GN=LIG3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	null	729-UNIMOD:385,729-UNIMOD:4	0.01	26.0	1	1	1
PRT	sp|Q9H6S0|YTDC2_HUMAN	3'-5' RNA helicase YTHDC2 OS=Homo sapiens OX=9606 GN=YTHDC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	26.0	null	1042-UNIMOD:267,234-UNIMOD:4,236-UNIMOD:188	0.02	26.0	2	2	2
PRT	sp|Q9UIV1|CNOT7_HUMAN	CCR4-NOT transcription complex subunit 7 OS=Homo sapiens OX=9606 GN=CNOT7 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.05	26.0	1	1	0
PRT	sp|P09497|CLCB_HUMAN	Clathrin light chain B OS=Homo sapiens OX=9606 GN=CLTB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	199-UNIMOD:4,204-UNIMOD:188	0.05	26.0	2	1	0
PRT	sp|P51532|SMCA4_HUMAN	Transcription activator BRG1 OS=Homo sapiens OX=9606 GN=SMARCA4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	397-UNIMOD:267	0.01	26.0	1	1	0
PRT	sp|P84103|SRSF3_HUMAN	Serine/arginine-rich splicing factor 3 OS=Homo sapiens OX=9606 GN=SRSF3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	23-UNIMOD:188	0.08	26.0	1	1	0
PRT	sp|Q9UMX0|UBQL1_HUMAN	Ubiquilin-1 OS=Homo sapiens OX=9606 GN=UBQLN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.03	26.0	1	1	0
PRT	sp|Q9NRV9|HEBP1_HUMAN	Heme-binding protein 1 OS=Homo sapiens OX=9606 GN=HEBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	118-UNIMOD:188	0.08	26.0	1	1	1
PRT	sp|O76062|ERG24_HUMAN	Delta(14)-sterol reductase TM7SF2 OS=Homo sapiens OX=9606 GN=TM7SF2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	335-UNIMOD:267	0.03	26.0	1	1	1
PRT	sp|Q8IXT5|RB12B_HUMAN	RNA-binding protein 12B OS=Homo sapiens OX=9606 GN=RBM12B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	204-UNIMOD:4	0.01	26.0	1	1	1
PRT	sp|O96008|TOM40_HUMAN	Mitochondrial import receptor subunit TOM40 homolog OS=Homo sapiens OX=9606 GN=TOMM40 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	253-UNIMOD:188	0.04	26.0	1	1	1
PRT	sp|P04920|B3A2_HUMAN	Anion exchange protein 2 OS=Homo sapiens OX=9606 GN=SLC4A2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	57-UNIMOD:267	0.01	26.0	1	1	0
PRT	sp|Q9NZM1|MYOF_HUMAN	Myoferlin OS=Homo sapiens OX=9606 GN=MYOF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	180-UNIMOD:267	0.01	26.0	1	1	0
PRT	sp|Q06210|GFPT1_HUMAN	Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Homo sapiens OX=9606 GN=GFPT1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	474-UNIMOD:267	0.03	26.0	1	1	0
PRT	sp|A5YM69|ARG35_HUMAN	Rho guanine nucleotide exchange factor 35 OS=Homo sapiens OX=9606 GN=ARHGEF35 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|P13984|T2FB_HUMAN	General transcription factor IIF subunit 2 OS=Homo sapiens OX=9606 GN=GTF2F2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.05	25.0	1	1	1
PRT	sp|Q68CZ2-2|TENS3_HUMAN	Isoform 2 of Tensin-3 OS=Homo sapiens OX=9606 GN=TNS3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q9UQE7|SMC3_HUMAN	Structural maintenance of chromosomes protein 3 OS=Homo sapiens OX=9606 GN=SMC3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	997-UNIMOD:188	0.01	25.0	1	1	1
PRT	sp|P35580|MYH10_HUMAN	Myosin-10 OS=Homo sapiens OX=9606 GN=MYH10 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null	1461-UNIMOD:188	0.01	25.0	2	2	2
PRT	sp|Q8WVM8-2|SCFD1_HUMAN	Isoform 2 of Sec1 family domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SCFD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	393-UNIMOD:4	0.03	25.0	1	1	1
PRT	sp|Q9BUQ8|DDX23_HUMAN	Probable ATP-dependent RNA helicase DDX23 OS=Homo sapiens OX=9606 GN=DDX23 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|P61225|RAP2B_HUMAN	Ras-related protein Rap-2b OS=Homo sapiens OX=9606 GN=RAP2B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	162-UNIMOD:267	0.07	25.0	2	1	0
PRT	sp|O14737|PDCD5_HUMAN	Programmed cell death protein 5 OS=Homo sapiens OX=9606 GN=PDCD5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	79-UNIMOD:267,97-UNIMOD:188	0.19	25.0	3	2	1
PRT	sp|Q9NR56-3|MBNL1_HUMAN	Isoform 3 of Muscleblind-like protein 1 OS=Homo sapiens OX=9606 GN=MBNL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.04	25.0	1	1	1
PRT	sp|O14776-2|TCRG1_HUMAN	Isoform 2 of Transcription elongation regulator 1 OS=Homo sapiens OX=9606 GN=TCERG1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	760-UNIMOD:267	0.01	25.0	1	1	1
PRT	sp|Q16891-3|MIC60_HUMAN	Isoform 3 of MICOS complex subunit MIC60 OS=Homo sapiens OX=9606 GN=IMMT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	353-UNIMOD:188,493-UNIMOD:267	0.03	25.0	4	2	0
PRT	sp|P43487-2|RANG_HUMAN	Isoform 2 of Ran-specific GTPase-activating protein OS=Homo sapiens OX=9606 GN=RANBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	68-UNIMOD:188	0.06	25.0	2	1	0
PRT	sp|P04920-2|B3A2_HUMAN	Isoform B1 of Anion exchange protein 2 OS=Homo sapiens OX=9606 GN=SLC4A2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	0
PRT	sp|Q9Y696|CLIC4_HUMAN	Chloride intracellular channel protein 4 OS=Homo sapiens OX=9606 GN=CLIC4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	189-UNIMOD:4,194-UNIMOD:188	0.07	25.0	2	1	0
PRT	sp|P61803|DAD1_HUMAN	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Homo sapiens OX=9606 GN=DAD1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	23-UNIMOD:267	0.12	25.0	1	1	1
PRT	sp|P17480-2|UBF1_HUMAN	Isoform UBF2 of Nucleolar transcription factor 1 OS=Homo sapiens OX=9606 GN=UBTF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	335-UNIMOD:267	0.02	25.0	1	1	1
PRT	sp|P46087-2|NOP2_HUMAN	Isoform 2 of Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase OS=Homo sapiens OX=9606 GN=NOP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	41-UNIMOD:188	0.01	25.0	2	1	0
PRT	sp|O95202|LETM1_HUMAN	Mitochondrial proton/calcium exchanger protein OS=Homo sapiens OX=9606 GN=LETM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	274-UNIMOD:188	0.02	25.0	2	1	0
PRT	sp|P61011-2|SRP54_HUMAN	Isoform 2 of Signal recognition particle 54 kDa protein OS=Homo sapiens OX=9606 GN=SRP54	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	218-UNIMOD:188	0.03	25.0	2	1	0
PRT	sp|O43823|AKAP8_HUMAN	A-kinase anchor protein 8 OS=Homo sapiens OX=9606 GN=AKAP8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	122-UNIMOD:267	0.02	25.0	2	1	0
PRT	sp|Q86VN1-2|VPS36_HUMAN	Isoform 2 of Vacuolar protein-sorting-associated protein 36 OS=Homo sapiens OX=9606 GN=VPS36	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	233-UNIMOD:4	0.05	25.0	1	1	1
PRT	sp|P06730|IF4E_HUMAN	Eukaryotic translation initiation factor 4E OS=Homo sapiens OX=9606 GN=EIF4E PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	170-UNIMOD:4,173-UNIMOD:267	0.06	25.0	2	1	0
PRT	sp|P36871-2|PGM1_HUMAN	Isoform 2 of Phosphoglucomutase-1 OS=Homo sapiens OX=9606 GN=PGM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	378-UNIMOD:188,533-UNIMOD:267	0.04	25.0	2	2	2
PRT	sp|Q9NQW7-2|XPP1_HUMAN	Isoform 2 of Xaa-Pro aminopeptidase 1 OS=Homo sapiens OX=9606 GN=XPNPEP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	522-UNIMOD:188,130-UNIMOD:188	0.07	25.0	3	3	3
PRT	sp|Q9NZ08|ERAP1_HUMAN	Endoplasmic reticulum aminopeptidase 1 OS=Homo sapiens OX=9606 GN=ERAP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	188-UNIMOD:267	0.01	25.0	1	1	1
PRT	sp|Q5VW32-2|BROX_HUMAN	Isoform 2 of BRO1 domain-containing protein BROX OS=Homo sapiens OX=9606 GN=BROX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	313-UNIMOD:188	0.03	25.0	2	1	0
PRT	sp|P06756-3|ITAV_HUMAN	Isoform 3 of Integrin alpha-V OS=Homo sapiens OX=9606 GN=ITGAV	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	614-UNIMOD:188	0.01	25.0	2	1	0
PRT	sp|Q13242|SRSF9_HUMAN	Serine/arginine-rich splicing factor 9 OS=Homo sapiens OX=9606 GN=SRSF9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|Q6NVY1-2|HIBCH_HUMAN	Isoform 2 of 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=HIBCH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	233-UNIMOD:188	0.04	25.0	1	1	1
PRT	sp|Q9UL15|BAG5_HUMAN	BAG family molecular chaperone regulator 5 OS=Homo sapiens OX=9606 GN=BAG5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	441-UNIMOD:188	0.03	25.0	1	1	1
PRT	sp|P07237|PDIA1_HUMAN	Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q96P48-7|ARAP1_HUMAN	Isoform 7 of Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ARAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|P26358-3|DNMT1_HUMAN	Isoform 3 of DNA (cytosine-5)-methyltransferase 1 OS=Homo sapiens OX=9606 GN=DNMT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q15269|PWP2_HUMAN	Periodic tryptophan protein 2 homolog OS=Homo sapiens OX=9606 GN=PWP2 PE=2 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	784-UNIMOD:267	0.01	25.0	1	1	1
PRT	sp|Q9NRW3|ABC3C_HUMAN	DNA dC->dU-editing enzyme APOBEC-3C OS=Homo sapiens OX=9606 GN=APOBEC3C PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	130-UNIMOD:4,136-UNIMOD:267	0.08	25.0	1	1	1
PRT	sp|Q8WUD4|CCD12_HUMAN	Coiled-coil domain-containing protein 12 OS=Homo sapiens OX=9606 GN=CCDC12 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	1-UNIMOD:1	0.11	25.0	1	1	1
PRT	sp|Q96KB5|TOPK_HUMAN	Lymphokine-activated killer T-cell-originated protein kinase OS=Homo sapiens OX=9606 GN=PBK PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	1-UNIMOD:1	0.04	25.0	1	1	1
PRT	sp|P0DMM9-2|ST1A3_HUMAN	Isoform 2 of Sulfotransferase 1A3 OS=Homo sapiens OX=9606 GN=SULT1A3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	1-UNIMOD:1	0.09	25.0	1	1	1
PRT	sp|P40939|ECHA_HUMAN	Trifunctional enzyme subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=HADHA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	516-UNIMOD:188	0.02	25.0	1	1	1
PRT	sp|Q9UBB9|TFP11_HUMAN	Tuftelin-interacting protein 11 OS=Homo sapiens OX=9606 GN=TFIP11 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	182-UNIMOD:188	0.02	25.0	2	1	0
PRT	sp|Q04726-2|TLE3_HUMAN	Isoform 2 of Transducin-like enhancer protein 3 OS=Homo sapiens OX=9606 GN=TLE3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	338-UNIMOD:267	0.02	25.0	2	1	0
PRT	sp|Q8IXB1-2|DJC10_HUMAN	Isoform 2 of DnaJ homolog subfamily C member 10 OS=Homo sapiens OX=9606 GN=DNAJC10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q9UNH7-2|SNX6_HUMAN	Isoform 2 of Sorting nexin-6 OS=Homo sapiens OX=9606 GN=SNX6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	270-UNIMOD:188	0.04	25.0	1	1	1
PRT	sp|Q9BVQ7|SPA5L_HUMAN	Spermatogenesis-associated protein 5-like protein 1 OS=Homo sapiens OX=9606 GN=SPATA5L1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	140-UNIMOD:267	0.02	25.0	1	1	1
PRT	sp|Q9BVW5|TIPIN_HUMAN	TIMELESS-interacting protein OS=Homo sapiens OX=9606 GN=TIPIN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	295-UNIMOD:267	0.04	25.0	1	1	1
PRT	sp|P40818-2|UBP8_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 8 OS=Homo sapiens OX=9606 GN=USP8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	325-UNIMOD:188	0.01	25.0	2	1	0
PRT	sp|O95639-3|CPSF4_HUMAN	Isoform 3 of Cleavage and polyadenylation specificity factor subunit 4 OS=Homo sapiens OX=9606 GN=CPSF4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	41-UNIMOD:4,46-UNIMOD:188	0.05	25.0	1	1	1
PRT	sp|Q15528-2|MED22_HUMAN	Isoform Surf5A of Mediator of RNA polymerase II transcription subunit 22 OS=Homo sapiens OX=9606 GN=MED22	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.09	25.0	1	1	1
PRT	sp|P48681|NEST_HUMAN	Nestin OS=Homo sapiens OX=9606 GN=NES PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	830-UNIMOD:188	0.01	25.0	1	1	1
PRT	sp|Q6Y7W6-4|GGYF2_HUMAN	Isoform 3 of GRB10-interacting GYF protein 2 OS=Homo sapiens OX=9606 GN=GIGYF2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	1005-UNIMOD:267	0.01	25.0	1	1	1
PRT	sp|Q8TBC4-2|UBA3_HUMAN	Isoform 2 of NEDD8-activating enzyme E1 catalytic subunit OS=Homo sapiens OX=9606 GN=UBA3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	395-UNIMOD:188	0.03	25.0	1	1	1
PRT	sp|Q92930|RAB8B_HUMAN	Ras-related protein Rab-8B OS=Homo sapiens OX=9606 GN=RAB8B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	167-UNIMOD:267	0.07	25.0	1	1	1
PRT	sp|P31942-3|HNRH3_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein H3 OS=Homo sapiens OX=9606 GN=HNRNPH3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|Q9NZT2-2|OGFR_HUMAN	Isoform 2 of Opioid growth factor receptor OS=Homo sapiens OX=9606 GN=OGFR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q9Y678|COPG1_HUMAN	Coatomer subunit gamma-1 OS=Homo sapiens OX=9606 GN=COPG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	590-UNIMOD:267,624-UNIMOD:267,706-UNIMOD:4	0.06	25.0	4	3	2
PRT	sp|P04632|CPNS1_HUMAN	Calpain small subunit 1 OS=Homo sapiens OX=9606 GN=CAPNS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	144-UNIMOD:4,145-UNIMOD:267	0.04	25.0	2	1	0
PRT	sp|Q9Y5B6-2|PAXB1_HUMAN	Isoform 2 of PAX3- and PAX7-binding protein 1 OS=Homo sapiens OX=9606 GN=PAXBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q9UBS4|DJB11_HUMAN	DnaJ homolog subfamily B member 11 OS=Homo sapiens OX=9606 GN=DNAJB11 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q9UMS4|PRP19_HUMAN	Pre-mRNA-processing factor 19 OS=Homo sapiens OX=9606 GN=PRPF19 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	439-UNIMOD:188	0.02	25.0	2	1	0
PRT	sp|Q8TC07-2|TBC15_HUMAN	Isoform 2 of TBC1 domain family member 15 OS=Homo sapiens OX=9606 GN=TBC1D15	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	39-UNIMOD:267	0.02	25.0	1	1	1
PRT	sp|O43684-2|BUB3_HUMAN	Isoform 2 of Mitotic checkpoint protein BUB3 OS=Homo sapiens OX=9606 GN=BUB3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	129-UNIMOD:4,139-UNIMOD:188	0.04	25.0	2	1	0
PRT	sp|P21281|VATB2_HUMAN	V-type proton ATPase subunit B, brain isoform OS=Homo sapiens OX=9606 GN=ATP6V1B2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	130-UNIMOD:267	0.02	25.0	2	1	0
PRT	sp|P16422|EPCAM_HUMAN	Epithelial cell adhesion molecule OS=Homo sapiens OX=9606 GN=EPCAM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|P04844-2|RPN2_HUMAN	Isoform 2 of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Homo sapiens OX=9606 GN=RPN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	334-UNIMOD:267	0.05	25.0	2	2	2
PRT	sp|O43143|DHX15_HUMAN	Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 OS=Homo sapiens OX=9606 GN=DHX15 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	174-UNIMOD:4	0.03	25.0	2	2	2
PRT	sp|Q13423|NNTM_HUMAN	NAD(P) transhydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=NNT PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q9UBR2|CATZ_HUMAN	Cathepsin Z OS=Homo sapiens OX=9606 GN=CTSZ PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|P52799|EFNB2_HUMAN	Ephrin-B2 OS=Homo sapiens OX=9606 GN=EFNB2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|P55010|IF5_HUMAN	Eukaryotic translation initiation factor 5 OS=Homo sapiens OX=9606 GN=EIF5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	234-UNIMOD:267	0.03	25.0	1	1	1
PRT	sp|Q99622|C10_HUMAN	Protein C10 OS=Homo sapiens OX=9606 GN=C12orf57 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	35-UNIMOD:267	0.15	25.0	1	1	1
PRT	sp|Q9GZL7|WDR12_HUMAN	Ribosome biogenesis protein WDR12 OS=Homo sapiens OX=9606 GN=WDR12 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	291-UNIMOD:188	0.03	25.0	1	1	1
PRT	sp|Q6L8Q7-2|PDE12_HUMAN	Isoform 2 of 2',5'-phosphodiesterase 12 OS=Homo sapiens OX=9606 GN=PDE12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	245-UNIMOD:267	0.02	25.0	1	1	1
PRT	sp|Q9NYB0|TE2IP_HUMAN	Telomeric repeat-binding factor 2-interacting protein 1 OS=Homo sapiens OX=9606 GN=TERF2IP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|P50991|TCPD_HUMAN	T-complex protein 1 subunit delta OS=Homo sapiens OX=9606 GN=CCT4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	295-UNIMOD:4,302-UNIMOD:188	0.02	25.0	2	1	0
PRT	sp|P54819|KAD2_HUMAN	Adenylate kinase 2, mitochondrial OS=Homo sapiens OX=9606 GN=AK2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	null	107-UNIMOD:28,117-UNIMOD:188,118-UNIMOD:267	0.05	25.0	2	1	0
PRT	sp|P40121|CAPG_HUMAN	Macrophage-capping protein OS=Homo sapiens OX=9606 GN=CAPG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	25.0	null	307-UNIMOD:28,319-UNIMOD:267	0.04	25.0	2	1	0
PRT	sp|P14635|CCNB1_HUMAN	G2/mitotic-specific cyclin-B1 OS=Homo sapiens OX=9606 GN=CCNB1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	null	180-UNIMOD:28,188-UNIMOD:267,190-UNIMOD:188	0.03	25.0	1	1	1
PRT	sp|P53365|ARFP2_HUMAN	Arfaptin-2 OS=Homo sapiens OX=9606 GN=ARFIP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.04	25.0	1	1	0
PRT	sp|Q96I59|SYNM_HUMAN	Probable asparagine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=NARS2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	null	291-UNIMOD:385,291-UNIMOD:4,298-UNIMOD:4,300-UNIMOD:188	0.02	25.0	1	1	1
PRT	sp|P53582|MAP11_HUMAN	Methionine aminopeptidase 1 OS=Homo sapiens OX=9606 GN=METAP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	179-UNIMOD:4	0.04	25.0	1	1	1
PRT	sp|Q9Y2Z0|SGT1_HUMAN	Protein SGT1 homolog OS=Homo sapiens OX=9606 GN=SUGT1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	84-UNIMOD:267	0.04	25.0	1	1	1
PRT	sp|Q9NZQ3|SPN90_HUMAN	NCK-interacting protein with SH3 domain OS=Homo sapiens OX=9606 GN=NCKIPSD PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|O15084|ANR28_HUMAN	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens OX=9606 GN=ANKRD28 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	122-UNIMOD:4	0.02	25.0	1	1	1
PRT	sp|Q13491|GPM6B_HUMAN	Neuronal membrane glycoprotein M6-b OS=Homo sapiens OX=9606 GN=GPM6B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	19-UNIMOD:267	0.07	25.0	1	1	1
PRT	sp|O14730-2|RIOK3_HUMAN	Isoform 2 of Serine/threonine-protein kinase RIO3 OS=Homo sapiens OX=9606 GN=RIOK3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	505-UNIMOD:188	0.03	24.0	1	1	1
PRT	sp|Q9Y312|AAR2_HUMAN	Protein AAR2 homolog OS=Homo sapiens OX=9606 GN=AAR2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.03	24.0	1	1	1
PRT	sp|P18433-6|PTPRA_HUMAN	Isoform 2 of Receptor-type tyrosine-protein phosphatase alpha OS=Homo sapiens OX=9606 GN=PTPRA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q8NBJ5|GT251_HUMAN	Procollagen galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=COLGALT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	369-UNIMOD:4,370-UNIMOD:267	0.02	24.0	2	1	0
PRT	sp|P98179|RBM3_HUMAN	RNA-binding protein 3 OS=Homo sapiens OX=9606 GN=RBM3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.07	24.0	1	1	1
PRT	sp|Q15276|RABE1_HUMAN	Rab GTPase-binding effector protein 1 OS=Homo sapiens OX=9606 GN=RABEP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	292-UNIMOD:267	0.01	24.0	2	1	0
PRT	sp|Q9UGP8|SEC63_HUMAN	Translocation protein SEC63 homolog OS=Homo sapiens OX=9606 GN=SEC63 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	366-UNIMOD:4	0.02	24.0	1	1	1
PRT	sp|P51692|STA5B_HUMAN	Signal transducer and activator of transcription 5B OS=Homo sapiens OX=9606 GN=STAT5B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q7Z5J4-4|RAI1_HUMAN	Isoform 4 of Retinoic acid-induced protein 1 OS=Homo sapiens OX=9606 GN=RAI1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q8TF09|DLRB2_HUMAN	Dynein light chain roadblock-type 2 OS=Homo sapiens OX=9606 GN=DYNLRB2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.14	24.0	1	1	1
PRT	sp|Q8NEN9|PDZD8_HUMAN	PDZ domain-containing protein 8 OS=Homo sapiens OX=9606 GN=PDZD8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|P38432|COIL_HUMAN	Coilin OS=Homo sapiens OX=9606 GN=COIL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	476-UNIMOD:188	0.03	24.0	1	1	1
PRT	sp|Q9UQB8-3|BAIP2_HUMAN	Isoform 3 of Brain-specific angiogenesis inhibitor 1-associated protein 2 OS=Homo sapiens OX=9606 GN=BAIAP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	410-UNIMOD:267	0.03	24.0	1	1	0
PRT	sp|P27797|CALR_HUMAN	Calreticulin OS=Homo sapiens OX=9606 GN=CALR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q8WTV0-3|SCRB1_HUMAN	Isoform 2 of Scavenger receptor class B member 1 OS=Homo sapiens OX=9606 GN=SCARB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	200-UNIMOD:267	0.03	24.0	1	1	1
PRT	sp|Q9Y3U8|RL36_HUMAN	60S ribosomal protein L36 OS=Homo sapiens OX=9606 GN=RPL36 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	48-UNIMOD:4,55-UNIMOD:267	0.10	24.0	1	1	1
PRT	sp|Q9H845|ACAD9_HUMAN	Complex I assembly factor ACAD9, mitochondrial OS=Homo sapiens OX=9606 GN=ACAD9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	2	2	2
PRT	sp|P46977-2|STT3A_HUMAN	Isoform 2 of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Homo sapiens OX=9606 GN=STT3A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	563-UNIMOD:188	0.02	24.0	1	1	1
PRT	sp|Q96EY1-2|DNJA3_HUMAN	Isoform 2 of DnaJ homolog subfamily A member 3, mitochondrial OS=Homo sapiens OX=9606 GN=DNAJA3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	187-UNIMOD:267	0.03	24.0	1	1	1
PRT	sp|Q15813|TBCE_HUMAN	Tubulin-specific chaperone E OS=Homo sapiens OX=9606 GN=TBCE PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	152-UNIMOD:4	0.02	24.0	1	1	1
PRT	sp|Q16790|CAH9_HUMAN	Carbonic anhydrase 9 OS=Homo sapiens OX=9606 GN=CA9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|A3KMH1-3|VWA8_HUMAN	Isoform 3 of von Willebrand factor A domain-containing protein 8 OS=Homo sapiens OX=9606 GN=VWA8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	1226-UNIMOD:267	0.01	24.0	1	1	1
PRT	sp|Q68D85|NR3L1_HUMAN	Natural cytotoxicity triggering receptor 3 ligand 1 OS=Homo sapiens OX=9606 GN=NCR3LG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	396-UNIMOD:188	0.03	24.0	2	1	0
PRT	sp|Q96BW9-2|TAM41_HUMAN	Isoform 2 of Phosphatidate cytidylyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=TAMM41	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	150-UNIMOD:267	0.04	24.0	1	1	1
PRT	sp|Q16181-2|SEPT7_HUMAN	Isoform 2 of Septin-7 OS=Homo sapiens OX=9606 GN=SEPTIN7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	424-UNIMOD:267	0.02	24.0	2	1	0
PRT	sp|O43242-2|PSMD3_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PSMD3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	287-UNIMOD:188	0.03	24.0	2	1	0
PRT	sp|Q15645|PCH2_HUMAN	Pachytene checkpoint protein 2 homolog OS=Homo sapiens OX=9606 GN=TRIP13 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	334-UNIMOD:4,340-UNIMOD:188	0.03	24.0	2	1	0
PRT	sp|O60925|PFD1_HUMAN	Prefoldin subunit 1 OS=Homo sapiens OX=9606 GN=PFDN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	39-UNIMOD:267,2-UNIMOD:1	0.19	24.0	3	2	1
PRT	sp|P56182|RRP1_HUMAN	Ribosomal RNA processing protein 1 homolog A OS=Homo sapiens OX=9606 GN=RRP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	25-UNIMOD:267	0.02	24.0	1	1	1
PRT	sp|Q5T3I0|GPTC4_HUMAN	G patch domain-containing protein 4 OS=Homo sapiens OX=9606 GN=GPATCH4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q8WWC4|MAIP1_HUMAN	m-AAA protease-interacting protein 1, mitochondrial OS=Homo sapiens OX=9606 GN=MAIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	258-UNIMOD:188	0.03	24.0	2	1	0
PRT	sp|Q5T0Z8|CF132_HUMAN	Uncharacterized protein C6orf132 OS=Homo sapiens OX=9606 GN=C6orf132 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	386-UNIMOD:267	0.01	24.0	1	1	1
PRT	sp|Q13247-3|SRSF6_HUMAN	Isoform SRP55-3 of Serine/arginine-rich splicing factor 6 OS=Homo sapiens OX=9606 GN=SRSF6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	154-UNIMOD:267,120-UNIMOD:267	0.06	24.0	4	2	0
PRT	sp|Q9H3N1|TMX1_HUMAN	Thioredoxin-related transmembrane protein 1 OS=Homo sapiens OX=9606 GN=TMX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|Q13200-2|PSMD2_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PSMD2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	553-UNIMOD:188	0.03	24.0	2	2	2
PRT	sp|Q9P0J0|NDUAD_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 OS=Homo sapiens OX=9606 GN=NDUFA13 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.07	24.0	1	1	1
PRT	sp|Q96Q11-3|TRNT1_HUMAN	Isoform 3 of CCA tRNA nucleotidyltransferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=TRNT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.28	24.0	1	1	1
PRT	sp|Q2TB90-3|HKDC1_HUMAN	Isoform 3 of Hexokinase HKDC1 OS=Homo sapiens OX=9606 GN=HKDC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P35250-2|RFC2_HUMAN	Isoform 2 of Replication factor C subunit 2 OS=Homo sapiens OX=9606 GN=RFC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	167-UNIMOD:267	0.03	24.0	2	1	0
PRT	sp|Q8N3X1|FNBP4_HUMAN	Formin-binding protein 4 OS=Homo sapiens OX=9606 GN=FNBP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	1005-UNIMOD:267	0.01	24.0	1	1	1
PRT	sp|Q5JNZ5|RS26L_HUMAN	Putative 40S ribosomal protein S26-like 1 OS=Homo sapiens OX=9606 GN=RPS26P11 PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	51-UNIMOD:267	0.09	24.0	2	1	0
PRT	sp|O15126-2|SCAM1_HUMAN	Isoform 2 of Secretory carrier-associated membrane protein 1 OS=Homo sapiens OX=9606 GN=SCAMP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.11	24.0	1	1	1
PRT	sp|P15104|GLNA_HUMAN	Glutamine synthetase OS=Homo sapiens OX=9606 GN=GLUL PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	346-UNIMOD:4,357-UNIMOD:267	0.05	24.0	2	1	0
PRT	sp|P08133-2|ANXA6_HUMAN	Isoform 2 of Annexin A6 OS=Homo sapiens OX=9606 GN=ANXA6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	258-UNIMOD:267	0.02	24.0	1	1	1
PRT	sp|Q9GZR1-2|SENP6_HUMAN	Isoform 2 of Sentrin-specific protease 6 OS=Homo sapiens OX=9606 GN=SENP6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P30154-4|2AAB_HUMAN	Isoform 4 of Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform OS=Homo sapiens OX=9606 GN=PPP2R1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	186-UNIMOD:4	0.02	24.0	1	1	1
PRT	sp|Q9Y2A7|NCKP1_HUMAN	Nck-associated protein 1 OS=Homo sapiens OX=9606 GN=NCKAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	599-UNIMOD:4,608-UNIMOD:188	0.01	24.0	1	1	1
PRT	sp|P46063|RECQ1_HUMAN	ATP-dependent DNA helicase Q1 OS=Homo sapiens OX=9606 GN=RECQL PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q14669-4|TRIPC_HUMAN	Isoform 4 of E3 ubiquitin-protein ligase TRIP12 OS=Homo sapiens OX=9606 GN=TRIP12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q9BZL6-2|KPCD2_HUMAN	Isoform 2 of Serine/threonine-protein kinase D2 OS=Homo sapiens OX=9606 GN=PRKD2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	573-UNIMOD:267	0.03	24.0	1	1	1
PRT	sp|Q9NTZ6|RBM12_HUMAN	RNA-binding protein 12 OS=Homo sapiens OX=9606 GN=RBM12 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	87-UNIMOD:267	0.01	24.0	1	1	1
PRT	sp|P05091-2|ALDH2_HUMAN	Isoform 2 of Aldehyde dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ALDH2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.07	24.0	2	2	2
PRT	sp|Q01415-2|GALK2_HUMAN	Isoform 2 of N-acetylgalactosamine kinase OS=Homo sapiens OX=9606 GN=GALK2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|P17612|KAPCA_HUMAN	cAMP-dependent protein kinase catalytic subunit alpha OS=Homo sapiens OX=9606 GN=PRKACA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	200-UNIMOD:4,214-UNIMOD:188	0.06	24.0	1	1	1
PRT	sp|Q8WUQ7|CATIN_HUMAN	Cactin OS=Homo sapiens OX=9606 GN=CACTIN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	424-UNIMOD:188	0.02	24.0	1	1	1
PRT	sp|Q9H9L3|I20L2_HUMAN	Interferon-stimulated 20 kDa exonuclease-like 2 OS=Homo sapiens OX=9606 GN=ISG20L2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|O75151|PHF2_HUMAN	Lysine-specific demethylase PHF2 OS=Homo sapiens OX=9606 GN=PHF2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	201-UNIMOD:267	0.01	24.0	1	1	1
PRT	sp|Q5JWF2-2|GNAS1_HUMAN	Isoform XLas-2 of Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas OS=Homo sapiens OX=9606 GN=GNAS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	840-UNIMOD:188	0.01	24.0	1	1	1
PRT	sp|P22061|PIMT_HUMAN	Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Homo sapiens OX=9606 GN=PCMT1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	144-UNIMOD:267	0.04	24.0	1	1	1
PRT	sp|Q9UL25|RAB21_HUMAN	Ras-related protein Rab-21 OS=Homo sapiens OX=9606 GN=RAB21 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	29-UNIMOD:4	0.05	24.0	1	1	1
PRT	sp|Q9BXS5|AP1M1_HUMAN	AP-1 complex subunit mu-1 OS=Homo sapiens OX=9606 GN=AP1M1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	24.0	null		0.03	24.0	2	1	0
PRT	sp|O60216|RAD21_HUMAN	Double-strand-break repair protein rad21 homolog OS=Homo sapiens OX=9606 GN=RAD21 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	78-UNIMOD:4,84-UNIMOD:188	0.02	24.0	1	1	1
PRT	sp|Q969H6-2|POP5_HUMAN	Isoform 2 of Ribonuclease P/MRP protein subunit POP5 OS=Homo sapiens OX=9606 GN=POP5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	11-UNIMOD:4	0.12	24.0	1	1	1
PRT	sp|Q13277-2|STX3_HUMAN	Isoform B of Syntaxin-3 OS=Homo sapiens OX=9606 GN=STX3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	142-UNIMOD:267	0.04	24.0	1	1	1
PRT	sp|P02545|LMNA_HUMAN	Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	24.0	null	249-UNIMOD:267,472-UNIMOD:28,482-UNIMOD:267,486-UNIMOD:188	0.04	24.0	2	2	1
PRT	sp|P15924|DESP_HUMAN	Desmoplakin OS=Homo sapiens OX=9606 GN=DSP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	2433-UNIMOD:385,2433-UNIMOD:4,2442-UNIMOD:4	0.01	24.0	1	1	1
PRT	sp|Q13885|TBB2A_HUMAN	Tubulin beta-2A chain OS=Homo sapiens OX=9606 GN=TUBB2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	354-UNIMOD:4,359-UNIMOD:267	0.02	24.0	7	1	0
PRT	sp|P11940|PABP1_HUMAN	Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	339-UNIMOD:4	0.03	24.0	1	1	0
PRT	sp|Q14008|CKAP5_HUMAN	Cytoskeleton-associated protein 5 OS=Homo sapiens OX=9606 GN=CKAP5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.01	24.0	1	1	0
PRT	sp|P78347|GTF2I_HUMAN	General transcription factor II-I OS=Homo sapiens OX=9606 GN=GTF2I PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	937-UNIMOD:188	0.01	24.0	1	1	1
PRT	sp|Q16695|H31T_HUMAN	Histone H3.1t OS=Homo sapiens OX=9606 GN=HIST3H3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	74-UNIMOD:27,80-UNIMOD:188,84-UNIMOD:267	0.09	24.0	1	1	1
PRT	sp|Q5UIP0|RIF1_HUMAN	Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	312-UNIMOD:4	0.01	24.0	1	1	0
PRT	sp|Q00653|NFKB2_HUMAN	Nuclear factor NF-kappa-B p100 subunit OS=Homo sapiens OX=9606 GN=NFKB2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	558-UNIMOD:267	0.01	24.0	1	1	1
PRT	sp|Q14203|DCTN1_HUMAN	Dynactin subunit 1 OS=Homo sapiens OX=9606 GN=DCTN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q86X55|CARM1_HUMAN	Histone-arginine methyltransferase CARM1 OS=Homo sapiens OX=9606 GN=CARM1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P16070|CD44_HUMAN	CD44 antigen OS=Homo sapiens OX=9606 GN=CD44 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	694-UNIMOD:267	0.02	24.0	1	1	0
PRT	sp|P18615|NELFE_HUMAN	Negative elongation factor E OS=Homo sapiens OX=9606 GN=NELFE PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	35-UNIMOD:28	0.04	24.0	1	1	1
PRT	sp|Q9Y3C6|PPIL1_HUMAN	Peptidyl-prolyl cis-trans isomerase-like 1 OS=Homo sapiens OX=9606 GN=PPIL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	81-UNIMOD:28,91-UNIMOD:188	0.07	24.0	2	1	0
PRT	sp|P11310|ACADM_HUMAN	Medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADM PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q9HAU5|RENT2_HUMAN	Regulator of nonsense transcripts 2 OS=Homo sapiens OX=9606 GN=UPF2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	999-UNIMOD:28,1005-UNIMOD:267,1010-UNIMOD:188	0.01	24.0	1	1	1
PRT	sp|Q8NBX0|SCPDL_HUMAN	Saccharopine dehydrogenase-like oxidoreductase OS=Homo sapiens OX=9606 GN=SCCPDH PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	98-UNIMOD:4	0.03	24.0	1	1	1
PRT	sp|P09496|CLCA_HUMAN	Clathrin light chain A OS=Homo sapiens OX=9606 GN=CLTA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	129-UNIMOD:267	0.04	24.0	2	1	0
PRT	sp|P08574|CY1_HUMAN	Cytochrome c1, heme protein, mitochondrial OS=Homo sapiens OX=9606 GN=CYC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	202-UNIMOD:267	0.05	24.0	1	1	1
PRT	sp|Q9UQB8|BAIP2_HUMAN	Brain-specific angiogenesis inhibitor 1-associated protein 2 OS=Homo sapiens OX=9606 GN=BAIAP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.03	24.0	1	1	0
PRT	sp|O95822|DCMC_HUMAN	Malonyl-CoA decarboxylase, mitochondrial OS=Homo sapiens OX=9606 GN=MLYCD PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	389-UNIMOD:188	0.03	24.0	1	1	1
PRT	sp|P04114|APOB_HUMAN	Apolipoprotein B-100 OS=Homo sapiens OX=9606 GN=APOB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.00	24.0	1	1	1
PRT	sp|Q969F9|HPS3_HUMAN	Hermansky-Pudlak syndrome 3 protein OS=Homo sapiens OX=9606 GN=HPS3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q53TN4|CYBR1_HUMAN	Cytochrome b reductase 1 OS=Homo sapiens OX=9606 GN=CYBRD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	283-UNIMOD:267	0.04	24.0	1	1	1
PRT	sp|P48553|TPC10_HUMAN	Trafficking protein particle complex subunit 10 OS=Homo sapiens OX=9606 GN=TRAPPC10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	162-UNIMOD:385,162-UNIMOD:4,170-UNIMOD:188,174-UNIMOD:267	0.01	24.0	1	1	1
PRT	sp|Q15404|RSU1_HUMAN	Ras suppressor protein 1 OS=Homo sapiens OX=9606 GN=RSU1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.07	24.0	1	1	1
PRT	sp|Q96PZ0|PUS7_HUMAN	Pseudouridylate synthase 7 homolog OS=Homo sapiens OX=9606 GN=PUS7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|O75937|DNJC8_HUMAN	DnaJ homolog subfamily C member 8 OS=Homo sapiens OX=9606 GN=DNAJC8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|P35908|K22E_HUMAN	Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens OX=9606 GN=KRT2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	353-UNIMOD:188	0.02	24.0	1	1	0
PRT	sp|A0AVF1|IFT56_HUMAN	Intraflagellar transport protein 56 OS=Homo sapiens OX=9606 GN=TTC26 PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	336-UNIMOD:267	0.03	24.0	1	1	1
PRT	sp|P49961-4|ENTP1_HUMAN	Isoform 4 of Ectonucleoside triphosphate diphosphohydrolase 1 OS=Homo sapiens OX=9606 GN=ENTPD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	1-UNIMOD:1,9-UNIMOD:267	0.05	24.0	1	1	1
PRT	sp|Q86XF7|ZN575_HUMAN	Zinc finger protein 575 OS=Homo sapiens OX=9606 GN=ZNF575 PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:267	0.09	24.0	1	1	1
PRT	sp|Q9BW30|TPPP3_HUMAN	Tubulin polymerization-promoting protein family member 3 OS=Homo sapiens OX=9606 GN=TPPP3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.09	23.0	1	1	1
PRT	sp|Q9NUQ6-2|SPS2L_HUMAN	Isoform 2 of SPATS2-like protein OS=Homo sapiens OX=9606 GN=SPATS2L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.02	23.0	1	1	1
PRT	sp|O00505|IMA4_HUMAN	Importin subunit alpha-4 OS=Homo sapiens OX=9606 GN=KPNA3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1,11-UNIMOD:267	0.02	23.0	1	1	1
PRT	sp|O94763-2|RMP_HUMAN	Isoform 2 of Unconventional prefoldin RPB5 interactor 1 OS=Homo sapiens OX=9606 GN=URI1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q9Y5K6|CD2AP_HUMAN	CD2-associated protein OS=Homo sapiens OX=9606 GN=CD2AP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	570-UNIMOD:188	0.02	23.0	1	1	1
PRT	sp|Q5SSJ5|HP1B3_HUMAN	Heterochromatin protein 1-binding protein 3 OS=Homo sapiens OX=9606 GN=HP1BP3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.03	23.0	1	1	1
PRT	sp|P25788-2|PSA3_HUMAN	Isoform 2 of Proteasome subunit alpha type-3 OS=Homo sapiens OX=9606 GN=PSMA3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	41-UNIMOD:267	0.05	23.0	1	1	1
PRT	sp|O60341|KDM1A_HUMAN	Lysine-specific histone demethylase 1A OS=Homo sapiens OX=9606 GN=KDM1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	618-UNIMOD:4,623-UNIMOD:4	0.02	23.0	1	1	1
PRT	sp|Q7LBC6-2|KDM3B_HUMAN	Isoform 2 of Lysine-specific demethylase 3B OS=Homo sapiens OX=9606 GN=KDM3B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|P38919|IF4A3_HUMAN	Eukaryotic initiation factor 4A-III OS=Homo sapiens OX=9606 GN=EIF4A3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	116-UNIMOD:267	0.03	23.0	1	1	1
PRT	sp|P47897-2|SYQ_HUMAN	Isoform 2 of Glutamine--tRNA ligase OS=Homo sapiens OX=9606 GN=QARS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	2	2	1
PRT	sp|P52756-4|RBM5_HUMAN	Isoform 4 of RNA-binding protein 5 OS=Homo sapiens OX=9606 GN=RBM5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	115-UNIMOD:267	0.09	23.0	1	1	1
PRT	sp|Q9Y2W1|TR150_HUMAN	Thyroid hormone receptor-associated protein 3 OS=Homo sapiens OX=9606 GN=THRAP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q5JUX0|SPIN3_HUMAN	Spindlin-3 OS=Homo sapiens OX=9606 GN=SPIN3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.07	23.0	1	1	1
PRT	sp|Q9BV20-2|MTNA_HUMAN	Isoform 2 of Methylthioribose-1-phosphate isomerase OS=Homo sapiens OX=9606 GN=MRI1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|P39019|RS19_HUMAN	40S ribosomal protein S19 OS=Homo sapiens OX=9606 GN=RPS19 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.08	23.0	1	1	1
PRT	sp|Q9H9S3-2|S61A2_HUMAN	Isoform 2 of Protein transport protein Sec61 subunit alpha isoform 2 OS=Homo sapiens OX=9606 GN=SEC61A2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	107-UNIMOD:188	0.02	23.0	1	1	1
PRT	sp|Q9UBQ7|GRHPR_HUMAN	Glyoxylate reductase/hydroxypyruvate reductase OS=Homo sapiens OX=9606 GN=GRHPR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q13308-4|PTK7_HUMAN	Isoform 4 of Inactive tyrosine-protein kinase 7 OS=Homo sapiens OX=9606 GN=PTK7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q9UBP6|TRMB_HUMAN	tRNA (guanine-N(7)-)-methyltransferase OS=Homo sapiens OX=9606 GN=METTL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.07	23.0	1	1	1
PRT	sp|P55196-2|AFAD_HUMAN	Isoform 1 of Afadin OS=Homo sapiens OX=9606 GN=AFDN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q969Q0|RL36L_HUMAN	60S ribosomal protein L36a-like OS=Homo sapiens OX=9606 GN=RPL36AL PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	72-UNIMOD:4,77-UNIMOD:4,78-UNIMOD:267	0.09	23.0	1	1	1
PRT	sp|Q13601-2|KRR1_HUMAN	Isoform 2 of KRR1 small subunit processome component homolog OS=Homo sapiens OX=9606 GN=KRR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|Q9BTC0-1|DIDO1_HUMAN	Isoform 1 of Death-inducer obliterator 1 OS=Homo sapiens OX=9606 GN=DIDO1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	671-UNIMOD:267	0.01	23.0	1	1	1
PRT	sp|Q13425-2|SNTB2_HUMAN	Isoform 2 of Beta-2-syntrophin OS=Homo sapiens OX=9606 GN=SNTB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.06	23.0	1	1	1
PRT	sp|Q8WUM9|S20A1_HUMAN	Sodium-dependent phosphate transporter 1 OS=Homo sapiens OX=9606 GN=SLC20A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	330-UNIMOD:267	0.02	23.0	1	1	1
PRT	sp|P00390-5|GSHR_HUMAN	Isoform 4 of Glutathione reductase, mitochondrial OS=Homo sapiens OX=9606 GN=GSR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	102-UNIMOD:4,107-UNIMOD:4	0.03	23.0	1	1	1
PRT	sp|Q9Y2H1|ST38L_HUMAN	Serine/threonine-protein kinase 38-like OS=Homo sapiens OX=9606 GN=STK38L PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q96B26|EXOS8_HUMAN	Exosome complex component RRP43 OS=Homo sapiens OX=9606 GN=EXOSC8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	60-UNIMOD:4	0.04	23.0	1	1	1
PRT	sp|Q8N565|MREG_HUMAN	Melanoregulin OS=Homo sapiens OX=9606 GN=MREG PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	184-UNIMOD:188	0.06	23.0	1	1	1
PRT	sp|Q71RC2-7|LARP4_HUMAN	Isoform 7 of La-related protein 4 OS=Homo sapiens OX=9606 GN=LARP4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q86TB9-2|PATL1_HUMAN	Isoform 2 of Protein PAT1 homolog 1 OS=Homo sapiens OX=9606 GN=PATL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	351-UNIMOD:267	0.02	23.0	1	1	1
PRT	sp|Q16851-2|UGPA_HUMAN	Isoform 2 of UTP--glucose-1-phosphate uridylyltransferase OS=Homo sapiens OX=9606 GN=UGP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	301-UNIMOD:188	0.02	23.0	1	1	1
PRT	sp|P17980|PRS6A_HUMAN	26S proteasome regulatory subunit 6A OS=Homo sapiens OX=9606 GN=PSMC3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	36-UNIMOD:35,44-UNIMOD:267	0.02	23.0	1	1	1
PRT	sp|Q4VC31|CCD58_HUMAN	Coiled-coil domain-containing protein 58 OS=Homo sapiens OX=9606 GN=CCDC58 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	100-UNIMOD:188	0.07	23.0	1	1	1
PRT	sp|P30085-2|KCY_HUMAN	Isoform 2 of UMP-CMP kinase OS=Homo sapiens OX=9606 GN=CMPK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.07	23.0	1	1	1
PRT	sp|P51812|KS6A3_HUMAN	Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens OX=9606 GN=RPS6KA3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	723-UNIMOD:267	0.02	23.0	1	1	1
PRT	sp|Q9UGI8|TES_HUMAN	Testin OS=Homo sapiens OX=9606 GN=TES PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	101-UNIMOD:188	0.03	23.0	1	1	1
PRT	sp|P35658-2|NU214_HUMAN	Isoform 2 of Nuclear pore complex protein Nup214 OS=Homo sapiens OX=9606 GN=NUP214	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q969U7-2|PSMG2_HUMAN	Isoform 2 of Proteasome assembly chaperone 2 OS=Homo sapiens OX=9606 GN=PSMG2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	134-UNIMOD:188	0.04	23.0	1	1	1
PRT	sp|Q9NYL9|TMOD3_HUMAN	Tropomodulin-3 OS=Homo sapiens OX=9606 GN=TMOD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|P01116|RASK_HUMAN	GTPase KRas OS=Homo sapiens OX=9606 GN=KRAS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	80-UNIMOD:4,88-UNIMOD:188	0.08	23.0	1	1	1
PRT	sp|Q9UIJ7|KAD3_HUMAN	GTP:AMP phosphotransferase AK3, mitochondrial OS=Homo sapiens OX=9606 GN=AK3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	104-UNIMOD:267	0.05	23.0	1	1	1
PRT	sp|Q86Y07-4|VRK2_HUMAN	Isoform 4 of Serine/threonine-protein kinase VRK2 OS=Homo sapiens OX=9606 GN=VRK2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	159-UNIMOD:188	0.04	23.0	1	1	1
PRT	sp|Q86U42-2|PABP2_HUMAN	Isoform 2 of Polyadenylate-binding protein 2 OS=Homo sapiens OX=9606 GN=PABPN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|Q9NPJ3|ACO13_HUMAN	Acyl-coenzyme A thioesterase 13 OS=Homo sapiens OX=9606 GN=ACOT13 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.09	23.0	1	1	1
PRT	sp|P51003|PAPOA_HUMAN	Poly(A) polymerase alpha OS=Homo sapiens OX=9606 GN=PAPOLA PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	736-UNIMOD:188	0.03	23.0	1	1	1
PRT	sp|Q96GQ7|DDX27_HUMAN	Probable ATP-dependent RNA helicase DDX27 OS=Homo sapiens OX=9606 GN=DDX27 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	545-UNIMOD:188	0.02	23.0	1	1	1
PRT	sp|P30740|ILEU_HUMAN	Leukocyte elastase inhibitor OS=Homo sapiens OX=9606 GN=SERPINB1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|Q99797|MIPEP_HUMAN	Mitochondrial intermediate peptidase OS=Homo sapiens OX=9606 GN=MIPEP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	126-UNIMOD:188	0.01	23.0	1	1	1
PRT	sp|P62318-2|SMD3_HUMAN	Isoform 2 of Small nuclear ribonucleoprotein Sm D3 OS=Homo sapiens OX=9606 GN=SNRPD3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	64-UNIMOD:267	0.09	23.0	1	1	1
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.04	23.0	1	1	1
PRT	sp|Q96HQ2-2|C2AIL_HUMAN	Isoform 2 of CDKN2AIP N-terminal-like protein OS=Homo sapiens OX=9606 GN=CDKN2AIPNL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	18-UNIMOD:267	0.21	23.0	1	1	1
PRT	sp|O75533|SF3B1_HUMAN	Splicing factor 3B subunit 1 OS=Homo sapiens OX=9606 GN=SF3B1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	1035-UNIMOD:4,1041-UNIMOD:267	0.01	23.0	1	1	1
PRT	sp|P43686-2|PRS6B_HUMAN	Isoform 2 of 26S proteasome regulatory subunit 6B OS=Homo sapiens OX=9606 GN=PSMC4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|O00571-2|DDX3X_HUMAN	Isoform 2 of ATP-dependent RNA helicase DDX3X OS=Homo sapiens OX=9606 GN=DDX3X	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|P13646|K1C13_HUMAN	Keratin, type I cytoskeletal 13 OS=Homo sapiens OX=9606 GN=KRT13 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	21-UNIMOD:4,27-UNIMOD:267	0.05	23.0	1	1	0
PRT	sp|Q16555|DPYL2_HUMAN	Dihydropyrimidinase-related protein 2 OS=Homo sapiens OX=9606 GN=DPYSL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	451-UNIMOD:188	0.02	23.0	1	1	0
PRT	sp|Q5T8P6|RBM26_HUMAN	RNA-binding protein 26 OS=Homo sapiens OX=9606 GN=RBM26 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	597-UNIMOD:267	0.01	23.0	1	1	1
PRT	sp|P12955|PEPD_HUMAN	Xaa-Pro dipeptidase OS=Homo sapiens OX=9606 GN=PEPD PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	58-UNIMOD:4,66-UNIMOD:267	0.02	23.0	1	1	1
PRT	sp|P31949|S10AB_HUMAN	Protein S100-A11 OS=Homo sapiens OX=9606 GN=S100A11 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	52-UNIMOD:188	0.16	23.0	1	1	1
PRT	sp|Q9H9J2|RM44_HUMAN	39S ribosomal protein L44, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL44 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	null	260-UNIMOD:28,276-UNIMOD:4,278-UNIMOD:188,279-UNIMOD:188	0.06	23.0	1	1	1
PRT	sp|P51580|TPMT_HUMAN	Thiopurine S-methyltransferase OS=Homo sapiens OX=9606 GN=TPMT PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	null	216-UNIMOD:385,216-UNIMOD:4,219-UNIMOD:188,226-UNIMOD:267	0.05	23.0	1	1	1
PRT	sp|Q6PK04|CC137_HUMAN	Coiled-coil domain-containing protein 137 OS=Homo sapiens OX=9606 GN=CCDC137 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|P59998|ARPC4_HUMAN	Actin-related protein 2/3 complex subunit 4 OS=Homo sapiens OX=9606 GN=ARPC4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	71-UNIMOD:267	0.07	23.0	1	1	1
PRT	sp|Q9NUW8|TYDP1_HUMAN	Tyrosyl-DNA phosphodiesterase 1 OS=Homo sapiens OX=9606 GN=TDP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|P19878|NCF2_HUMAN	Neutrophil cytosol factor 2 OS=Homo sapiens OX=9606 GN=NCF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|O15371|EIF3D_HUMAN	Eukaryotic translation initiation factor 3 subunit D OS=Homo sapiens OX=9606 GN=EIF3D PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	1	1	0
PRT	sp|A0FGR8|ESYT2_HUMAN	Extended synaptotagmin-2 OS=Homo sapiens OX=9606 GN=ESYT2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.01	23.0	1	1	0
PRT	sp|Q13085|ACACA_HUMAN	Acetyl-CoA carboxylase 1 OS=Homo sapiens OX=9606 GN=ACACA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	2161-UNIMOD:267	0.01	23.0	1	1	1
PRT	sp|Q13315|ATM_HUMAN	Serine-protein kinase ATM OS=Homo sapiens OX=9606 GN=ATM PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	900-UNIMOD:35	0.00	23.0	1	1	1
PRT	sp|Q86TU7|SETD3_HUMAN	Actin-histidine N-methyltransferase OS=Homo sapiens OX=9606 GN=SETD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|O75530|EED_HUMAN	Polycomb protein EED OS=Homo sapiens OX=9606 GN=EED PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q9C0D5|TANC1_HUMAN	Protein TANC1 OS=Homo sapiens OX=9606 GN=TANC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	437-UNIMOD:35	0.01	23.0	1	1	1
PRT	sp|P29350|PTN6_HUMAN	Tyrosine-protein phosphatase non-receptor type 6 OS=Homo sapiens OX=9606 GN=PTPN6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.03	23.0	1	1	0
PRT	sp|Q8IWY8-3|ZSC29_HUMAN	Isoform 3 of Zinc finger and SCAN domain-containing protein 29 OS=Homo sapiens OX=9606 GN=ZSCAN29	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	512-UNIMOD:188,515-UNIMOD:4	0.03	23.0	1	1	1
PRT	sp|Q96QU1|PCD15_HUMAN	Protocadherin-15 OS=Homo sapiens OX=9606 GN=PCDH15 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	1230-UNIMOD:188	0.01	23.0	1	1	1
PRT	sp|Q06481|APLP2_HUMAN	Amyloid-like protein 2 OS=Homo sapiens OX=9606 GN=APLP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|A8MZ36|EVPLL_HUMAN	Envoplakin-like protein OS=Homo sapiens OX=9606 GN=EVPLL PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.06	23.0	1	1	1
PRT	sp|Q9UPT6|JIP3_HUMAN	C-Jun-amino-terminal kinase-interacting protein 3 OS=Homo sapiens OX=9606 GN=MAPK8IP3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	42-UNIMOD:267,46-UNIMOD:4	0.01	23.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	QGVHAAGAAEAGPLASVPAQSAK	1	sp|Q96H79|ZCCHL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	53.0	1-UNIMOD:28	ms_run[1]:scan=6486	37.170365000000004	2	2070.0514	2070.0489	K	K	269	292
PSM	NVASGGGGVGDGVQEPTTGNWR	2	sp|O00429-3|DNM1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0		ms_run[2]:scan=6191	35.549	2	2113.9777	2113.9777	K	G	543	565
PSM	AENNSEVGASGYGVPGPTWDR	3	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	21-UNIMOD:267	ms_run[2]:scan=7830	44.572	2	2171.9747	2171.9747	K	G	121	142
PSM	LQSSSASYGGGFGGGSCQLGGGR	4	sp|P13646-3|K1C13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	17-UNIMOD:4,23-UNIMOD:267	ms_run[2]:scan=5917	34.131	2	2155.958	2155.9580	R	G	5	28
PSM	FGVSSSSSGPSQTLTSTGNFK	5	sp|P49790-2|NU153_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0		ms_run[2]:scan=7343	41.817	2	2074.9807	2074.9807	K	F	863	884
PSM	GGMGSGGLATGIAGGLAGMGGIQNEK	6	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	19-UNIMOD:35	ms_run[2]:scan=9137	51.929	2	2276.0889	2276.0889	R	E	56	82
PSM	GGMGSGGLATGIAGGLAGMGGIQNEK	7	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	3-UNIMOD:35	ms_run[2]:scan=10347	59.152	2	2276.0889	2276.0889	R	E	56	82
PSM	GPNQPVESDESLGGLSAALR	8	sp|P51617-4|IRAK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0		ms_run[2]:scan=9475	53.845	2	1995.9861	1995.9861	R	S	502	522
PSM	GGMGSGGLATGIAGGLAGMGGIQNEK	9	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	26-UNIMOD:188	ms_run[2]:scan=11003	63.267	2	2266.1141	2266.1141	R	E	56	82
PSM	GPNQPVESDESLGGLSAALR	10	sp|P51617-4|IRAK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	20-UNIMOD:267	ms_run[2]:scan=9473	53.833	2	2005.9944	2005.9944	R	S	502	522
PSM	LVGQGASAVLLDLPNSGGEAQAK	11	sp|Q99714-2|HCD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	23-UNIMOD:188	ms_run[2]:scan=9866	55.989	2	2200.1795	2200.1795	R	K	30	53
PSM	LVSPGSANETSSILVESVTR	12	sp|O75369-6|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	20-UNIMOD:267	ms_run[2]:scan=9759	55.432	2	2055.0723	2055.0723	R	S	2411	2431
PSM	NVASGGGGVGDGVQEPTTGNWR	13	sp|O00429-3|DNM1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	22-UNIMOD:267	ms_run[2]:scan=6172	35.454	2	2123.986	2123.9860	K	G	543	565
PSM	PVSSAASVYAGAGGSGSR	14	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	18-UNIMOD:267	ms_run[2]:scan=3743	22.931	2	1589.7673	1589.7673	R	I	28	46
PSM	SSGSPYGGGYGSGGGSGGYGSR	15	sp|P51991-2|ROA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	22-UNIMOD:267	ms_run[2]:scan=3287	20.633	2	1919.791	1919.7910	R	R	333	355
PSM	VVAPTISSPVCQEQLVEAGR	16	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	11-UNIMOD:4	ms_run[2]:scan=8552	48.568	2	2139.0994	2139.0994	K	L	722	742
PSM	QKGADFLVTEVENGGSLGSK	17	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	48.0	1-UNIMOD:28	ms_run[1]:scan=10981	63.127918333333334	2	2017.9985	2017.9951	K	K	187	207
PSM	GGMGSGGLATGIAGGLAGMGGIQNEK	18	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	3-UNIMOD:35,26-UNIMOD:188	ms_run[2]:scan=10279	58.689	2	2282.109	2282.1090	R	E	56	82
PSM	LVGQGASAVLLDLPNSGGEAQAK	19	sp|Q99714-2|HCD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0		ms_run[2]:scan=9867	55.994	2	2194.1594	2194.1594	R	K	30	53
PSM	LVGQGASAVLLDLPNSGGEAQAK	20	sp|Q99714-2|HCD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0		ms_run[2]:scan=9868	55.999	3	2194.1594	2194.1594	R	K	30	53
PSM	SSGSPYGGGYGSGGGSGGYGSR	21	sp|P51991-2|ROA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0		ms_run[2]:scan=3305	20.737	2	1909.7827	1909.7827	R	R	333	355
PSM	TIGGGDDSFNTFFSETGAGK	22	sp|Q9BQE3|TBA1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	20-UNIMOD:188	ms_run[2]:scan=10918	62.739	2	2012.9059	2012.9059	K	H	41	61
PSM	AFLASPEYVNLPINGNGKQ	23	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	47.0	18-UNIMOD:188	ms_run[1]:scan=10937	62.85525666666666	2	2038.052239	2037.062670	K	-	192	211
PSM	DVAWAPSIGLPTSTIASCSQDGR	24	sp|P55735-2|SEC13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	18-UNIMOD:4	ms_run[2]:scan=11404	65.806	2	2388.138	2388.1380	R	V	203	226
PSM	FGVSSSSSGPSQTLTSTGNFK	25	sp|P49790-2|NU153_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	21-UNIMOD:188	ms_run[2]:scan=7344	41.823	2	2081.0009	2081.0009	K	F	863	884
PSM	FSLCSDNLEGISEGPSNR	26	sp|Q14C86-3|GAPD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	4-UNIMOD:4	ms_run[2]:scan=9113	51.781	2	1980.8847	1980.8847	R	S	565	583
PSM	ILATPPQEDAPSVDIANIR	27	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	19-UNIMOD:267	ms_run[2]:scan=9344	53.095	2	2029.0719	2029.0719	K	M	284	303
PSM	ILQACGGNSLGSYSASQGVNCIR	28	sp|Q8TD30|ALAT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	5-UNIMOD:4,21-UNIMOD:4	ms_run[2]:scan=7661	43.653	2	2411.1322	2411.1322	R	E	138	161
PSM	IPSAVGYQPTLATDMGTMQER	29	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	21-UNIMOD:267	ms_run[2]:scan=9463	53.771	2	2275.0852	2275.0852	R	I	325	346
PSM	ISLGLPVGAVINCADNTGAK	30	sp|P62829|RL23_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	13-UNIMOD:4,20-UNIMOD:188	ms_run[2]:scan=11454	66.114	2	1975.0504	1975.0504	R	N	16	36
PSM	ISLGLPVGAVINCADNTGAK	31	sp|P62829|RL23_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	13-UNIMOD:4	ms_run[2]:scan=11455	66.12	2	1969.0303	1969.0303	R	N	16	36
PSM	LFGEAGPASGVGSSGGGGSGSGTGGGDAALDFK	32	sp|Q8IWZ3|ANKH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=9313	52.919	2	2783.2634	2783.2634	R	L	46	79
PSM	MDLAAAAEPGAGSQHLEVR	33	sp|Q14566|MCM6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	1-UNIMOD:1	ms_run[2]:scan=9294	52.817	2	1963.9422	1963.9422	-	D	1	20
PSM	MMDYLQGSGETPQTDVR	34	sp|Q14697|GANAB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	1-UNIMOD:35,17-UNIMOD:267	ms_run[2]:scan=6243	35.808	2	1952.8483	1952.8483	K	W	338	355
PSM	PTEICADPQFIIGGATR	35	sp|P17655|CAN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	5-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=9752	55.391	2	1854.9174	1854.9174	R	T	78	95
PSM	PVSSAASVYAGAGGSGSR	36	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=3980	24.114	2	1579.759	1579.7590	R	I	28	46
PSM	TGLTPLMEAASGGYAEVGR	37	sp|Q8IWZ3|ANKH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	19-UNIMOD:267	ms_run[2]:scan=11026	63.407	2	1888.9228	1888.9228	K	V	1256	1275
PSM	VVAPTISSPVCQEQLVEAGR	38	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	11-UNIMOD:4,20-UNIMOD:267	ms_run[2]:scan=8549	48.552	2	2149.1077	2149.1077	K	L	722	742
PSM	QKGADFLVTEVENGGSLGSK	39	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	46.0	1-UNIMOD:28,2-UNIMOD:188,20-UNIMOD:188	ms_run[1]:scan=10963	63.016425	2	2032.0322	2030.0352	K	K	187	207
PSM	GGMGSGGLATGIAGGLAGMGGIQNEK	40	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	3-UNIMOD:35,19-UNIMOD:35,26-UNIMOD:188	ms_run[2]:scan=8207	46.683	2	2298.104	2298.1040	R	E	56	82
PSM	GLLSDSMTDVPVDTGVAAR	41	sp|O43399-2|TPD54_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	19-UNIMOD:267	ms_run[2]:scan=9733	55.286	2	1912.944	1912.9440	K	T	16	35
PSM	GVPESLASGEGAGAGLPALDLAK	42	sp|O95865|DDAH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=10861	62.393	2	2079.0848	2079.0848	R	A	18	41
PSM	IAQFLSDIPETVPLSTVNR	43	sp|P09110-2|THIK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=12329	71.795	2	2099.1263	2099.1263	R	Q	103	122
PSM	IGMDALQIYPISQANANQR	44	sp|Q92620-2|PRP16_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=10878	62.495	2	2102.0579	2102.0579	R	S	147	166
PSM	LGNDFMGITLASSQAVSNAR	45	sp|Q9HC38|GLOD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=11332	65.353	2	2051.0106	2051.0106	K	K	97	117
PSM	LVPLLDTGDIIIDGGNSEYR	46	sp|P52209-2|6PGD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	20-UNIMOD:267	ms_run[2]:scan=13049	76.516	2	2169.1193	2169.1193	K	D	75	95
PSM	PVSSAASVYAGAGGSGSR	47	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	18-UNIMOD:267	ms_run[2]:scan=4018	24.298	2	1589.7673	1589.7673	R	I	28	46
PSM	PVSSAASVYAGAGGSGSR	48	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=3751	22.974	2	1579.759	1579.7590	R	I	28	46
PSM	SGNWESSEGWGAQPEGAGAQR	49	sp|Q9Y5X1|SNX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	21-UNIMOD:267	ms_run[2]:scan=6521	37.365	2	2169.9339	2169.9339	K	N	116	137
PSM	SQLDLFDDVGTFASGPPK	50	sp|Q8N6H7-3|ARFG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	18-UNIMOD:188	ms_run[2]:scan=12571	73.36	2	1898.9357	1898.9357	R	Y	71	89
PSM	TPASINATPANINLADLTR	51	sp|Q7KZ85|SPT6H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=10515	60.238	2	1952.0327	1952.0327	R	A	1532	1551
PSM	AFLASPEYVNLPINGNGKQ	52	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0	18-UNIMOD:188	ms_run[1]:scan=10657	61.14203333333334	2	2038.070672	2037.062670	K	-	192	211
PSM	ISLGLPVGAVINCADNTGAK	53	sp|P62829|RL23_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0	13-UNIMOD:4,20-UNIMOD:188	ms_run[1]:scan=11092	63.816606666666665	2	1976.040261	1975.050391	R	N	16	36
PSM	AENNSEVGASGYGVPGPTWDR	54	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=7828	44.562	2	2161.9665	2161.9665	K	G	121	142
PSM	AIGVLTSGGDAQGMNAAVR	55	sp|P17858|PFKAL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	19-UNIMOD:267	ms_run[2]:scan=7201	40.934	2	1796.9078	1796.9079	K	A	17	36
PSM	GGMGSGGLATGIAGGLAGMGGIQNEK	56	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	3-UNIMOD:35,19-UNIMOD:35	ms_run[2]:scan=8209	46.694	2	2292.0838	2292.0838	R	E	56	82
PSM	GGMGSGGLATGIAGGLAGMGGIQNEK	57	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	19-UNIMOD:35,26-UNIMOD:188	ms_run[2]:scan=9128	51.874	2	2282.109	2282.1090	R	E	56	82
PSM	KEESEESDDDMGFGLFD	58	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:188	ms_run[2]:scan=11580	66.889	2	1954.7722	1954.7722	K	-	99	116
PSM	LAAQPLCMTQPTASGTLR	59	sp|Q9BST9|RTKN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	7-UNIMOD:4,18-UNIMOD:267	ms_run[2]:scan=7610	43.372	2	1924.9738	1924.9738	R	V	300	318
PSM	LVSPGSANETSSILVESVTR	60	sp|O75369-6|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=9779	55.545	2	2045.0641	2045.0641	R	S	2411	2431
PSM	MAPYQGPDAVPGALDYK	61	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:35	ms_run[2]:scan=7631	43.49	2	1807.8451	1807.8451	R	S	883	900
PSM	MMDYLQGSGETPQTDVR	62	sp|Q14697|GANAB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:35	ms_run[2]:scan=6237	35.776	2	1942.8401	1942.8401	K	W	338	355
PSM	NIIVFYGSQTGTAEEFANR	63	sp|P16435|NCPR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=10509	60.197	2	2116.0225	2116.0225	R	L	79	98
PSM	NVFIAQNVASLQELGGSEK	64	sp|Q5T4S7-3|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=10847	62.311	2	2003.0324	2003.0324	K	L	237	256
PSM	PTEICADPQFIIGGATR	65	sp|P17655|CAN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	5-UNIMOD:4	ms_run[2]:scan=9758	55.427	2	1844.9091	1844.9091	R	T	78	95
PSM	SGGSGGCSGAGGASNCGTGSGR	66	sp|Q15005|SPCS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	7-UNIMOD:4,16-UNIMOD:4,22-UNIMOD:267	ms_run[2]:scan=441	6.0659	2	1866.7209	1866.7209	R	S	11	33
PSM	TPGSLGSSASAGQAAASAPLPLESGELSR	67	sp|Q9BZE9-4|ASPC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=9173	52.128	2	2668.3304	2668.3304	K	G	104	133
PSM	TVITPDPNLSIDQVGVPR	68	sp|P24928|RPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=9689	55.035	2	1920.0316	1920.0316	R	S	365	383
PSM	YTPSGQAGAAASESLFVSNHAY	69	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=9131	51.89	2	2227.0182	2227.0182	K	-	343	365
PSM	QPYAVSELAGHQTSAESWGTGR	70	sp|P36578|RL4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44.0	1-UNIMOD:28	ms_run[1]:scan=9538	54.208506666666665	2	2315.0682	2314.0612	R	A	50	72
PSM	QGQGQLVTCSGAFKEGSLR	71	sp|Q16531|DDB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44.0	1-UNIMOD:28,9-UNIMOD:4,14-UNIMOD:188,19-UNIMOD:267	ms_run[1]:scan=7640	43.541648333333335	2	2021.0021	2020.9966	R	I	370	389
PSM	QAHLCVLASNCDEPMYVK	72	sp|P25398|RS12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44.0	1-UNIMOD:28,5-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=9147	51.98404166666667	2	2116.9406	2116.9375	R	L	46	64
PSM	QATVGDINTERPGMLDFTGK	73	sp|P07108|ACBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44.0	1-UNIMOD:28	ms_run[1]:scan=10062	57.15620666666666	2	2132.0212	2132.0203	K	A	34	54
PSM	QGGASQSDKTPEELFHPLGADSQV	74	sp|P11166|GTR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44.0	1-UNIMOD:28	ms_run[1]:scan=10525	60.30005666666666	2	2480.1502	2480.1450	R	-	469	493
PSM	AASAAAASAAAASAASGSPGPGEGSAGGEKR	75	sp|Q13263-2|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:1	ms_run[2]:scan=7081	40.287	2	2584.2113	2584.2113	M	S	2	33
PSM	CGPVCYSPEGGVHYVAGTGGLGPA	76	sp|O75414-2|NDK6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:4,5-UNIMOD:4	ms_run[2]:scan=9030	51.264	2	2361.0518	2361.0518	R	-	96	120
PSM	FDSNNVVLIEDNGNPVGTR	77	sp|Q6P1L8|RM14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=8570	48.661	2	2058.997	2058.9970	R	I	100	119
PSM	FLDGIYVSEKGTVQQADE	78	sp|P32969|RL9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	10-UNIMOD:188	ms_run[2]:scan=9153	52.015	2	2003.9783	2003.9783	K	-	175	193
PSM	FQMPDQGMTSADDFFQGTK	79	sp|Q16555-2|DPYL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=11286	65.064	2	2149.9085	2149.9085	R	A	40	59
PSM	FSPDGELYASGSEDGTLR	80	sp|Q9Y3F4|STRAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	18-UNIMOD:267	ms_run[2]:scan=7709	43.937	2	1909.8569	1909.8569	R	L	273	291
PSM	FSPDGELYASGSEDGTLR	81	sp|Q9Y3F4|STRAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=7719	43.993	2	1899.8487	1899.8487	R	L	273	291
PSM	GGMGSGGLATGIAGGLAGMGGIQNEK	82	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=10996	63.222	2	2260.094	2260.0940	R	E	56	82
PSM	GLLSDSMTDVPVDTGVAAR	83	sp|O43399-2|TPD54_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=9753	55.396	2	1902.9357	1902.9357	K	T	16	35
PSM	IPSAVGYQPTLATDMGTMQER	84	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	18-UNIMOD:35	ms_run[2]:scan=8386	47.643	2	2281.0719	2281.0719	R	I	325	346
PSM	KENVATTDTLESTTVGTSV	85	sp|Q15046|SYK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=6728	38.413	2	1951.9586	1951.9586	K	-	579	598
PSM	LGDLLISQFSGPSAEQMCK	86	sp|Q92974-3|ARHG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	18-UNIMOD:4	ms_run[2]:scan=11317	65.255	2	2079.9969	2079.9969	R	T	290	309
PSM	LWAPEEDPATEGGATPVPR	87	sp|Q6F5E8-2|CARL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=8037	45.676	2	1991.9589	1991.9589	R	T	1038	1057
PSM	NVMSAFGLTDDQVSGPPSAPAEDR	88	sp|Q92734-4|TFG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	24-UNIMOD:267	ms_run[2]:scan=10640	61.034	2	2470.131	2470.1310	K	S	180	204
PSM	PVSSAASVYAGAGGSGSR	89	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	18-UNIMOD:267	ms_run[2]:scan=3553	21.926	2	1589.7673	1589.7673	R	I	28	46
PSM	SELPLDPLPVPTEEGNPLLK	90	sp|Q15758|AAAT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	20-UNIMOD:188	ms_run[2]:scan=12831	75.042	2	2163.177	2163.1770	K	H	503	523
PSM	SLLVIPNTLAVNAAQDSTDLVAK	91	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	23-UNIMOD:188	ms_run[2]:scan=13036	76.428	2	2358.3102	2358.3102	R	L	444	467
PSM	SMLQATAEANNLAAVAGAR	92	sp|Q8NHH9-3|ATLA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	19-UNIMOD:267	ms_run[2]:scan=9572	54.403	2	1867.945	1867.9450	K	D	202	221
PSM	SVAPAAPTSCDFSPGDLVWAK	93	sp|P52701|MSH6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	10-UNIMOD:4	ms_run[2]:scan=11162	64.261	2	2175.0307	2175.0307	R	M	79	100
PSM	TAWGQQPDLAANEAQLLR	94	sp|Q9UNM6|PSD13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=10377	59.342	2	1981.0017	1981.0017	K	K	253	271
PSM	TIGGGDDSFNTFFSETGAGK	95	sp|Q9BQE3|TBA1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=10873	62.468	2	2006.8858	2006.8858	K	H	41	61
PSM	TIGGGDDSFTTFFCETGAGK	96	sp|P68366-2|TBA4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	14-UNIMOD:4	ms_run[2]:scan=11624	67.17	2	2066.8891	2066.8891	K	H	26	46
PSM	TVDSQGPTPVCTPTFLER	97	sp|Q9BYG3|MK67I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	11-UNIMOD:4,18-UNIMOD:267	ms_run[2]:scan=8658	49.144	2	2013.9705	2013.9705	K	R	227	245
PSM	TVITPDPNLSIDQVGVPR	98	sp|P24928|RPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	18-UNIMOD:267	ms_run[2]:scan=9697	55.084	2	1930.0399	1930.0399	R	S	365	383
PSM	VGAIPANALDDGQWSQGLISAAR	99	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	23-UNIMOD:267	ms_run[2]:scan=11877	68.773	2	2319.1847	2319.1847	K	M	2376	2399
PSM	VGAIPANALDDGQWSQGLISAAR	100	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=11880	68.795	2	2309.1764	2309.1764	K	M	2376	2399
PSM	VLLQASQDENFGNTTPR	101	sp|P57740|NU107_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=6784	38.724	2	1888.9279	1888.9279	R	N	32	49
PSM	VNAGDQPGADLGPLITPQAK	102	sp|Q02252-2|MMSA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=8643	49.058	2	1961.0218	1961.0218	R	E	332	352
PSM	QKGADFLVTEVENGGSLGSK	103	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	1-UNIMOD:28,2-UNIMOD:188,20-UNIMOD:188	ms_run[1]:scan=11284	65.05149499999999	2	2031.0212	2030.0352	K	K	187	207
PSM	ISLGLPVGAVINCADNTGAK	104	sp|P62829|RL23_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	13-UNIMOD:4	ms_run[1]:scan=11084	63.770185	2	1971.025550	1969.030262	R	N	16	36
PSM	VIGLSSDLQQVGGASAR	105	sp|O00303|EIF3F_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	17-UNIMOD:267	ms_run[1]:scan=8078	45.91511	2	1667.892343	1666.887767	R	I	262	279
PSM	QATVGDINTERPGMLDFTGK	106	sp|P07108|ACBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	1-UNIMOD:28,11-UNIMOD:267,20-UNIMOD:188	ms_run[1]:scan=10085	57.31731666666666	2	2148.0493	2148.0487	K	A	34	54
PSM	AFLASPEYVNLPINGNGKQ	107	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=10655	61.125	2	2031.0425	2031.0425	K	-	192	211
PSM	AIGVLTSGGDAQGMNAAVR	108	sp|P17858|PFKAL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=7200	40.928	2	1786.8996	1786.8996	K	A	17	36
PSM	AVCMLSNTTAVAEAWAR	109	sp|Q9BQE3|TBA1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=11275	64.993	2	1859.8898	1859.8898	R	L	374	391
PSM	FQDGDLTLYQSNTILR	110	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	16-UNIMOD:267	ms_run[2]:scan=10372	59.308	2	1892.9508	1892.9508	K	H	56	72
PSM	FQDVGPQAPVGSVYQK	111	sp|Q9UJU6|DBNL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=6392	36.65	2	1718.8628	1718.8628	R	T	149	165
PSM	FQMPDQGMTSADDFFQGTK	112	sp|Q16555-2|DPYL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	19-UNIMOD:188	ms_run[2]:scan=11288	65.075	2	2155.9286	2155.9286	R	A	40	59
PSM	GTPEQPQCGFSNAVVQILR	113	sp|Q86SX6|GLRX5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	8-UNIMOD:4,19-UNIMOD:267	ms_run[2]:scan=11758	68	2	2110.0505	2110.0505	K	L	60	79
PSM	GTPEQPQCGFSNAVVQILR	114	sp|Q86SX6|GLRX5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	8-UNIMOD:4	ms_run[2]:scan=11760	68.01	2	2100.0422	2100.0422	K	L	60	79
PSM	IFCGDLGNEVNDDILAR	115	sp|Q9BTD8-4|RBM42_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=10545	60.425	2	1929.913	1929.9130	R	A	349	366
PSM	ILATPPQEDAPSVDIANIR	116	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=9346	53.104	2	2019.0637	2019.0637	K	M	284	303
PSM	IPDEFDNDPILVQQLR	117	sp|Q3ZCQ8-2|TIM50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	16-UNIMOD:267	ms_run[2]:scan=11251	64.837	2	1920.9821	1920.9821	K	R	201	217
PSM	IPSAVGYQPTLATDMGTMQER	118	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=9459	53.746	2	2265.077	2265.0770	R	I	325	346
PSM	IYELAAGGTAVGTGLNTR	119	sp|P07954-2|FUMH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	18-UNIMOD:267	ms_run[2]:scan=7963	45.265	2	1772.9296	1772.9296	R	I	226	244
PSM	IYELAAGGTAVGTGLNTR	120	sp|P07954-2|FUMH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=7965	45.276	2	1762.9214	1762.9214	R	I	226	244
PSM	LSLQNCCLTGAGCGVLSSTLR	121	sp|P13489|RINI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	6-UNIMOD:4,7-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=10603	60.801	2	2266.0868	2266.0868	K	T	90	111
PSM	NIELICQENEGENDPVLQR	122	sp|Q15691|MARE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	6-UNIMOD:4,19-UNIMOD:267	ms_run[2]:scan=8604	48.85	2	2279.0727	2279.0727	R	I	223	242
PSM	NQGGYGGSSSSSSYGSGR	123	sp|P09651-3|ROA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	18-UNIMOD:267	ms_run[2]:scan=1058	9.3838	2	1703.7011	1703.7011	R	R	248	266
PSM	SETAPAAPAAPAPAEKTPVK	124	sp|P10412|H14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:1	ms_run[2]:scan=4362	26.057	2	1945.0157	1945.0157	M	K	2	22
PSM	SLGYAYVNFQQPADAER	125	sp|Q13310-3|PABP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	17-UNIMOD:267	ms_run[2]:scan=8810	49.941	2	1937.9147	1937.9147	R	A	51	68
PSM	SSFLQVFNNSPDESSYYR	126	sp|Q15436-2|SC23A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=11446	66.064	2	2138.9545	2138.9545	R	H	385	403
PSM	TAAANAAAGAAENAFRAP	127	sp|O14828-2|SCAM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	16-UNIMOD:267	ms_run[2]:scan=7902	44.955	2	1653.8099	1653.8099	R	-	304	322
PSM	TGASFQQAQEEFSQGIFSSR	128	sp|O15127|SCAM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	20-UNIMOD:267	ms_run[2]:scan=11581	66.895	2	2214.0217	2214.0217	R	T	293	313
PSM	TPDGTENGDFLALDLGGTNFR	129	sp|P19367-4|HXK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	21-UNIMOD:267	ms_run[2]:scan=12374	72.088	2	2219.037	2219.0370	R	V	507	528
PSM	VIVVGNPANTNCLTASK	130	sp|P40925-2|MDHC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	12-UNIMOD:4	ms_run[2]:scan=6476	37.117	2	1756.9142	1756.9142	K	S	37	54
PSM	VLCPIIQTADYPINLAAIK	131	sp|Q7Z460-4|CLAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:4	ms_run[2]:scan=13095	76.812	2	2112.1653	2112.1653	K	M	1365	1384
PSM	VPEIEVTVEGPNNNNPQTSAVR	132	sp|P78347-2|GTF2I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	22-UNIMOD:267	ms_run[2]:scan=7625	43.454	2	2373.18	2373.1800	K	T	640	662
PSM	VWLDPNETNEIANANSR	133	sp|P84098|RL19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	17-UNIMOD:267	ms_run[2]:scan=8304	47.193	2	1951.9263	1951.9263	K	Q	22	39
PSM	AFLASPEYVNLPINGNGKQ	134	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	18-UNIMOD:188	ms_run[1]:scan=10768	61.82620333333333	2	2038.052239	2037.062670	K	-	192	211
PSM	CELCDVSCTGADAYAAHIR	135	sp|Q96KR1|ZFR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	1-UNIMOD:385,1-UNIMOD:4,4-UNIMOD:4,8-UNIMOD:4,19-UNIMOD:267	ms_run[1]:scan=9265	52.64509833333333	2	2160.8926	2160.8897	R	G	384	403
PSM	QAHLCVLASNCDEPMYVK	136	sp|P25398|RS12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	1-UNIMOD:28,5-UNIMOD:4,11-UNIMOD:4,18-UNIMOD:188	ms_run[1]:scan=9146	51.978968333333334	2	2122.9599	2122.9576	R	L	46	64
PSM	QATVGDINTERPGMLDFTGK	137	sp|P07108|ACBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	1-UNIMOD:28	ms_run[1]:scan=10204	58.15658833333333	2	2132.0212	2132.0203	K	A	34	54
PSM	AAAAAAAAAAAAAAAGAGAGAK	138	sp|P55011-3|S12A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=8089	45.979	2	1595.838	1595.8380	R	Q	93	115
PSM	ACANPAAGSVILLENLR	139	sp|P00558|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	2-UNIMOD:4	ms_run[2]:scan=11771	68.077	2	1767.9302	1767.9302	K	F	107	124
PSM	AGAIAPCEVTVPAQNTGLGPEK	140	sp|P05388-2|RLA0_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	7-UNIMOD:4,22-UNIMOD:188	ms_run[2]:scan=7498	42.706	2	2185.1144	2185.1144	R	T	113	135
PSM	AINCATSGVVGLVNCLR	141	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	4-UNIMOD:4,15-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=11368	65.58	2	1812.9214	1812.9214	K	R	1445	1462
PSM	AINCATSGVVGLVNCLR	142	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	4-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=11369	65.586	2	1802.9131	1802.9131	K	R	1445	1462
PSM	ATENDIYNFFSPLNPVR	143	sp|P52597|HNRPF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=13654	80.456	2	1995.969	1995.9690	K	V	300	317
PSM	DLAGAPPGEVVGCFTPQSR	144	sp|Q9Y446|PKP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	13-UNIMOD:4,19-UNIMOD:267	ms_run[2]:scan=8963	50.833	2	1966.9446	1966.9446	R	R	557	576
PSM	FDSNCITPGTEFMDNLAK	145	sp|Q9H0D6-2|XRN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	5-UNIMOD:4	ms_run[2]:scan=11250	64.831	2	2058.9027	2058.9027	R	C	79	97
PSM	FDTGNLCMVTGGANLGR	146	sp|P62701|RS4X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	7-UNIMOD:4	ms_run[2]:scan=9336	53.049	2	1781.8189	1781.8189	K	I	175	192
PSM	GEELGGGQDPVQLLSGFPR	147	sp|Q04323|UBXN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	19-UNIMOD:267	ms_run[2]:scan=12295	71.577	2	1964.9831	1964.9831	R	R	248	267
PSM	GFFICDQPYEPVSPYSCK	148	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	5-UNIMOD:4,17-UNIMOD:4,18-UNIMOD:188	ms_run[2]:scan=10741	61.664	2	2198.9748	2198.9748	R	E	676	694
PSM	GVGIISEGNETVEDIAAR	149	sp|P13637-3|AT1A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=9583	54.467	2	1828.9167	1828.9167	K	L	633	651
PSM	IFCGDLGNEVNDDILAR	150	sp|Q9BTD8-4|RBM42_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:4	ms_run[2]:scan=10567	60.571	2	1919.9047	1919.9047	R	A	349	366
PSM	IGGDAATTVNNSTPDFGFGGQK	151	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	22-UNIMOD:188	ms_run[2]:scan=8255	46.934	2	2159.0227	2159.0227	K	R	88	110
PSM	ILGADTSVDLEETGR	152	sp|P25705-2|ATPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=7483	42.616	2	1574.7788	1574.7788	R	V	9	24
PSM	IMLNTPEDVQALVSGK	153	sp|O00231|PSD11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	2-UNIMOD:35,16-UNIMOD:188	ms_run[2]:scan=10712	61.485	2	1735.9122	1735.9122	K	L	259	275
PSM	ISLGLPVGAVINCADNTGAK	154	sp|P62829|RL23_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	13-UNIMOD:4	ms_run[2]:scan=11472	66.227	3	1969.0303	1969.0303	R	N	16	36
PSM	KENVATTDTLESTTVGTSV	155	sp|Q15046|SYK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:188	ms_run[2]:scan=6740	38.471	2	1957.9787	1957.9787	K	-	579	598
PSM	LAAQPLCMTQPTASGTLR	156	sp|Q9BST9|RTKN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	7-UNIMOD:4	ms_run[2]:scan=7611	43.378	2	1914.9656	1914.9656	R	V	300	318
PSM	LCNLEEGSPGSGTYTR	157	sp|Q9Y3B2|EXOS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	2-UNIMOD:4	ms_run[2]:scan=4738	27.985	2	1739.7785	1739.7785	R	H	14	30
PSM	LDGLVETPTGYIESLPR	158	sp|P55209-3|NP1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	17-UNIMOD:267	ms_run[2]:scan=11425	65.935	2	1868.9759	1868.9759	R	V	15	32
PSM	LFVYDPNNPPSSEVLR	159	sp|Q15165-3|PON2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=9566	54.368	2	1845.9261	1845.9261	K	I	278	294
PSM	LGNDFMGITLASSQAVSNAR	160	sp|Q9HC38|GLOD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	20-UNIMOD:267	ms_run[2]:scan=11338	65.393	2	2061.0189	2061.0189	K	K	97	117
PSM	LNLEAINYMAADGDFK	161	sp|P09382|LEG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	16-UNIMOD:188	ms_run[2]:scan=11836	68.488	2	1789.8652	1789.8652	R	I	113	129
PSM	LPSGSGAASPTGSAVDIR	162	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	18-UNIMOD:267	ms_run[2]:scan=5222	30.686	2	1651.8405	1651.8405	R	A	208	226
PSM	LSLQNCCLTGAGCGVLSSTLR	163	sp|P13489|RINI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	6-UNIMOD:4,7-UNIMOD:4,13-UNIMOD:4,21-UNIMOD:267	ms_run[2]:scan=10595	60.749	2	2276.0951	2276.0951	K	T	90	111
PSM	LSPEPWTPETGLVTDAFK	164	sp|O60488-2|ACSL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	18-UNIMOD:188	ms_run[2]:scan=12490	72.833	2	1993.014	1993.0140	R	L	632	650
PSM	MIAGQVLDINLAAEPK	165	sp|P07910-4|HNRPC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:35,16-UNIMOD:188	ms_run[2]:scan=9805	55.679	2	1703.9223	1703.9223	R	V	74	90
PSM	MIAGQVLDINLAAEPK	166	sp|P07910-4|HNRPC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	16-UNIMOD:188	ms_run[2]:scan=10883	62.527	2	1687.9274	1687.9274	R	V	74	90
PSM	MPSESAAQSLAVALPLQTK	167	sp|O43660-2|PLRG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=10666	61.198	2	1941.0241	1941.0241	R	A	108	127
PSM	NAFYIGSYQQCINEAQR	168	sp|O14579|COPE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	11-UNIMOD:4	ms_run[2]:scan=9084	51.605	2	2060.9374	2060.9374	K	V	24	41
PSM	PTELLSNPQFIVDGATR	169	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=10614	60.868	2	1856.9632	1856.9632	R	T	88	105
PSM	SELPLDPLPVPTEEGNPLLK	170	sp|Q15758|AAAT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=12981	76.068	2	2157.1569	2157.1569	K	H	503	523
PSM	SETAPAAPAAPAPAEKTPVK	171	sp|P10412|H14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:1,16-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=4363	26.062	2	1957.0559	1957.0559	M	K	2	22
PSM	SPTDWALFTYEGNSNDIR	172	sp|Q9UJU6|DBNL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=11584	66.913	2	2084.9439	2084.9439	K	V	24	42
PSM	SQLDLFDDVGTFASGPPK	173	sp|Q8N6H7-3|ARFG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=12570	73.354	2	1892.9156	1892.9156	R	Y	71	89
PSM	STMVGTPYWMAPEVVTR	174	sp|Q13177|PAK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=11347	65.451	2	1923.9223	1923.9223	R	K	401	418
PSM	STNGDTFLGGEDFDQALLR	175	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	19-UNIMOD:267	ms_run[2]:scan=11980	69.482	2	2064.9628	2064.9628	K	H	266	285
PSM	TAADELEAFLGGGAPGGR	176	sp|Q3YEC7|RABL6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	18-UNIMOD:267	ms_run[2]:scan=12633	73.767	2	1697.8248	1697.8248	R	H	702	720
PSM	TPDGTENGDFLALDLGGTNFR	177	sp|P19367-4|HXK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=12364	72.024	2	2209.0287	2209.0287	R	V	507	528
PSM	TYQELLVNQNPIAQPLASR	178	sp|Q9NX24|NHP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=10200	58.128	2	2154.1433	2154.1433	R	R	23	42
PSM	VELPGTAVPSVPEDAAPASR	179	sp|P55011-3|S12A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=8079	45.92	2	1962.0058	1962.0058	R	D	32	52
PSM	VGLTNYAAAYCTGLLLAR	180	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	11-UNIMOD:4,18-UNIMOD:267	ms_run[2]:scan=12372	72.077	2	1936.0116	1936.0116	K	R	90	108
PSM	VWLDPNETNEIANANSR	181	sp|P84098|RL19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=8306	47.204	2	1941.9181	1941.9181	K	Q	22	39
PSM	YLFNQLFGEEDADQEVSPDR	182	sp|Q9UBT2|SAE2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=12709	74.256	2	2371.0604	2371.0604	K	A	191	211
PSM	AFLASPEYVNLPINGNGKQ	183	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0		ms_run[1]:scan=10936	62.850406666666665	2	2032.032707	2031.042541	K	-	192	211
PSM	AFLASPEYVNLPINGNGK	184	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	18-UNIMOD:188	ms_run[1]:scan=10920	62.749276666666674	2	1909.992433	1909.004092	K	Q	192	210
PSM	QVFGEATKQPGITFIAAK	185	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:28,8-UNIMOD:188,18-UNIMOD:188	ms_run[1]:scan=10784	61.92039666666667	2	1900.0556	1900.0492	R	F	177	195
PSM	QTIAHQQQQLTNLQMAAQR	186	sp|Q9UHX1-2|PUF60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:28,19-UNIMOD:267	ms_run[1]:scan=7706	43.915076666666664	2	2200.1087	2200.1041	K	Q	86	105
PSM	QAHLCVLASNCDEPMYVK	187	sp|P25398|RS12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:28,5-UNIMOD:4,11-UNIMOD:4,15-UNIMOD:35	ms_run[1]:scan=8117	46.13827	2	2132.9383	2132.9324	R	L	46	64
PSM	QGGASQSDKTPEELFHPLGADSQV	188	sp|P11166|GTR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:28,9-UNIMOD:188	ms_run[1]:scan=10524	60.29506833333333	2	2486.1687	2486.1652	R	-	469	493
PSM	ACANPAAGSVILLENLR	189	sp|P00558|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	2-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=11920	69.064	2	1777.9384	1777.9384	K	F	107	124
PSM	AFLASPEYVNLPINGNGK	190	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=10745	61.688	2	1902.984	1902.9840	K	Q	192	210
PSM	AGAIAPCEVTVPAQNTGLGPEK	191	sp|P05388-2|RLA0_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	7-UNIMOD:4	ms_run[2]:scan=7505	42.749	2	2179.0943	2179.0943	R	T	113	135
PSM	AGQDPALSTSHPFYDVAR	192	sp|P85298-2|RHG08_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:1	ms_run[2]:scan=8785	49.797	2	1972.9279	1972.9279	M	H	2	20
PSM	AGRLPACVVDCGTGYTK	193	sp|P61158|ARP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:1,7-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=7749	44.15	2	1865.8764	1865.8764	M	L	2	19
PSM	ALPAVQQNNLDEDLIR	194	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=9200	52.278	2	1807.9428	1807.9428	R	K	329	345
PSM	APIVTVGVNNDPADVR	195	sp|Q9BPX3|CND3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=6785	38.73	2	1635.858	1635.8580	R	K	471	487
PSM	AVCMLSNTTAVAEAWAR	196	sp|Q9BQE3|TBA1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:4	ms_run[2]:scan=11276	64.999	2	1849.8815	1849.8815	R	L	374	391
PSM	DSSQGPCEPLPGPLTQPR	197	sp|O15027-2|SC16A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	7-UNIMOD:4,18-UNIMOD:267	ms_run[2]:scan=7492	42.667	2	1944.9239	1944.9239	R	A	101	119
PSM	FDSNNVVLIEDNGNPVGTR	198	sp|Q6P1L8|RM14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	19-UNIMOD:267	ms_run[2]:scan=8569	48.654	2	2069.0053	2069.0053	R	I	100	119
PSM	FLDGNELTLADCNLLPK	199	sp|O00299|CLIC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	12-UNIMOD:4	ms_run[2]:scan=12168	70.745	2	1931.9663	1931.9663	K	L	167	184
PSM	FQDGDLTLYQSNTILR	200	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=10506	60.179	2	1882.9425	1882.9425	K	H	56	72
PSM	GCITIIGGGDTATCCAK	201	sp|P00558|PGK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	2-UNIMOD:4,14-UNIMOD:4,15-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=6027	34.702	2	1759.7999	1759.7999	R	W	366	383
PSM	GFGTDEQAIIDCLGSR	202	sp|P50995-2|ANX11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	12-UNIMOD:4	ms_run[2]:scan=11143	64.144	2	1737.7992	1737.7992	K	S	182	198
PSM	GISDPLTVFEQTEAAAR	203	sp|O00116|ADAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	17-UNIMOD:267	ms_run[2]:scan=12637	73.791	2	1813.9086	1813.9086	R	E	587	604
PSM	GQAAVQQLQAEGLSPR	204	sp|P16152-2|CBR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=6447	36.962	2	1651.8642	1651.8642	R	F	43	59
PSM	GTPEQPQCGFSNAVVQILR	205	sp|Q86SX6|GLRX5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	8-UNIMOD:4,19-UNIMOD:267	ms_run[2]:scan=11913	69.019	2	2110.0505	2110.0505	K	L	60	79
PSM	GVNLPGAAVDLPAVSEK	206	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=9467	53.794	2	1635.8832	1635.8832	K	D	208	225
PSM	GVNLPGAAVDLPAVSEK	207	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	17-UNIMOD:188	ms_run[2]:scan=9471	53.822	2	1641.9033	1641.9033	K	D	208	225
PSM	GYAVNVFDIQQGFDNPQVR	208	sp|Q15738|NSDHL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	19-UNIMOD:267	ms_run[2]:scan=11991	69.558	2	2176.0577	2176.0577	R	F	61	80
PSM	IGGDAATTVNNSTPDFGFGGQK	209	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=8228	46.796	2	2153.0025	2153.0025	K	R	88	110
PSM	IISNASCTTNCLAPLAK	210	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	7-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=6672	38.13	2	1832.9125	1832.9125	K	V	104	121
PSM	INMNGINNSSGMVDAR	211	sp|Q15819|UB2V2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=6321	36.25	2	1691.7719	1691.7719	K	S	86	102
PSM	LAEGEQILSGGVFNK	212	sp|P30260|CDC27_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	15-UNIMOD:188	ms_run[2]:scan=9454	53.718	2	1566.8349	1566.8349	K	Q	85	100
PSM	LGAPAAGGEEEWGQQQR	213	sp|O94992|HEXI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=5351	31.313	2	1782.8285	1782.8285	K	Q	130	147
PSM	LLALTSSDLGCQPSRT	214	sp|Q8IY95-2|TM192_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	11-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=7949	45.188	2	1727.8752	1727.8752	R	-	252	268
PSM	LPDGSSFTNQFPSDAPLEEAR	215	sp|Q92575|UBXN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=10071	57.22	2	2277.055	2277.0550	R	Q	326	347
PSM	LQCVPNPELLQTEDSLK	216	sp|Q08AM6|VAC14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:4	ms_run[2]:scan=9411	53.484	2	1982.9983	1982.9983	R	A	717	734
PSM	LSPEPWTPETGLVTDAFK	217	sp|O60488-2|ACSL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=12483	72.786	2	1986.9939	1986.9939	R	L	632	650
PSM	LVLDPGEAPLVPVYSGK	218	sp|Q8NCF5|NF2IP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=10868	62.436	2	1752.9662	1752.9662	R	V	113	130
PSM	LVLPAPQISDAELQEVVK	219	sp|Q99459|CDC5L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=12033	69.836	2	1948.0881	1948.0881	K	V	295	313
PSM	MAPYQGPDAVPGALDYK	220	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:35,17-UNIMOD:188	ms_run[2]:scan=7620	43.428	2	1813.8652	1813.8652	R	S	883	900
PSM	MQNDAGEFVDLYVPRK	221	sp|P63220|RS21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:1	ms_run[2]:scan=11506	66.436	2	1922.9196	1922.9196	-	C	1	17
PSM	MQQNIQELEEQLEEEESAR	222	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:35,19-UNIMOD:267	ms_run[2]:scan=10499	60.133	2	2358.0521	2358.0521	K	Q	941	960
PSM	MQQQLDEYQELLDIK	223	sp|P02545-2|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:35	ms_run[2]:scan=11265	64.93	2	1908.9139	1908.9139	R	L	352	367
PSM	MVPVSVQQSLAAYNQR	224	sp|Q8WUM4-2|PDC6I_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=8612	48.896	2	1789.9145	1789.9145	K	K	363	379
PSM	NLSELQDTSLQQLVSQR	225	sp|Q5QJE6|TDIF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=11032	63.446	2	1958.0069	1958.0069	K	H	322	339
PSM	QSSATSSFGGLGGGSVR	226	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	17-UNIMOD:267	ms_run[2]:scan=5610	32.577	2	1563.7517	1563.7517	R	F	8	25
PSM	SELPLDPLPVPTEEGNPLLK	227	sp|Q15758|AAAT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	20-UNIMOD:188	ms_run[2]:scan=12980	76.063	2	2163.177	2163.1770	K	H	503	523
PSM	SIYDDISSPGLGSTPLTSR	228	sp|Q8NFH5-2|NUP35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	19-UNIMOD:267	ms_run[2]:scan=10043	57.033	2	1974.9774	1974.9774	R	R	76	95
PSM	SIYDDISSPGLGSTPLTSR	229	sp|Q8NFH5-2|NUP35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=10064	57.172	2	1964.9691	1964.9691	R	R	76	95
PSM	SLAMLGSSEDNTALSR	230	sp|Q13596-2|SNX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=7682	43.78	2	1650.7883	1650.7883	K	A	285	301
PSM	SLLVIPNTLAVNAAQDSTDLVAK	231	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=13037	76.434	2	2352.29	2352.2900	R	L	444	467
PSM	SLVASLAEPDFVVTDFAK	232	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	18-UNIMOD:188	ms_run[2]:scan=13324	78.297	2	1914.0082	1914.0082	K	F	265	283
PSM	SYELPDGQVITIGNER	233	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	16-UNIMOD:267	ms_run[2]:scan=10004	56.804	2	1799.8929	1799.8929	K	F	239	255
PSM	SYELPDGQVITIGNER	234	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	16-UNIMOD:267	ms_run[2]:scan=10155	57.816	2	1799.8929	1799.8929	K	F	239	255
PSM	SYELPDGQVITIGNER	235	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	16-UNIMOD:267	ms_run[2]:scan=10298	58.832	2	1799.8929	1799.8929	K	F	239	255
PSM	VGLIGSCTNSSYEDMGR	236	sp|Q99798|ACON_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	7-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=7425	42.28	2	1854.8116	1854.8116	R	S	379	396
PSM	VGLTNYAAAYCTGLLLAR	237	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	11-UNIMOD:4	ms_run[2]:scan=12376	72.1	2	1926.0033	1926.0033	K	R	90	108
PSM	VLAGETLSVNDPPDVLDR	238	sp|Q12906-5|ILF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=9450	53.693	2	1908.9793	1908.9793	K	Q	183	201
PSM	VMTIPYQPMPASSPVICAGGQDR	239	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	17-UNIMOD:4,23-UNIMOD:267	ms_run[2]:scan=9781	55.555	3	2484.1839	2484.1839	R	C	178	201
PSM	VPEIEVTVEGPNNNNPQTSAVR	240	sp|P78347-2|GTF2I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=7623	43.443	2	2363.1717	2363.1717	K	T	640	662
PSM	VSEGGPAEIAGLQIGDK	241	sp|O14907|TX1B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	17-UNIMOD:188	ms_run[2]:scan=8515	48.357	2	1645.8618	1645.8618	R	I	60	77
PSM	WLCTGDIGEFEPDGCLK	242	sp|O95573|ACSL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:4,15-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=11243	64.785	2	2001.8908	2001.8908	R	I	559	576
PSM	WNSPAEEGSSDCEVFSK	243	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	12-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=6714	38.336	2	1933.8096	1933.8096	R	N	406	423
PSM	YAACNAVGQMATDFAPGFQK	244	sp|O00410-2|IPO5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	4-UNIMOD:4	ms_run[2]:scan=11012	63.323	2	2145.9612	2145.9612	R	K	357	377
PSM	YEPDSANPDALQCPIVLCGWR	245	sp|Q08J23-3|NSUN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	13-UNIMOD:4,18-UNIMOD:4	ms_run[2]:scan=11753	67.969	2	2460.1202	2460.1202	K	G	425	446
PSM	QKGADFLVTEVENGGSLGSK	246	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:28	ms_run[1]:scan=11001	63.25680333333333	3	2017.9951	2017.9951	K	K	187	207
PSM	GVGIISEGNETVEDIAAR	247	sp|P05023|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	18-UNIMOD:267	ms_run[1]:scan=9578	54.441101666666675	2	1838.945987	1838.924940	K	L	630	648
PSM	AFLASPEYVNLPINGNGKQ	248	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0		ms_run[1]:scan=10766	61.81617166666667	2	2032.032707	2031.042541	K	-	192	211
PSM	QVFGEATKQPGITFIAAK	249	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:28	ms_run[1]:scan=10779	61.88933166666666	2	1888.0151	1888.0089	R	F	177	195
PSM	CELCDVSCTGADAYAAHIR	250	sp|Q96KR1|ZFR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:385,1-UNIMOD:4,4-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=9264	52.639084999999994	2	2150.8845	2150.8814	R	G	384	403
PSM	VIGLSSDLQQVGGASAR	251	sp|O00303|EIF3F_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0		ms_run[1]:scan=8025	45.60735833333333	2	1656.893820	1656.879498	R	I	262	279
PSM	ALAIYEGQLGPDNPNVAR	252	sp|Q9NSK0-5|KLC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	18-UNIMOD:267	ms_run[2]:scan=8425	47.862	2	1906.9776	1906.9776	R	T	286	304
PSM	ALPAVQQNNLDEDLIR	253	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	16-UNIMOD:267	ms_run[2]:scan=9201	52.282	2	1817.9511	1817.9511	R	K	329	345
PSM	AQGVLFDCDGVLWNGER	254	sp|Q96GD0|PLPP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	8-UNIMOD:4	ms_run[2]:scan=11440	66.025	2	1934.8945	1934.8945	R	A	19	36
PSM	AVCMLSNTTAIAEAWAR	255	sp|P68366-2|TBA4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:4	ms_run[2]:scan=12274	71.446	2	1863.8971	1863.8971	R	L	359	376
PSM	AYDGTTYLPGIVGLNNIK	256	sp|Q53GS9-2|SNUT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	18-UNIMOD:188	ms_run[2]:scan=11741	67.896	2	1914.0194	1914.0194	R	A	111	129
PSM	CIPALDSLTPANEDQK	257	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=8512	48.342	2	1776.8659	1776.8659	R	I	447	463
PSM	CIPALDSLTPANEDQK	258	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:4	ms_run[2]:scan=8517	48.367	2	1770.8458	1770.8458	R	I	447	463
PSM	DVAWAPSIGLPTSTIASCSQDGR	259	sp|P55735-2|SEC13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	18-UNIMOD:4,23-UNIMOD:267	ms_run[2]:scan=11405	65.813	2	2398.1462	2398.1462	R	V	203	226
PSM	EICSLFGEAPQNLSQTQR	260	sp|Q93008-1|USP9X_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:4,18-UNIMOD:267	ms_run[2]:scan=9576	54.425	2	2086.9981	2086.9981	R	S	575	593
PSM	EILGTAQSVGCNVDGR	261	sp|P30050|RL12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	11-UNIMOD:4	ms_run[2]:scan=6043	34.792	2	1674.7995	1674.7995	K	H	131	147
PSM	FDSNCITPGTEFMDNLAK	262	sp|Q9H0D6-2|XRN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:4,18-UNIMOD:188	ms_run[2]:scan=11249	64.825	2	2064.9228	2064.9228	R	C	79	97
PSM	FDTGNLCMVTGGANLGR	263	sp|P62701|RS4X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	7-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=9337	53.055	2	1791.8272	1791.8272	K	I	175	192
PSM	FQMPDQGMTSADDFFQGTK	264	sp|Q16555-2|DPYL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	8-UNIMOD:35	ms_run[2]:scan=9918	56.274	2	2165.9034	2165.9034	R	A	40	59
PSM	FSFCCSPEPEAEAEAAAGPGPCER	265	sp|Q13501|SQSTM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:4,5-UNIMOD:4,22-UNIMOD:4,24-UNIMOD:267	ms_run[2]:scan=8624	48.957	3	2635.0653	2635.0653	R	L	23	47
PSM	GAGIGGLGITVEGPSESK	266	sp|O75369-6|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=8648	49.088	2	1627.8417	1627.8417	R	I	1355	1373
PSM	GAGTGGLGLAVEGPSEAK	267	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	18-UNIMOD:188	ms_run[2]:scan=6462	37.04	2	1575.82	1575.8200	R	M	1382	1400
PSM	GALTVGITNTVGSSISR	268	sp|Q06210-2|GFPT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=8593	48.79	2	1631.8842	1631.8842	R	E	440	457
PSM	GEELGGGQDPVQLLSGFPR	269	sp|Q04323|UBXN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	19-UNIMOD:267	ms_run[2]:scan=12313	71.692	2	1964.9831	1964.9831	R	R	248	267
PSM	GEELGGGQDPVQLLSGFPR	270	sp|Q04323|UBXN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=12296	71.583	2	1954.9749	1954.9749	R	R	248	267
PSM	GFFICDQPYEPVSPYSCK	271	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:4,17-UNIMOD:4	ms_run[2]:scan=10740	61.658	2	2192.9547	2192.9547	R	E	676	694
PSM	GGVQVPAVDISSSLGGR	272	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	17-UNIMOD:267	ms_run[2]:scan=9143	51.958	2	1607.8507	1607.8507	R	A	271	288
PSM	GKSDSDSVNSVFSDTPFVAST	273	sp|Q86SJ2|AMGO2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=10848	62.317	2	2145.9702	2145.9702	R	-	502	523
PSM	GLPLVDDGGWNTVPISK	274	sp|Q04637-6|IF4G1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=11229	64.7	2	1766.9203	1766.9203	R	G	847	864
PSM	GPDGLTAFEATDNQAIK	275	sp|P58546|MTPN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=8262	46.975	2	1746.8424	1746.8424	K	A	98	115
PSM	IFVGNVSAACTSQELR	276	sp|Q96PK6-2|RBM14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	10-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=7581	43.205	2	1760.8755	1760.8755	K	S	81	97
PSM	IFVGNVSAACTSQELR	277	sp|Q96PK6-2|RBM14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	10-UNIMOD:4	ms_run[2]:scan=7584	43.226	2	1750.8672	1750.8672	K	S	81	97
PSM	IINEPTAAAIAYGLDR	278	sp|P17066|HSP76_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	16-UNIMOD:267	ms_run[2]:scan=9877	56.046	2	1696.9024	1696.9024	R	R	174	190
PSM	IINYNVEQECNNFLR	279	sp|Q12768|WASC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	10-UNIMOD:4	ms_run[2]:scan=9291	52.801	2	1924.9101	1924.9101	R	T	777	792
PSM	IISNASCTTNCLAPLAK	280	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	7-UNIMOD:4,11-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=6664	38.09	2	1838.9326	1838.9326	K	V	104	121
PSM	ILGADTSVDLEETGR	281	sp|P25705-2|ATPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	15-UNIMOD:267	ms_run[2]:scan=7489	42.652	2	1584.787	1584.7870	R	V	9	24
PSM	IQTLPNQNQSQTQPLLK	282	sp|Q8IX12-2|CCAR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=6284	36.042	2	1950.0534	1950.0534	R	T	190	207
PSM	ITGEAFVQFASQELAEK	283	sp|P52597|HNRPF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	17-UNIMOD:188	ms_run[2]:scan=13117	76.954	2	1872.9565	1872.9565	K	A	151	168
PSM	LAALNPESNTAGLDIFAK	284	sp|O00299|CLIC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=11375	65.626	2	1843.968	1843.9680	K	F	96	114
PSM	LCLQQGQLCEPLPSLAESR	285	sp|Q6XQN6|PNCB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	2-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=10201	58.134	2	2198.0824	2198.0824	R	A	476	495
PSM	LCNLEEGSPGSGTYTR	286	sp|Q9Y3B2|EXOS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	2-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=4730	27.94	2	1749.7867	1749.7867	R	H	14	30
PSM	LFVGNLPADITEDEFK	287	sp|P23246-2|SFPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	16-UNIMOD:188	ms_run[2]:scan=12239	71.223	2	1812.9241	1812.9241	R	R	299	315
PSM	LGLQDGSTSLLPEQLLSAPK	288	sp|Q5T7V8-2|GORAB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=12654	73.902	2	2066.1259	2066.1259	K	Q	76	96
PSM	LGQMVLSGVDTVLGK	289	sp|O60664-4|PLIN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	15-UNIMOD:188	ms_run[2]:scan=11463	66.17	2	1521.8532	1521.8532	R	S	169	184
PSM	LSLDGQNIYNACCTLR	290	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	12-UNIMOD:4,13-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=9065	51.492	2	1906.8905	1906.8905	K	I	239	255
PSM	LSPPYSSPQEFAQDVGR	291	sp|Q13263-2|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=9094	51.665	2	1876.8955	1876.8955	K	M	669	686
PSM	LWNTTEVAPALSVFNDTK	292	sp|O43815-2|STRN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	18-UNIMOD:188	ms_run[2]:scan=12708	74.25	2	2011.0358	2011.0358	R	E	546	564
PSM	MDATSYSSIASEFGVR	293	sp|Q96JJ7-2|TMX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:35,16-UNIMOD:267	ms_run[2]:scan=10644	61.057	2	1745.7806	1745.7806	K	G	82	98
PSM	MDVGELLSYQPNRGTK	294	sp|Q8WYA6|CTBL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:1	ms_run[2]:scan=11747	67.936	2	1848.904	1848.9040	-	R	1	17
PSM	MQNDAGEFVDLYVPRK	295	sp|P63220|RS21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=9900	56.17	2	1938.9146	1938.9146	-	C	1	17
PSM	MQQNIQELEEQLEEEESAR	296	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:35	ms_run[2]:scan=10498	60.126	2	2348.0438	2348.0438	K	Q	941	960
PSM	MSGGWELELNGTEAK	297	sp|Q07021|C1QBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:35,15-UNIMOD:188	ms_run[2]:scan=8430	47.893	2	1642.7604	1642.7604	K	L	105	120
PSM	MSSFGDFVALSDVCDVPTAK	298	sp|P31939-2|PUR9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:35,14-UNIMOD:4,20-UNIMOD:188	ms_run[2]:scan=11784	68.156	2	2166.9909	2166.9909	R	I	311	331
PSM	MTNGFSGADLTEICQR	299	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:35,14-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=8119	46.15	2	1824.801	1824.8010	K	A	678	694
PSM	NTNAGAPPGTAYQSPLPLSR	300	sp|Q02218-2|ODO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	20-UNIMOD:267	ms_run[2]:scan=7408	42.186	2	2021.0206	2021.0206	R	G	82	102
PSM	QLAQIDGTLSTIEFQR	301	sp|Q9H444|CHM4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	16-UNIMOD:267	ms_run[2]:scan=10720	61.536	2	1828.9558	1828.9558	K	E	78	94
PSM	SQIFSTASDNQPTVTIK	302	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=7472	42.545	2	1835.9265	1835.9265	K	V	448	465
PSM	SSGDYSATFLPGLIPAEK	303	sp|Q96JH7|VCIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=11716	67.744	2	1851.9254	1851.9254	R	C	314	332
PSM	SVAPAAPTSCDFSPGDLVWAK	304	sp|P52701|MSH6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	10-UNIMOD:4,21-UNIMOD:188	ms_run[2]:scan=11161	64.255	2	2181.0508	2181.0508	R	M	79	100
PSM	TAADELEAFLGGGAPGGR	305	sp|Q3YEC7|RABL6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=12628	73.732	2	1687.8166	1687.8166	R	H	702	720
PSM	TAWGQQPDLAANEAQLLR	306	sp|Q9UNM6|PSD13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=10229	58.332	2	1981.0017	1981.0017	K	K	253	271
PSM	TIAECLADELINAAK	307	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:4	ms_run[2]:scan=13938	82.621	2	1630.8236	1630.8236	K	G	168	183
PSM	TLLYNPFPPTNESDVIR	308	sp|Q969X6-2|UTP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=11350	65.469	2	1975.0051	1975.0051	K	R	503	520
PSM	TVGALQVLGTEAQSSLLK	309	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	18-UNIMOD:188	ms_run[2]:scan=12145	70.596	2	1820.0351	1820.0351	R	A	1275	1293
PSM	TVGALQVLGTEAQSSLLK	310	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	18-UNIMOD:188	ms_run[2]:scan=12203	70.985	2	1820.0351	1820.0351	R	A	1275	1293
PSM	VANEPVLAFTQGSPER	311	sp|P30038|AL4A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=8342	47.396	2	1713.8686	1713.8686	K	D	32	48
PSM	VELPGTAVPSVPEDAAPASR	312	sp|P55011-3|S12A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	20-UNIMOD:267	ms_run[2]:scan=8084	45.947	2	1972.0141	1972.0141	R	D	32	52
PSM	VGLIGSCTNSSYEDMGR	313	sp|Q99798|ACON_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	7-UNIMOD:4	ms_run[2]:scan=7424	42.274	2	1844.8033	1844.8033	R	S	379	396
PSM	VIVVGNPANTNCLTASK	314	sp|P40925-2|MDHC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	12-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=6468	37.073	2	1762.9343	1762.9343	K	S	37	54
PSM	VLCPIIQTADYPINLAAIK	315	sp|Q7Z460-4|CLAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:4,19-UNIMOD:188	ms_run[2]:scan=13103	76.865	2	2118.1854	2118.1854	K	M	1365	1384
PSM	VLLQASQDENFGNTTPR	316	sp|P57740|NU107_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	17-UNIMOD:267	ms_run[2]:scan=6781	38.708	2	1898.9362	1898.9362	R	N	32	49
PSM	VNQPASFAVSLNGAK	317	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	15-UNIMOD:188	ms_run[2]:scan=7233	41.121	2	1507.809	1507.8090	K	G	2339	2354
PSM	VNQSALEAVTPSPSFQQR	318	sp|Q9UKG1|DP13A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	18-UNIMOD:267	ms_run[2]:scan=7669	43.7	2	1967.994	1967.9940	R	H	390	408
PSM	VSEGGPAEIAGLQIGDK	319	sp|O14907|TX1B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=8496	48.254	2	1639.8417	1639.8417	R	I	60	77
PSM	VTIDPENNLISIWNNGK	320	sp|P11388|TOP2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=12595	73.519	2	1925.9847	1925.9847	R	G	107	124
PSM	VVLAYEPVWAIGTGK	321	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	15-UNIMOD:188	ms_run[2]:scan=11756	67.991	2	1607.9019	1607.9019	K	T	198	213
PSM	YGAAMALGICCAGTGNK	322	sp|Q99460-2|PSMD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	10-UNIMOD:4,11-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=7630	43.485	2	1719.7838	1719.7838	R	E	650	667
PSM	YGIVDYMIEQSGPPSK	323	sp|P13667|PDIA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=10875	62.478	2	1782.8498	1782.8498	K	E	273	289
PSM	YPANSIVVVGGCPVCR	324	sp|O95415|BRI3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	12-UNIMOD:4,15-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=7442	42.375	2	1756.8628	1756.8628	R	V	67	83
PSM	QKGADFLVTEVENGGSLGSK	325	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:28	ms_run[1]:scan=11285	65.05759666666667	2	2018.9832	2017.9952	K	K	187	207
PSM	VAGTGEGGLEEMVEELNSGK	326	sp|Q9UJU6|DBNL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	20-UNIMOD:188	ms_run[1]:scan=12325	71.76536333333333	2	2011.948762	2010.951130	R	V	42	62
PSM	CLLAASPENEAGGLKLDGR	327	sp|Q9NW13|RBM28_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=10841	62.27197333333333	2	1952.9669	1952.9621	K	Q	392	411
PSM	VNQIGSVTESLQACK	328	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	14-UNIMOD:4,15-UNIMOD:188	ms_run[1]:scan=6815	38.896928333333335	2	1638.837212	1638.834250	K	L	344	359
PSM	VIGLSSDLQQVGGASAR	329	sp|O00303|EIF3F_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0		ms_run[1]:scan=8051	45.75846833333333	2	1656.893820	1656.879498	R	I	262	279
PSM	MSGGWELELNGTEAK	330	sp|Q07021|C1QBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	1-UNIMOD:35,15-UNIMOD:188	ms_run[1]:scan=8731	49.516575	2	1643.747332	1642.760416	K	L	105	120
PSM	AAELIANSLATAGDGLIELR	331	sp|P35232|PHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	20-UNIMOD:267	ms_run[2]:scan=13335	78.368	2	2007.0876	2007.0876	K	K	220	240
PSM	AAELIANSLATAGDGLIELR	332	sp|P35232|PHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=13346	78.44	2	1997.0793	1997.0793	K	K	220	240
PSM	AAFGLSEAGFNTACVTK	333	sp|P31040-3|SDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	14-UNIMOD:4	ms_run[2]:scan=9464	53.777	2	1742.8298	1742.8298	R	L	76	93
PSM	AATASAGAGGIDGKPR	334	sp|Q02978|M2OM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:1	ms_run[2]:scan=2817	18.318	2	1440.7321	1440.7321	M	T	2	18
PSM	ACANPAAGSVILLENLR	335	sp|P00558|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:4	ms_run[2]:scan=11919	69.059	2	1767.9302	1767.9302	K	F	107	124
PSM	ACANPAAGSVILLENLR	336	sp|P00558|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:4	ms_run[2]:scan=12076	70.124	2	1767.9302	1767.9302	K	F	107	124
PSM	AFLASPEYVNLPINGNGK	337	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	18-UNIMOD:188	ms_run[2]:scan=10747	61.703	2	1909.0041	1909.0041	K	Q	192	210
PSM	AVETPPLSSVNLLEGLSR	338	sp|Q14C86-3|GAPD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=12780	74.717	2	1881.0207	1881.0207	R	T	387	405
PSM	AYDGTTYLPGIVGLNNIK	339	sp|Q53GS9-2|SNUT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=11743	67.908	2	1907.9993	1907.9993	R	A	111	129
PSM	CFSPGVIEVQEVQGK	340	sp|O15160-2|RPAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=8206	46.678	2	1681.8441	1681.8441	R	K	256	271
PSM	FAAYFQQGDMESNGK	341	sp|P06744|G6PI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=6951	39.621	2	1691.725	1691.7250	R	Y	348	363
PSM	FQDGDLTLYQSNTILR	342	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=10352	59.18	2	1882.9425	1882.9425	K	H	56	72
PSM	GLGTDEDAIISVLAYR	343	sp|P09525|ANXA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=13475	79.271	2	1691.873	1691.8730	K	N	29	45
PSM	GLLSDSMTDVPVDTGVAAR	344	sp|O43399-2|TPD54_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:35	ms_run[2]:scan=8170	46.463	2	1918.9306	1918.9306	K	T	16	35
PSM	GNAGQSNYGFANSAMER	345	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	17-UNIMOD:267	ms_run[2]:scan=5668	32.863	2	1782.7619	1782.7619	R	I	2027	2044
PSM	GPCVSENEIGTGGTCQWK	346	sp|Q15436-2|SC23A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=6269	35.955	2	1978.8513	1978.8513	K	I	228	246
PSM	GPDGLTAFEATDNQAIK	347	sp|P58546|MTPN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	17-UNIMOD:188	ms_run[2]:scan=8261	46.97	2	1752.8626	1752.8626	K	A	98	115
PSM	GQAAVQQLQAEGLSPR	348	sp|P16152-2|CBR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	16-UNIMOD:267	ms_run[2]:scan=6432	36.876	2	1661.8725	1661.8725	R	F	43	59
PSM	GVPGAIVNVSSQCSQR	349	sp|Q7Z4W1|DCXR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	13-UNIMOD:4	ms_run[2]:scan=5490	32.001	2	1657.8206	1657.8206	R	A	126	142
PSM	IFVGGLNPEATEEK	350	sp|Q99729-3|ROAA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=7614	43.393	2	1502.7617	1502.7617	K	I	156	170
PSM	IINEPTAAAIAYGLDR	351	sp|P17066|HSP76_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=9880	56.06	2	1686.8941	1686.8941	R	R	174	190
PSM	IPDEFDNDPILVQQLR	352	sp|Q3ZCQ8-2|TIM50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=11253	64.849	2	1910.9738	1910.9738	K	R	201	217
PSM	LAALNPESNTAGLDIFAK	353	sp|O00299|CLIC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	18-UNIMOD:188	ms_run[2]:scan=11374	65.62	2	1849.9881	1849.9881	K	F	96	114
PSM	LAQEGIYTLYPFINSR	354	sp|Q08J23-3|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	16-UNIMOD:267	ms_run[2]:scan=12705	74.232	2	1893.9864	1893.9864	R	I	367	383
PSM	LCLQQGQLCEPLPSLAESR	355	sp|Q6XQN6|PNCB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:4,9-UNIMOD:4,19-UNIMOD:267	ms_run[2]:scan=10173	57.929	2	2208.0906	2208.0906	R	A	476	495
PSM	LFSDGGLSQSQDDSIVGTR	356	sp|Q8TEU7-6|RPGF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=8173	46.48	2	1980.9389	1980.9389	K	H	692	711
PSM	LFVGNLPADITEDEFK	357	sp|P23246-2|SFPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=12238	71.217	2	1806.904	1806.9040	R	R	299	315
PSM	LFVYDPNNPPSSEVLR	358	sp|Q15165-3|PON2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	16-UNIMOD:267	ms_run[2]:scan=9590	54.509	2	1855.9344	1855.9344	K	I	278	294
PSM	LGGAVLSFSEATSSVQK	359	sp|P27708|PYR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=9020	51.199	2	1679.873	1679.8730	R	G	1987	2004
PSM	LGLGGNAPVSIPQQSQSVK	360	sp|Q9H2P0|ADNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=7577	43.182	2	1879.0163	1879.0163	R	Q	349	368
PSM	LGLQYSQGLVSGSNAR	361	sp|Q9UI10-3|EI2BD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	16-UNIMOD:267	ms_run[2]:scan=7476	42.572	2	1658.8616	1658.8616	R	C	209	225
PSM	LGQYGFPNPEWSEVSEDAK	362	sp|Q16644|MAPK3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	19-UNIMOD:188	ms_run[2]:scan=10592	60.727	2	2157.995	2157.9950	R	Q	260	279
PSM	LLDDNGNIAEELSILK	363	sp|O60613|SEP15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	16-UNIMOD:188	ms_run[2]:scan=12697	74.181	2	1761.9456	1761.9456	K	W	133	149
PSM	LLQQLAMTGSEEGDPR	364	sp|Q14C86-3|GAPD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=7550	43.019	2	1743.8461	1743.8461	R	T	347	363
PSM	LMDGEEPLPMLPSYK	365	sp|P11388|TOP2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=10887	62.548	2	1718.8259	1718.8259	R	N	879	894
PSM	LPDGSSFTNQFPSDAPLEEAR	366	sp|Q92575|UBXN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	21-UNIMOD:267	ms_run[2]:scan=10101	57.455	2	2287.0632	2287.0632	R	Q	326	347
PSM	LSPPYSSPQEFAQDVGR	367	sp|Q13263-2|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	17-UNIMOD:267	ms_run[2]:scan=9093	51.659	2	1886.9038	1886.9038	K	M	669	686
PSM	LSPPYSSPQEFAQDVGR	368	sp|Q13263-2|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	17-UNIMOD:267	ms_run[2]:scan=9272	52.689	2	1886.9038	1886.9038	K	M	669	686
PSM	LSYCGGGEALAVPFEPAR	369	sp|Q6P1X6-2|CH082_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:4	ms_run[2]:scan=9853	55.92	2	1892.9091	1892.9091	R	L	119	137
PSM	LVLVSPTSEQYDSLLR	370	sp|O00178|GTPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=11126	64.035	2	1818.9727	1818.9727	K	Q	65	81
PSM	MIAGQVLDINLAAEPK	371	sp|P07910-4|HNRPC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=10882	62.522	2	1681.9073	1681.9073	R	V	74	90
PSM	MSGGWELELNGTEAK	372	sp|Q07021|C1QBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:35	ms_run[2]:scan=8417	47.817	2	1636.7403	1636.7403	K	L	105	120
PSM	MSGGWELELNGTEAK	373	sp|Q07021|C1QBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:35	ms_run[2]:scan=8429	47.889	2	1636.7403	1636.7403	K	L	105	120
PSM	NAFYIGSYQQCINEAQR	374	sp|O14579|COPE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	11-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=9092	51.653	2	2070.9457	2070.9457	K	V	24	41
PSM	NFILDQCNVYNSGQR	375	sp|Q1KMD3|HNRL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:4	ms_run[2]:scan=8259	46.96	2	1826.837	1826.8370	R	R	532	547
PSM	NLPGLVQEGEPFSEEATLFTK	376	sp|Q7KZF4|SND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	21-UNIMOD:188	ms_run[2]:scan=13010	76.26	2	2311.1679	2311.1679	R	E	566	587
PSM	NQGGYGGSSSSSSYGSGR	377	sp|P09651-3|ROA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=1047	9.3334	2	1693.6928	1693.6928	R	R	248	266
PSM	NTVVLFVPQQEAWVVER	378	sp|Q9UJZ1-2|STML2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	17-UNIMOD:267	ms_run[2]:scan=12330	71.801	2	2023.0766	2023.0766	R	M	35	52
PSM	PGPTAESASGPSEDPSVNFLK	379	sp|Q13501|SQSTM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	21-UNIMOD:188	ms_run[2]:scan=8165	46.429	2	2092.0056	2092.0056	R	N	218	239
PSM	PVSSAASVYAGAGGSGSR	380	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=4494	26.715	2	1579.759	1579.7590	R	I	28	46
PSM	QLAQIDGTLSTIEFQR	381	sp|Q9H444|CHM4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=10721	61.542	2	1818.9476	1818.9476	K	E	78	94
PSM	QPALSAACLGPEVTTQYGGQYR	382	sp|P13798|ACPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	8-UNIMOD:4	ms_run[2]:scan=9059	51.452	2	2366.1325	2366.1325	R	T	23	45
PSM	QSLGELIGTLNAAK	383	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=11395	65.752	2	1413.7827	1413.7827	K	V	57	71
PSM	QSSATSSFGGLGGGSVR	384	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=5611	32.581	2	1553.7434	1553.7434	R	F	8	25
PSM	QVLVAPGNAGTACSEK	385	sp|P22102|PUR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	13-UNIMOD:4	ms_run[2]:scan=3708	22.744	2	1600.7879	1600.7879	K	I	29	45
PSM	SELPLDPLPVPTEEGNPLLK	386	sp|Q15758|AAAT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	20-UNIMOD:188	ms_run[2]:scan=12988	76.112	3	2163.177	2163.1770	K	H	503	523
PSM	SELPLDPLPVPTEEGNPLLK	387	sp|Q15758|AAAT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=12832	75.047	2	2157.1569	2157.1569	K	H	503	523
PSM	SLGGDVASDGDFLIFEGNR	388	sp|O00267-2|SPT5H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=12226	71.136	2	1967.9225	1967.9225	R	Y	343	362
PSM	SLGLSLSGGDQEDAGR	389	sp|Q9UJ70|NAGK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	16-UNIMOD:267	ms_run[2]:scan=6702	38.277	2	1570.7462	1570.7462	R	I	70	86
PSM	SPLIIFSDCDMNNAVK	390	sp|P49189-2|AL9A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	9-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=10907	62.667	2	1828.8795	1828.8795	K	G	189	205
PSM	SSFLQVFNNSPDESSYYR	391	sp|Q15436-2|SC23A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	18-UNIMOD:267	ms_run[2]:scan=11447	66.071	2	2148.9628	2148.9628	R	H	385	403
PSM	STMVGTPYWMAPEVVTR	392	sp|Q13177|PAK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	17-UNIMOD:267	ms_run[2]:scan=11346	65.445	2	1933.9306	1933.9306	R	K	401	418
PSM	STVLTPMFVETQASQGTLQTR	393	sp|P78527|PRKDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	21-UNIMOD:267	ms_run[2]:scan=10675	61.254	2	2304.1659	2304.1659	R	T	2599	2620
PSM	TAWGQQPDLAANEAQLLR	394	sp|Q9UNM6|PSD13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	18-UNIMOD:267	ms_run[2]:scan=10364	59.259	2	1991.01	1991.0100	K	K	253	271
PSM	TEWETAAPAVAETPDIKLFGK	395	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:1	ms_run[2]:scan=12515	73	2	2315.1685	2315.1685	M	W	2	23
PSM	TGASFQQAQEEFSQGIFSSR	396	sp|O15127|SCAM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=11582	66.901	2	2204.0134	2204.0134	R	T	293	313
PSM	TGLFSATQTQEVENLVR	397	sp|Q8NHQ9|DDX55_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=11645	67.297	2	1891.964	1891.9640	R	A	198	215
PSM	TMLELLNQLDGFEATK	398	sp|P62195-2|PRS8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:35,16-UNIMOD:188	ms_run[2]:scan=12510	72.965	2	1843.9333	1843.9333	R	N	264	280
PSM	TPPEAIALCSSLLEYTPSSR	399	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	9-UNIMOD:4	ms_run[2]:scan=11996	69.593	2	2191.0831	2191.0831	R	L	372	392
PSM	TSGSQDSQPSPLALLAATCSK	400	sp|Q02446|SP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	19-UNIMOD:4	ms_run[2]:scan=11202	64.522	2	2118.0263	2118.0263	K	I	37	58
PSM	TSPSPDSLGLPEDPCLGPR	401	sp|Q6F5E8-2|CARL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	15-UNIMOD:4	ms_run[2]:scan=9230	52.436	2	1993.9415	1993.9415	R	N	1289	1308
PSM	TSVLAAANPIESQWNPK	402	sp|P33991|MCM4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	17-UNIMOD:188	ms_run[2]:scan=9661	54.887	2	1830.9571	1830.9571	R	K	611	628
PSM	TTEPGVTGLLLAVEGPAAK	403	sp|Q14690|RRP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	19-UNIMOD:188	ms_run[2]:scan=12745	74.489	2	1829.0242	1829.0242	K	R	982	1001
PSM	VAMPVELNEPLNTLQR	404	sp|Q9H4L5-8|OSBL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=10573	60.606	2	1822.9611	1822.9611	K	L	476	492
PSM	VFIWTCDDASSNTWSPK	405	sp|P55735-2|SEC13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=10752	61.73	2	2018.914	2018.9140	R	L	226	243
PSM	VGINYQPPTVVPGGDLAK	406	sp|P68366-2|TBA4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	18-UNIMOD:188	ms_run[2]:scan=8789	49.825	2	1829.9983	1829.9983	K	V	338	356
PSM	VLAQNSGFDLQETLVK	407	sp|P40227-2|TCPZ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	16-UNIMOD:188	ms_run[2]:scan=9750	55.382	2	1766.951	1766.9510	K	I	405	421
PSM	VLAQNSGFDLQETLVK	408	sp|P40227-2|TCPZ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=9756	55.411	2	1760.9309	1760.9309	K	I	405	421
PSM	VLQDMGLPTGAEGR	409	sp|Q12906-5|ILF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=6987	39.813	2	1442.7188	1442.7188	K	D	461	475
PSM	VNLLSFTGSTQVGK	410	sp|P49419-4|AL7A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	14-UNIMOD:188	ms_run[2]:scan=9835	55.831	2	1455.8029	1455.8029	R	Q	267	281
PSM	VNLLSFTGSTQVGK	411	sp|P49419-4|AL7A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=9836	55.836	2	1449.7827	1449.7827	R	Q	267	281
PSM	WNSPAEEGSSDCEVFSK	412	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	12-UNIMOD:4	ms_run[2]:scan=6705	38.292	2	1927.7894	1927.7894	R	N	406	423
PSM	YGAAMALGICCAGTGNK	413	sp|Q99460-2|PSMD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	10-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=7634	43.506	2	1713.7637	1713.7637	R	E	650	667
PSM	YLFNQLFGEEDADQEVSPDR	414	sp|Q9UBT2|SAE2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	20-UNIMOD:267	ms_run[2]:scan=12715	74.297	2	2381.0687	2381.0687	K	A	191	211
PSM	YLILGSAVGGGYTAK	415	sp|O60313-13|OPA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	15-UNIMOD:188	ms_run[2]:scan=9107	51.742	2	1474.8127	1474.8127	R	K	102	117
PSM	QNRYDGQVAVFGSDLQEK	416	sp|P22314|UBA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:28	ms_run[1]:scan=8606	48.86235333333333	2	2035.9660	2035.9594	R	L	448	466
PSM	AAFGLSEAGFNTACVTK	417	sp|P31040|SDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	14-UNIMOD:4,17-UNIMOD:188	ms_run[1]:scan=9466	53.788465	2	1749.860001	1748.849900	R	L	76	93
PSM	QLSSSGRPTASVIPSGVEWIK	418	sp|Q9Y6N5|SQOR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:28	ms_run[1]:scan=11380	65.65559499999999	2	2181.1480	2181.1425	K	A	95	116
PSM	ISPDAWQVCAEALAQR	419	sp|O43592|XPOT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	9-UNIMOD:4,16-UNIMOD:267	ms_run[1]:scan=10699	61.40097666666667	2	1824.897876	1823.886387	K	T	30	46
PSM	ADLPEGVAVSGPSPAEFCR	420	sp|Q8IXI1|MIRO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	18-UNIMOD:4,19-UNIMOD:267	ms_run[1]:scan=8832	50.06892333333333	2	1968.937681	1967.928646	K	K	526	545
PSM	AASAAAASAAAASAASGSPGPGEGSAGGEKR	421	sp|Q13263-2|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:1	ms_run[2]:scan=7116	40.461	3	2584.2113	2584.2113	M	S	2	33
PSM	AFLDALQNQAEASSK	422	sp|Q12931-2|TRAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=8740	49.561	2	1591.7842	1591.7842	K	I	129	144
PSM	AFLDALQNQAEASSK	423	sp|Q12931-2|TRAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:188	ms_run[2]:scan=8750	49.61	2	1597.8043	1597.8043	K	I	129	144
PSM	AIGAVPLIQGEYMIPCEK	424	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	16-UNIMOD:4	ms_run[2]:scan=11494	66.361	2	1988.0111	1988.0111	K	V	314	332
PSM	AIVAIENPADVSVISSR	425	sp|P08865|RSSA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=9526	54.138	2	1739.9418	1739.9418	R	N	64	81
PSM	ALAIYEGQLGPDNPNVAR	426	sp|Q9NSK0-5|KLC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=8420	47.837	2	1896.9694	1896.9694	R	T	286	304
PSM	AVCMLSNTTAIAEAWAR	427	sp|P68366-2|TBA4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:4,4-UNIMOD:35,17-UNIMOD:267	ms_run[2]:scan=9909	56.22	2	1889.9003	1889.9003	R	L	359	376
PSM	FASWALESDNNTALLLSK	428	sp|Q13263-2|TIF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	18-UNIMOD:188	ms_run[2]:scan=11826	68.418	2	1985.0201	1985.0201	R	K	266	284
PSM	FISLASLEYSDYSK	429	sp|Q14232|EI2BA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=11365	65.563	2	1621.7876	1621.7876	R	C	75	89
PSM	FSLCSDNLEGISEGPSNR	430	sp|Q14C86-3|GAPD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:4,18-UNIMOD:267	ms_run[2]:scan=9121	51.83	2	1990.893	1990.8930	R	S	565	583
PSM	FTITPSTTQVVGILK	431	sp|P47755|CAZA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:188	ms_run[2]:scan=11104	63.891	2	1609.9386	1609.9386	K	I	179	194
PSM	FYQPYSEDTQQQIIR	432	sp|Q92572|AP3S1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:267	ms_run[2]:scan=7675	43.738	2	1924.9195	1924.9195	K	E	19	34
PSM	FYQPYSEDTQQQIIR	433	sp|Q92572|AP3S1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=7677	43.749	2	1914.9112	1914.9112	K	E	19	34
PSM	GCAFAQFMTQEAAQK	434	sp|Q9NW13-2|RBM28_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=9597	54.549	2	1692.7695	1692.7695	K	C	236	251
PSM	GGMGSGGLATGIAGGLAGMGGIQNEK	435	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	26-UNIMOD:188	ms_run[2]:scan=11011	63.317	3	2266.1141	2266.1141	R	E	56	82
PSM	GISCMNTTLSESPFK	436	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=8827	50.043	2	1676.7845	1676.7845	K	C	239	254
PSM	GLLSDSMTDVPVDTGVAAR	437	sp|O43399-2|TPD54_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:35,19-UNIMOD:267	ms_run[2]:scan=8169	46.457	2	1928.9389	1928.9389	K	T	16	35
PSM	GNTAAQMAQILSFNK	438	sp|P35237|SPB6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:188	ms_run[2]:scan=10819	62.133	2	1598.8182	1598.8182	K	S	47	62
PSM	GSTAPVGGGAFPTIVER	439	sp|Q15084-3|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	17-UNIMOD:267	ms_run[2]:scan=8352	47.449	2	1624.8448	1624.8448	R	E	390	407
PSM	GSYGDLGGPIITTQVTIPK	440	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=10516	60.244	2	1916.0255	1916.0255	R	D	354	373
PSM	GSYGDLGGPIITTQVTIPK	441	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	19-UNIMOD:188	ms_run[2]:scan=10517	60.25	2	1922.0456	1922.0456	R	D	354	373
PSM	GVVPLAGTNGETTTQGLDGLSER	442	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=8977	50.923	2	2271.1343	2271.1343	K	C	112	135
PSM	IGIIGGTGLDDPEILEGR	443	sp|Q13126-7|MTAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	18-UNIMOD:267	ms_run[2]:scan=11678	67.51	2	1833.9712	1833.9712	K	T	12	30
PSM	IGIIGGTGLDDPEILEGR	444	sp|Q13126-7|MTAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=11684	67.549	2	1823.9629	1823.9629	K	T	12	30
PSM	IIDVVYNASNNELVR	445	sp|P62241|RS8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=8870	50.285	2	1717.8999	1717.8999	R	T	78	93
PSM	IIGATDSSGELMFLMK	446	sp|Q13185|CBX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:35,16-UNIMOD:188	ms_run[2]:scan=10679	61.277	2	1733.8675	1733.8675	R	W	126	142
PSM	IIGATDSSGELMFLMK	447	sp|Q13185|CBX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	16-UNIMOD:188	ms_run[2]:scan=12448	72.563	2	1717.8726	1717.8726	R	W	126	142
PSM	INMNGINNSSGMVDAR	448	sp|Q15819|UB2V2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	16-UNIMOD:267	ms_run[2]:scan=6316	36.223	2	1701.7802	1701.7802	K	S	86	102
PSM	INPDGSQSVVEVPYAR	449	sp|Q9Y2B0|CNPY2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=7045	40.098	2	1729.8635	1729.8635	R	S	58	74
PSM	LANQAADYFGDAFK	450	sp|Q8WUM4-2|PDC6I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:188	ms_run[2]:scan=9812	55.716	2	1535.7352	1535.7352	K	Q	216	230
PSM	LASIVEQVSVLQNQGR	451	sp|P54886-2|P5CS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	16-UNIMOD:267	ms_run[2]:scan=9831	55.812	2	1749.9613	1749.9613	R	E	95	111
PSM	LEGMLSQSVSSQYNMAGVR	452	sp|P54105|ICLN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=9077	51.56	2	2055.9718	2055.9718	R	T	188	207
PSM	LFVGNLPTDITEEDFK	453	sp|Q8WXF1-2|PSPC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	16-UNIMOD:188	ms_run[2]:scan=11866	68.695	2	1842.9347	1842.9347	R	R	84	100
PSM	LGCYFCNDVVAPGDSTR	454	sp|O95352-3|ATG7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:4,6-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=8111	46.101	2	1939.8432	1939.8432	K	D	509	526
PSM	LGGYLAEEQATPENPTIR	455	sp|O75165|DJC13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=7365	41.94	2	1957.9745	1957.9745	R	K	1589	1607
PSM	LGLQDGSTSLLPEQLLSAPK	456	sp|Q5T7V8-2|GORAB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	20-UNIMOD:188	ms_run[2]:scan=12669	74.001	2	2072.1461	2072.1461	K	Q	76	96
PSM	LLALTSSDLGCQPSRT	457	sp|Q8IY95-2|TM192_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	11-UNIMOD:4	ms_run[2]:scan=7948	45.182	2	1717.8669	1717.8669	R	-	252	268
PSM	LPACVVDCGTGYTK	458	sp|P61158|ARP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:4,8-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=5561	32.34	2	1545.7263	1545.7263	R	L	5	19
PSM	MAPAEILNGKEISAQIR	459	sp|P11586|C1TC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:1	ms_run[2]:scan=11277	65.005	2	1881.9982	1881.9982	-	A	1	18
PSM	MDATANDVPSPYEVR	460	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:35,15-UNIMOD:267	ms_run[2]:scan=5674	32.896	2	1689.7544	1689.7544	K	G	434	449
PSM	MQQQLDEYQELLDIK	461	sp|P02545-2|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:35,15-UNIMOD:188	ms_run[2]:scan=11256	64.872	2	1914.934	1914.9340	R	L	352	367
PSM	MSGGWELELNGTEAK	462	sp|Q07021|C1QBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=9132	51.896	2	1620.7454	1620.7454	K	L	105	120
PSM	MTNGFSGADLTEICQR	463	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:35,14-UNIMOD:4	ms_run[2]:scan=8142	46.29	2	1814.7927	1814.7927	K	A	678	694
PSM	NEEDAAELVALAQAVNAR	464	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=12036	69.854	2	1882.9385	1882.9385	R	A	311	329
PSM	NFILDQCNVYNSGQR	465	sp|Q1KMD3|HNRL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=8258	46.955	2	1836.8452	1836.8453	R	R	532	547
PSM	NFILDQTNVSAAAQR	466	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=8034	45.66	2	1646.8376	1646.8376	R	R	557	572
PSM	NIYVLQELDNPGAK	467	sp|P12956|XRCC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=9925	56.315	2	1572.8148	1572.8148	K	R	101	115
PSM	NLIAFSEDGSDPYVR	468	sp|A0FGR8-2|ESYT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=9547	54.262	2	1681.7948	1681.7948	R	M	784	799
PSM	NLIDEDGNNQWPEGLK	469	sp|O00410-2|IPO5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	16-UNIMOD:188	ms_run[2]:scan=9396	53.398	2	1846.8793	1846.8793	R	F	59	75
PSM	NLPPEEQMISALPDIK	470	sp|O15355|PPM1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=11563	66.785	2	1793.9233	1793.9233	K	V	410	426
PSM	NLQEQTVQLQSELSR	471	sp|P12270|TPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=8775	49.74	2	1771.9064	1771.9064	R	L	1513	1528
PSM	NLQEQTVQLQSELSR	472	sp|P12270|TPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:267	ms_run[2]:scan=8780	49.771	2	1781.9147	1781.9147	R	L	1513	1528
PSM	NLTALGLNLVASGGTAK	473	sp|P31939-2|PUR9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=10955	62.967	2	1598.8992	1598.8992	R	A	22	39
PSM	NQVALNPQNTVFDAK	474	sp|P0DMV8-2|HS71A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:188	ms_run[2]:scan=7615	43.397	2	1663.8625	1663.8625	K	R	57	72
PSM	PTELLSNPQFIVDGATR	475	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	17-UNIMOD:267	ms_run[2]:scan=10585	60.685	2	1866.9715	1866.9715	R	T	88	105
PSM	QAVLGAGLPISTPCTTINK	476	sp|P24752|THIL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:4	ms_run[2]:scan=9490	53.939	2	1940.0401	1940.0401	R	V	106	125
PSM	QGQGQLVTCSGAFK	477	sp|Q16531|DDB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	9-UNIMOD:4	ms_run[2]:scan=5197	30.552	2	1479.714	1479.7140	R	E	370	384
PSM	QQAAYYAQTSPQGMPQHPPAPQGQ	478	sp|Q96AE4|FUBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=5739	33.221	2	2580.1816	2580.1816	R	-	621	645
PSM	QVLVAPGNAGTACSEK	479	sp|P22102|PUR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	13-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=3706	22.734	2	1606.808	1606.8080	K	I	29	45
PSM	SAIQNLHSFDPFADASK	480	sp|P41567|EIF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:1,17-UNIMOD:188	ms_run[2]:scan=12333	71.819	2	1894.9157	1894.9157	M	G	2	19
PSM	SAIQNLHSFDPFADASK	481	sp|P41567|EIF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:1	ms_run[2]:scan=12337	71.848	2	1888.8955	1888.8955	M	G	2	19
PSM	SGLGELILPENEPGSSIMPGK	482	sp|P07954-2|FUMH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	21-UNIMOD:188	ms_run[2]:scan=11459	66.142	2	2130.0974	2130.0974	R	V	308	329
PSM	SLGDDISSETSGDFR	483	sp|P12429|ANXA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=7659	43.643	2	1584.6904	1584.6904	K	K	139	154
PSM	SLGLSLSGGDQEDAGR	484	sp|Q9UJ70|NAGK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=6718	38.36	2	1560.738	1560.7380	R	I	70	86
PSM	SLVASLAEPDFVVTDFAK	485	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=13340	78.403	2	1907.988	1907.9880	K	F	265	283
PSM	SPDLLMYQGPPDTAEIIK	486	sp|P82909|RT36_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=11230	64.706	2	1986.9972	1986.9972	K	T	61	79
PSM	SPYTVTVGQACNPSACR	487	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	11-UNIMOD:4,16-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=5295	31.037	2	1876.8435	1876.8435	R	A	468	485
PSM	SQPEPSPVLSQLSQR	488	sp|Q5T6F2|UBAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:267	ms_run[2]:scan=7290	41.488	2	1661.8612	1661.8612	K	Q	427	442
PSM	STNGDTFLGGEDFDQALLR	489	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=11976	69.454	2	2054.9545	2054.9545	K	H	266	285
PSM	SYELPDGQVITIGNER	490	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=10156	57.82	2	1789.8846	1789.8846	K	F	239	255
PSM	SYELPDGQVITIGNER	491	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=10299	58.836	2	1789.8846	1789.8846	K	F	239	255
PSM	SYGRPPPDVEGMTSLK	492	sp|Q01130-2|SRSF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:1	ms_run[2]:scan=8053	45.769	2	1774.856	1774.8560	M	V	2	18
PSM	TEWETAAPAVAETPDIKLFGK	493	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:1,17-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=12499	72.893	2	2327.2088	2327.2088	M	W	2	23
PSM	TFAPEEISAMVLTK	494	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	10-UNIMOD:35	ms_run[2]:scan=9817	55.738	2	1551.7854	1551.7854	K	M	139	153
PSM	TFAQGLAVAGDVVSK	495	sp|O75487-2|GPC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=9232	52.447	2	1461.7827	1461.7827	R	V	150	165
PSM	TFNTSTGGLLLPSDTK	496	sp|P12956|XRCC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=8669	49.204	2	1650.8465	1650.8465	R	R	302	318
PSM	TFNTSTGGLLLPSDTK	497	sp|P12956|XRCC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	16-UNIMOD:188	ms_run[2]:scan=8676	49.244	2	1656.8666	1656.8666	R	R	302	318
PSM	TLQEQLENGPNTQLAR	498	sp|Q9P2E9|RRBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	16-UNIMOD:267	ms_run[2]:scan=7019	39.965	2	1820.9256	1820.9256	R	L	782	798
PSM	TPAFAESVTEGDVR	499	sp|P36957|ODO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=6537	37.452	2	1477.7049	1477.7049	K	W	75	89
PSM	TPVTQVNEVTGTLR	500	sp|Q13405|RM49_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=7042	40.084	2	1513.81	1513.8100	K	I	135	149
PSM	TPVTQVNEVTGTLR	501	sp|Q13405|RM49_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:267	ms_run[2]:scan=7043	40.088	2	1523.8183	1523.8183	K	I	135	149
PSM	TQETPSAQMEGFLNR	502	sp|Q01082|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:267	ms_run[2]:scan=8805	49.909	2	1717.7969	1717.7969	R	K	2192	2207
PSM	TTEPGVTGLLLAVEGPAAK	503	sp|Q14690|RRP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=12744	74.483	2	1823.004	1823.0040	K	R	982	1001
PSM	VDIETPNLEGTLTGPR	504	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	16-UNIMOD:267	ms_run[2]:scan=9470	53.816	2	1720.8871	1720.8871	R	L	541	557
PSM	VGEIFSAAGAAFTK	505	sp|Q8IXM2-2|BAP18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=9791	55.605	2	1367.7085	1367.7085	K	L	8	22
PSM	VGINYQPPTVVPGGDLAK	506	sp|P68366-2|TBA4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=8967	50.86	2	1823.9781	1823.9781	K	V	338	356
PSM	VLQDMGLPTGAEGR	507	sp|Q12906-5|ILF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:267	ms_run[2]:scan=6989	39.821	2	1452.727	1452.7270	K	D	461	475
PSM	VPADTEVVCAPPTAYIDFAR	508	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	9-UNIMOD:4	ms_run[2]:scan=11079	63.739	2	2191.062	2191.0620	K	Q	71	91
PSM	VPFCPMVGSEVYSTEIK	509	sp|Q9Y265|RUVB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=10535	60.363	2	1947.9418	1947.9418	K	K	91	108
PSM	VTNGAFTGEISPGMIK	510	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:35	ms_run[2]:scan=7191	40.873	2	1636.8131	1636.8131	K	D	107	123
PSM	YAICSALAASALPALVMSK	511	sp|P36578|RL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:4,17-UNIMOD:35	ms_run[2]:scan=12460	72.635	2	1952.0111	1952.0111	R	G	122	141
PSM	YAICSALAASALPALVMSK	512	sp|P36578|RL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:4,17-UNIMOD:35,19-UNIMOD:188	ms_run[2]:scan=12462	72.647	2	1958.0312	1958.0312	R	G	122	141
PSM	YGIVDYMIEQSGPPSK	513	sp|P13667|PDIA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	16-UNIMOD:188	ms_run[2]:scan=10877	62.489	2	1788.87	1788.8700	K	E	273	289
PSM	YITGDQLGALYQDFVR	514	sp|P09104-2|ENOG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	16-UNIMOD:267	ms_run[2]:scan=13595	80.064	2	1867.9344	1867.9344	R	D	227	243
PSM	YPANSIVVVGGCPVCR	515	sp|O95415|BRI3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	12-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=7443	42.381	2	1746.8545	1746.8545	R	V	67	83
PSM	YVDLGGSYVGPTQNR	516	sp|P27338-2|AOFB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:267	ms_run[2]:scan=6428	36.85	2	1634.7928	1634.7928	K	I	37	52
PSM	YVPGSSGSSNTLPTADPFTGAGR	517	sp|Q9Y263|PLAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	23-UNIMOD:267	ms_run[2]:scan=8530	48.441	2	2248.0636	2248.0636	R	Y	477	500
PSM	QSSATSSFGGLGGGSVR	518	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:28	ms_run[1]:scan=7561	43.089009999999995	2	1536.7185	1536.7163	R	F	8	25
PSM	AFLASPEYVNLPINGNGK	519	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	18-UNIMOD:188	ms_run[1]:scan=10744	61.681475	2	1909.011167	1909.004092	K	Q	192	210
PSM	QQQMVVAHQYSFAPDGEAR	520	sp|Q68CZ2|TENS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:28	ms_run[1]:scan=8116	46.132175	2	2143.9793	2143.9740	R	L	592	611
PSM	QTIAHQQQQLTNLQMAAQR	521	sp|Q9UHX1-2|PUF60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:28	ms_run[1]:scan=7705	43.90896333333334	2	2190.1007	2190.0959	K	Q	86	105
PSM	QATVGDINTERPGMLDFTGK	522	sp|P07108|ACBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:28,11-UNIMOD:267,14-UNIMOD:35,20-UNIMOD:188	ms_run[1]:scan=8661	49.16075	2	2164.0467	2164.0436	K	A	34	54
PSM	ADLPEGVAVSGPSPAEFCR	523	sp|Q8IXI1|MIRO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	18-UNIMOD:4,19-UNIMOD:267	ms_run[1]:scan=8844	50.142493333333334	2	1968.9372	1967.9282	K	K	526	545
PSM	LVLVLPDVEEQSPESCGR	524	sp|O60318|GANP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	16-UNIMOD:4	ms_run[1]:scan=10889	62.55930166666667	2	2025.966499	2026.004106	K	I	1362	1380
PSM	QVTPDGESDEVGVIPSKR	525	sp|Q12959|DLG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:28,17-UNIMOD:188,18-UNIMOD:267	ms_run[1]:scan=6511	37.309670000000004	2	1910.9599	1910.9551	R	R	628	646
PSM	AAPCIYWLPLTDSQIVQK	526	sp|Q9UKV3-3|ACINU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:4,18-UNIMOD:188	ms_run[2]:scan=13166	77.282	2	2108.1072	2108.1072	K	E	462	480
PSM	AAVEEGIVLGGGCALLR	527	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	13-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=10578	60.639	2	1693.9061	1693.9061	R	C	430	447
PSM	ADLPEGVAVSGPSPAEFCR	528	sp|Q8IXI1|MIRO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	18-UNIMOD:4	ms_run[2]:scan=8914	50.546	2	1957.9204	1957.9204	K	K	526	545
PSM	AEVSIDQSKLPGVK	529	sp|Q8IVM0|CCD50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:1,9-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=7743	44.117	2	1523.8598	1523.8598	M	E	2	16
PSM	AGGADAVQTVTGGLR	530	sp|Q9H223|EHD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	15-UNIMOD:267	ms_run[2]:scan=6595	37.748	2	1381.7189	1381.7189	R	S	15	30
PSM	AILVDLEPGTMDSVR	531	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=10472	59.962	2	1614.8287	1614.8287	R	S	63	78
PSM	AIVAIENPADVSVISSR	532	sp|P08865|RSSA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	17-UNIMOD:267	ms_run[2]:scan=9525	54.132	2	1749.95	1749.9500	R	N	64	81
PSM	ALTVPELTQQMFDAK	533	sp|P68371|TBB4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	15-UNIMOD:188	ms_run[2]:scan=12301	71.619	2	1696.8801	1696.8801	R	N	283	298
PSM	ALTVPELTQQMFDAK	534	sp|P68371|TBB4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	15-UNIMOD:188	ms_run[2]:scan=12464	72.664	2	1696.8801	1696.8801	R	N	283	298
PSM	APIVTVGVNNDPADVR	535	sp|Q9BPX3|CND3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	16-UNIMOD:267	ms_run[2]:scan=6780	38.703	2	1645.8663	1645.8663	R	K	471	487
PSM	ASCASIDIEDATQHLR	536	sp|Q6P2E9|EDC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:1,3-UNIMOD:4	ms_run[2]:scan=10383	59.384	2	1827.8421	1827.8421	M	D	2	18
PSM	CFSPGVIEVQEVQGK	537	sp|O15160-2|RPAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:4	ms_run[2]:scan=8205	46.673	2	1675.824	1675.8240	R	K	256	271
PSM	FDTGNLCMVTGGANLGR	538	sp|P62701|RS4X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:4,8-UNIMOD:35,17-UNIMOD:267	ms_run[2]:scan=8143	46.296	2	1807.8221	1807.8221	K	I	175	192
PSM	FGYVDFESAEDLEK	539	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=10580	60.651	2	1647.7304	1647.7304	K	A	349	363
PSM	FLEGTSCIAGVFVDATK	540	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:4	ms_run[2]:scan=12214	71.061	2	1813.892	1813.8920	K	E	3896	3913
PSM	FQDVGPQAPVGSVYQK	541	sp|Q9UJU6|DBNL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	16-UNIMOD:188	ms_run[2]:scan=6397	36.681	2	1724.8829	1724.8829	R	T	149	165
PSM	FSFCCSPEPEAEAEAAAGPGPCER	542	sp|Q13501|SQSTM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:4,5-UNIMOD:4,22-UNIMOD:4,24-UNIMOD:267	ms_run[2]:scan=8602	48.84	2	2635.0653	2635.0653	R	L	23	47
PSM	FTITPSTTQVVGILK	543	sp|P47755|CAZA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=11097	63.847	2	1603.9185	1603.9185	K	I	179	194
PSM	GAGIGGLGITVEGPSESK	544	sp|O75369-6|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	18-UNIMOD:188	ms_run[2]:scan=8637	49.027	2	1633.8618	1633.8618	R	I	1355	1373
PSM	GAGTDEGCLIEILASR	545	sp|P09525|ANXA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	8-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=12023	69.769	2	1670.8173	1670.8173	K	T	101	117
PSM	GALTVGITNTVGSSISR	546	sp|Q06210-2|GFPT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	17-UNIMOD:267	ms_run[2]:scan=8591	48.78	2	1641.8925	1641.8925	R	E	440	457
PSM	GANVIAGVWLEEAGQK	547	sp|Q15149-7|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	16-UNIMOD:188	ms_run[2]:scan=11150	64.183	2	1646.8723	1646.8723	R	L	2990	3006
PSM	GCAFAQFMTQEAAQK	548	sp|Q9NW13-2|RBM28_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	2-UNIMOD:4	ms_run[2]:scan=9599	54.56	2	1686.7494	1686.7494	K	C	236	251
PSM	GFFDPNTEENLTYLQLK	549	sp|P15924-2|DESP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=12446	72.551	2	2027.984	2027.9840	K	E	1815	1832
PSM	GGGGGQDNGLEGLGNDSR	550	sp|P08621-4|RU17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=4115	24.815	2	1658.7245	1658.7245	R	D	298	316
PSM	GINSSNVENQLQATQAAR	551	sp|P52292|IMA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	18-UNIMOD:267	ms_run[2]:scan=6160	35.39	2	1909.9481	1909.9481	K	K	84	102
PSM	GLPCTELFVAPVGVASK	552	sp|O00515|LAD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=11093	63.823	2	1749.9431	1749.9431	R	R	425	442
PSM	GQDEASAGGIWGFIK	553	sp|Q96M27-4|PRRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=11802	68.268	2	1534.7416	1534.7416	R	G	204	219
PSM	GTGLQPGEEELPDIAPPLVTPDEPK	554	sp|P45974-2|UBP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=11270	64.959	2	2598.3065	2598.3065	R	A	604	629
PSM	GYAVNVFDIQQGFDNPQVR	555	sp|Q15738|NSDHL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=11987	69.53	2	2166.0494	2166.0494	R	F	61	80
PSM	IAESLPGVESCQNYLFR	556	sp|O14686|KMT2D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	11-UNIMOD:4	ms_run[2]:scan=10645	61.063	2	1981.9568	1981.9568	R	Y	5304	5321
PSM	IFVGGLSPDTPEEK	557	sp|Q14103-4|HNRPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	14-UNIMOD:188	ms_run[2]:scan=7531	42.908	2	1493.7709	1493.7709	K	I	165	179
PSM	IGIIDGEYVVNPTR	558	sp|Q8TCS8|PNPT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	14-UNIMOD:267	ms_run[2]:scan=9171	52.113	2	1554.8281	1554.8281	R	K	193	207
PSM	IIGATDSSGELMFLMK	559	sp|Q13185|CBX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=12442	72.523	2	1711.8525	1711.8525	R	W	126	142
PSM	ISLGLPVGAVINCADNTGAK	560	sp|P62829|RL23_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	13-UNIMOD:4,20-UNIMOD:188	ms_run[2]:scan=11481	66.283	3	1975.0504	1975.0504	R	N	16	36
PSM	ISPDAWQVCAEALAQR	561	sp|O43592|XPOT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	9-UNIMOD:4	ms_run[2]:scan=10705	61.44	2	1813.8781	1813.8781	K	T	30	46
PSM	LAEGEQILSGGVFNK	562	sp|P30260|CDC27_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=9457	53.735	2	1560.8148	1560.8148	K	Q	85	100
PSM	LATPELLETAQALER	563	sp|Q8N6R0-2|EFNMT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=11546	66.679	2	1653.8938	1653.8938	K	T	357	372
PSM	LATQSNEITIPVTFESR	564	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=9821	55.762	2	1904.9844	1904.9844	K	A	172	189
PSM	LGCYFCNDVVAPGDSTR	565	sp|O95352-3|ATG7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:4,6-UNIMOD:4	ms_run[2]:scan=8138	46.263	2	1929.8349	1929.8349	K	D	509	526
PSM	LGLGGNAPVSIPQQSQSVK	566	sp|Q9H2P0|ADNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	19-UNIMOD:188	ms_run[2]:scan=7573	43.158	2	1885.0365	1885.0365	R	Q	349	368
PSM	LIAPVAEEEATVPNNK	567	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=6423	36.825	2	1693.8887	1693.8887	K	I	8	24
PSM	LLDAQLATGGIVDPR	568	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=9221	52.385	2	1537.8464	1537.8464	R	L	3767	3782
PSM	LQPFATEADVEEALR	569	sp|P33992|MCM5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	15-UNIMOD:267	ms_run[2]:scan=11101	63.873	2	1697.85	1697.8500	K	L	628	643
PSM	LSLDGQNIYNACCTLR	570	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	12-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=9067	51.502	2	1896.8822	1896.8822	K	I	239	255
PSM	LTPTSVLDYFGTGSVQR	571	sp|P35251-2|RFC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	17-UNIMOD:267	ms_run[2]:scan=12518	73.018	2	1849.9449	1849.9449	K	S	160	177
PSM	LYIGNLSPAVTADDLR	572	sp|Q9Y6M1-1|IF2B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	16-UNIMOD:267	ms_run[2]:scan=10658	61.147	2	1726.9129	1726.9129	K	Q	5	21
PSM	MAPYQGPDAVPGALDYK	573	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=8313	47.243	2	1791.8502	1791.8502	R	S	883	900
PSM	MCDLVSDFDGFSER	574	sp|P30520|PURA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:35,2-UNIMOD:4	ms_run[2]:scan=10650	61.095	2	1692.676	1692.6760	R	F	181	195
PSM	MELLGEYVGQEGKPQK	575	sp|Q9BXV9|GON7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:1,13-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=12576	73.39	2	1858.9538	1858.9538	-	L	1	17
PSM	MTLADDVTLDDLIMAK	576	sp|P62191-2|PRS4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:35,16-UNIMOD:188	ms_run[2]:scan=12713	74.285	2	1785.8836	1785.8836	R	D	299	315
PSM	MTLADDVTLDDLIMAK	577	sp|P62191-2|PRS4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:35	ms_run[2]:scan=12723	74.349	2	1779.8634	1779.8634	R	D	299	315
PSM	MTNGFSGADLTEICQR	578	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:35,14-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=8133	46.236	2	1824.801	1824.8010	K	A	678	694
PSM	NAAQVLVGIPLETGQK	579	sp|Q9BT78|CSN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	16-UNIMOD:188	ms_run[2]:scan=9869	56.003	2	1642.9349	1642.9349	R	Q	122	138
PSM	NDLSPASSGNAVYDFFIGR	580	sp|Q14739|LBR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=13498	79.424	2	2028.9541	2028.9541	R	E	354	373
PSM	NENQLIIFADDTYPR	581	sp|Q15393|SF3B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=11260	64.895	2	1807.8741	1807.8741	R	W	1017	1032
PSM	NLFEDQNTLTSICEK	582	sp|P55060|XPO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	13-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=9317	52.946	2	1816.8609	1816.8609	K	V	332	347
PSM	NLFEDQNTLTSICEK	583	sp|P55060|XPO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	13-UNIMOD:4	ms_run[2]:scan=9319	52.955	2	1810.8407	1810.8407	K	V	332	347
PSM	NLTALGLNLVASGGTAK	584	sp|P31939-2|PUR9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	17-UNIMOD:188	ms_run[2]:scan=10954	62.961	2	1604.9193	1604.9193	R	A	22	39
PSM	NYLEGIYNVPVAAVR	585	sp|Q16540|RM23_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	15-UNIMOD:267	ms_run[2]:scan=10824	62.163	2	1686.8969	1686.8969	R	T	55	70
PSM	QSLGELIGTLNAAK	586	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	14-UNIMOD:188	ms_run[2]:scan=11394	65.747	2	1419.8029	1419.8029	K	V	57	71
PSM	SECLNNIGDSSPLIR	587	sp|Q92973-2|TNPO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=7891	44.896	2	1683.8126	1683.8126	K	A	93	108
PSM	SELPLDPLPVPTEEGNPLLK	588	sp|Q15758|AAAT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	20-UNIMOD:188	ms_run[2]:scan=12838	75.085	3	2163.177	2163.1770	K	H	503	523
PSM	SGLGELILPENEPGSSIMPGK	589	sp|P07954-2|FUMH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=11448	66.077	2	2124.0773	2124.0773	R	V	308	329
PSM	SGNWESSEGWGAQPEGAGAQR	590	sp|Q9Y5X1|SNX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=6524	37.381	2	2159.9257	2159.9257	K	N	116	137
PSM	SLGGDVASDGDFLIFEGNR	591	sp|O00267-2|SPT5H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	19-UNIMOD:267	ms_run[2]:scan=12231	71.171	2	1977.9308	1977.9308	R	Y	343	362
PSM	SLVASLAEPDFVVTDFAK	592	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=13325	78.303	2	1907.988	1907.9880	K	F	265	283
PSM	SMVPVQVQLDVPVVK	593	sp|P18754|RCC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	2-UNIMOD:35	ms_run[2]:scan=9683	55.001	2	1652.9171	1652.9171	K	V	162	177
PSM	SQIFSTASDNQPTVTIK	594	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	17-UNIMOD:188	ms_run[2]:scan=7480	42.594	2	1841.9466	1841.9466	K	V	448	465
PSM	SSAQDPQAVLGALGR	595	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=8719	49.46	2	1468.7634	1468.7634	R	A	123	138
PSM	SVGLANQELAEVVSR	596	sp|P78540|ARGI2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	15-UNIMOD:267	ms_run[2]:scan=9330	53.013	2	1580.8398	1580.8398	R	A	91	106
PSM	SYELPDGQVITIGNER	597	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	16-UNIMOD:267	ms_run[2]:scan=10454	59.848	2	1799.8929	1799.8929	K	F	239	255
PSM	SYELPDGQVITIGNER	598	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=10455	59.854	2	1789.8846	1789.8846	K	F	239	255
PSM	SYQDPSNAQFLESIR	599	sp|Q9UNZ2-4|NSF1C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=9162	52.065	2	1753.8271	1753.8271	R	R	169	184
PSM	TAGQPEGGPGADFGQSCFPAEAGR	600	sp|Q14694|UBP10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	17-UNIMOD:4	ms_run[2]:scan=7509	42.771	2	2363.0237	2363.0237	R	D	238	262
PSM	TAMNVNEIFMAIAK	601	sp|P51148|RAB5C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	14-UNIMOD:188	ms_run[2]:scan=13672	80.572	2	1557.799	1557.7991	K	K	167	181
PSM	TEVNGFDPLFNAITGLNGSGK	602	sp|O95347|SMC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	21-UNIMOD:188	ms_run[2]:scan=14000	83.112	2	2156.0845	2156.0845	R	S	18	39
PSM	TIAECLADELINAAK	603	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=13937	82.616	2	1636.8438	1636.8438	K	G	168	183
PSM	TIGGGDDSFTTFFCETGAGK	604	sp|P68366-2|TBA4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	14-UNIMOD:4,20-UNIMOD:188	ms_run[2]:scan=11621	67.152	2	2072.9093	2072.9093	K	H	26	46
PSM	TLNEWSSQINPDLVR	605	sp|P48507|GSH0_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	15-UNIMOD:267	ms_run[2]:scan=9680	54.986	2	1780.8983	1780.8983	K	E	50	65
PSM	TSVLAAANPIESQWNPK	606	sp|P33991|MCM4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=9663	54.897	2	1824.937	1824.9370	R	K	611	628
PSM	VAAAESMPLLLECAR	607	sp|O00410-2|IPO5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	13-UNIMOD:4	ms_run[2]:scan=10456	59.86	2	1629.8218	1629.8218	R	V	661	676
PSM	VAAAESMPLLLECAR	608	sp|O00410-2|IPO5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	13-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=10431	59.699	2	1639.8301	1639.8301	R	V	661	676
PSM	VAMANIQPQMLVAGATSIAR	609	sp|P18206|VINC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=12138	70.549	2	2041.0813	2041.0813	K	R	739	759
PSM	VDFPQDQLTALTGR	610	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	14-UNIMOD:267	ms_run[2]:scan=10371	59.304	2	1569.8026	1569.8026	K	I	216	230
PSM	VFLDPNILSDDGTVALR	611	sp|P48147|PPCE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=12382	72.141	2	1843.968	1843.9680	R	G	112	129
PSM	VGPQYQAVVPDFDPAK	612	sp|Q9UKL0|RCOR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	16-UNIMOD:188	ms_run[2]:scan=9375	53.272	2	1735.8877	1735.8877	R	L	107	123
PSM	VGSLNCIVAVSQNMGIGK	613	sp|P00374|DYR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:4,18-UNIMOD:188	ms_run[2]:scan=11206	64.551	2	1851.9642	1851.9642	M	N	2	20
PSM	VLGQLTETGVVSPEQFMK	614	sp|Q96EK6|GNA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	17-UNIMOD:35	ms_run[2]:scan=9322	52.968	2	1978.0081	1978.0081	K	S	56	74
PSM	VLLESEQFLTELTR	615	sp|P37108|SRP14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=13135	77.076	2	1676.8985	1676.8985	M	L	2	16
PSM	VMTIPYQPMPASSPVICAGGQDR	616	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	17-UNIMOD:4,23-UNIMOD:267	ms_run[2]:scan=9771	55.498	2	2484.1839	2484.1839	R	C	178	201
PSM	VPFCPMVGSEVYSTEIK	617	sp|Q9Y265|RUVB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:4	ms_run[2]:scan=10536	60.369	2	1941.9216	1941.9216	K	K	91	108
PSM	VPSENVLGEVGSGFK	618	sp|P49748-2|ACADV_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=9427	53.574	2	1517.7726	1517.7726	R	V	295	310
PSM	VPSENVLGEVGSGFK	619	sp|P49748-2|ACADV_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	15-UNIMOD:188	ms_run[2]:scan=9434	53.614	2	1523.7927	1523.7927	R	V	295	310
PSM	VVLAYEPVWAIGTGK	620	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=11757	67.995	2	1601.8817	1601.8817	K	T	198	213
PSM	WLCTGDIGEFEPDGCLK	621	sp|O95573|ACSL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=11240	64.768	2	1995.8706	1995.8706	R	I	559	576
PSM	YVVQNPEQEPLSQFLR	622	sp|Q8WVV4-1|POF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=11382	65.672	2	1945.9898	1945.9898	K	G	139	155
PSM	VFPGSTTEDYNLIVIER	623	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	17-UNIMOD:267	ms_run[1]:scan=11078	63.733216666666664	2	1962.007436	1961.997377	K	G	508	525
PSM	VFPGSTTEDYNLIVIER	624	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	17-UNIMOD:267	ms_run[1]:scan=11238	64.75757833333333	2	1962.007436	1961.997377	K	G	508	525
PSM	QATKDAGQISGLNVLR	625	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:28	ms_run[1]:scan=8471	48.119945	2	1652.8845	1652.8841	R	V	203	219
PSM	TVTNAVVTVPAYFNDSQR	626	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=9485	53.90759166666666	2	1983.001546	1980.990505	K	Q	138	156
PSM	CLLAASPENEAGGLKLDGR	627	sp|Q9NW13|RBM28_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:385,1-UNIMOD:4,15-UNIMOD:188,19-UNIMOD:267	ms_run[1]:scan=10834	62.226731666666666	2	1968.9979	1968.9904	K	Q	392	411
PSM	TIGGGDDSFNTFFSETGAGK	628	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=11432	65.97668166666666	2	2007.883158	2006.885765	K	H	41	61
PSM	QSSGPGASSGTSGDHGELVVR	629	sp|P29692-3|EF1D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:28	ms_run[1]:scan=4245	25.436536666666665	2	1966.8985	1966.8975	R	I	39	60
PSM	SQEQLAAELAEYTAK	630	sp|P15311|EZRI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	15-UNIMOD:188	ms_run[1]:scan=9720	55.21401333333333	2	1657.840381	1656.830210	K	I	413	428
PSM	QGQGQLVTCSGAFKEGSLR	631	sp|Q16531|DDB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:28,9-UNIMOD:4	ms_run[1]:scan=7642	43.552725	2	2004.9726	2004.9682	R	I	370	389
PSM	QLDFNSSKDVAVMQLR	632	sp|P53621|COPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:28,8-UNIMOD:188,16-UNIMOD:267	ms_run[1]:scan=10924	62.7736	2	1848.9410	1848.9370	R	S	343	359
PSM	QVFGEATKQPGITFIAAK	633	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:28,8-UNIMOD:188,18-UNIMOD:188	ms_run[1]:scan=10839	62.260034999999995	2	1900.0556	1900.0492	R	F	177	195
PSM	QTPNDLTGEHSCIMLK	634	sp|Q9H0A0|NAT10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:28,12-UNIMOD:4,16-UNIMOD:188	ms_run[1]:scan=8103	46.054118333333335	2	1831.8545	1831.8535	R	T	735	751
PSM	QKLFQEDDEIPLYLK	635	sp|P14406|CX7A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:28	ms_run[1]:scan=12248	71.278765	2	1860.9513	1860.9504	K	G	32	47
PSM	CSVLAAANPVYGRYDQYK	636	sp|P25205|MCM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=10421	59.63114	2	2056.9712	2056.9671	R	T	446	464
PSM	ATENDIANFFSPLNPIR	637	sp|P31942|HNRH3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=13617	80.21310333333334	2	1918.943838	1917.958477	R	V	206	223
PSM	LVLVSPTSEQYDSLLR	638	sp|O00178|GTPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	16-UNIMOD:267	ms_run[1]:scan=11116	63.96494333333334	2	1829.987803	1828.980999	K	Q	65	81
PSM	MSGGWELELNGTEAK	639	sp|Q07021|C1QBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	1-UNIMOD:35	ms_run[1]:scan=8729	49.50695	2	1637.726431	1636.740287	K	L	105	120
PSM	AEVSIDQSKLPGVK	640	sp|Q8IVM0|CCD50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:1	ms_run[1]:scan=7738	44.09445833333333	2	1511.8121	1511.8190	M	E	2	16
PSM	QLQALSSELAQARDETK	641	sp|P35241|RADI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:28,13-UNIMOD:267,17-UNIMOD:188	ms_run[1]:scan=11625	67.17516166666667	2	1885.9766	1885.9711	K	K	527	544
PSM	QCSDLLSQAQYHVAR	642	sp|Q6PD62|CTR9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:28,2-UNIMOD:4	ms_run[1]:scan=8145	46.306940000000004	2	1757.8189	1757.8150	R	A	816	831
PSM	QGTFHSQQALEYGTK	643	sp|P53597|SUCA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:28,15-UNIMOD:188	ms_run[1]:scan=5597	32.50682333333334	2	1683.7982	1682.7992	K	L	67	82
PSM	QGNMTAALQAALKNPPINTK	644	sp|O15511|ARPC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:28	ms_run[1]:scan=11814	68.34474499999999	2	2063.0891	2063.0828	R	S	48	68
PSM	AGYIIPLQGPGLTTTESR	645	sp|P10253|LYAG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=9897	56.154	2	1872.9945	1872.9945	R	Q	820	838
PSM	AIQLNSNSVQALLLK	646	sp|Q9UJX3-2|APC7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:188	ms_run[2]:scan=11633	67.223	2	1616.9557	1616.9557	K	G	365	380
PSM	AIQTVSCLLQGPCDAGNR	647	sp|Q9H3U1-2|UN45A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	7-UNIMOD:4,13-UNIMOD:4,18-UNIMOD:267	ms_run[2]:scan=8844	50.142	2	1968.9385	1968.9385	R	A	399	417
PSM	ALEFGEPVLLVGDTGCGK	648	sp|Q9NU22|MDN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	16-UNIMOD:4	ms_run[2]:scan=11781	68.136	2	1860.9291	1860.9292	R	T	1379	1397
PSM	ALTVPELTQQMFDAK	649	sp|P68371|TBB4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=12318	71.727	2	1690.86	1690.8600	R	N	283	298
PSM	ALTVPELTQQMFDAK	650	sp|P68371|TBB4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=12482	72.781	2	1690.86	1690.8600	R	N	283	298
PSM	ALYDTFSAFGNILSCK	651	sp|Q13310-3|PABP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:4	ms_run[2]:scan=13775	81.306	2	1805.8658	1805.8658	K	V	114	130
PSM	AMDSDWFAENYMGR	652	sp|P55084-2|ECHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=10977	63.101	2	1691.6708	1691.6708	K	K	370	384
PSM	ASCASIDIEDATQHLR	653	sp|Q6P2E9|EDC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:1,3-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=10464	59.911	2	1837.8504	1837.8504	M	D	2	18
PSM	ASGGLPQFGDEYDFYR	654	sp|Q01780-2|EXOSX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=10751	61.724	2	1820.8006	1820.8006	K	S	49	65
PSM	ASQSQGIQQLLQAEKR	655	sp|O95670-2|VATG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:1	ms_run[2]:scan=9216	52.358	2	1825.9646	1825.9646	M	A	2	18
PSM	AVLPEGQDVTSGFSR	656	sp|Q32P41|TRM5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:267	ms_run[2]:scan=7434	42.327	2	1571.7819	1571.7819	R	I	188	203
PSM	AVLVDLEPGTMDSVR	657	sp|P68371|TBB4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	11-UNIMOD:35,15-UNIMOD:267	ms_run[2]:scan=8220	46.754	2	1626.8162	1626.8162	R	S	63	78
PSM	CAGPTPEAELQALAR	658	sp|Q15050|RRS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:4	ms_run[2]:scan=9755	55.407	2	1582.7773	1582.7773	R	D	52	67
PSM	CLSEQIADAYSSFR	659	sp|Q5JTV8|TOIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:4	ms_run[2]:scan=10743	61.676	2	1645.7406	1645.7406	R	S	424	438
PSM	CTVIAAANPIGGR	660	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=5732	33.186	2	1308.6848	1308.6848	R	Y	624	637
PSM	DLAGAPPGEVVGCFTPQSR	661	sp|Q9Y446|PKP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:4	ms_run[2]:scan=8945	50.725	2	1956.9364	1956.9364	R	R	557	576
PSM	DNPNLLFNMCGFECR	662	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	10-UNIMOD:4,14-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=12186	70.865	2	1895.7992	1895.7992	K	I	1181	1196
PSM	ELPALVVYESQAGQPVQR	663	sp|Q969G9|NKD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=9888	56.102	2	1983.0425	1983.0425	R	H	434	452
PSM	ELVEPLTPSGEAPNQALLR	664	sp|P00533|EGFR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	19-UNIMOD:267	ms_run[2]:scan=9585	54.479	2	2043.0876	2043.0876	R	I	687	706
PSM	ESFSLVQVQPGVDIIR	665	sp|P46379-4|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	16-UNIMOD:267	ms_run[2]:scan=11515	66.492	2	1795.9708	1795.9708	R	T	689	705
PSM	FAMEPEEFDSDTLR	666	sp|P13667|PDIA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=9621	54.678	2	1685.7243	1685.7243	K	E	486	500
PSM	FDDGAGGDNEVQR	667	sp|P35998|PRS7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:267	ms_run[2]:scan=1920	13.744	2	1388.5832	1388.5832	R	T	285	298
PSM	FDQLFDDESDPFEVLK	668	sp|Q8NC51-4|PAIRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	16-UNIMOD:188	ms_run[2]:scan=13344	78.427	2	1948.9038	1948.9038	R	A	17	33
PSM	FISLASLEYSDYSK	669	sp|Q14232|EI2BA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	14-UNIMOD:188	ms_run[2]:scan=11373	65.614	2	1627.8077	1627.8077	R	C	75	89
PSM	FLQDGTVEGCLEQR	670	sp|Q86YS7|C2CD5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	10-UNIMOD:4	ms_run[2]:scan=7388	42.076	2	1650.7672	1650.7672	R	L	440	454
PSM	FNYGFEYLGVQDK	671	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=10642	61.046	2	1578.7355	1578.7355	K	L	1866	1879
PSM	FQMPDQGMTSADDFFQGTK	672	sp|Q16555-2|DPYL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:35,8-UNIMOD:35	ms_run[2]:scan=8182	46.538	2	2181.8983	2181.8983	R	A	40	59
PSM	FQSIVIGCALEDQK	673	sp|O95816|BAG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	8-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=9263	52.634	2	1612.8226	1612.8226	K	K	155	169
PSM	FSASGELGNGNIK	674	sp|P12004|PCNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=5115	30.146	2	1292.6361	1292.6361	K	L	169	182
PSM	FSFCCSPEPEAEAEAAAGPGPCER	675	sp|Q13501|SQSTM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:4,5-UNIMOD:4,22-UNIMOD:4	ms_run[2]:scan=8605	48.856	2	2625.057	2625.0570	R	L	23	47
PSM	FSIQTMCPIEGEGNIAR	676	sp|Q13155-2|AIMP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	7-UNIMOD:4	ms_run[2]:scan=9614	54.646	2	1921.9026	1921.9026	K	F	130	147
PSM	FYSQAIELNPSNAIYYGNR	677	sp|P53041|PPP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	19-UNIMOD:267	ms_run[2]:scan=10463	59.905	2	2229.073	2229.0730	K	S	50	69
PSM	GAGTDEGCLIEILASR	678	sp|P09525|ANXA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	8-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=12056	69.991	2	1670.8173	1670.8173	K	T	101	117
PSM	GAGTNEDALIEILTTR	679	sp|P12429|ANXA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	16-UNIMOD:267	ms_run[2]:scan=13070	76.649	2	1682.8714	1682.8714	K	T	105	121
PSM	GEGPEAGAGGAGGR	680	sp|A0FGR8-2|ESYT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=727	7.7241	2	1141.5112	1141.5112	R	A	54	68
PSM	GFGTDEQAIIDCLGSR	681	sp|P50995-2|ANX11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	12-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=11134	64.087	2	1747.8075	1747.8075	K	S	182	198
PSM	GPAGDATVASEKESVM	682	sp|Q15758|AAAT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	12-UNIMOD:188	ms_run[2]:scan=4745	28.027	2	1553.7339	1553.7339	R	-	526	542
PSM	GPCIIYNEDNGIIK	683	sp|P36578|RL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=8102	46.049	2	1610.807	1610.8070	R	A	206	220
PSM	GQLPDYTSPVVLPYSR	684	sp|Q9Y295|DRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	16-UNIMOD:267	ms_run[2]:scan=9777	55.536	2	1800.9286	1800.9286	K	T	300	316
PSM	GSTAPVGGGAFPTIVER	685	sp|Q15084-3|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=8360	47.492	2	1614.8366	1614.8366	R	E	390	407
PSM	GVGTDEACLIEILASR	686	sp|P50995-2|ANX11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	8-UNIMOD:4	ms_run[2]:scan=13253	77.841	2	1702.856	1702.8560	K	S	254	270
PSM	GWEEGVAQMSVGQR	687	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	9-UNIMOD:35	ms_run[2]:scan=5478	31.94	2	1548.6991	1548.6991	R	A	59	73
PSM	ICDQWDNLGALTQK	688	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:4	ms_run[2]:scan=9647	54.812	2	1660.7879	1660.7879	K	R	479	493
PSM	ICNEILTSPCSPEIR	689	sp|Q9BPX3|CND3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=7679	43.759	2	1787.8546	1787.8546	K	V	834	849
PSM	IDCFSEVPTSVFGEK	690	sp|O00567|NOP56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=10522	60.279	2	1719.8121	1719.8121	R	L	382	397
PSM	IGQQPQQPGAPPQQDYTK	691	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=3274	20.568	2	1979.9701	1979.9701	K	A	629	647
PSM	ILDQGEDFPASEMTR	692	sp|P30040|ERP29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=8187	46.571	2	1707.7774	1707.7774	K	I	209	224
PSM	IQTLPNQNQSQTQPLLK	693	sp|Q8IX12-2|CCAR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	17-UNIMOD:188	ms_run[2]:scan=6286	36.053	2	1956.0736	1956.0736	R	T	190	207
PSM	ISATSIFFESMPYK	694	sp|P34897-3|GLYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=12802	74.864	2	1619.7905	1619.7905	R	L	162	176
PSM	IVDDWANDGWGLK	695	sp|P27824-3|CALX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:188	ms_run[2]:scan=10349	59.163	2	1493.7246	1493.7246	R	K	338	351
PSM	IVEPYIAWGYPNLK	696	sp|P18124|RL7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	14-UNIMOD:188	ms_run[2]:scan=11777	68.113	2	1667.9019	1667.9019	R	S	135	149
PSM	IVLTNPVCTEVGEK	697	sp|P41091|IF2G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	8-UNIMOD:4	ms_run[2]:scan=7598	43.301	2	1557.8072	1557.8072	K	I	427	441
PSM	LAALPENPPAIDWAYYK	698	sp|O75947-2|ATP5H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=11600	67.016	2	1930.9829	1930.9829	R	A	42	59
PSM	LAAVDATVNQVLASR	699	sp|Q15084-3|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=9799	55.647	2	1526.8417	1526.8417	K	Y	214	229
PSM	LAQQQAALLMQQEER	700	sp|Q13435|SF3B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=7157	40.669	2	1755.8938	1755.8938	K	A	149	164
PSM	LDGLVETPTGYIESLPR	701	sp|P55209-3|NP1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=11429	65.96	2	1858.9676	1858.9676	R	V	15	32
PSM	LEILQQQLQVANEAR	702	sp|Q14980-4|NUMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:267	ms_run[2]:scan=9333	53.028	2	1761.9613	1761.9613	K	D	617	632
PSM	LEILQQQLQVANEAR	703	sp|Q14980-4|NUMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=9342	53.079	2	1751.953	1751.9530	K	D	617	632
PSM	LFADAVQELLPQYK	704	sp|P33993-2|MCM7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=12775	74.688	2	1633.8716	1633.8716	K	E	76	90
PSM	LFQEDDEIPLYLK	705	sp|P14406|CX7A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:188	ms_run[2]:scan=11411	65.85	2	1627.8441	1627.8441	K	G	34	47
PSM	LGADAVGMSTVPEVIVAR	706	sp|P00491|PNPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	8-UNIMOD:35,18-UNIMOD:267	ms_run[2]:scan=8582	48.728	2	1809.9534	1809.9534	K	H	212	230
PSM	LGGSAVISLEGKPL	707	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	12-UNIMOD:188	ms_run[2]:scan=9426	53.57	2	1345.7912	1345.7912	K	-	153	167
PSM	LGTDESCFNMILATR	708	sp|P20073-2|ANXA7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	7-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=10829	62.197	2	1736.8101	1736.8101	R	S	335	350
PSM	LLQQQNDITGLSR	709	sp|Q9UPN9-2|TRI33_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=6080	34.996	2	1484.7947	1484.7947	K	Q	395	408
PSM	LMTDTINEPILLCR	710	sp|O43776|SYNC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:4	ms_run[2]:scan=10530	60.328	2	1687.8637	1687.8637	R	F	426	440
PSM	LNFSTPTSTNIVSVCR	711	sp|O15067|PUR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=8736	49.543	2	1804.9017	1804.9017	R	A	94	110
PSM	LQALQADYQALQQR	712	sp|Q9BQS8|FYCO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	14-UNIMOD:267	ms_run[2]:scan=8210	46.7	2	1654.8666	1654.8666	K	E	639	653
PSM	LQEAGILSAEELQR	713	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=8333	47.344	2	1555.8206	1555.8206	R	L	2626	2640
PSM	MFVLDEADEMLSR	714	sp|P60842|IF4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:35,10-UNIMOD:35,13-UNIMOD:267	ms_run[2]:scan=8467	48.098	2	1596.7039	1596.7039	K	G	178	191
PSM	MFVLDEADEMLSR	715	sp|P60842|IF4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:35,10-UNIMOD:35	ms_run[2]:scan=8477	48.154	2	1586.6956	1586.6956	K	G	178	191
PSM	MFVLDEADEMLSR	716	sp|P60842|IF4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:35,13-UNIMOD:267	ms_run[2]:scan=11177	64.358	2	1580.709	1580.7090	K	G	178	191
PSM	MFVLDEADEMLSR	717	sp|P60842|IF4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:267	ms_run[2]:scan=12703	74.222	2	1564.7141	1564.7141	K	G	178	191
PSM	MFVLDEADEMLSR	718	sp|P60842|IF4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=12704	74.226	2	1554.7058	1554.7058	K	G	178	191
PSM	MLGDQFNGELEASAK	719	sp|Q5TBC7|B2L15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:35	ms_run[2]:scan=7309	41.61	2	1624.7403	1624.7403	R	N	59	74
PSM	MLNGLEDSIGLSK	720	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:35	ms_run[2]:scan=7991	45.409	2	1391.6966	1391.6966	K	M	1164	1177
PSM	MLNGLEDSIGLSK	721	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:35,13-UNIMOD:188	ms_run[2]:scan=7994	45.424	2	1397.7168	1397.7168	K	M	1164	1177
PSM	MLTAQDMSYDEAR	722	sp|Q01082|SPTB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:35,13-UNIMOD:267	ms_run[2]:scan=5202	30.575	2	1555.6522	1555.6522	K	N	1295	1308
PSM	MNLTQLYGSNTAGYIVCR	723	sp|Q12769|NU160_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	17-UNIMOD:4	ms_run[2]:scan=10715	61.502	2	2059.9819	2059.9819	R	G	701	719
PSM	MNQVEDEVFEEFCR	724	sp|Q14683|SMC1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:35,13-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=11120	63.994	2	1856.7585	1856.7585	K	E	769	783
PSM	MQGQEAVLAMSSR	725	sp|Q15393|SF3B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=6070	34.944	2	1406.6646	1406.6646	R	S	706	719
PSM	MSGGWELELNGTEAK	726	sp|Q07021|C1QBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:188	ms_run[2]:scan=9135	51.913	2	1626.7655	1626.7655	K	L	105	120
PSM	MVDDGSGEVQVWR	727	sp|P09327|VILI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:35	ms_run[2]:scan=6242	35.804	2	1492.6616	1492.6616	K	I	392	405
PSM	MVSDINNAWGCLEQVEK	728	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:35,11-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=10479	60.009	2	2013.9231	2013.9231	R	G	360	377
PSM	NAGGGGLENALSK	729	sp|Q8WZA9|IRGQ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:188	ms_run[2]:scan=4207	25.255	2	1192.6143	1192.6143	K	G	356	369
PSM	NDGAAILAAVSSIAQK	730	sp|P28331-3|NDUS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	16-UNIMOD:188	ms_run[2]:scan=12437	72.489	2	1533.8458	1533.8458	R	I	373	389
PSM	NISSSPSVESLPGGR	731	sp|Q92609|TBCD5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=5368	31.399	2	1485.7423	1485.7423	K	E	535	550
PSM	NLIDEDGNNQWPEGLK	732	sp|O00410-2|IPO5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=9395	53.392	2	1840.8592	1840.8592	R	F	59	75
PSM	NLLLLANSTEEQQK	733	sp|O75116|ROCK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	14-UNIMOD:188	ms_run[2]:scan=8542	48.51	2	1605.8669	1605.8669	K	W	1326	1340
PSM	NQLTSNPENTVFDAK	734	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:188	ms_run[2]:scan=6808	38.855	2	1682.8207	1682.8207	K	R	82	97
PSM	NQLTSNPENTVFDAK	735	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=6810	38.865	2	1676.8006	1676.8006	K	R	82	97
PSM	NQVAMNPTNTVFDAK	736	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:188	ms_run[2]:scan=7060	40.181	2	1654.808	1654.8080	K	R	57	72
PSM	NQYDNDVTVWSPQGR	737	sp|P25786|PSA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:267	ms_run[2]:scan=7447	42.408	2	1787.8102	1787.8102	R	I	4	19
PSM	NTNAGAPPGTAYQSPLPLSR	738	sp|Q02218-2|ODO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=7399	42.139	2	2011.0123	2011.0123	R	G	82	102
PSM	QCANLQNAIADAEQR	739	sp|P13647|K2C5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=7755	44.181	2	1710.7983	1710.7983	K	G	406	421
PSM	QILLYSATFPLSVQK	740	sp|P26196|DDX6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=12292	71.56	2	1706.9607	1706.9607	R	F	272	287
PSM	QPALSAACLGPEVTTQYGGQYR	741	sp|P13798|ACPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	8-UNIMOD:4,22-UNIMOD:267	ms_run[2]:scan=9049	51.39	2	2376.1408	2376.1408	R	T	23	45
PSM	SAPLDAALHALQEEQAR	742	sp|P80217|IN35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:1,17-UNIMOD:267	ms_run[2]:scan=13458	79.161	2	1870.9413	1870.9413	M	L	2	19
PSM	SLDLFNCEVTNLNDYR	743	sp|P39687|AN32A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	7-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=11875	68.76	2	1981.9079	1981.9079	K	E	117	133
PSM	SLGYAYVNFQQPADAER	744	sp|Q13310-3|PABP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=8809	49.935	2	1927.9064	1927.9064	R	A	51	68
PSM	SNMDNMFESYINNLR	745	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:35,15-UNIMOD:267	ms_run[2]:scan=12130	70.497	2	1872.801	1872.8010	R	R	134	149
PSM	SNMDNMFESYINNLR	746	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=13289	78.071	2	1846.7978	1846.7978	R	R	134	149
PSM	SPYTVTVGQACNPSACR	747	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	11-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=5301	31.065	2	1866.8353	1866.8353	R	A	468	485
PSM	SVYQLLSENPPDGER	748	sp|Q96FV9|THOC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=8711	49.419	2	1702.8162	1702.8162	K	F	359	374
PSM	SWASPVYTEADGTFSR	749	sp|Q8WWI1-3|LMO7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=9101	51.71	2	1772.8006	1772.8006	R	L	342	358
PSM	SWASPVYTEADGTFSR	750	sp|Q8WWI1-3|LMO7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	16-UNIMOD:267	ms_run[2]:scan=9126	51.858	2	1782.8088	1782.8088	R	L	342	358
PSM	TAWGQQPDLAANEAQLLR	751	sp|Q9UNM6|PSD13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	18-UNIMOD:267	ms_run[2]:scan=10211	58.204	2	1991.01	1991.0100	K	K	253	271
PSM	TGLTPLMEAASGGYAEVGR	752	sp|Q8IWZ3|ANKH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=11035	63.464	2	1878.9146	1878.9146	K	V	1256	1275
PSM	TLNEWSSQINPDLVR	753	sp|P48507|GSH0_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=9690	55.042	2	1770.8901	1770.8901	K	E	50	65
PSM	TLQEQLENGPNTQLAR	754	sp|Q9P2E9|RRBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=6999	39.867	2	1810.9173	1810.9173	R	L	782	798
PSM	TLQVSPLDNGDLIR	755	sp|P29350-2|PTN6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=9354	53.149	2	1539.8257	1539.8257	R	E	355	369
PSM	TPSPLILDQNYINTK	756	sp|Q9UK58-4|CCNL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:188	ms_run[2]:scan=9555	54.31	2	1721.9295	1721.9295	R	N	164	179
PSM	TSPSGGTWSSVVSGVPR	757	sp|Q99700-2|ATX2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=8426	47.868	2	1659.8216	1659.8216	R	L	666	683
PSM	TTQVPQFILDDFIQNDR	758	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	17-UNIMOD:267	ms_run[2]:scan=13657	80.475	2	2059.025	2059.0250	K	A	418	435
PSM	VAMPVELNEPLNTLQR	759	sp|Q9H4L5-8|OSBL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	16-UNIMOD:267	ms_run[2]:scan=10570	60.588	2	1832.9694	1832.9694	K	L	476	492
PSM	VGPQYQAVVPDFDPAK	760	sp|Q9UKL0|RCOR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=9373	53.261	2	1729.8675	1729.8675	R	L	107	123
PSM	VLATAFDTTLGGR	761	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=8494	48.245	2	1320.7038	1320.7038	K	K	222	235
PSM	VLDMPTQELGLPAYR	762	sp|Q9NP81|SYSM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:267	ms_run[2]:scan=10964	63.021	2	1711.8843	1711.8843	R	K	388	403
PSM	VLQLTSWDEDAWASK	763	sp|P18206|VINC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=11343	65.423	2	1747.8417	1747.8417	R	D	247	262
PSM	VMTIPYQPMPASSPVICAGGQDR	764	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	17-UNIMOD:4	ms_run[2]:scan=9773	55.509	2	2474.1756	2474.1756	R	C	178	201
PSM	VNQIGSVTESLQACK	765	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	14-UNIMOD:4	ms_run[2]:scan=6813	38.882	2	1632.8141	1632.8141	K	L	344	359
PSM	VNQSALEAVTPSPSFQQR	766	sp|Q9UKG1|DP13A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=7692	43.838	2	1957.9858	1957.9858	R	H	390	408
PSM	VPADTEVVCAPPTAYIDFAR	767	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	9-UNIMOD:4,20-UNIMOD:267	ms_run[2]:scan=11094	63.829	2	2201.0702	2201.0702	K	Q	71	91
PSM	VQIAVANAQELLQR	768	sp|Q9Y5L4|TIM13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=9571	54.398	2	1551.8733	1551.8733	K	M	28	42
PSM	VSIDPESNIISIWNNGK	769	sp|Q02880-2|TOP2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=12650	73.878	2	1884.9581	1884.9581	K	G	123	140
PSM	VSLAGACGVGGYGSR	770	sp|P13647|K2C5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	7-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=5514	32.12	2	1419.6804	1419.6804	R	S	49	64
PSM	VTLDPVQLESSLLR	771	sp|Q9UPN3-4|MACF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	14-UNIMOD:267	ms_run[2]:scan=12748	74.512	2	1578.8856	1578.8856	R	S	2848	2862
PSM	VVLASQPDLECGFSR	772	sp|Q9P2I0|CPSF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	11-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=8218	46.744	2	1686.8275	1686.8275	K	D	325	340
PSM	YEDAYQYQNIFGPLVK	773	sp|Q92900-2|RENT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=12396	72.227	2	1946.9414	1946.9414	R	L	296	312
PSM	YFVISNTTGYNDR	774	sp|P49354-2|FNTA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:267	ms_run[2]:scan=7193	40.884	2	1558.7291	1558.7291	R	A	174	187
PSM	YLILGSAVGGGYTAK	775	sp|O60313-13|OPA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=9117	51.803	2	1468.7926	1468.7926	R	K	102	117
PSM	YNVLGAETVLNQMR	776	sp|Q1KMD3|HNRL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	14-UNIMOD:267	ms_run[2]:scan=11030	63.434	2	1616.822	1616.8220	R	M	481	495
PSM	YVASYLLAALGGNSSPSAK	777	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=12552	73.239	2	1867.968	1867.9680	R	D	3	22
PSM	SYELPDGQVITIGNER	778	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	16-UNIMOD:267	ms_run[1]:scan=10594	60.74316999999999	2	1800.884531	1799.892912	K	F	241	257
PSM	CDRNLAMGVNLTSMSK	779	sp|P12004|PCNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=9554	54.30518166666666	2	1778.8076	1778.8108	R	I	62	78
PSM	CDRNLAMGVNLTSMSK	780	sp|P12004|PCNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:385,1-UNIMOD:4,3-UNIMOD:267,16-UNIMOD:188	ms_run[1]:scan=9548	54.268125	2	1794.8414	1794.8392	R	I	62	78
PSM	AFLASPEYVNLPINGNGK	781	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=10928	62.80025	2	1903.973172	1902.983963	K	Q	192	210
PSM	VGINYQPPTVVPGGDLAK	782	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	18-UNIMOD:188	ms_run[1]:scan=9120	51.82417	2	1830.987143	1829.998278	K	V	353	371
PSM	GAGTDEGCLIEILASR	783	sp|P09525|ANXA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	8-UNIMOD:4,16-UNIMOD:267	ms_run[1]:scan=12060	70.01789833333333	2	1670.821124	1670.817304	K	T	101	117
PSM	QFQDAGHFDAENIK	784	sp|Q13813|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:28	ms_run[1]:scan=8300	47.168929999999996	2	1601.7122	1601.7105	R	K	743	757
PSM	QNAQCLHGDIAQSQR	785	sp|Q9BQ39|DDX50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:28,5-UNIMOD:4	ms_run[1]:scan=3907	23.745345	2	1707.7740	1707.7742	K	E	413	428
PSM	SLEEGEGPIAVIMTPTR	786	sp|Q7L014|DDX46_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=11149	64.17734	2	1798.908761	1798.913500	R	E	439	456
PSM	QSYKGSPMEISLPIALSK	787	sp|P09960|LKHA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:28	ms_run[1]:scan=12129	70.49042666666668	2	1931.0202	1931.0072	R	N	80	98
PSM	QAHLCVLASNCDEPMYVK	788	sp|P25398|RS12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:28,5-UNIMOD:4,11-UNIMOD:4,15-UNIMOD:35,18-UNIMOD:188	ms_run[1]:scan=8132	46.23007	2	2138.9617	2138.9525	R	L	46	64
PSM	AVDLCAAPGSWSQVLSQK	789	sp|Q9UET6|TRM7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	5-UNIMOD:4	ms_run[1]:scan=10948	62.922668333333334	2	1916.951600	1915.946198	R	I	45	63
PSM	QCSDLLSQAQYHVAR	790	sp|Q6PD62|CTR9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:28,2-UNIMOD:4,15-UNIMOD:267	ms_run[1]:scan=8152	46.350971666666666	2	1767.8306	1767.8233	R	A	816	831
PSM	QIFDEYENETFLCHR	791	sp|Q9Y3A3|PHOCN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:28,13-UNIMOD:4	ms_run[1]:scan=11735	67.85958666666667	2	1982.8552	1982.8464	R	F	176	191
PSM	GVYPDLLATSGDYLR	792	sp|P61962|DCAF7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=11492	66.34905	2	1639.808421	1638.825337	K	V	82	97
PSM	QLASEDISHITPTQGFNIK	793	sp|P36405|ARL3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:28	ms_run[1]:scan=10667	61.20381333333333	2	2081.0468	2081.0424	K	S	36	55
PSM	CFSVSMLAGPNDRSDVEK	794	sp|Q92890|UFD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=11217	64.61946833333333	2	1995.8742	1993.8872	R	G	25	43
PSM	ACANPAAGSVILLENLR	795	sp|P00558|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=11770	68.071	2	1777.9384	1777.9384	K	F	107	124
PSM	ADLDKLNIDSIIQR	796	sp|P36873|PP1G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:1	ms_run[2]:scan=12319	71.732	2	1654.889	1654.8890	M	L	2	16
PSM	ADLPEGVAVSGPSPAEFCR	797	sp|Q8IXI1|MIRO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	18-UNIMOD:4	ms_run[2]:scan=8845	50.149	2	1957.9204	1957.9204	K	K	526	545
PSM	AEAGVPAEFSIWTR	798	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=11247	64.814	2	1532.7623	1532.7623	R	E	2243	2257
PSM	AERPEDLNLPNAVITR	799	sp|Q9NRF9|DPOE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:1,3-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=9236	52.474	2	1868.9859	1868.9859	M	I	2	18
PSM	AFLASPEYVNLPINGNGKQ	800	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=10660	61.159	3	2031.0425	2031.0425	K	-	192	211
PSM	AIFTTGQGASAVGLTAYVQR	801	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=10459	59.876	2	2010.0534	2010.0534	R	H	543	563
PSM	ALTVPELTQQMFDAK	802	sp|P68371|TBB4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	11-UNIMOD:35,15-UNIMOD:188	ms_run[2]:scan=9331	53.018	2	1712.8751	1712.8751	R	N	283	298
PSM	ATENDIYNFFSPLNPVR	803	sp|P52597|HNRPF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	17-UNIMOD:267	ms_run[2]:scan=13653	80.45	2	2005.9773	2005.9773	K	V	300	317
PSM	AVCMLSNTTAIAEAWAR	804	sp|P68366-2|TBA4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=12243	71.246	2	1873.9054	1873.9054	R	L	359	376
PSM	AVLVDLEPGTMDSVR	805	sp|P68371|TBB4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	15-UNIMOD:267	ms_run[2]:scan=9659	54.878	2	1610.8213	1610.8213	R	S	63	78
PSM	CAGPTPEAELQALAR	806	sp|Q15050|RRS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=9754	55.402	2	1592.7856	1592.7856	R	D	52	67
PSM	CASQVGMTAPGTR	807	sp|Q99439|CNN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=2431	16.311	2	1344.6154	1344.6154	K	R	215	228
PSM	DLYANTVLSGGTTMYPGIADR	808	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	21-UNIMOD:267	ms_run[2]:scan=11068	63.672	2	2224.071	2224.0710	K	M	292	313
PSM	EACWTISNITAGNR	809	sp|O60684|IMA7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=8694	49.333	2	1601.7496	1601.7496	K	A	355	369
PSM	EIVLADVIDNDSWR	810	sp|P22234|PUR6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:267	ms_run[2]:scan=12542	73.175	2	1653.8238	1653.8238	K	L	202	216
PSM	ELAQQVQQVAAEYCR	811	sp|P17844-2|DDX5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:4	ms_run[2]:scan=9288	52.779	2	1791.8574	1791.8574	R	A	99	114
PSM	ELSEALGQIFDSQR	812	sp|Q08380|LG3BP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=11473	66.232	2	1591.7842	1591.7842	R	G	138	152
PSM	FCADSDGFSQELR	813	sp|P52732|KIF11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=7256	41.262	2	1540.6492	1540.6492	K	N	772	785
PSM	FDQLFDDESDPFEVLK	814	sp|Q8NC51-4|PAIRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=13345	78.433	2	1942.8836	1942.8836	R	A	17	33
PSM	FFTDDLFQYAGEK	815	sp|Q6NYC1-2|JMJD6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:188	ms_run[2]:scan=12249	71.285	2	1585.7396	1585.7396	K	R	155	168
PSM	FNYGFEYLGVQDK	816	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:188	ms_run[2]:scan=10618	60.891	2	1584.7556	1584.7556	K	L	1866	1879
PSM	FTQAGSEVSALLGR	817	sp|P06576|ATPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9617	54.661	2	1434.7467	1434.7467	R	I	311	325
PSM	FVDEGSLYGLSIATSR	818	sp|Q9Y5J1|UTP18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	16-UNIMOD:267	ms_run[2]:scan=10591	60.721	2	1723.8656	1723.8656	R	N	420	436
PSM	FVDEGSLYGLSIATSR	819	sp|Q9Y5J1|UTP18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=10608	60.83	2	1713.8574	1713.8574	R	N	420	436
PSM	GADFLVTEVENGGSLGSK	820	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=10576	60.628	2	1778.8687	1778.8687	K	K	189	207
PSM	GEGPEAGAGGAGGR	821	sp|A0FGR8-2|ESYT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:267	ms_run[2]:scan=728	7.7294	2	1151.5195	1151.5195	R	A	54	68
PSM	GFGFVDFNSEEDAK	822	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:188	ms_run[2]:scan=9885	56.088	2	1566.6934	1566.6934	K	A	611	625
PSM	GLAITFVSDENDAK	823	sp|Q13838|DX39B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:188	ms_run[2]:scan=8651	49.104	2	1484.7454	1484.7454	K	I	385	399
PSM	GLEVTAYSPLGSSDR	824	sp|P14550|AK1A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=8336	47.361	2	1550.7577	1550.7577	R	A	204	219
PSM	GPVEGYEENEEFLR	825	sp|Q9UI30-2|TR112_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7801	44.419	2	1666.7475	1666.7475	K	T	64	78
PSM	GSAFAIGSDGLCCQSR	826	sp|Q92499|DDX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	12-UNIMOD:4,13-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=7289	41.482	2	1694.738	1694.7380	R	E	99	115
PSM	IANLQTDLSDGLR	827	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:267	ms_run[2]:scan=8663	49.177	2	1424.7499	1424.7499	R	L	64	77
PSM	IAQFLSDIPETVPLSTVNR	828	sp|P09110-2|THIK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	19-UNIMOD:267	ms_run[2]:scan=12327	71.782	2	2109.1345	2109.1345	R	Q	103	122
PSM	ICDQWDNLGALTQK	829	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=9642	54.79	2	1666.808	1666.8080	K	R	479	493
PSM	IGIFGQDEDVTSK	830	sp|P16615-5|AT2A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7910	44.998	2	1407.6882	1407.6882	R	A	638	651
PSM	IGQQPQQPGAPPQQDYTK	831	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	18-UNIMOD:188	ms_run[2]:scan=3273	20.562	2	1985.9902	1985.9902	K	A	629	647
PSM	ILCDVPCSGDGTMR	832	sp|Q08J23-3|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=5451	31.797	2	1579.6793	1579.6793	R	K	29	43
PSM	ILCDVPCSGDGTMR	833	sp|Q08J23-3|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:4,7-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=5452	31.802	2	1589.6876	1589.6876	R	K	29	43
PSM	ILTTNTWSSELSK	834	sp|O60701-3|UGDH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:188	ms_run[2]:scan=8236	46.836	2	1484.7818	1484.7818	K	L	111	124
PSM	IMLNTPEDVQALVSGK	835	sp|O00231|PSD11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	16-UNIMOD:188	ms_run[2]:scan=11261	64.901	2	1719.9173	1719.9173	K	L	259	275
PSM	IPTCFTLYQDEITER	836	sp|Q9H1Y0|ATG5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:4	ms_run[2]:scan=10588	60.703	2	1884.8928	1884.8928	R	E	16	31
PSM	IVEANPLLEAFGNAK	837	sp|Q9UM54-5|MYO6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=11988	69.536	2	1584.8512	1584.8512	R	T	182	197
PSM	KEESEESDDDMGFGLFD	838	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=11583	66.907	2	1948.752	1948.7520	K	-	99	116
PSM	LAGTQPLEVLEAVQR	839	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	15-UNIMOD:267	ms_run[2]:scan=11292	65.105	2	1632.9074	1632.9074	R	S	639	654
PSM	LATPELLETAQALER	840	sp|Q8N6R0-2|EFNMT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	15-UNIMOD:267	ms_run[2]:scan=11564	66.791	2	1663.902	1663.9020	K	T	357	372
PSM	LATQSNEITIPVTFESR	841	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	17-UNIMOD:267	ms_run[2]:scan=9823	55.77	2	1914.9926	1914.9926	K	A	172	189
PSM	LDLQQGQNLLQGLSK	842	sp|Q9HCE1|MOV10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=11140	64.122	2	1653.905	1653.9050	K	L	953	968
PSM	LDVGNFSWGSECCTR	843	sp|P62241|RS8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	12-UNIMOD:4,13-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=9654	54.848	2	1796.7486	1796.7486	R	K	60	75
PSM	LFVGNLPTDITEEDFK	844	sp|Q8WXF1-2|PSPC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=11871	68.733	2	1836.9145	1836.9145	R	R	84	100
PSM	LGADAVGMSTVPEVIVAR	845	sp|P00491|PNPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	8-UNIMOD:35	ms_run[2]:scan=8576	48.695	2	1799.9451	1799.9451	K	H	212	230
PSM	LGGAVLSFSEATSSVQK	846	sp|P27708|PYR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	17-UNIMOD:188	ms_run[2]:scan=9038	51.317	2	1685.8931	1685.8931	R	G	1987	2004
PSM	LGGEVSCLVAGTK	847	sp|P13804|ETFA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	7-UNIMOD:4	ms_run[2]:scan=6644	37.995	2	1289.6649	1289.6649	R	C	47	60
PSM	LGQMVLSGVDTVLGK	848	sp|O60664-4|PLIN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=11465	66.182	2	1515.8331	1515.8331	R	S	169	184
PSM	LGTDESCFNMILATR	849	sp|P20073-2|ANXA7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	7-UNIMOD:4	ms_run[2]:scan=10822	62.151	2	1726.8018	1726.8018	R	S	335	350
PSM	LLLINNAGSLGDVSK	850	sp|P35270|SPRE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9632	54.741	2	1512.8512	1512.8512	R	G	95	110
PSM	LLLINNAGSLGDVSK	851	sp|P35270|SPRE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	15-UNIMOD:188	ms_run[2]:scan=9633	54.745	2	1518.8713	1518.8713	R	G	95	110
PSM	LLSDFLDSEVSELR	852	sp|Q9BPX3|CND3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:267	ms_run[2]:scan=13052	76.534	2	1631.8282	1631.8282	K	T	695	709
PSM	LLSELDQQSTEMPR	853	sp|O95793-2|STAU1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7397	42.128	2	1645.7981	1645.7981	K	T	471	485
PSM	LNFSTPTSTNIVSVCR	854	sp|O15067|PUR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	15-UNIMOD:4	ms_run[2]:scan=8730	49.512	2	1794.8934	1794.8934	R	A	94	110
PSM	LNQNLNDVLVGLEK	855	sp|O00499-9|BIN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=10910	62.688	2	1567.857	1567.8570	K	Q	228	242
PSM	LNQNLNDVLVGLEK	856	sp|O00499-9|BIN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:188	ms_run[2]:scan=10919	62.744	2	1573.8771	1573.8771	K	Q	228	242
PSM	LPSGSGAASPTGSAVDIR	857	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=5229	30.719	2	1641.8322	1641.8322	R	A	208	226
PSM	LQPFATEADVEEALR	858	sp|P33992|MCM5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=11070	63.684	2	1687.8417	1687.8417	K	L	628	643
PSM	LSAAEDPLVQSLR	859	sp|P48449-2|ERG7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:267	ms_run[2]:scan=8622	48.947	2	1407.7597	1407.7597	R	Q	168	181
PSM	LSDFNDITNMLLLK	860	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:188	ms_run[2]:scan=14165	84.606	2	1641.8743	1641.8743	K	M	3656	3670
PSM	LSGSNPYTTVTPQIINSK	861	sp|O43707|ACTN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	18-UNIMOD:188	ms_run[2]:scan=8085	45.954	2	1925.0201	1925.0201	K	W	605	623
PSM	LSVACFYGGTPYGGQFER	862	sp|Q9NR30-2|DDX21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:4,18-UNIMOD:267	ms_run[2]:scan=10581	60.657	2	2017.9232	2017.9232	K	M	219	237
PSM	LTFDTTFSPNTGK	863	sp|P45880|VDAC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=8235	46.831	2	1427.6933	1427.6933	K	K	108	121
PSM	LVVECVMNNVTCTR	864	sp|Q01469|FABP5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=8796	49.86	2	1693.795	1693.7950	K	I	116	130
PSM	MIAGQVLDINLAAEPK	865	sp|P07910-4|HNRPC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:35	ms_run[2]:scan=9804	55.675	2	1697.9022	1697.9022	R	V	74	90
PSM	MQNNSSPSISPNTSFTSDGSPSPLGGIK	866	sp|Q9H0D6-2|XRN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:35	ms_run[2]:scan=9070	51.518	2	2822.3029	2822.3029	R	R	390	418
PSM	MSSFGDFVALSDVCDVPTAK	867	sp|P31939-2|PUR9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:35,14-UNIMOD:4	ms_run[2]:scan=11786	68.168	2	2160.9708	2160.9708	R	I	311	331
PSM	MVDDGSGEVQVWR	868	sp|P09327|VILI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=6953	39.631	2	1476.6667	1476.6667	K	I	392	405
PSM	NFILDQTNVSAAAQR	869	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	15-UNIMOD:267	ms_run[2]:scan=8051	45.758	2	1656.8459	1656.8459	R	R	557	572
PSM	NILLTNEQLESAR	870	sp|Q9H9B4|SFXN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:267	ms_run[2]:scan=7700	43.887	2	1509.8026	1509.8026	R	K	36	49
PSM	NISFTVWDVGGQDK	871	sp|P61204|ARF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:188	ms_run[2]:scan=11023	63.39	2	1570.7723	1570.7723	K	I	60	74
PSM	NISFTVWDVGGQDK	872	sp|P61204|ARF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=11024	63.396	2	1564.7522	1564.7522	K	I	60	74
PSM	NIYVLQELDNPGAK	873	sp|P12956|XRCC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9954	56.49	2	1572.8148	1572.8148	K	R	101	115
PSM	NLGSINTELQDVQR	874	sp|O75396|SC22B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7962	45.26	2	1585.806	1585.8060	R	I	134	148
PSM	NLGSINTELQDVQR	875	sp|O75396|SC22B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:267	ms_run[2]:scan=7972	45.315	2	1595.8143	1595.8143	R	I	134	148
PSM	NLIAFSEDGSDPYVR	876	sp|A0FGR8-2|ESYT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	15-UNIMOD:267	ms_run[2]:scan=9553	54.299	2	1691.803	1691.8030	R	M	784	799
PSM	NLNEDDTFLVFSK	877	sp|Q9BYT8|NEUL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=10985	63.15	2	1540.7409	1540.7409	K	A	205	218
PSM	NNVSLLQSCIDLFK	878	sp|Q9Y5X3|SNX5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	9-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=12795	74.817	2	1655.8648	1655.8648	R	N	389	403
PSM	NQGFDVVLVDTAGR	879	sp|P08240-2|SRPRA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9472	53.827	2	1489.7525	1489.7525	R	M	483	497
PSM	NQVAMNPTNTVFDAK	880	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7065	40.208	2	1648.7879	1648.7879	K	R	57	72
PSM	NQYDNDVTVWSPQGR	881	sp|P25786|PSA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7449	42.419	2	1777.802	1777.8020	R	I	4	19
PSM	NYLLPAGYSLEEQR	882	sp|Q12888|TP53B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9528	54.148	2	1651.8206	1651.8206	R	I	1845	1859
PSM	QAASGLVGQENAR	883	sp|Q9Y265|RUVB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:267	ms_run[2]:scan=2064	14.489	2	1309.6614	1309.6614	K	E	34	47
PSM	QAVLGAGLPISTPCTTINK	884	sp|P24752|THIL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:4,19-UNIMOD:188	ms_run[2]:scan=9500	53.994	2	1946.0602	1946.0602	R	V	106	125
PSM	QLCDNAGFDATNILNK	885	sp|Q99832-3|TCPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=9158	52.044	2	1798.8615	1798.8615	R	L	404	420
PSM	QVAAVGQEPQVFGR	886	sp|Q03518|TAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:267	ms_run[2]:scan=6410	36.749	2	1494.7818	1494.7818	R	S	640	654
PSM	SFSTASAITPSVSR	887	sp|P13647|K2C5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:267	ms_run[2]:scan=5888	33.99	2	1419.7233	1419.7233	R	T	16	30
PSM	SLDLFNCEVTNLNDYR	888	sp|P39687|AN32A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	7-UNIMOD:4	ms_run[2]:scan=11876	68.766	2	1971.8996	1971.8996	K	E	117	133
PSM	SQETECTYFSTPLLLGK	889	sp|P40926|MDHM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=11528	66.571	2	1978.9653	1978.9653	K	K	280	297
PSM	SQLDLFDDVGTFASGPPK	890	sp|Q8N6H7-3|ARFG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	18-UNIMOD:188	ms_run[2]:scan=12551	73.233	2	1898.9357	1898.9357	R	Y	71	89
PSM	SSQSSSQQFSGIGR	891	sp|Q92841-1|DDX17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:267	ms_run[2]:scan=3332	20.885	2	1464.6833	1464.6833	R	S	592	606
PSM	SSVAVLTQESFAEHR	892	sp|Q00341|VIGLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:1	ms_run[2]:scan=9581	54.457	2	1701.8322	1701.8322	M	S	2	17
PSM	SVYQLLSENPPDGER	893	sp|Q96FV9|THOC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	15-UNIMOD:267	ms_run[2]:scan=8712	49.425	2	1712.8245	1712.8245	K	F	359	374
PSM	SWCPDCVQAEPVVR	894	sp|Q9BRA2|TXD17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:4,6-UNIMOD:4	ms_run[2]:scan=7197	40.911	2	1701.7603	1701.7603	K	E	41	55
PSM	SWCPDCVQAEPVVR	895	sp|Q9BRA2|TXD17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:4,6-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=7208	40.973	2	1711.7686	1711.7686	K	E	41	55
PSM	SYELPDGQVITIGNER	896	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=10005	56.809	2	1789.8846	1789.8846	K	F	239	255
PSM	TAGQPEGGPGADFGQSCFPAEAGR	897	sp|Q14694|UBP10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	17-UNIMOD:4,24-UNIMOD:267	ms_run[2]:scan=7514	42.804	2	2373.0319	2373.0319	R	D	238	262
PSM	TDIQIALPSGCYGR	898	sp|P33316-2|DUT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	11-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=8672	49.225	2	1559.7641	1559.7641	K	V	68	82
PSM	TDIQIALPSGCYGR	899	sp|P33316-2|DUT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	11-UNIMOD:4	ms_run[2]:scan=8673	49.229	2	1549.7559	1549.7559	K	V	68	82
PSM	TGEAIVDAALSALR	900	sp|Q15084-3|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:267	ms_run[2]:scan=13186	77.409	2	1395.7597	1395.7597	R	Q	116	130
PSM	TIGGGDDSFNTFFSETGAGK	901	sp|Q9BQE3|TBA1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=11198	64.498	2	2006.8858	2006.8858	K	H	41	61
PSM	TLASAGGPDNLVLLNPEK	902	sp|P35611-2|ADDA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9691	55.048	2	1807.968	1807.9680	R	Y	331	349
PSM	TLGVSFVQAESECR	903	sp|O60826|CCD22_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=8254	46.928	2	1591.754	1591.7540	K	H	357	371
PSM	TLNQLGTPQDSPELR	904	sp|O15400-2|STX7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	15-UNIMOD:267	ms_run[2]:scan=6343	36.378	2	1677.8561	1677.8561	R	Q	35	50
PSM	TMLESAGGLIQTAR	905	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:267	ms_run[2]:scan=8699	49.363	2	1456.7583	1456.7583	K	A	1605	1619
PSM	TMLESAGGLIQTAR	906	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=8700	49.367	2	1446.7501	1446.7501	K	A	1605	1619
PSM	TPLSEAEFEEIMNR	907	sp|Q16630-3|CPSF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=11006	63.285	2	1664.7716	1664.7716	R	N	334	348
PSM	TPLSEAEFEEIMNR	908	sp|Q16630-3|CPSF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:267	ms_run[2]:scan=11007	63.29	2	1674.7799	1674.7799	R	N	334	348
PSM	TPTEALASFDYIVR	909	sp|Q9H7Z7|PGES2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:267	ms_run[2]:scan=11641	67.275	2	1591.8121	1591.8121	R	E	253	267
PSM	TQEQLALEMAELTAR	910	sp|P26038|MOES_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	15-UNIMOD:267	ms_run[2]:scan=11352	65.481	2	1712.8643	1712.8643	K	I	413	428
PSM	TQETPSAQMEGFLNR	911	sp|Q01082|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=8808	49.929	2	1707.7886	1707.7886	R	K	2192	2207
PSM	TTQIPQFILDDSLNGPPEK	912	sp|Q6P158-2|DHX57_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	19-UNIMOD:188	ms_run[2]:scan=11598	67.003	2	2118.094	2118.0940	K	V	574	593
PSM	TVAEVQETLAEMIR	913	sp|Q8TEQ6|GEMI5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:267	ms_run[2]:scan=12868	75.269	2	1598.8213	1598.8213	R	Q	1373	1387
PSM	TVAEVQETLAEMIR	914	sp|Q8TEQ6|GEMI5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=12871	75.286	2	1588.8131	1588.8131	R	Q	1373	1387
PSM	TVQGPPTSDDIFER	915	sp|P04181|OAT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7241	41.167	2	1560.742	1560.7420	K	E	33	47
PSM	VDFPQDQLTALTGR	916	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=10332	59.058	2	1559.7944	1559.7944	K	I	216	230
PSM	VDFPQDQLTALTGR	917	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=10488	60.065	2	1559.7944	1559.7944	K	I	216	230
PSM	VDFPQDQLTALTGR	918	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:267	ms_run[2]:scan=10702	61.423	2	1569.8026	1569.8026	K	I	216	230
PSM	VFLDPNILSDDGTVALR	919	sp|P48147|PPCE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	17-UNIMOD:267	ms_run[2]:scan=12390	72.192	2	1853.9762	1853.9762	R	G	112	129
PSM	VGINYQPPTVVPGGDLAK	920	sp|P68366-2|TBA4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=8597	48.809	2	1823.9781	1823.9781	K	V	338	356
PSM	VGINYQPPTVVPGGDLAK	921	sp|P68366-2|TBA4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	18-UNIMOD:188	ms_run[2]:scan=8966	50.855	2	1829.9983	1829.9983	K	V	338	356
PSM	VGVEVPDVNIEGPEGK	922	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	16-UNIMOD:188	ms_run[2]:scan=8634	49.008	2	1642.8509	1642.8509	K	L	913	929
PSM	VIDPATATSVDLR	923	sp|P50991-2|TCPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7013	39.939	2	1356.7249	1356.7249	K	D	164	177
PSM	VIGGDDLSTLTGK	924	sp|P00492|HPRT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:188	ms_run[2]:scan=7601	43.321	2	1280.6919	1280.6919	K	N	116	129
PSM	VLATTFDPYLGGR	925	sp|O95757|HS74L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9620	54.674	2	1408.7351	1408.7351	K	N	222	235
PSM	VLLESEQFLTELTR	926	sp|P37108|SRP14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:267	ms_run[2]:scan=13141	77.118	2	1686.9068	1686.9068	M	L	2	16
PSM	VQGIAGQPFVVLNSGEK	927	sp|Q9P2M7-2|CING_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9464	53.777	2	1741.9363	1741.9363	R	G	51	68
PSM	VQIAVANAQELLQR	928	sp|Q9Y5L4|TIM13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:267	ms_run[2]:scan=9569	54.388	2	1561.8816	1561.8816	K	M	28	42
PSM	VSASPLLYTLIEK	929	sp|P02786|TFR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=12222	71.113	2	1432.8177	1432.8177	K	T	496	509
PSM	VTNGAFTGEISPGMIK	930	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:35,16-UNIMOD:188	ms_run[2]:scan=7176	40.778	2	1642.8332	1642.8332	K	D	107	123
PSM	TVGALQVLGTEAQSSLLK	931	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	18-UNIMOD:188	ms_run[1]:scan=12213	71.05504166666667	2	1820.040267	1820.035058	R	A	1275	1293
PSM	QATKDAGTIAGLNVLR	932	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:28	ms_run[1]:scan=9363	53.201930000000004	2	1609.8811	1609.8782	R	I	156	172
PSM	VAAPDVVVPTLDTVR	933	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	15-UNIMOD:267	ms_run[1]:scan=9636	54.758285	2	1561.882603	1560.875077	K	H	2562	2577
PSM	SYELPDGQVITIGNER	934	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=10544	60.419018333333334	2	1790.873539	1789.884643	K	F	241	257
PSM	QVVQGLLSETYLEAHR	935	sp|P33993|MCM7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:28	ms_run[1]:scan=12456	72.61235333333333	2	1824.9357	1824.9365	R	I	287	303
PSM	QLYHLGVVEAYSGLTK	936	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:28	ms_run[1]:scan=11790	68.19112666666668	2	1759.9302	1759.9142	R	K	249	265
PSM	QLLTLSSELSQARDENK	937	sp|P15311|EZRI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:28	ms_run[1]:scan=11377	65.63710833333333	2	1913.9756	1913.9689	R	R	530	547
PSM	SLGGNDELSATFLEMK	938	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=11423	65.923435	2	1711.825614	1710.813452	K	G	271	287
PSM	ADVIQATGDAICIFR	939	sp|Q08945|SSRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	12-UNIMOD:4	ms_run[1]:scan=11789	68.18535166666668	2	1649.821577	1648.824292	K	E	189	204
PSM	QFVVFEGNHYFYSPYPTK	940	sp|P04843|RPN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:28,18-UNIMOD:188	ms_run[1]:scan=12807	74.89296	2	2211.0416	2211.0403	K	T	152	170
PSM	TVDSQGPTPVCTPTFLER	941	sp|Q9BYG3|MK67I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	11-UNIMOD:4	ms_run[1]:scan=8668	49.199236666666664	2	2004.965408	2003.962242	K	R	227	245
PSM	IVDNLGASGNSLYQR	942	sp|Q6PGP7|TTC37_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	15-UNIMOD:267	ms_run[1]:scan=6375	36.55437333333333	2	1616.816472	1615.819353	K	N	335	350
PSM	QKEMDNFLAQMEAK	943	sp|Q8WXX5|DNJC9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:28,2-UNIMOD:188,14-UNIMOD:188	ms_run[1]:scan=11538	66.63112833333334	2	1676.8004	1676.7936	R	Y	228	242
PSM	FGIDDQDYQNSVTR	944	sp|P78356|PI42B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=6763	38.60431	2	1657.741176	1656.737979	R	S	110	124
PSM	QLQALSSELAQARDETK	945	sp|P35241|RADI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:28	ms_run[1]:scan=11605	67.04847	2	1869.9492	1869.9427	K	K	527	544
PSM	LATVLSGACDGEVR	946	sp|Q9NV06|DCA13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	9-UNIMOD:4	ms_run[1]:scan=6053	34.84984333333333	2	1446.704150	1446.713678	K	I	79	93
PSM	NALGPGLSPELGPLPALR	947	sp|Q8N1G4|LRC47_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0		ms_run[1]:scan=12683	74.08760833333334	2	1771.9832	1770.9982	R	V	85	103
PSM	QREELGQGLQGVEQK	948	sp|Q07065|CKAP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:28	ms_run[1]:scan=6251	35.85335	2	1680.8424	1680.8426	R	V	147	162
PSM	ILLQGTPVAQMTEDAVDAER	949	sp|P01024|CO3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=12724	74.35495833333334	2	2156.078825	2156.078334	R	L	980	1000
PSM	AAVEEGIVLGGGCALLR	950	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	13-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=10738	61.647	2	1693.9061	1693.9061	R	C	430	447
PSM	AAVPELLQQQEEDRSK	951	sp|Q9Y5X3|SNX5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:1	ms_run[2]:scan=9311	52.91	2	1881.9432	1881.9432	M	L	2	18
PSM	ACANPAAGSVILLENLR	952	sp|P00558|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=12073	70.101	2	1777.9384	1777.9384	K	F	107	124
PSM	ADPDVLTEVPAALKR	953	sp|P29083|T2EA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:1	ms_run[2]:scan=10794	61.979	2	1635.8832	1635.8832	M	L	2	17
PSM	AEAGVPAEFSIWTR	954	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:267	ms_run[2]:scan=11231	64.712	2	1542.7706	1542.7706	R	E	2243	2257
PSM	AERPEDLNLPNAVITR	955	sp|Q9NRF9|DPOE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:1	ms_run[2]:scan=9222	52.39	2	1848.9694	1848.9694	M	I	2	18
PSM	AGAGSATLSMAYAGAR	956	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6159	35.385	2	1453.6984	1453.6984	K	F	242	258
PSM	AGGADAVQTVTGGLR	957	sp|Q9H223|EHD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6601	37.778	2	1371.7106	1371.7106	R	S	15	30
PSM	AGGIETIANEFSDR	958	sp|Q92598-2|HS105_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:267	ms_run[2]:scan=9722	55.229	2	1488.7084	1488.7084	R	C	20	34
PSM	AGGLDWPEATEVSPSR	959	sp|Q9Y446|PKP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	16-UNIMOD:267	ms_run[2]:scan=8541	48.504	2	1680.7983	1680.7983	R	T	226	242
PSM	AILVDLEPGTMDSVR	960	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10022	56.907	2	1614.8287	1614.8287	R	S	63	78
PSM	ALQPDWFQCLSDGEVSCK	961	sp|Q9H974-2|QTRT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	9-UNIMOD:4,17-UNIMOD:4	ms_run[2]:scan=11893	68.885	2	2138.9401	2138.9401	K	E	12	30
PSM	ALSNLESIPGGYNALR	962	sp|Q9UMX0-3|UBQL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	16-UNIMOD:267	ms_run[2]:scan=9482	53.89	2	1683.882	1683.8820	R	R	81	97
PSM	ALTVPELTQQMFDSK	963	sp|Q9BVA1|TBB2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	11-UNIMOD:35,15-UNIMOD:188	ms_run[2]:scan=9204	52.296	2	1728.87	1728.8700	R	N	283	298
PSM	ALTVPELTQQMFDSK	964	sp|Q9BVA1|TBB2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:188	ms_run[2]:scan=11999	69.615	2	1712.8751	1712.8751	R	N	283	298
PSM	ALTVPELTQQMFDSK	965	sp|Q9BVA1|TBB2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:188	ms_run[2]:scan=12150	70.631	2	1712.8751	1712.8751	R	N	283	298
PSM	ALYDTFSAFGNILSCK	966	sp|Q13310-3|PABP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=13772	81.282	2	1811.886	1811.8860	K	V	114	130
PSM	ANLPQSFQVDTSK	967	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6372	36.538	2	1433.7151	1433.7151	R	A	1465	1478
PSM	AQQEFAAGVFSNPAVR	968	sp|O14828-2|SCAM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=8834	50.086	2	1690.8427	1690.8427	K	T	288	304
PSM	AQSLTTGQEGFIPFNFVAK	969	sp|P06239-2|LCK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=12741	74.465	2	2054.0473	2054.0473	K	A	100	119
PSM	ASASYHISNLLEK	970	sp|Q86VP6|CAND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:1,13-UNIMOD:188	ms_run[2]:scan=9165	52.084	2	1479.7665	1479.7665	M	M	2	15
PSM	ASNPERGEILLTELQGDSR	971	sp|Q16513-3|PKN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:1	ms_run[2]:scan=10753	61.736	2	2126.0604	2126.0604	M	S	2	21
PSM	AVDLCAAPGSWSQVLSQK	972	sp|Q9UET6-2|TRM7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	5-UNIMOD:4,18-UNIMOD:188	ms_run[2]:scan=10947	62.916	2	1921.9663	1921.9663	R	I	45	63
PSM	AVLPEGQDVTSGFSR	973	sp|Q32P41|TRM5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7435	42.333	2	1561.7736	1561.7736	R	I	188	203
PSM	AVYSTNCPVWEEAFR	974	sp|Q9BSJ8|ESYT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=11039	63.493	2	1837.8333	1837.8333	K	F	516	531
PSM	DYGVLLEGSGLALR	975	sp|P30048-2|PRDX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:267	ms_run[2]:scan=11590	66.953	2	1471.791	1471.7910	R	G	153	167
PSM	ECICEVEGQVPCPSLVPLPK	976	sp|P82663|RT25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:4,4-UNIMOD:4,12-UNIMOD:4,20-UNIMOD:188	ms_run[2]:scan=10615	60.874	2	2316.1259	2316.1259	R	E	138	158
PSM	ELLVPLTSSMYVPGK	977	sp|Q99471|PFD5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=11464	66.176	2	1632.8797	1632.8797	K	L	61	76
PSM	ELSLAGNELGDEGAR	978	sp|P13489|RINI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7063	40.198	2	1529.7322	1529.7322	K	L	288	303
PSM	FCNDLCVDPTEFR	979	sp|Q8IWE4|DCNL3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:4,6-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=9315	52.93	2	1681.7104	1681.7104	R	V	114	127
PSM	FFLQDPQSQELDVQVK	980	sp|Q9BSJ8|ESYT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10452	59.831	2	1919.9629	1919.9629	R	D	531	547
PSM	FVAPEEVLPFTEGDILEK	981	sp|P49770|EI2BB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=13265	77.915	2	2032.0405	2032.0405	K	V	288	306
PSM	GEAGVPAEFSIWTR	982	sp|O75369-6|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:267	ms_run[2]:scan=11154	64.209	2	1528.755	1528.7550	R	E	2141	2155
PSM	GEAGVPAEFSIWTR	983	sp|O75369-6|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=11182	64.391	2	1518.7467	1518.7467	R	E	2141	2155
PSM	GFGFVDFNSEEDAK	984	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9893	56.136	2	1560.6733	1560.6733	K	A	611	625
PSM	GGCPGGEATLSQPPPR	985	sp|P20290|BTF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=3160	19.998	2	1589.7496	1589.7496	R	G	20	36
PSM	GGGGGQDNGLEGLGNDSR	986	sp|P08621-4|RU17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	18-UNIMOD:267	ms_run[2]:scan=4113	24.805	2	1668.7327	1668.7327	R	D	298	316
PSM	GLEMDPIDCTPPEYILPGSR	987	sp|O75153|CLU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	9-UNIMOD:4	ms_run[2]:scan=11577	66.865	2	2259.0552	2259.0552	K	E	176	196
PSM	GLGTDEDSLIEIICSR	988	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=13031	76.399	2	1786.8646	1786.8646	K	T	120	136
PSM	GPVEGYEENEEFLR	989	sp|Q9UI30-2|TR112_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:267	ms_run[2]:scan=7793	44.376	2	1676.7557	1676.7557	K	T	64	78
PSM	GQDEASAGGIWGFIK	990	sp|Q96M27-4|PRRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:188	ms_run[2]:scan=11806	68.295	2	1540.7617	1540.7617	R	G	204	219
PSM	GQLPDYTSPVVLPYSR	991	sp|Q9Y295|DRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9780	55.55	2	1790.9203	1790.9203	K	T	300	316
PSM	GSAFAIGSDGLCCQSR	992	sp|Q92499|DDX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	12-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=7294	41.514	2	1684.7297	1684.7297	R	E	99	115
PSM	GSGIFDESTPVQTR	993	sp|Q9H910-2|JUPI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:267	ms_run[2]:scan=6548	37.508	2	1502.7241	1502.7241	K	Q	52	66
PSM	GVDEVTIVNILTNR	994	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:267	ms_run[2]:scan=12826	75.014	2	1551.8496	1551.8496	K	S	50	64
PSM	GVGTDEACLIEILASR	995	sp|P50995-2|ANX11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	8-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=13254	77.847	2	1712.8643	1712.8643	K	S	254	270
PSM	GWEEGVAQMSVGQR	996	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7880	44.84	2	1532.7042	1532.7042	R	A	59	73
PSM	IAGGTSNEVAQFLSK	997	sp|Q6NXG1-2|ESRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:188	ms_run[2]:scan=9300	52.853	2	1526.8036	1526.8036	K	E	308	323
PSM	IAGGTSNEVAQFLSK	998	sp|Q6NXG1-2|ESRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9303	52.866	2	1520.7835	1520.7835	K	E	308	323
PSM	IAQPNYIPTQQDVLR	999	sp|P63096-2|GNAI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=8181	46.532	2	1754.9315	1754.9315	R	T	110	125
PSM	IDPENAEFLTALCELR	1000	sp|Q13325-2|IFIT5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	13-UNIMOD:4	ms_run[2]:scan=13547	79.743	2	1889.9193	1889.9193	K	L	416	432
PSM	IINYNVEQECNNFLR	1001	sp|Q12768|WASC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	10-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=9290	52.795	2	1934.9184	1934.9184	R	T	777	792
PSM	ILDQGEDFPASEMTR	1002	sp|P30040|ERP29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:267	ms_run[2]:scan=8019	45.57	2	1717.7857	1717.7857	K	I	209	224
PSM	IMYDLTSKPPGTTEWE	1003	sp|P49915-2|GUAA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	8-UNIMOD:188	ms_run[2]:scan=9519	54.093	2	1872.8911	1872.8911	R	-	579	595
PSM	IQGLTVEQAEAVVR	1004	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=8786	49.803	2	1511.8308	1511.8308	R	L	3924	3938
PSM	ISDALLQLTCVSCVR	1005	sp|Q27J81|INF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	10-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=11376	65.631	2	1733.8804	1733.8804	R	A	92	107
PSM	ISDALLQLTCVSCVR	1006	sp|Q27J81|INF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	10-UNIMOD:4,13-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=11378	65.643	2	1743.8887	1743.8887	R	A	92	107
PSM	ISFLENNLEQLTK	1007	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=11603	67.038	2	1547.8195	1547.8195	K	V	832	845
PSM	ISSLLEEQFQQGK	1008	sp|P62241|RS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	13-UNIMOD:188	ms_run[2]:scan=8087	45.97	2	1511.7927	1511.7927	K	L	158	171
PSM	ISSLLEEQFQQGK	1009	sp|P62241|RS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=8088	45.974	2	1505.7726	1505.7726	K	L	158	171
PSM	ITCLCQVPQNAANR	1010	sp|P49588|SYAC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:4,5-UNIMOD:4	ms_run[2]:scan=4824	28.505	2	1643.7872	1643.7872	K	G	899	913
PSM	ITCLCQVPQNAANR	1011	sp|P49588|SYAC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:4,5-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=4840	28.602	2	1653.7955	1653.7955	K	G	899	913
PSM	IVDDWANDGWGLK	1012	sp|P27824-3|CALX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10356	59.209	2	1487.7045	1487.7045	R	K	338	351
PSM	LAAQSLDTSGLR	1013	sp|P07199|CENPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=5466	31.876	2	1230.6568	1230.6568	R	H	299	311
PSM	LAQEGIYTLYPFINSR	1014	sp|Q08J23-3|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=12698	74.187	2	1883.9781	1883.9781	R	I	367	383
PSM	LAQQQAALLMQQEER	1015	sp|Q13435|SF3B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:267	ms_run[2]:scan=7164	40.71	2	1765.902	1765.9020	K	A	149	164
PSM	LASIVEQVSVLQNQGR	1016	sp|P54886-2|P5CS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9830	55.807	2	1739.953	1739.9530	R	E	95	111
PSM	LEEGPPVTTVLTR	1017	sp|P08559-3|ODPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	13-UNIMOD:267	ms_run[2]:scan=7757	44.191	2	1420.7801	1420.7801	R	E	46	59
PSM	LFVGNLPPDITEEEMR	1018	sp|Q15233|NONO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10828	62.191	2	1858.9135	1858.9135	R	K	76	92
PSM	LGDVISIQPCPDVK	1019	sp|P55072|TERA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	10-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=8208	46.689	2	1545.8168	1545.8168	R	Y	96	110
PSM	LGFATSSDVIEMK	1020	sp|P42285|MTREX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9170	52.108	2	1396.6908	1396.6908	R	G	861	874
PSM	LGGEVSCLVAGTK	1021	sp|P13804|ETFA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=6636	37.954	2	1295.6851	1295.6851	R	C	47	60
PSM	LGGSLADSYLDEGFLLDK	1022	sp|P78371-2|TCPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=12824	75.002	2	1911.9466	1911.9466	K	K	158	176
PSM	LGGVSSTEELDIR	1023	sp|Q5VTR2|BRE1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	13-UNIMOD:267	ms_run[2]:scan=6948	39.601	2	1384.7073	1384.7073	K	T	37	50
PSM	LGYAGNTEPQFIIPSCIAIK	1024	sp|P61158|ARP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	16-UNIMOD:4,20-UNIMOD:188	ms_run[2]:scan=12348	71.919	2	2197.1549	2197.1549	K	E	19	39
PSM	LLDAQLATGGIVDPR	1025	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:267	ms_run[2]:scan=9206	52.307	2	1547.8547	1547.8547	R	L	3767	3782
PSM	LLGPDAAINLTDPDGALAK	1026	sp|Q13561|DCTN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	19-UNIMOD:188	ms_run[2]:scan=10849	62.323	2	1870.0143	1870.0143	K	R	157	176
PSM	LLQFYAETCPAPER	1027	sp|O00159-2|MYO1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	9-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=8459	48.053	2	1703.8217	1703.8217	R	G	118	132
PSM	LLQTDDEEEAGLLELLK	1028	sp|P55060|XPO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	17-UNIMOD:188	ms_run[2]:scan=13674	80.584	2	1934.0191	1934.0191	K	S	252	269
PSM	LLSELDQQSTEMPR	1029	sp|O95793-2|STAU1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:267	ms_run[2]:scan=7390	42.086	2	1655.8064	1655.8064	K	T	471	485
PSM	LMDEVAGIVAAR	1030	sp|O00154-2|BACH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	12-UNIMOD:267	ms_run[2]:scan=8826	50.038	2	1253.6677	1253.6677	K	H	211	223
PSM	LMTDTINEPILLCR	1031	sp|O43776|SYNC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	13-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=10519	60.261	2	1697.872	1697.8720	R	F	426	440
PSM	LPETNLFETEETR	1032	sp|Q15046|SYK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=8492	48.237	2	1577.7573	1577.7573	K	K	408	421
PSM	LPETNLFETEETR	1033	sp|Q15046|SYK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	13-UNIMOD:267	ms_run[2]:scan=8493	48.241	2	1587.7656	1587.7656	K	K	408	421
PSM	LQDAYYIFQEMADK	1034	sp|O14579|COPE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=12572	73.366	2	1733.7971	1733.7971	K	C	198	212
PSM	LQEAGILSAEELQR	1035	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:267	ms_run[2]:scan=8330	47.332	2	1565.8289	1565.8289	R	L	2626	2640
PSM	LQTSSVLVSGLR	1036	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	12-UNIMOD:267	ms_run[2]:scan=7604	43.336	2	1268.7328	1268.7328	R	G	30	42
PSM	LVQSPNSYFMDVK	1037	sp|Q71UM5|RS27L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=8718	49.456	2	1526.7439	1526.7439	R	C	24	37
PSM	LVTMQIWDTAGQER	1038	sp|P51149|RAB7A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:267	ms_run[2]:scan=9854	55.927	2	1656.8169	1656.8169	R	F	56	70
PSM	LVTMQIWDTAGQER	1039	sp|P51149|RAB7A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9861	55.962	2	1646.8086	1646.8086	R	F	56	70
PSM	LVVPASQCGSLIGK	1040	sp|Q15366-7|PCBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	8-UNIMOD:4	ms_run[2]:scan=6893	39.296	2	1427.7806	1427.7806	R	G	102	116
PSM	LVVPASQCGSLIGK	1041	sp|Q15366-7|PCBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	8-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=6894	39.3	2	1433.8008	1433.8008	R	G	102	116
PSM	LWGTQDVSQDIQEMK	1042	sp|Q8TDB8-4|GTR14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:188	ms_run[2]:scan=10449	59.814	2	1782.8554	1782.8554	R	D	144	159
PSM	LWNTTEVAPALSVFNDTK	1043	sp|O43815-2|STRN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=12716	74.303	2	2005.0157	2005.0157	R	E	546	564
PSM	LYIGNLSPAVTADDLR	1044	sp|Q9Y6M1-1|IF2B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10659	61.153	2	1716.9046	1716.9046	K	Q	5	21
PSM	MAPYQGPDAVPGALDYK	1045	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	17-UNIMOD:188	ms_run[2]:scan=8303	47.189	2	1797.8703	1797.8703	R	S	883	900
PSM	MDATSYSSIASEFGVR	1046	sp|Q96JJ7-2|TMX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:35	ms_run[2]:scan=10643	61.051	2	1735.7723	1735.7723	K	G	82	98
PSM	MTDQEAIQDLWQWR	1047	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:35	ms_run[2]:scan=12631	73.755	2	1834.8308	1834.8308	R	K	278	292
PSM	MTNGFSGADLTEICQR	1048	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=8582	48.728	2	1808.8061	1808.8061	K	A	678	694
PSM	NAAQVLVGIPLETGQK	1049	sp|Q9BT78|CSN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9864	55.975	2	1636.9148	1636.9148	R	Q	122	138
PSM	NALFPEVFSPTPDENSDQNSR	1050	sp|Q8IVT2|MISP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	21-UNIMOD:267	ms_run[2]:scan=10982	63.133	2	2373.0749	2373.0749	R	S	567	588
PSM	NAVITVPAYFNDSQR	1051	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9400	53.423	2	1693.8424	1693.8424	K	Q	188	203
PSM	NEFIPTNFEILPLEK	1052	sp|P14735|IDE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=13561	79.834	2	1802.9455	1802.9455	K	E	528	543
PSM	NNVSLLQSCIDLFK	1053	sp|Q9Y5X3|SNX5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	9-UNIMOD:4	ms_run[2]:scan=12797	74.829	2	1649.8447	1649.8447	R	N	389	403
PSM	NPVDYMDLPFSSSPSR	1054	sp|Q9BX66-8|SRBS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	16-UNIMOD:267	ms_run[2]:scan=10871	62.453	2	1820.8279	1820.8279	K	S	710	726
PSM	NTKGGDAPAAGEDA	1055	sp|P62851|RS25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:188	ms_run[2]:scan=749	7.8419	2	1278.5784	1278.5784	R	-	112	126
PSM	PVSSAASVYAGAGGSGSR	1056	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=3562	21.967	2	1579.759	1579.7590	R	I	28	46
PSM	SEQLEELFSQVGPVK	1057	sp|Q9NW13-2|RBM28_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=11703	67.667	2	1688.8621	1688.8621	R	Q	17	32
PSM	SGGSGGCSGAGGASNCGTGSGR	1058	sp|Q15005|SPCS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=439	6.0481	2	1856.7126	1856.7126	R	S	11	33
PSM	SGLGELILPENEPGSSIMPGK	1059	sp|P07954-2|FUMH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	18-UNIMOD:35,21-UNIMOD:188	ms_run[2]:scan=10534	60.356	2	2146.0923	2146.0923	R	V	308	329
PSM	SLDLDSCTLSEILR	1060	sp|Q9NRL2-2|BAZ1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:4	ms_run[2]:scan=12655	73.908	2	1620.8029	1620.8029	K	L	509	523
PSM	SLDLDSCTLSEILR	1061	sp|Q9NRL2-2|BAZ1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=12659	73.937	2	1630.8112	1630.8112	K	L	509	523
PSM	SMPDAMPLPGVGEELKQAK	1062	sp|O43865|SAHH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:1,16-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=10826	62.175	2	2051.047	2051.0470	M	E	2	21
PSM	SNMDNMFESYINNLR	1063	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:35	ms_run[2]:scan=11488	66.322	2	1862.7927	1862.7927	R	R	134	149
PSM	SNMDNMFESYINNLR	1064	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:35	ms_run[2]:scan=12142	70.578	2	1862.7927	1862.7927	R	R	134	149
PSM	SPDFTNENPLETR	1065	sp|P05023-3|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	13-UNIMOD:267	ms_run[2]:scan=7403	42.166	2	1528.7033	1528.7033	R	N	197	210
PSM	SPVEVAQDVLAAVGK	1066	sp|Q6IAN0|DRS7B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:188	ms_run[2]:scan=13098	76.83	2	1487.8291	1487.8291	R	K	268	283
PSM	SQLELLISPTCSCK	1067	sp|Q29RF7-3|PDS5A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	11-UNIMOD:4,13-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=9371	53.249	2	1640.8209	1640.8209	R	Q	571	585
PSM	SSFYVNGLTLGGQK	1068	sp|P07737|PROF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9134	51.908	2	1469.7514	1469.7514	R	C	57	71
PSM	SSGIHVALVTGGNK	1069	sp|P16152-2|CBR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:1	ms_run[2]:scan=6738	38.462	2	1380.7361	1380.7361	M	G	2	16
PSM	SVVTGGVQSVMGSR	1070	sp|O60664-4|PLIN3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6572	37.638	2	1362.6925	1362.6925	K	L	155	169
PSM	SYELPDGQVITIGNER	1071	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	16-UNIMOD:267	ms_run[2]:scan=9826	55.784	2	1799.8929	1799.8929	K	F	239	255
PSM	TAAAVAAQSGILDR	1072	sp|Q9Y6N5|SQOR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=5717	33.113	2	1342.7205	1342.7205	K	T	345	359
PSM	TALLPSDSVFAEER	1073	sp|Q14966-5|ZN638_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:267	ms_run[2]:scan=9410	53.479	2	1543.7758	1543.7758	K	N	318	332
PSM	TAMNVNEIFMAIAK	1074	sp|P51148|RAB5C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	10-UNIMOD:35	ms_run[2]:scan=13069	76.643	2	1567.7738	1567.7738	K	K	167	181
PSM	TEVNGFDPLFNAITGLNGSGK	1075	sp|O95347|SMC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=14007	83.164	2	2150.0644	2150.0644	R	S	18	39
PSM	TGLIDYNQLALTAR	1076	sp|P34897-3|GLYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:267	ms_run[2]:scan=9879	56.056	2	1557.839	1557.8390	K	L	180	194
PSM	TGTAYTFFTPNNIK	1077	sp|P17844-2|DDX5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9542	54.235	2	1573.7777	1573.7777	K	Q	359	373
PSM	TLAESALQLLYTAK	1078	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:188	ms_run[2]:scan=13525	79.604	2	1526.8651	1526.8651	K	E	1767	1781
PSM	TLAESALQLLYTAK	1079	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=13534	79.663	2	1520.845	1520.8450	K	E	1767	1781
PSM	TLSPGDSFSTFDTPYCR	1080	sp|Q9NQR4|NIT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	16-UNIMOD:4	ms_run[2]:scan=9524	54.126	2	1949.8465	1949.8465	K	V	131	148
PSM	TMGFCYQILTEPNADPR	1081	sp|O95373|IPO7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	5-UNIMOD:4	ms_run[2]:scan=10765	61.811	2	2011.9132	2011.9132	K	K	411	428
PSM	TQEQLALEMAELTAR	1082	sp|P26038|MOES_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=11349	65.463	2	1702.856	1702.8560	K	I	413	428
PSM	TSQTVATFLDELAQK	1083	sp|P52888|THOP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=13113	76.93	2	1650.8465	1650.8465	K	L	287	302
PSM	TTLPTFQSPEFSVTR	1084	sp|Q9Y5X3|SNX5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:267	ms_run[2]:scan=9834	55.827	2	1719.8707	1719.8707	K	Q	53	68
PSM	TTPSYVAFTDTER	1085	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6853	39.112	2	1486.694	1486.6940	R	L	37	50
PSM	TTQVPQFILDDFIQNDR	1086	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=13662	80.51	2	2049.0167	2049.0167	K	A	418	435
PSM	VAAALPGMESTQDR	1087	sp|P20340-3|RAB6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:267	ms_run[2]:scan=5549	32.284	2	1454.7063	1454.7063	R	S	66	80
PSM	VACPQCNAEYLIVFPK	1088	sp|Q9NX47|MARH5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:4,6-UNIMOD:4	ms_run[2]:scan=11022	63.384	2	1907.9274	1907.9274	R	L	63	79
PSM	VALVYGQMNEPPGAR	1089	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6800	38.812	2	1600.8032	1600.8032	K	A	265	280
PSM	VALVYGQMNEPPGAR	1090	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:267	ms_run[2]:scan=6801	38.817	2	1610.8114	1610.8114	K	A	265	280
PSM	VCENIPIVLCGNK	1091	sp|P62826|RAN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=8231	46.815	2	1514.7585	1514.7585	R	V	111	124
PSM	VDHLANTEINSQR	1092	sp|Q96S99|PKHF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:1,13-UNIMOD:267	ms_run[2]:scan=6329	36.296	2	1547.7568	1547.7568	M	I	2	15
PSM	VDIETPNLEGTLTGPR	1093	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9502	54.003	2	1710.8788	1710.8788	R	L	541	557
PSM	VDNIQAGELTEGIWR	1094	sp|Q08945|SSRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10635	61	2	1699.8529	1699.8529	K	R	40	55
PSM	VFANAPDSACVIGLK	1095	sp|P17858|PFKAL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	10-UNIMOD:4	ms_run[2]:scan=8416	47.812	2	1560.797	1560.7970	R	K	699	714
PSM	VIGDNPWTPEQLEQCK	1096	sp|Q5VYK3|ECM29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=9039	51.323	2	1918.919	1918.9190	R	L	229	245
PSM	VLEQLTGQTPVFSK	1097	sp|P62913-2|RL11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:188	ms_run[2]:scan=8456	48.04	2	1551.8604	1551.8604	K	A	38	52
PSM	VLGEAMTGISQNAK	1098	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:188	ms_run[2]:scan=5790	33.483	2	1423.7436	1423.7436	K	N	1402	1416
PSM	VLQATVVAVGSGSK	1099	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:188	ms_run[2]:scan=5204	30.591	2	1320.7708	1320.7708	K	G	41	55
PSM	VLQATVVAVGSGSK	1100	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=5208	30.609	2	1314.7507	1314.7507	K	G	41	55
PSM	VLQDMGLPTGAEGR	1101	sp|Q12906-5|ILF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	5-UNIMOD:35,14-UNIMOD:267	ms_run[2]:scan=4929	29.157	2	1468.7219	1468.7219	K	D	461	475
PSM	VNATGPQFVSGVIVK	1102	sp|Q4G0J3-3|LARP7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:188	ms_run[2]:scan=8445	47.974	2	1520.8658	1520.8658	K	I	451	466
PSM	VNSLPEVLPILNSDEPK	1103	sp|P23229-7|ITA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	17-UNIMOD:188	ms_run[2]:scan=12014	69.714	2	1869.0191	1869.0191	R	T	478	495
PSM	VSALDLAVLDQVEAR	1104	sp|Q13561|DCTN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=11853	68.605	2	1597.8675	1597.8675	K	L	268	283
PSM	VTNGAFTGEISPGMIK	1105	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	16-UNIMOD:188	ms_run[2]:scan=8601	48.835	2	1626.8383	1626.8383	K	D	107	123
PSM	VTQALNVLTTTFGR	1106	sp|Q6PJG6|BRAT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=11034	63.458	2	1519.8358	1519.8358	K	C	214	228
PSM	YAICSALAASALPALVMSK	1107	sp|P36578|RL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	4-UNIMOD:4	ms_run[2]:scan=13527	79.616	2	1936.0162	1936.0162	R	G	122	141
PSM	YITGDQLGALYQDFVR	1108	sp|P09104-2|ENOG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=13593	80.046	2	1857.9261	1857.9261	R	D	227	243
PSM	TVGALQVLGTEAQSSLLK	1109	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=12214	71.06108166666667	2	1814.019287	1814.014929	R	A	1275	1293
PSM	VAAAESMPLLLECAR	1110	sp|O00410|IPO5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	7-UNIMOD:35,13-UNIMOD:4,15-UNIMOD:267	ms_run[1]:scan=7815	44.48894666666667	2	1655.837198	1655.825033	R	V	721	736
PSM	MTNGFSGADLTEICQR	1111	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	1-UNIMOD:35,14-UNIMOD:4	ms_run[1]:scan=8260	46.96413166666667	2	1815.778770	1814.792734	K	A	678	694
PSM	VGINYQPPTVVPGGDLAK	1112	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=9111	51.76951	2	1824.967310	1823.978149	K	V	353	371
PSM	VLGIQVDTDGSGR	1113	sp|P33992|MCM5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	13-UNIMOD:267	ms_run[1]:scan=6549	37.512785	2	1325.684564	1325.681462	R	S	296	309
PSM	QVLEGEEIAYKFTPK	1114	sp|Q03252|LMNB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:28	ms_run[1]:scan=11591	66.95842833333333	2	1733.8908	1733.8871	R	Y	506	521
PSM	IFVGGLNPEATEEK	1115	sp|Q99729-2|ROAA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	14-UNIMOD:188	ms_run[1]:scan=7700	43.88729333333333	2	1508.786058	1508.781803	K	I	156	170
PSM	SPLIIFSDCDMNNAVK	1116	sp|P49189|AL9A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	9-UNIMOD:4	ms_run[1]:scan=10911	62.69372166666667	2	1823.865058	1822.859356	K	G	259	275
PSM	CQCEEGFQLDPHTK	1117	sp|P01130|LDLR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:385,1-UNIMOD:4,3-UNIMOD:4	ms_run[1]:scan=6838	39.028888333333335	2	1730.7044	1730.7023	K	A	377	391
PSM	ADVIQATGDAICIFR	1118	sp|Q08945|SSRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	12-UNIMOD:4	ms_run[1]:scan=11841	68.522315	2	1649.821577	1648.824292	K	E	189	204
PSM	QFQDAGHFDAENIK	1119	sp|Q13813|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:28,14-UNIMOD:188	ms_run[1]:scan=8291	47.12347333333334	2	1607.7314	1607.7306	R	K	743	757
PSM	QKVIGAGEFGEVYK	1120	sp|P29317|EPHA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:28,2-UNIMOD:188,14-UNIMOD:188	ms_run[1]:scan=8349	47.43427333333334	2	1518.8125	1518.8116	R	G	616	630
PSM	QGQETAVAPSLVAPALNKPK	1121	sp|Q15691|MARE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:28	ms_run[1]:scan=8298	47.159351666666666	2	2001.0919	2001.0890	R	K	131	151
PSM	QGQETAVAPSLVAPALNKPK	1122	sp|Q15691|MARE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:28,18-UNIMOD:188,20-UNIMOD:188	ms_run[1]:scan=8296	47.149840000000005	2	2013.1313	2013.1292	R	K	131	151
PSM	TPLSEAEFEEIMNR	1123	sp|Q16630|CPSF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	12-UNIMOD:35	ms_run[1]:scan=8588	48.75852166666667	2	1680.760306	1680.766502	R	N	407	421
PSM	MMADEALGSGLVSR	1124	sp|Q13011|ECH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	1-UNIMOD:35	ms_run[1]:scan=6970	39.72676666666667	2	1452.682610	1451.674850	K	V	232	246
PSM	LGAAAADAVTGR	1125	sp|Q9H4A3|WNK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	12-UNIMOD:267	ms_run[1]:scan=3462	21.512558333333335	2	1082.572470	1081.575541	K	T	39	51
PSM	QFEDEKANWEAQQR	1126	sp|Q16181|SEPT7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:28	ms_run[1]:scan=6772	38.657558333333334	2	1760.7791	1760.7749	R	I	403	417
PSM	SYFSEEGIGYNIIR	1127	sp|P04062|GLCM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=10724	61.558184999999995	2	1647.805649	1646.794037	K	V	146	160
PSM	NSEGWEQNGLYEFFR	1128	sp|Q8IWX8|CHERP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=13244	77.78201333333332	2	1875.806405	1874.822377	R	A	704	719
PSM	QATVGDINTERPGMLDFTGK	1129	sp|P07108|ACBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:28,14-UNIMOD:35	ms_run[1]:scan=8675	49.238393333333335	2	2148.0185	2148.0152	K	A	34	54
PSM	CPQVEEAIVQSGQKK	1130	sp|Q9BVP2|GNL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=7823	44.5333	2	1682.8323	1682.8292	R	L	158	173
PSM	CPQVEEAIVQSGQKK	1131	sp|Q9BVP2|GNL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:385,1-UNIMOD:4,14-UNIMOD:188,15-UNIMOD:188	ms_run[1]:scan=7820	44.517934999999994	2	1694.8705	1694.8695	R	L	158	173
PSM	VTGQNQEQFLLLAK	1132	sp|Q9UBW8|CSN7A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	14-UNIMOD:188	ms_run[1]:scan=9237	52.47911833333333	2	1594.8692	1593.8812	K	S	7	21
PSM	FMQTFVLAPEGSVANK	1133	sp|Q13283|G3BP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	2-UNIMOD:35	ms_run[1]:scan=8585	48.742538333333336	2	1754.848969	1753.870907	R	F	108	124
PSM	AAPCIYWLPLTDSQIVQK	1134	sp|Q9UKV3-3|ACINU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:4	ms_run[2]:scan=13164	77.27	2	2102.087	2102.0870	K	E	462	480
PSM	AAVEEGIVLGGGCALLR	1135	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:4	ms_run[2]:scan=10617	60.885	2	1683.8978	1683.8978	R	C	430	447
PSM	AAYNPGQAVPWNAVK	1136	sp|Q8N163-2|CCAR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8308	47.214	2	1584.8049	1584.8049	K	V	98	113
PSM	AGAGSATLSMAYAGAR	1137	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	16-UNIMOD:267	ms_run[2]:scan=6189	35.539	2	1463.7066	1463.7066	K	F	242	258
PSM	AGALNSNDAFVLK	1138	sp|P06396-2|GELS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:188	ms_run[2]:scan=7641	43.548	2	1324.7082	1324.7082	K	T	534	547
PSM	AGLEQELEAGVGGR	1139	sp|Q96LA8-2|ANM6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8551	48.563	2	1384.6947	1384.6947	R	F	178	192
PSM	AGQCVIGLQMGTNK	1140	sp|Q99439|CNN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=6624	37.892	2	1481.7426	1481.7426	K	C	161	175
PSM	AGRLPACVVDCGTGYTK	1141	sp|P61158|ARP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:1,7-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=7777	44.287	3	1865.8764	1865.8764	M	L	2	19
PSM	AIDENNEPTACFLIR	1142	sp|Q9P2R3|ANFY1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	11-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=9261	52.617	2	1771.8439	1771.8439	R	S	732	747
PSM	AINQQTGAFVEISR	1143	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:267	ms_run[2]:scan=6851	39.103	2	1542.803	1542.8030	K	Q	449	463
PSM	AINQQTGAFVEISR	1144	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6852	39.108	2	1532.7947	1532.7947	K	Q	449	463
PSM	ALESDMAPVLIMATNR	1145	sp|Q9Y230|RUVB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=11732	67.842	2	1730.8695	1730.8695	R	G	315	331
PSM	ALIVVQQGMTPSAK	1146	sp|P19388|RPAB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6700	38.268	2	1441.7963	1441.7963	R	Q	102	116
PSM	ALLAMYTNQAEQCR	1147	sp|O76094-2|SRP72_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:4	ms_run[2]:scan=7696	43.86	2	1667.776	1667.7760	K	K	250	264
PSM	ALLVEPVINSYLLAER	1148	sp|P21980|TGM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	16-UNIMOD:267	ms_run[2]:scan=13479	79.295	2	1809.0276	1809.0276	R	D	565	581
PSM	ALTVPELTQQMFDSK	1149	sp|Q9BVA1|TBB2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=12066	70.057	2	1706.8549	1706.8549	R	N	283	298
PSM	ALTVPELTQQVFDAK	1150	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=12092	70.23	2	1658.8879	1658.8879	R	N	283	298
PSM	ALTVPELTQQVFDAK	1151	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	15-UNIMOD:188	ms_run[2]:scan=12110	70.357	2	1664.9081	1664.9081	R	N	283	298
PSM	ASAGPQPLLVQSCK	1152	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=5080	29.961	2	1460.7753	1460.7753	K	A	944	958
PSM	ASGVAVSDGVIKVFNDMK	1153	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:1	ms_run[2]:scan=13201	77.504	2	1877.9557	1877.9557	M	V	2	20
PSM	ASGVAVSDGVIKVFNDMK	1154	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:1,12-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=13202	77.51	2	1889.996	1889.9960	M	V	2	20
PSM	ASIPFSVVGSNQLIEAK	1155	sp|Q15019|SEPT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=10838	62.254	2	1758.9516	1758.9516	K	G	233	250
PSM	ATGANATPLDFPSKK	1156	sp|Q15637-4|SF01_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:1	ms_run[2]:scan=6639	37.966	2	1558.7991	1558.7991	M	R	2	17
PSM	AVFQANQENLPILK	1157	sp|P05023-3|AT1A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:188	ms_run[2]:scan=9518	54.087	2	1589.8873	1589.8873	R	R	400	414
PSM	AVLVDLEPGTMDSVR	1158	sp|P68371|TBB4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9652	54.838	2	1600.8131	1600.8131	R	S	63	78
PSM	AVYSTNCPVWEEAFR	1159	sp|Q9BSJ8|ESYT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:4	ms_run[2]:scan=11038	63.487	2	1827.825	1827.8250	K	F	516	531
PSM	AWCVNCFACSTCNTK	1160	sp|P48059|LIMS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:4,6-UNIMOD:4,9-UNIMOD:4,12-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=7853	44.693	2	1883.7519	1883.7519	K	L	270	285
PSM	AWCVNCFACSTCNTK	1161	sp|P48059|LIMS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:4,6-UNIMOD:4,9-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=7856	44.708	2	1877.7317	1877.7317	K	L	270	285
PSM	CLMDQATDPNILGR	1162	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=8550	48.558	2	1612.7577	1612.7577	K	T	4106	4120
PSM	CQLEINFNTLQTK	1163	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=9615	54.651	2	1613.8179	1613.8179	K	L	351	364
PSM	CQLEINFNTLQTK	1164	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:4	ms_run[2]:scan=9623	54.693	2	1607.7977	1607.7977	K	L	351	364
PSM	CTVIAAANPIGGR	1165	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:4	ms_run[2]:scan=5736	33.208	2	1298.6765	1298.6765	R	Y	624	637
PSM	CWEVQDSGQTIPK	1166	sp|P78406|RAE1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:4	ms_run[2]:scan=6249	35.842	2	1546.7086	1546.7086	R	A	68	81
PSM	DFLAGGVAAAISK	1167	sp|P05141|ADT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:188	ms_run[2]:scan=9808	55.693	2	1224.681	1224.6810	K	T	11	24
PSM	DFLAGGVAAAISK	1168	sp|P05141|ADT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9809	55.697	2	1218.6608	1218.6608	K	T	11	24
PSM	DLSIGNPIPTVVSGAR	1169	sp|O95104-3|SCAF4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	16-UNIMOD:267	ms_run[2]:scan=10437	59.734	2	1604.8761	1604.8761	K	G	763	779
PSM	DLYANTVLSGGTTMYPGIADR	1170	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=11062	63.632	2	2214.0627	2214.0627	K	M	292	313
PSM	EACWTISNITAGNR	1171	sp|O60684|IMA7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:4	ms_run[2]:scan=8695	49.338	2	1591.7413	1591.7413	K	A	355	369
PSM	EILGTAQSVGCNVDGR	1172	sp|P30050|RL12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	11-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=6057	34.87	2	1684.8078	1684.8078	K	H	131	147
PSM	EIVLADVIDNDSWR	1173	sp|P22234|PUR6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=12533	73.117	2	1643.8155	1643.8155	K	L	202	216
PSM	EKFTTPIEETGGEGCPAVALIQ	1174	sp|Q9NP84-2|TNR12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:188,15-UNIMOD:4	ms_run[2]:scan=10546	60.431	2	2352.1615	2352.1615	R	-	73	95
PSM	EQTADGVAVIPVLQR	1175	sp|Q9UKK9|NUDT5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	15-UNIMOD:267	ms_run[2]:scan=9283	52.752	2	1604.8761	1604.8761	K	T	56	71
PSM	ETLAQLQQEFQR	1176	sp|O15212|PFD6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:267	ms_run[2]:scan=9713	55.177	2	1499.7608	1499.7608	R	A	106	118
PSM	EVAFFNNFLTDAK	1177	sp|Q9BXP5-5|SRRT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=12820	74.98	2	1514.7405	1514.7405	K	R	709	722
PSM	EVQGNESDLFMSYFPR	1178	sp|P40121-2|CAPG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=12651	73.885	2	1917.8567	1917.8567	R	G	97	113
PSM	FAAYFQQGDMESNGK	1179	sp|P06744|G6PI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	15-UNIMOD:188	ms_run[2]:scan=6943	39.574	2	1697.7451	1697.7451	R	Y	348	363
PSM	FFTDDLFQYAGEK	1180	sp|Q6NYC1-2|JMJD6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=12254	71.314	2	1579.7195	1579.7195	K	R	155	168
PSM	FSIQTMCPIEGEGNIAR	1181	sp|Q13155-2|AIMP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=9616	54.656	2	1931.9109	1931.9109	K	F	130	147
PSM	FTDEYQLFEELGK	1182	sp|Q13557-8|KCC2D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=11989	69.542	2	1617.7563	1617.7563	R	G	10	23
PSM	FTPSPVDFTITPETLQNVK	1183	sp|O14972-2|VP26C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	19-UNIMOD:188	ms_run[2]:scan=12127	70.474	2	2139.1195	2139.1195	K	E	123	142
PSM	FTQLDLEDVQVR	1184	sp|Q9NTJ3-2|SMC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:267	ms_run[2]:scan=9445	53.669	2	1471.7546	1471.7546	K	E	390	402
PSM	FYSQAIELNPSNAIYYGNR	1185	sp|P53041|PPP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=10470	59.95	2	2219.0647	2219.0647	K	S	50	69
PSM	GAGTGGLGLAVEGPSEAK	1186	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6475	37.111	2	1569.7999	1569.7999	R	M	1382	1400
PSM	GDINILLIGDPSVAK	1187	sp|P25205|MCM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=11631	67.212	2	1523.8559	1523.8559	R	S	337	352
PSM	GFGTDEQAIIDCLGSR	1188	sp|P50995-2|ANX11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:4	ms_run[2]:scan=11212	64.591	2	1737.7992	1737.7992	K	S	182	198
PSM	GFSEGLWEIENNPTVK	1189	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	16-UNIMOD:188	ms_run[2]:scan=10774	61.863	2	1824.899	1824.8990	K	A	81	97
PSM	GFVDDIIQPSSTR	1190	sp|P05166|PCCB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8875	50.311	2	1433.7151	1433.7151	R	A	500	513
PSM	GGSGTAGTEPSDIIIPLR	1191	sp|P98172|EFNB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	18-UNIMOD:267	ms_run[2]:scan=9383	53.321	2	1749.9136	1749.9136	K	T	290	308
PSM	GLAITFVSDENDAK	1192	sp|Q13838|DX39B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8642	49.052	2	1478.7253	1478.7253	K	I	385	399
PSM	GLGTDEDSLIEIICSR	1193	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:4	ms_run[2]:scan=13032	76.405	2	1776.8564	1776.8564	K	T	120	136
PSM	GLNLTTPGESDGFCANK	1194	sp|P57737-2|CORO7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:4	ms_run[2]:scan=7579	43.193	2	1779.8098	1779.8098	K	L	407	424
PSM	GLNLTTPGESDGFCANK	1195	sp|P57737-2|CORO7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=7580	43.199	2	1785.8299	1785.8299	K	L	407	424
PSM	GNTAAQMAQILSFNK	1196	sp|P35237|SPB6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=10811	62.083	2	1592.7981	1592.7981	K	S	47	62
PSM	GPCIIYNEDNGIIK	1197	sp|P36578|RL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:4	ms_run[2]:scan=8105	46.07	2	1604.7868	1604.7868	R	A	206	220
PSM	GVDEVTIVNILTNR	1198	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:267	ms_run[2]:scan=12830	75.038	3	1551.8496	1551.8496	K	S	50	64
PSM	GVVDSDDLPLNVSR	1199	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:267	ms_run[2]:scan=8186	46.566	2	1494.7554	1494.7554	K	E	435	449
PSM	ICNEILTSPCSPEIR	1200	sp|Q9BPX3|CND3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:4,10-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=7673	43.728	2	1797.8629	1797.8629	K	V	834	849
PSM	IFQNLDGALDEVVLK	1201	sp|Q02809|PLOD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=12649	73.873	2	1672.9036	1672.9036	R	F	206	221
PSM	IGIFGQDEDVTSK	1202	sp|P16615-5|AT2A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:188	ms_run[2]:scan=7911	45.002	2	1413.7083	1413.7083	R	A	638	651
PSM	IGSFTIQNVFPQSDGDSSK	1203	sp|O95757|HS74L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=10889	62.559	2	2025.9643	2025.9643	R	V	459	478
PSM	IIAINSELTQPK	1204	sp|Q8WVX9|FACR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7068	40.227	2	1325.7555	1325.7555	K	L	79	91
PSM	ILDIDNVDLAMGK	1205	sp|O43615|TIM44_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	11-UNIMOD:35,13-UNIMOD:188	ms_run[2]:scan=9116	51.798	2	1437.7481	1437.7481	R	M	369	382
PSM	ILTLESMNPQVK	1206	sp|Q8TD30|ALAT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8615	48.911	2	1371.7432	1371.7432	R	A	47	59
PSM	INVYYNEATGGK	1207	sp|P68371|TBB4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=5001	29.554	2	1327.6408	1327.6408	R	Y	47	59
PSM	IQPSGGTNINEALLR	1208	sp|P19823|ITIH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7145	40.602	2	1581.8475	1581.8475	K	A	380	395
PSM	ISEIEDAAFLAR	1209	sp|O94905|ERLN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9202	52.287	2	1333.6878	1333.6878	K	E	242	254
PSM	ISELGAGNGGVVFK	1210	sp|Q02750-2|MP2K1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7192	40.879	2	1346.7194	1346.7194	K	V	71	85
PSM	IYVDDGLISLQVK	1211	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:188	ms_run[2]:scan=10913	62.706	2	1467.828	1467.8280	K	Q	174	187
PSM	LAGTQPLEVLEAVQR	1212	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=11188	64.431	2	1622.8992	1622.8992	R	S	639	654
PSM	LANELPDWFQTAK	1213	sp|Q9UDY2-5|ZO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:188	ms_run[2]:scan=11353	65.487	2	1537.7872	1537.7872	K	T	747	760
PSM	LASVPGSQTVVVK	1214	sp|O00592-2|PODXL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:188	ms_run[2]:scan=5273	30.928	2	1289.765	1289.7650	R	E	367	380
PSM	LCGDTSLNNMQR	1215	sp|O00410-2|IPO5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=3845	23.419	2	1417.6318	1417.6318	K	Q	205	217
PSM	LDDIFEPVLIPEPK	1216	sp|Q14008-2|CKAP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=12766	74.63	2	1623.876	1623.8760	K	I	1510	1524
PSM	LDIDPSTITWQR	1217	sp|Q6UB35|C1TM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9776	55.532	2	1443.7358	1443.7358	R	V	564	576
PSM	LEGLTDEINFLR	1218	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:267	ms_run[2]:scan=11774	68.099	2	1428.7488	1428.7488	R	Q	214	226
PSM	LEGLTDEINFLR	1219	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:267	ms_run[2]:scan=11928	69.119	2	1428.7488	1428.7488	R	Q	214	226
PSM	LEGLTDEINFLR	1220	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=11775	68.104	2	1418.7405	1418.7405	R	Q	214	226
PSM	LEGLTDEINFLR	1221	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=11929	69.123	2	1418.7405	1418.7405	R	Q	214	226
PSM	LELFLPEEYPMAAPK	1222	sp|P61088|UBE2N_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	15-UNIMOD:188	ms_run[2]:scan=12617	73.661	2	1752.9104	1752.9104	K	V	54	69
PSM	LFQEDDEIPLYLK	1223	sp|P14406|CX7A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=11406	65.819	2	1621.8239	1621.8239	K	G	34	47
PSM	LFQVQGTGANNTK	1224	sp|P09327|VILI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=3931	23.877	2	1376.7048	1376.7048	R	A	517	530
PSM	LFSDEAANIYER	1225	sp|Q12996|CSTF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7741	44.108	2	1426.6729	1426.6729	K	A	319	331
PSM	LFVSGACDASAK	1226	sp|P62873-2|GBB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:4	ms_run[2]:scan=3923	23.835	2	1224.5809	1224.5809	R	L	198	210
PSM	LFVSGACDASAK	1227	sp|P62873-2|GBB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:4,12-UNIMOD:188	ms_run[2]:scan=3935	23.892	2	1230.601	1230.6010	R	L	198	210
PSM	LFVTNDAATILR	1228	sp|P50990|TCPQ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:267	ms_run[2]:scan=9794	55.624	2	1342.7484	1342.7484	K	E	63	75
PSM	LGPGGLDPVEVYESLPEELQK	1229	sp|Q16543|CDC37_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	21-UNIMOD:188	ms_run[2]:scan=13538	79.686	2	2274.1727	2274.1727	R	C	287	308
PSM	LGYAGNTEPQFIIPSCIAIK	1230	sp|P61158|ARP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	16-UNIMOD:4	ms_run[2]:scan=12346	71.907	2	2191.1347	2191.1347	K	E	19	39
PSM	LICCDILDVLDK	1231	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:4,4-UNIMOD:4,12-UNIMOD:188	ms_run[2]:scan=12874	75.308	2	1481.7565	1481.7565	K	H	95	107
PSM	LIQQVAQEIWVCEK	1232	sp|Q9UG63|ABCF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:4	ms_run[2]:scan=10862	62.399	2	1742.9025	1742.9025	R	Q	575	589
PSM	LLQFQDLTGIESMDQCR	1233	sp|Q96CS3|FAF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	16-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=12196	70.934	2	2062.9691	2062.9691	K	H	17	34
PSM	LLQFYAETCPAPER	1234	sp|O00159-2|MYO1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	9-UNIMOD:4	ms_run[2]:scan=8470	48.114	2	1693.8134	1693.8134	R	G	118	132
PSM	LLSGPSQESPQTLGK	1235	sp|Q9BWE0|REPI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=4982	29.457	2	1540.8097	1540.8097	R	E	19	34
PSM	LLSVVPVPEGYSVK	1236	sp|Q9GZN8|CT027_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9767	55.481	2	1485.8443	1485.8443	K	C	92	106
PSM	LMTDTINEPILLCR	1237	sp|O43776|SYNC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:4	ms_run[2]:scan=10492	60.087	2	1687.8637	1687.8637	R	F	426	440
PSM	LMTQAQLEEATR	1238	sp|P82650-2|RT22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:267	ms_run[2]:scan=6050	34.835	2	1399.7005	1399.7005	K	Q	104	116
PSM	LNTQEIFDDWAR	1239	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=11740	67.891	2	1506.7103	1506.7103	K	K	693	705
PSM	LQAFSAAIESCNK	1240	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	11-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=6590	37.728	2	1443.7123	1443.7123	K	A	332	345
PSM	LQAFSAAIESCNK	1241	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	11-UNIMOD:4	ms_run[2]:scan=6591	37.732	2	1437.6922	1437.6922	K	A	332	345
PSM	LQDAYYIFQEMADK	1242	sp|O14579|COPE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:188	ms_run[2]:scan=12563	73.309	2	1739.8172	1739.8172	K	C	198	212
PSM	LSGLEQPQGALQTR	1243	sp|Q6RFH5-2|WDR74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=5712	33.085	2	1496.7947	1496.7947	K	R	341	355
PSM	LSGLEQPQGALQTR	1244	sp|Q6RFH5-2|WDR74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:267	ms_run[2]:scan=5714	33.094	2	1506.803	1506.8030	K	R	341	355
PSM	LTDEDFSPFGSGGGLFSGGK	1245	sp|Q9Y4E1-5|WAC2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	20-UNIMOD:188	ms_run[2]:scan=12208	71.014	2	1979.9208	1979.9208	K	G	322	342
PSM	LVGEIMQETGTR	1246	sp|Q00341|VIGLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:267	ms_run[2]:scan=6353	36.433	2	1342.679	1342.6790	R	I	244	256
PSM	LVTDQNISENWR	1247	sp|P24666|PPAC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6901	39.336	2	1473.7212	1473.7212	K	V	30	42
PSM	MFVLDEADEMLSR	1248	sp|P60842|IF4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:35	ms_run[2]:scan=11178	64.363	2	1570.7007	1570.7007	K	G	178	191
PSM	MLVNENFEEYLR	1249	sp|P09455|RET1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:35,12-UNIMOD:267	ms_run[2]:scan=10139	57.702	2	1581.7373	1581.7373	K	A	11	23
PSM	MQNDAGEFVDLYVPRK	1250	sp|P63220|RS21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:1,1-UNIMOD:35,15-UNIMOD:267,16-UNIMOD:188	ms_run[2]:scan=9890	56.114	2	1954.943	1950.9548	-	C	1	17
PSM	NCPLIDNICAFAK	1251	sp|O60488-2|ACSL4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=11509	66.458	2	1534.7272	1534.7272	K	S	553	566
PSM	NFTTEQVTAMLLSK	1252	sp|P34932|HSP74_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=12062	70.029	2	1581.8072	1581.8072	R	L	111	125
PSM	NGQVIGIGAGQQSR	1253	sp|P31939-2|PUR9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:267	ms_run[2]:scan=3564	21.976	2	1393.7301	1393.7301	K	I	437	451
PSM	NGQVIGIGAGQQSR	1254	sp|P31939-2|PUR9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=3567	21.993	2	1383.7219	1383.7219	K	I	437	451
PSM	NINDAWVCTNDMFR	1255	sp|P61970|NTF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	8-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=10932	62.823	2	1764.7587	1764.7587	K	L	107	121
PSM	NLANTVTEEILEK	1256	sp|O60506-4|HNRPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:188	ms_run[2]:scan=11248	64.82	2	1478.7924	1478.7924	R	A	309	322
PSM	NLATTVTEEILEK	1257	sp|O43390-3|HNRPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=12569	73.349	2	1459.777	1459.7770	R	S	309	322
PSM	NLATTVTEEILEK	1258	sp|O43390-3|HNRPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:188	ms_run[2]:scan=12578	73.408	2	1465.7971	1465.7971	R	S	309	322
PSM	NLPGLVQEGEPFSEEATLFTK	1259	sp|Q7KZF4|SND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=12994	76.154	2	2305.1478	2305.1478	R	E	566	587
PSM	NLSELQDTSLQQLVSQR	1260	sp|Q5QJE6|TDIF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	17-UNIMOD:267	ms_run[2]:scan=11031	63.44	2	1968.0152	1968.0152	K	H	322	339
PSM	NNLAGAEELFAR	1261	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:267	ms_run[2]:scan=9164	52.08	2	1313.6603	1313.6603	R	K	355	367
PSM	NSLGGDVLFVGK	1262	sp|Q9H0D6-2|XRN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:188	ms_run[2]:scan=8763	49.68	2	1210.6653	1210.6653	R	H	601	613
PSM	NSLGGDVLFVGK	1263	sp|Q9H0D6-2|XRN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8765	49.688	2	1204.6452	1204.6452	R	H	601	613
PSM	NTKGGDAPAAGEDA	1264	sp|P62851|RS25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=757	7.8872	2	1272.5582	1272.5582	R	-	112	126
PSM	NVDEAINFINER	1265	sp|P51648|AL3A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9321	52.964	2	1432.6947	1432.6947	K	E	344	356
PSM	NYLEGIYNVPVAAVR	1266	sp|Q16540|RM23_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=10821	62.145	2	1676.8886	1676.8886	R	T	55	70
PSM	QAAAAGIFLNNVK	1267	sp|Q9NQ88|TIGAR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8344	47.406	2	1315.7248	1315.7248	K	F	38	51
PSM	QIVQSISDLNEIFR	1268	sp|O14662-6|STX16_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:267	ms_run[2]:scan=12582	73.431	2	1670.8867	1670.8867	R	D	189	203
PSM	QLGGSVELVDIGK	1269	sp|Q96KP4|CNDP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8595	48.8	2	1313.7191	1313.7191	K	Q	54	67
PSM	QLQDIATLADQR	1270	sp|O95373|IPO7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:267	ms_run[2]:scan=7707	43.921	2	1380.7237	1380.7237	K	R	991	1003
PSM	QMEQISQFLQAAER	1271	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=11634	67.229	2	1677.8145	1677.8145	K	Y	89	103
PSM	QVFQQTISCPEGLR	1272	sp|Q14653|IRF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	9-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=7387	42.07	2	1671.8278	1671.8278	R	L	214	228
PSM	SDIGEVILVGGMTR	1273	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:267	ms_run[2]:scan=10397	59.476	2	1455.7631	1455.7631	K	M	378	392
PSM	SDPLLIGIPTSENPFK	1274	sp|Q9UBI6|GBG12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	16-UNIMOD:188	ms_run[2]:scan=12604	73.579	2	1732.9343	1732.9343	R	D	49	65
PSM	SETAPLAPTIPAPAEKTPVK	1275	sp|P16402|H13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:1	ms_run[2]:scan=7783	44.321	2	2059.1201	2059.1201	M	K	2	22
PSM	SFLESIDDALAEK	1276	sp|Q15750-2|TAB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=12680	74.071	2	1436.7035	1436.7035	R	A	116	129
PSM	SFLESIDDALAEK	1277	sp|Q15750-2|TAB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:188	ms_run[2]:scan=12681	74.076	2	1442.7236	1442.7236	R	A	116	129
PSM	SGALDVLQMKEEDVLK	1278	sp|P08865|RSSA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:1	ms_run[2]:scan=11864	68.678	2	1815.9288	1815.9288	M	F	2	18
PSM	SLLGSTAIEAPSSTCVAR	1279	sp|Q8NCD3-3|HJURP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	15-UNIMOD:4	ms_run[2]:scan=8175	46.492	2	1818.9146	1818.9146	K	A	564	582
PSM	SNMDNMFESYINNLR	1280	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	15-UNIMOD:267	ms_run[2]:scan=13281	78.018	2	1856.8061	1856.8061	R	R	134	149
PSM	SVTEQGAELSNEER	1281	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:267	ms_run[2]:scan=3152	19.953	2	1557.7146	1557.7146	K	N	28	42
PSM	TALLPSDSVFAEER	1282	sp|Q14966-5|ZN638_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9409	53.474	2	1533.7675	1533.7675	K	N	318	332
PSM	TALNNTLDLSNVR	1283	sp|Q12768|WASC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:267	ms_run[2]:scan=7824	44.539	2	1439.7608	1439.7608	K	E	312	325
PSM	TAMNVNEIFMAIAK	1284	sp|P51148|RAB5C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	10-UNIMOD:35,14-UNIMOD:188	ms_run[2]:scan=13068	76.638	2	1573.794	1573.7940	K	K	167	181
PSM	TDPSILGGMIVR	1285	sp|P48047|ATPO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:267	ms_run[2]:scan=9881	56.065	2	1267.6834	1267.6834	K	I	177	189
PSM	TDTAEAVPKFEEMFASR	1286	sp|Q9BTL3|RAMAC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:1	ms_run[2]:scan=12347	71.913	2	1969.9091	1969.9091	M	F	2	19
PSM	TINEVENQILTR	1287	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7934	45.119	2	1428.7573	1428.7573	R	D	746	758
PSM	TLLYNPFPPTNESDVIR	1288	sp|Q969X6-2|UTP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	17-UNIMOD:267	ms_run[2]:scan=11348	65.457	2	1985.0134	1985.0134	K	R	503	520
PSM	TLNQLGTPQDSPELR	1289	sp|O15400-2|STX7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6357	36.452	2	1667.8479	1667.8479	R	Q	35	50
PSM	TLSPGDSFSTFDTPYCR	1290	sp|Q9NQR4|NIT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	16-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=9517	54.081	2	1959.8548	1959.8548	K	V	131	148
PSM	TLTLVDTGIGMTK	1291	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9218	52.373	2	1348.7272	1348.7272	R	A	83	96
PSM	TPAFAESVTEGDVR	1292	sp|P36957|ODO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:267	ms_run[2]:scan=6536	37.448	2	1487.7132	1487.7132	K	W	75	89
PSM	TSQTVATFLDELAQK	1293	sp|P52888|THOP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	15-UNIMOD:188	ms_run[2]:scan=13110	76.913	2	1656.8666	1656.8666	K	L	287	302
PSM	TSTSAVPNLFVPLNTNPK	1294	sp|P35611-2|ADDA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	18-UNIMOD:188	ms_run[2]:scan=10840	62.266	2	1905.0303	1905.0303	R	E	480	498
PSM	TTYQALPCLPSMYGYPNR	1295	sp|P53621|COPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	8-UNIMOD:4,18-UNIMOD:267	ms_run[2]:scan=10922	62.761	2	2140.995	2140.9950	R	N	968	986
PSM	TVQGPPTSDDIFER	1296	sp|P04181|OAT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:267	ms_run[2]:scan=7254	41.251	2	1570.7503	1570.7503	K	E	33	47
PSM	VDFEQLTENLGQLER	1297	sp|Q9Y613|FHOD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	15-UNIMOD:267	ms_run[2]:scan=12779	74.711	2	1799.8929	1799.8929	K	R	890	905
PSM	VDFPQDQLTALTGR	1298	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:267	ms_run[2]:scan=10220	58.272	2	1569.8026	1569.8026	K	I	216	230
PSM	VDIGDTIIYLVH	1299	sp|Q9P2J5|SYLC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=13543	79.72	2	1356.7289	1356.7289	R	-	1165	1177
PSM	VEGFPTIYFAPSGDK	1300	sp|P13667|PDIA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=11105	63.896	2	1626.793	1626.7930	K	K	597	612
PSM	VGINYQPPTVVPGGDLAK	1301	sp|P68366-2|TBA4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8790	49.829	2	1823.9781	1823.9781	K	V	338	356
PSM	VGINYQPPTVVPGGDLAK	1302	sp|P68366-2|TBA4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	18-UNIMOD:188	ms_run[2]:scan=8598	48.815	2	1829.9983	1829.9983	K	V	338	356
PSM	VIGGDDLSTLTGK	1303	sp|P00492|HPRT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7603	43.331	2	1274.6718	1274.6718	K	N	116	129
PSM	VIGSGCNLDSAR	1304	sp|P00338-3|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=2985	19.15	2	1257.6011	1257.6011	R	F	187	199
PSM	VISFEEQVASIR	1305	sp|Q9BT78|CSN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:267	ms_run[2]:scan=9634	54.749	2	1386.7382	1386.7382	R	Q	96	108
PSM	VLATAFDTTLGGR	1306	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:267	ms_run[2]:scan=8483	48.188	2	1330.712	1330.7120	K	K	222	235
PSM	VLGTPVETIELTEDR	1307	sp|P27708|PYR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	15-UNIMOD:267	ms_run[2]:scan=9611	54.626	2	1680.8809	1680.8809	R	R	501	516
PSM	VLQQFADNDVSR	1308	sp|P51659-3|DHB4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:267	ms_run[2]:scan=5069	29.904	2	1400.6924	1400.6924	R	F	526	538
PSM	VMPNAIVQSVGVSSGK	1309	sp|O95831-3|AIFM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	16-UNIMOD:188	ms_run[2]:scan=7775	44.278	2	1577.8543	1577.8543	K	L	359	375
PSM	VMQPQILEVNFNPDCER	1310	sp|Q14166|TTL12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	15-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=10754	61.742	2	2097.9851	2097.9851	R	A	598	615
PSM	VPAINVNDSVTK	1311	sp|P23526-2|SAHH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:188	ms_run[2]:scan=5180	30.469	2	1261.6973	1261.6973	K	S	147	159
PSM	VQPVIGENGGDAR	1312	sp|P22059|OSBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=2588	17.062	2	1310.6579	1310.6579	K	Q	655	668
PSM	VTAQGPGLEPSGNIANK	1313	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	17-UNIMOD:188	ms_run[2]:scan=4502	26.76	2	1657.8731	1657.8731	K	T	384	401
PSM	VVGAVIDQGLITR	1314	sp|E9PRG8|CK098_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8252	46.919	2	1339.7823	1339.7823	R	H	36	49
PSM	YAACNAVGQMATDFAPGFQK	1315	sp|O00410-2|IPO5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:4,10-UNIMOD:35	ms_run[2]:scan=8184	46.549	2	2161.9561	2161.9561	R	K	357	377
PSM	YADALQEIIQER	1316	sp|Q9Y6N5|SQOR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=10639	61.029	2	1447.7307	1447.7307	K	N	242	254
PSM	YWQQVIDMNDYQR	1317	sp|O60701-3|UGDH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9670	54.934	2	1757.7832	1757.7832	R	R	202	215
PSM	QKAQVEQELTTLR	1318	sp|Q15149|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:28,2-UNIMOD:188,13-UNIMOD:267	ms_run[1]:scan=8310	47.224084999999995	2	1541.8390	1541.8379	R	L	2317	2330
PSM	LEGLTDEINFLR	1319	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	12-UNIMOD:267	ms_run[1]:scan=12302	71.62387666666667	2	1429.731772	1428.748814	R	Q	214	226
PSM	LEGLTDEINFLR	1320	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	12-UNIMOD:267	ms_run[1]:scan=11403	65.80104833333333	2	1429.736067	1428.748814	R	Q	214	226
PSM	QQCFSKDIVENYFMR	1321	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:28,3-UNIMOD:4	ms_run[1]:scan=12263	71.37110666666666	2	1946.8650	1946.8650	K	D	122	137
PSM	QATKDAGTIAGLNVLR	1322	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:28,4-UNIMOD:188,16-UNIMOD:267	ms_run[1]:scan=9362	53.197215	2	1625.9095	1625.9066	R	I	156	172
PSM	SYELPDGQVITIGNER	1323	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	16-UNIMOD:267	ms_run[1]:scan=10196	58.100935	3	1800.893539	1799.892912	K	F	241	257
PSM	QSSATSSFGGLGGGSVR	1324	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:28,17-UNIMOD:267	ms_run[1]:scan=7567	43.126846666666665	2	1548.7262	1546.7242	R	F	8	25
PSM	GVDEVTIVNILTNR	1325	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=12829	75.03353166666666	2	1541.844937	1541.841322	K	S	50	64
PSM	VDFPQDQLTALTGR	1326	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=10118	57.569518333333335	2	1560.796634	1559.794371	K	I	216	230
PSM	TLTIVDTGIGMTK	1327	sp|Q58FG1|HS904_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	13-UNIMOD:188	ms_run[1]:scan=9219	52.376936666666666	2	1354.746515	1354.747332	R	A	28	41
PSM	GNENANGAPAITLLIR	1328	sp|Q9Y5B9|SP16H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=10995	63.21628166666667	2	1623.863180	1622.874019	K	E	93	109
PSM	QKVIGAGEFGEVYK	1329	sp|P29317|EPHA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:28	ms_run[1]:scan=8350	47.43928333333333	2	1506.7735	1506.7713	R	G	616	630
PSM	QWLQEIDRYASENVNK	1330	sp|P62820|RAB1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:28	ms_run[1]:scan=12767	74.63548666666667	2	1974.9406	1974.9430	K	L	104	120
PSM	QYMEGFNDELEAFKER	1331	sp|Q16543|CDC37_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:28,14-UNIMOD:188,16-UNIMOD:267	ms_run[1]:scan=12355	71.96602833333333	2	2003.8846	2003.8901	R	V	247	263
PSM	EVAFFNNFLTDAK	1332	sp|Q9BXP5|SRRT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	13-UNIMOD:188	ms_run[1]:scan=12818	74.96410666666667	2	1521.764053	1520.760674	K	R	746	759
PSM	QSYKGSPMEISLPIALSK	1333	sp|P09960|LKHA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:28	ms_run[1]:scan=12168	70.74536166666667	2	1931.0202	1931.0072	R	N	80	98
PSM	QKEMDNFLAQMEAK	1334	sp|Q8WXX5|DNJC9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:28	ms_run[1]:scan=11539	66.63648666666667	2	1664.7605	1664.7533	R	Y	228	242
PSM	VGEIFSAAGAAFTK	1335	sp|Q8IXM2|BAP18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	14-UNIMOD:188	ms_run[1]:scan=9790	55.6008	2	1373.702799	1373.728645	K	L	8	22
PSM	QGTFHSQQALEYGTK	1336	sp|P53597|SUCA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:28	ms_run[1]:scan=5602	32.53454333333333	2	1676.7813	1676.7789	K	L	67	82
PSM	AEAGAGSATEFQFR	1337	sp|Q9NQ39|RS10L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	14-UNIMOD:267	ms_run[1]:scan=6492	37.206895	2	1450.695615	1450.671626	K	G	151	165
PSM	CKDVLTGQEFDVR	1338	sp|P43304|GPDM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=9156	52.035740000000004	2	1548.7257	1548.7237	R	A	270	283
PSM	QIFDEYENETFLCHR	1339	sp|Q9Y3A3|PHOCN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:28,13-UNIMOD:4,15-UNIMOD:267	ms_run[1]:scan=11726	67.80341833333334	2	1992.8637	1992.8546	R	F	176	191
PSM	QGNMTAALQAALKNPPINTK	1340	sp|O15511|ARPC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:28,13-UNIMOD:188,20-UNIMOD:188	ms_run[1]:scan=11829	68.43927166666667	2	2075.1342	2075.1232	R	S	48	68
PSM	FSASGELGNGNIK	1341	sp|P12004|PCNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	13-UNIMOD:188	ms_run[1]:scan=5323	31.175365000000003	2	1299.636583	1298.656209	K	L	169	182
PSM	MAAAAVQGGRSGGSGGCSGAGGASNCGTGSGR	1342	sp|Q15005|SPCS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	10-UNIMOD:267,17-UNIMOD:4,26-UNIMOD:4	ms_run[1]:scan=439	6.048091666666666	3	2782.210764	2779.180825	-	S	1	33
PSM	AEALMMPLVDQLENR	1343	sp|Q9H583|HEAT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	15-UNIMOD:267	ms_run[2]:scan=12771	74.659	2	1738.8621	1738.8621	R	L	2016	2031
PSM	AELNPWPEYIYTR	1344	sp|P26639|SYTC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11088	63.791	2	1650.8042	1650.8042	R	L	45	58
PSM	AGGGPTLQCPPPSSPEK	1345	sp|Q96N66-3|MBOA7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:4	ms_run[2]:scan=3346	20.96	2	1678.7985	1678.7985	R	A	272	289
PSM	AGGLDWPEATEVSPSR	1346	sp|Q9Y446|PKP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8553	48.574	2	1670.79	1670.7900	R	T	226	242
PSM	AGLPGFYDPCVGEEK	1347	sp|Q9NVH1-3|DJC11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	10-UNIMOD:4	ms_run[2]:scan=9160	52.055	2	1637.7396	1637.7396	K	N	457	472
PSM	AILVDLEPGTMDSVR	1348	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	15-UNIMOD:267	ms_run[2]:scan=10312	58.931	2	1624.837	1624.8370	R	S	63	78
PSM	AIQLNSNSVQALLLK	1349	sp|Q9UJX3-2|APC7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11635	67.235	2	1610.9356	1610.9356	K	G	365	380
PSM	AITGASLADIMAK	1350	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	11-UNIMOD:35,13-UNIMOD:188	ms_run[2]:scan=6902	39.341	2	1282.6898	1282.6898	R	R	81	94
PSM	AITGASLADIMAK	1351	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9678	54.978	2	1260.6748	1260.6748	R	R	81	94
PSM	AITGASLADIMAK	1352	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:188	ms_run[2]:scan=9686	55.022	2	1266.6949	1266.6949	R	R	81	94
PSM	ALAGCDFLTISPK	1353	sp|P37837|TALDO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	5-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=9672	54.944	2	1397.732	1397.7320	K	L	246	259
PSM	ALIAAQYSGAQVR	1354	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:267	ms_run[2]:scan=5723	33.14	2	1356.7389	1356.7389	K	V	18	31
PSM	ALIAAQYSGAQVR	1355	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5735	33.204	2	1346.7306	1346.7306	K	V	18	31
PSM	ALIVVQQGMTPSAK	1356	sp|P19388|RPAB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:188	ms_run[2]:scan=6701	38.272	2	1447.8164	1447.8164	R	Q	102	116
PSM	ALTVPELTQQVFDAK	1357	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=12247	71.274	2	1658.8879	1658.8879	R	N	283	298
PSM	APDVEQAIEVLTR	1358	sp|P39880-9|CUX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:267	ms_run[2]:scan=12560	73.292	2	1449.7703	1449.7703	K	S	238	251
PSM	ASGEHSPGSGAAR	1359	sp|Q9H4A4|AMPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:1,13-UNIMOD:267	ms_run[2]:scan=696	7.5622	2	1234.5566	1234.5566	M	R	2	15
PSM	ASGGLPQFGDEYDFYR	1360	sp|Q01780-2|EXOSX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	16-UNIMOD:267	ms_run[2]:scan=10749	61.713	2	1830.8088	1830.8088	K	S	49	65
PSM	ASLEAAIADAEQR	1361	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8609	48.884	2	1343.6681	1343.6681	R	G	329	342
PSM	ASNTADTLFQEVLGR	1362	sp|Q96KP1|EXOC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	15-UNIMOD:267	ms_run[2]:scan=12857	75.202	2	1630.819	1630.8190	R	K	249	264
PSM	ASNTADTLFQEVLGR	1363	sp|Q96KP1|EXOC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=12870	75.28	2	1620.8107	1620.8107	R	K	249	264
PSM	ATFAFSPEEQQAQR	1364	sp|Q9UHN6-2|CEIP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6568	37.612	2	1608.7532	1608.7532	R	E	58	72
PSM	AVCMLSNTTAIAEAWAR	1365	sp|P68366-2|TBA4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=12250	71.291	3	1873.9054	1873.9054	R	L	359	376
PSM	AVETPPLSSVNLLEGLSR	1366	sp|Q14C86-3|GAPD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	18-UNIMOD:267	ms_run[2]:scan=12777	74.7	2	1891.029	1891.0290	R	T	387	405
PSM	AVFVDLEPTVIDEVR	1367	sp|Q9BQE3|TBA1C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=12001	69.627	2	1700.8985	1700.8985	R	T	65	80
PSM	AVSDWLIASVEGR	1368	sp|Q969V3-2|NCLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=12535	73.128	2	1401.7252	1401.7252	K	L	195	208
PSM	CLLAASPENEAGGLK	1369	sp|Q9NW13-2|RBM28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=6614	37.843	2	1534.7757	1534.7757	K	L	251	266
PSM	CNEPAVWSQLAK	1370	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:4	ms_run[2]:scan=8226	46.787	2	1401.6711	1401.6711	R	A	1102	1114
PSM	CQVFEETQIGGER	1371	sp|Q99832-3|TCPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:4	ms_run[2]:scan=5972	34.402	2	1551.6988	1551.6988	R	Y	301	314
PSM	CWEVQDSGQTIPK	1372	sp|P78406|RAE1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=6245	35.818	2	1552.7287	1552.7287	R	A	68	81
PSM	DPVLAPAVGADLLDYCLAR	1373	sp|O60287|NPA1P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	16-UNIMOD:4	ms_run[2]:scan=13364	78.554	2	2028.035	2028.0350	R	R	1207	1226
PSM	DVSELTGFPEMLGGR	1374	sp|P31939-2|PUR9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	15-UNIMOD:267	ms_run[2]:scan=12028	69.802	2	1616.7744	1616.7744	R	V	49	64
PSM	DVSELTGFPEMLGGR	1375	sp|P31939-2|PUR9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=12029	69.808	2	1606.7661	1606.7661	R	V	49	64
PSM	DYGVLLEGSGLALR	1376	sp|P30048-2|PRDX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11589	66.947	2	1461.7827	1461.7827	R	G	153	167
PSM	ECICEVEGQVPCPSLVPLPK	1377	sp|P82663|RT25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:4,4-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=10621	60.914	2	2310.1058	2310.1058	R	E	138	158
PSM	EDGLAQQQTQLNLR	1378	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6044	34.798	2	1612.8169	1612.8169	K	S	2207	2221
PSM	EGAFSNFPISEETIK	1379	sp|Q9NR30-2|DDX21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9863	55.97	2	1667.8043	1667.8043	K	L	117	132
PSM	EGPAVVGQFIQDVK	1380	sp|Q86VP6|CAND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:188	ms_run[2]:scan=10559	60.521	2	1491.8029	1491.8029	K	N	813	827
PSM	ENNAVYAFLGLTAPPGSK	1381	sp|O75368|SH3L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=12872	75.292	2	1847.9418	1847.9418	R	E	87	105
PSM	ESFSLVQVQPGVDIIR	1382	sp|P46379-4|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11523	66.539	2	1785.9625	1785.9625	R	T	689	705
PSM	EYEIPSNLTPADVFFR	1383	sp|Q8WUM0|NU133_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=13356	78.503	2	1896.9258	1896.9258	R	E	676	692
PSM	FETFCLDPSLVTK	1384	sp|Q9UHB9-4|SRP68_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	5-UNIMOD:4	ms_run[2]:scan=11146	64.16	2	1555.7592	1555.7592	R	Q	520	533
PSM	FETFCLDPSLVTK	1385	sp|Q9UHB9-4|SRP68_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	5-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=11148	64.172	2	1561.7794	1561.7794	R	Q	520	533
PSM	FLDGNELTLADCNLLPK	1386	sp|O00299|CLIC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	12-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=12159	70.688	2	1937.9864	1937.9864	K	L	167	184
PSM	FLQEFYQDDELGK	1387	sp|P33993-2|MCM7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9612	54.631	2	1630.7515	1630.7515	K	K	16	29
PSM	FSVGGMTDVAEIK	1388	sp|P36776-3|LONM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9302	52.861	2	1352.6646	1352.6646	R	G	351	364
PSM	GFFDPNTEENLTYLQLK	1389	sp|P15924-2|DESP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	17-UNIMOD:188	ms_run[2]:scan=12440	72.511	2	2034.0042	2034.0042	K	E	1815	1832
PSM	GFSVVADTPELQR	1390	sp|Q14847-3|LASP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:267	ms_run[2]:scan=8042	45.709	2	1427.7284	1427.7284	K	I	41	54
PSM	GGGAFVQNSQPVAVR	1391	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=4837	28.581	2	1485.7688	1485.7688	R	G	942	957
PSM	GGGAFVQNSQPVAVR	1392	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	15-UNIMOD:267	ms_run[2]:scan=4844	28.627	2	1495.7771	1495.7771	R	G	942	957
PSM	GGMGSGGLATGIAGGLAGMGGIQNEK	1393	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:35,26-UNIMOD:188	ms_run[2]:scan=10303	58.864	3	2282.109	2282.1090	R	E	56	82
PSM	GGNIGDGGGAADR	1394	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=812	8.1773	2	1115.4956	1115.4956	R	V	587	600
PSM	GGNQTSGIDFFITQER	1395	sp|Q9H0W8-2|SMG9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10378	59.349	2	1768.838	1768.8380	R	I	249	265
PSM	GGNQTSGIDFFITQER	1396	sp|Q9H0W8-2|SMG9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	16-UNIMOD:267	ms_run[2]:scan=10382	59.378	2	1778.8463	1778.8463	R	I	249	265
PSM	GIDYDFPSLILQK	1397	sp|Q9BYG3|MK67I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=12668	73.995	2	1507.7922	1507.7922	K	T	180	193
PSM	GIGMNEPLVDCEGYPR	1398	sp|O00233-2|PSMD9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	11-UNIMOD:4	ms_run[2]:scan=8406	47.756	2	1805.8077	1805.8077	K	S	49	65
PSM	GISCMNTTLSESPFK	1399	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:4	ms_run[2]:scan=8825	50.034	2	1670.7644	1670.7644	K	C	239	254
PSM	GLGTDEDSLIEIICSR	1400	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=12881	75.351	2	1786.8646	1786.8646	K	T	120	136
PSM	GLVVDMDGFEEER	1401	sp|P49588|SYAC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9715	55.188	2	1494.6661	1494.6661	K	K	433	446
PSM	GPDALTLLEYTETR	1402	sp|Q96JB5-3|CK5P3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11881	68.801	2	1577.7937	1577.7937	R	N	112	126
PSM	GVLLDIDDLQTNQFK	1403	sp|Q13576-3|IQGA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	15-UNIMOD:188	ms_run[2]:scan=11694	67.61	2	1723.9088	1723.9088	K	N	986	1001
PSM	GVVDSEDLPLNISR	1404	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9130	51.885	2	1512.7784	1512.7784	R	E	387	401
PSM	IASLEVENQSLR	1405	sp|P29692|EF1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	12-UNIMOD:267	ms_run[2]:scan=6108	35.128	2	1367.7284	1367.7284	R	G	84	96
PSM	IAVEPVNPSELPK	1406	sp|Q15029-2|U5S1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7648	43.587	2	1391.766	1391.7660	K	M	555	568
PSM	IDCFSEVPTSVFGEK	1407	sp|O00567|NOP56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:4	ms_run[2]:scan=10528	60.316	2	1713.792	1713.7920	R	L	382	397
PSM	IESIQLMMDSETGR	1408	sp|Q14498-3|RBM39_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:267	ms_run[2]:scan=9725	55.242	2	1618.757	1618.7570	R	S	254	268
PSM	IFDEILVNAADNK	1409	sp|P11388|TOP2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9797	55.638	2	1460.7511	1460.7511	K	Q	84	97
PSM	IFTSIGEDYDER	1410	sp|P35232|PHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	12-UNIMOD:267	ms_run[2]:scan=7098	40.375	2	1453.6601	1453.6601	R	V	106	118
PSM	IILDLISESPIK	1411	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=12260	71.354	2	1339.7963	1339.7963	K	G	184	196
PSM	ILDQGEDFPASEMTR	1412	sp|P30040|ERP29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8009	45.511	2	1707.7774	1707.7774	K	I	209	224
PSM	ILQDVADEEIAALPR	1413	sp|O60783|RT14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10510	60.203	2	1651.8781	1651.8781	K	D	66	81
PSM	INEAIVAVQAIIADPK	1414	sp|Q9Y224|RTRAF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=12863	75.238	2	1663.9509	1663.9509	K	T	219	235
PSM	INMNGVNSSNGVVDPR	1415	sp|Q13404-6|UB2V1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	16-UNIMOD:267	ms_run[2]:scan=5462	31.852	2	1681.8081	1681.8081	K	A	44	60
PSM	ISAFGYLECSAK	1416	sp|P08134|RHOC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:4	ms_run[2]:scan=9129	51.881	2	1344.6384	1344.6384	R	T	151	163
PSM	ISAFGYLECSAK	1417	sp|P08134|RHOC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:4	ms_run[2]:scan=9139	51.939	2	1344.6384	1344.6384	R	T	151	163
PSM	ISAFGYLECSAK	1418	sp|P08134|RHOC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:4,12-UNIMOD:188	ms_run[2]:scan=9138	51.935	2	1350.6585	1350.6585	R	T	151	163
PSM	ISDLGLACDFSK	1419	sp|P35626|ARBK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	8-UNIMOD:4	ms_run[2]:scan=8705	49.389	2	1324.6333	1324.6333	R	K	333	345
PSM	ISFLENNLEQLTK	1420	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:188	ms_run[2]:scan=11604	67.043	2	1553.8397	1553.8397	K	V	832	845
PSM	ISTLPQLNSALVQDLAK	1421	sp|P14635-2|CCNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=12471	72.704	2	1810.02	1810.0200	K	A	375	392
PSM	ISTLPQLNSALVQDLAK	1422	sp|P14635-2|CCNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	17-UNIMOD:188	ms_run[2]:scan=12520	73.03	3	1816.0401	1816.0401	K	A	375	392
PSM	ITVNEVELLVMK	1423	sp|Q9UNM6|PSD13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	12-UNIMOD:188	ms_run[2]:scan=12776	74.694	2	1392.7994	1392.7994	K	A	302	314
PSM	IVDDWANDGWGLK	1424	sp|P27824-3|CALX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:188	ms_run[2]:scan=10520	60.267	2	1493.7246	1493.7246	R	K	338	351
PSM	IVNGWQVEEADDWLR	1425	sp|P11216|PYGB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	15-UNIMOD:267	ms_run[2]:scan=11909	68.992	2	1838.8827	1838.8827	K	Y	171	186
PSM	IVQLLGQNEVDYR	1426	sp|Q9BZX2|UCK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8422	47.848	2	1545.8151	1545.8151	K	Q	40	53
PSM	IVSLPECFNSPYGAK	1427	sp|Q9NQR4|NIT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:4	ms_run[2]:scan=9193	52.239	2	1680.8181	1680.8181	K	Y	38	53
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVK	1428	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	32-UNIMOD:188,36-UNIMOD:188	ms_run[2]:scan=6342	36.372	3	4129.4886	4129.4886	K	K	158	194
PSM	LAATNALLNSLEFTK	1429	sp|Q14974|IMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=12404	72.278	2	1604.8774	1604.8774	K	A	192	207
PSM	LAATNALLNSLEFTK	1430	sp|Q14974|IMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	15-UNIMOD:188	ms_run[2]:scan=12245	71.258	2	1610.8975	1610.8975	K	A	192	207
PSM	LCGDTSLNNMQR	1431	sp|O00410-2|IPO5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:4	ms_run[2]:scan=3847	23.428	2	1407.6235	1407.6235	K	Q	205	217
PSM	LEVAPISDIIAIK	1432	sp|P13804|ETFA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:188	ms_run[2]:scan=12287	71.526	2	1386.8429	1386.8429	K	S	127	140
PSM	LFQTNTELLELTTK	1433	sp|Q8NB49-2|AT11C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:188	ms_run[2]:scan=10974	63.083	2	1655.9077	1655.9077	R	T	693	707
PSM	LFQVQGTGANNTK	1434	sp|P09327|VILI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:188	ms_run[2]:scan=3951	23.968	2	1382.725	1382.7250	R	A	517	530
PSM	LFSDEAANIYER	1435	sp|Q12996|CSTF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	12-UNIMOD:267	ms_run[2]:scan=7739	44.099	2	1436.6811	1436.6811	K	A	319	331
PSM	LGAVPATSGPTTFK	1436	sp|Q96ME7-3|ZN512_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5696	33.005	2	1345.7242	1345.7242	R	Q	5	19
PSM	LGNDFMGITLASSQAVSNAR	1437	sp|Q9HC38|GLOD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11342	65.417	3	2051.0106	2051.0106	K	K	97	117
PSM	LGSESQYSPTPLLK	1438	sp|O75691|UTP20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:188	ms_run[2]:scan=7175	40.772	2	1524.8131	1524.8131	R	L	1191	1205
PSM	LGSIAIQGAIEK	1439	sp|P24752|THIL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6891	39.288	2	1198.6921	1198.6921	K	A	67	79
PSM	LGSIAIQGAIEK	1440	sp|P24752|THIL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	12-UNIMOD:188	ms_run[2]:scan=6892	39.292	2	1204.7123	1204.7123	K	A	67	79
PSM	LLDLGAGDGEVTK	1441	sp|Q9H1A3-2|METL9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:188	ms_run[2]:scan=6910	39.384	2	1292.6919	1292.6919	R	I	149	162
PSM	LLELQEVDSLLR	1442	sp|P16144-4|ITB4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=13050	76.522	2	1426.8031	1426.8031	K	G	1061	1073
PSM	LLELQEVDSLLR	1443	sp|P16144-4|ITB4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	12-UNIMOD:267	ms_run[2]:scan=13067	76.632	2	1436.8114	1436.8114	K	G	1061	1073
PSM	LLSGPSQESPQTLGK	1444	sp|Q9BWE0|REPI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	15-UNIMOD:188	ms_run[2]:scan=5004	29.57	2	1546.8298	1546.8298	R	E	19	34
PSM	LLVPANEGDPTETLR	1445	sp|O14763-2|TR10B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7694	43.85	2	1623.8468	1623.8468	R	Q	296	311
PSM	LMTDTINEPILLCR	1446	sp|O43776|SYNC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:4	ms_run[2]:scan=10336	59.079	2	1687.8637	1687.8637	R	F	426	440
PSM	LNECPLDPGGYFIVK	1447	sp|Q9NW08-2|RPC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=11385	65.69	2	1726.8696	1726.8696	K	G	100	115
PSM	LQGETLDQQLGR	1448	sp|O15118-2|NPC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	12-UNIMOD:267	ms_run[2]:scan=5322	31.171	2	1366.708	1366.7080	R	V	397	409
PSM	LSDLLAPISEQIK	1449	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10798	62.001	2	1425.8079	1425.8079	K	E	100	113
PSM	LSLAQEDLISNR	1450	sp|Q15075|EEA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7770	44.251	2	1357.7201	1357.7201	K	N	1056	1068
PSM	LTFDTTFSPNTGK	1451	sp|P45880|VDAC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:188	ms_run[2]:scan=8238	46.845	2	1433.7134	1433.7134	K	K	108	121
PSM	LVPGGGATEIELAK	1452	sp|P50990|TCPQ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:188	ms_run[2]:scan=6699	38.263	2	1359.7705	1359.7705	R	Q	408	422
PSM	LVSDIIDPVALEIPLSK	1453	sp|Q5UIP0-2|RIF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	17-UNIMOD:188	ms_run[2]:scan=13613	80.182	2	1827.07	1827.0700	R	N	2373	2390
PSM	MCDLVSDFDGFSER	1454	sp|P30520|PURA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:4	ms_run[2]:scan=11421	65.912	2	1676.6811	1676.6811	R	F	181	195
PSM	MNVGTAHSEVNPNTR	1455	sp|Q8N138-4|ORML3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:1,15-UNIMOD:267	ms_run[2]:scan=4639	27.46	2	1677.7768	1677.7768	-	V	1	16
PSM	MTDQEAIQDLWQWR	1456	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:35,14-UNIMOD:267	ms_run[2]:scan=12624	73.708	2	1844.8391	1844.8391	R	K	278	292
PSM	NAMGSLASQATK	1457	sp|P55036|PSMD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=4068	24.56	2	1177.5761	1177.5761	R	D	354	366
PSM	NDGAAILAAVSSIAQK	1458	sp|P28331-3|NDUS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=12438	72.494	2	1527.8257	1527.8257	R	I	373	389
PSM	NELSGALTGLTR	1459	sp|P26639|SYTC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8654	49.125	2	1230.6568	1230.6568	R	V	443	455
PSM	NILEESLCELVAK	1460	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	8-UNIMOD:4	ms_run[2]:scan=13452	79.12	2	1516.7807	1516.7807	K	Q	2335	2348
PSM	NINDAWVCTNDMFR	1461	sp|P61970|NTF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	8-UNIMOD:4	ms_run[2]:scan=10912	62.7	2	1754.7505	1754.7505	K	L	107	121
PSM	NINSINFDNPVYQK	1462	sp|P01130-2|LDLR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:188	ms_run[2]:scan=8402	47.738	2	1670.836	1670.8360	K	T	639	653
PSM	NLANTVTEEILEK	1463	sp|O60506-4|HNRPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11091	63.812	2	1472.7722	1472.7722	R	A	309	322
PSM	NLANTVTEEILEK	1464	sp|O60506-4|HNRPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11258	64.884	2	1472.7722	1472.7722	R	A	309	322
PSM	NLATTVTEEILEK	1465	sp|O43390-3|HNRPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:188	ms_run[2]:scan=12417	72.364	2	1465.7971	1465.7971	R	S	309	322
PSM	NLDCPELISEFMK	1466	sp|P45973|CBX5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=12588	73.472	2	1600.7572	1600.7572	K	K	56	69
PSM	NLDLDSIIAEVK	1467	sp|P13647|K2C5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	12-UNIMOD:188	ms_run[2]:scan=12856	75.197	2	1334.7389	1334.7389	R	A	332	344
PSM	NLENGALQPSDLDR	1468	sp|Q9Y6E0-2|STK24_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:267	ms_run[2]:scan=6721	38.375	2	1550.7564	1550.7564	K	N	336	350
PSM	NLPPEEQMISALPDIK	1469	sp|O15355|PPM1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	16-UNIMOD:188	ms_run[2]:scan=11554	66.729	2	1799.9435	1799.9435	K	V	410	426
PSM	NNSGEEFDCAFR	1470	sp|Q08J23-3|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:4	ms_run[2]:scan=6194	35.568	2	1444.5677	1444.5677	R	L	355	367
PSM	NVFIAQNVASLQELGGSEK	1471	sp|Q5T4S7-3|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	19-UNIMOD:188	ms_run[2]:scan=10856	62.365	2	2009.0525	2009.0525	K	L	237	256
PSM	NYLLPAGYSLEEQR	1472	sp|Q12888|TP53B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:267	ms_run[2]:scan=9540	54.219	2	1661.8289	1661.8289	R	I	1845	1859
PSM	QAQEYEALLNIK	1473	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	12-UNIMOD:188	ms_run[2]:scan=9587	54.495	2	1424.7607	1424.7607	R	V	359	371
PSM	QCSELGICAVSVGPK	1474	sp|Q00653-3|NFKB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:4,8-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=7515	42.81	2	1609.7899	1609.7899	K	D	113	128
PSM	QGQGQLVTCSGAFK	1475	sp|Q16531|DDB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=5161	30.379	2	1485.7341	1485.7341	R	E	370	384
PSM	QLLTLSSELSQAR	1476	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9286	52.768	2	1444.7886	1444.7886	R	D	530	543
PSM	QSSFALLGDLTK	1477	sp|Q92973-2|TNPO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	12-UNIMOD:188	ms_run[2]:scan=11356	65.508	2	1284.7021	1284.7021	R	A	685	697
PSM	QVCEIIESPLFLK	1478	sp|Q7L5N1|CSN6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:4	ms_run[2]:scan=11793	68.211	2	1574.8378	1574.8378	K	L	141	154
PSM	QVCEIIESPLFLK	1479	sp|Q7L5N1|CSN6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=11794	68.217	2	1580.8579	1580.8579	K	L	141	154
PSM	QVEVINFGDCLVR	1480	sp|P46060|RAGP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	10-UNIMOD:4	ms_run[2]:scan=10586	60.691	2	1547.7766	1547.7766	R	S	265	278
PSM	SGLGELILPENEPGSSIMPGK	1481	sp|P07954-2|FUMH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	18-UNIMOD:35	ms_run[2]:scan=10529	60.322	2	2140.0722	2140.0722	R	V	308	329
PSM	SILEDPPSISEGCGGR	1482	sp|Q9NVM9-2|INT13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:4	ms_run[2]:scan=7261	41.298	2	1672.7726	1672.7726	R	V	293	309
PSM	SNLAYDIVQLPTGLTGIK	1483	sp|P34932|HSP74_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=13332	78.35	2	1902.0462	1902.0462	K	V	85	103
PSM	SNMDNMFESYINNLR	1484	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:35,15-UNIMOD:267	ms_run[2]:scan=11495	66.367	2	1872.801	1872.8010	R	R	134	149
PSM	SNMDNMFESYINNLR	1485	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:35,6-UNIMOD:35	ms_run[2]:scan=10337	59.085	2	1878.7876	1878.7876	R	R	134	149
PSM	SPDFTNENPLETR	1486	sp|P05023-3|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:267	ms_run[2]:scan=7232	41.116	2	1528.7033	1528.7033	R	N	197	210
PSM	SPDLLMYQGPPDTAEIIK	1487	sp|P82909|RT36_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	18-UNIMOD:188	ms_run[2]:scan=11217	64.619	2	1993.0174	1993.0174	K	T	61	79
PSM	SQFEELCAELLQK	1488	sp|Q92598-2|HS105_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:4	ms_run[2]:scan=11303	65.17	2	1593.7709	1593.7709	R	I	304	317
PSM	SSAQDPQAVLGALGR	1489	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	15-UNIMOD:267	ms_run[2]:scan=8720	49.464	2	1478.7717	1478.7717	R	A	123	138
PSM	SSVAVLTQESFAEHR	1490	sp|Q00341|VIGLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:1,15-UNIMOD:267	ms_run[2]:scan=9579	54.447	2	1711.8405	1711.8405	M	S	2	17
PSM	STAEGEAFIQALPGSGTTPLLR	1491	sp|O60437|PEPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	22-UNIMOD:267	ms_run[2]:scan=12072	70.095	2	2225.1567	2225.1567	R	T	566	588
PSM	TAAANAAAGAAENAFRAP	1492	sp|O14828-2|SCAM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7892	44.902	2	1643.8016	1643.8016	R	-	304	322
PSM	TALINSTGEEVAMR	1493	sp|P02545-2|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6485	37.165	2	1490.7399	1490.7399	R	K	528	542
PSM	TDTAEAVPKFEEMFASR	1494	sp|Q9BTL3|RAMAC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:1	ms_run[2]:scan=12383	72.147	2	1969.9091	1969.9091	M	F	2	19
PSM	TFAPEEISAMVLTK	1495	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11873	68.744	2	1535.7905	1535.7905	K	M	139	153
PSM	TGAVGDLVIIGDR	1496	sp|Q5JTZ9|SYAM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9114	51.787	2	1284.7038	1284.7038	R	Q	757	770
PSM	TIAECLADELINAAK	1497	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	5-UNIMOD:4	ms_run[2]:scan=13929	82.558	2	1630.8236	1630.8236	K	G	168	183
PSM	TIAECLADELINAAK	1498	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	5-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=13939	82.627	3	1636.8438	1636.8438	K	G	168	183
PSM	TLFQPQTGAYQTLAK	1499	sp|P53992|SC24C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8372	47.561	2	1665.8726	1665.8726	K	E	671	686
PSM	TLNDELEIIEGMK	1500	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11952	69.288	2	1503.7491	1503.7491	K	F	206	219
PSM	TLTLVDTGIGMTK	1501	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8904	50.489	2	1348.7272	1348.7272	R	A	83	96
PSM	TMGFCYQILTEPNADPR	1502	sp|O95373|IPO7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:35,5-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=9593	54.524	2	2037.9164	2037.9164	K	K	411	428
PSM	TNLVWDEVSGQWR	1503	sp|Q15050|RRS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11053	63.576	2	1588.7634	1588.7634	K	R	129	142
PSM	TNLVWDEVSGQWR	1504	sp|Q15050|RRS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:267	ms_run[2]:scan=11052	63.57	2	1598.7717	1598.7717	K	R	129	142
PSM	TPGSLGSSASAGQAAASAPLPLESGELSR	1505	sp|Q9BZE9-4|ASPC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9180	52.164	3	2668.3304	2668.3304	K	G	104	133
PSM	TSMNVNEIFMAIAK	1506	sp|P20339-2|RAB5A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=13537	79.68	2	1567.7738	1567.7738	K	K	152	166
PSM	TYQELLVNQNPIAQPLASR	1507	sp|Q9NX24|NHP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	19-UNIMOD:267	ms_run[2]:scan=10221	58.277	3	2164.1516	2164.1516	R	R	23	42
PSM	VAAALPGMESTQDR	1508	sp|P20340-3|RAB6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5564	32.359	2	1444.698	1444.6980	R	S	66	80
PSM	VACPQCNAEYLIVFPK	1509	sp|Q9NX47|MARH5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:4,6-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=11005	63.278	2	1913.9475	1913.9475	R	L	63	79
PSM	VAGSVTELIQAAEAMK	1510	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	16-UNIMOD:188	ms_run[2]:scan=13182	77.386	2	1622.8645	1622.8645	R	G	2276	2292
PSM	VDFPQDQLTALTGR	1511	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:267	ms_run[2]:scan=10542	60.409	2	1569.8026	1569.8026	K	I	216	230
PSM	VDNIQAGELTEGIWR	1512	sp|Q08945|SSRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	15-UNIMOD:267	ms_run[2]:scan=10634	60.994	2	1709.8612	1709.8612	K	R	40	55
PSM	VEQLFQVMNGILAQDSACSQR	1513	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	18-UNIMOD:4,21-UNIMOD:267	ms_run[2]:scan=13923	82.516	2	2403.155	2403.1550	R	A	3764	3785
PSM	VGDPQELNGITR	1514	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	12-UNIMOD:267	ms_run[2]:scan=5060	29.858	2	1307.6709	1307.6709	K	A	299	311
PSM	VGSGDTNNFPYLEK	1515	sp|Q9NR45|SIAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:188	ms_run[2]:scan=7378	42.02	2	1545.7407	1545.7407	K	T	132	146
PSM	VGTSFSIPVVSDVR	1516	sp|Q92979|NEP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10067	57.194	2	1461.7827	1461.7827	K	E	174	188
PSM	VIDPATATSVDLR	1517	sp|P50991-2|TCPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:267	ms_run[2]:scan=7006	39.904	2	1366.7332	1366.7332	K	D	164	177
PSM	VIGAGEFGEVYK	1518	sp|P29317|EPHA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7767	44.239	2	1267.6449	1267.6449	K	G	618	630
PSM	VIGAGEFGEVYK	1519	sp|P29317|EPHA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	12-UNIMOD:188	ms_run[2]:scan=7765	44.23	2	1273.665	1273.6650	K	G	618	630
PSM	VLGFSEPTVVTAALNCVGK	1520	sp|O43395|PRPF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	16-UNIMOD:4	ms_run[2]:scan=13027	76.37	2	1961.0292	1961.0292	R	G	22	41
PSM	VLGIQVDTDGSGR	1521	sp|P33992|MCM5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6554	37.541	2	1315.6732	1315.6732	R	S	296	309
PSM	VLGQLTETGVVSPEQFMK	1522	sp|Q96EK6|GNA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	18-UNIMOD:188	ms_run[2]:scan=11232	64.718	2	1968.0333	1968.0333	K	S	56	74
PSM	VLNYAPGPLDTDMQQLAR	1523	sp|P35270|SPRE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:35	ms_run[2]:scan=8213	46.72	2	2016.9939	2016.9939	R	E	193	211
PSM	VMTIPYQPMPASSPVICAGGQDR	1524	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:35,17-UNIMOD:4	ms_run[2]:scan=8997	51.05	2	2490.1705	2490.1705	R	C	178	201
PSM	VMTIPYQPMPASSPVICAGGQDR	1525	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:35,17-UNIMOD:4,23-UNIMOD:267	ms_run[2]:scan=9010	51.135	3	2500.1788	2500.1788	R	C	178	201
PSM	VPAINVNDSVTK	1526	sp|P23526-2|SAHH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5183	30.482	2	1255.6772	1255.6772	K	S	147	159
PSM	VPTANVSVVDLTCR	1527	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=8073	45.885	2	1539.7954	1539.7954	R	L	193	207
PSM	VQPVIGENGGDAR	1528	sp|P22059|OSBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:267	ms_run[2]:scan=2590	17.07	2	1320.6661	1320.6661	K	Q	655	668
PSM	VSWLGEEPVAGVWSEK	1529	sp|Q9BQ67|GRWD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11671	67.465	2	1771.8781	1771.8781	R	G	157	173
PSM	VTWDSTFCAVNPK	1530	sp|Q9BR76|COR1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	8-UNIMOD:4	ms_run[2]:scan=8701	49.371	2	1523.7079	1523.7079	R	F	34	47
PSM	VVLAYEPVWAIGTGK	1531	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11916	69.037	2	1601.8817	1601.8817	K	T	198	213
PSM	VVLAYEPVWAIGTGK	1532	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11766	68.049	3	1601.8817	1601.8817	K	T	198	213
PSM	VVSGMVNCNDDQGVLLGR	1533	sp|P21980|TGM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	8-UNIMOD:4,18-UNIMOD:267	ms_run[2]:scan=7909	44.993	2	1941.9276	1941.9276	R	W	223	241
PSM	VWDDGIIDPADTR	1534	sp|Q9HCC0-2|MCCB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8757	49.647	2	1471.6943	1471.6943	R	L	488	501
PSM	VYVGNLGTGAGK	1535	sp|Q16629-3|SRSF7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	12-UNIMOD:188	ms_run[2]:scan=4024	24.332	2	1140.6235	1140.6235	K	G	13	25
PSM	YLIGSGDNPTIVQEGCR	1536	sp|Q86XL3-2|ANKL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	16-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=7668	43.694	2	1887.9024	1887.9024	R	Y	335	352
PSM	YTQGGLENLELSR	1537	sp|Q15006|EMC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7595	43.287	2	1478.7365	1478.7365	K	K	200	213
PSM	LEGLTDEINFLR	1538	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	12-UNIMOD:267	ms_run[1]:scan=12275	71.45154166666666	2	1429.731772	1428.748814	R	Q	214	226
PSM	CEFQDAYVLLSEK	1539	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	1-UNIMOD:4,13-UNIMOD:188	ms_run[1]:scan=10896	62.602435	2	1607.770334	1606.764439	K	K	237	250
PSM	QAVTNPNNTFYATKR	1540	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:28,14-UNIMOD:188,15-UNIMOD:267	ms_run[1]:scan=5427	31.675906666666666	2	1722.8641	1722.8655	R	L	108	123
PSM	QATKDAGTIAGLNVMR	1541	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:28,4-UNIMOD:188,16-UNIMOD:267	ms_run[1]:scan=8466	48.092953333333334	2	1643.8649	1643.8631	R	I	182	198
PSM	QATKDAGTIAGLNVMR	1542	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:28	ms_run[1]:scan=8460	48.05819	2	1627.8367	1627.8347	R	I	182	198
PSM	VLATAFDTTLGGR	1543	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=8484	48.19242	2	1320.700046	1320.703765	K	K	222	235
PSM	QEYDESGPSIVHR	1544	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:28,13-UNIMOD:267	ms_run[1]:scan=5242	30.785631666666664	2	1508.6780	1508.6766	K	K	360	373
PSM	TLTIVDTGIGMTK	1545	sp|Q58FG1|HS904_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	13-UNIMOD:188	ms_run[1]:scan=9273	52.69418	2	1354.746515	1354.747332	R	A	28	41
PSM	QLKLDPSIFESLQK	1546	sp|Q9Y265|RUVB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:28	ms_run[1]:scan=12851	75.16415166666667	2	1627.8852	1627.8816	K	E	169	183
PSM	QVVQGLLSETYLEAHR	1547	sp|P33993|MCM7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:28,16-UNIMOD:267	ms_run[1]:scan=12443	72.52865	2	1834.9439	1834.9448	R	I	287	303
PSM	ADFPAGIPECGTDALR	1548	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	10-UNIMOD:4	ms_run[1]:scan=8697	49.34752666666667	2	1689.788908	1688.782821	K	F	908	924
PSM	SLGGNDELSATFLEMK	1549	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	16-UNIMOD:188	ms_run[1]:scan=11420	65.90611666666666	2	1717.846273	1716.833581	K	G	271	287
PSM	SALENMLSETQSR	1550	sp|Q9C075|K1C23_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	13-UNIMOD:267	ms_run[1]:scan=8529	48.43649166666667	2	1474.697907	1474.696126	K	Y	309	322
PSM	QAVSMFLGAVEEAKK	1551	sp|P49419|AL7A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:28	ms_run[1]:scan=13058	76.57375166666667	2	1589.8110	1589.8118	K	E	376	391
PSM	QSEQQRETLAQLQQEFQR	1552	sp|O15212|PFD6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:28	ms_run[1]:scan=10668	61.209981666666664	2	2229.0837	2229.0769	R	A	100	118
PSM	VSALDLAVLDQVEAR	1553	sp|Q13561|DCTN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	15-UNIMOD:267	ms_run[1]:scan=11844	68.54459666666666	2	1608.871697	1607.875805	K	L	268	283
PSM	QYDAGRDGFIDLMELK	1554	sp|Q96C19|EFHD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:28	ms_run[1]:scan=13341	78.40930999999999	2	1852.8658	1852.8660	K	L	103	119
PSM	VLLESEQFLTELTR	1555	sp|P37108|SRP14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	14-UNIMOD:267	ms_run[1]:scan=13209	77.55799	2	1686.9063	1686.9062	M	L	2	16
PSM	ILDQGEDFPASEMTR	1556	sp|P30040|ERP29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	15-UNIMOD:267	ms_run[1]:scan=7948	45.181825	2	1717.789906	1717.785670	K	I	209	224
PSM	QFEDEKANWEAQQR	1557	sp|Q16181|SEPT7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:28,6-UNIMOD:188,14-UNIMOD:267	ms_run[1]:scan=6771	38.65160833333333	2	1776.8041	1776.8033	R	I	403	417
PSM	QSIAIDDCTFHQCVR	1558	sp|Q96CW1|AP2M1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:28,8-UNIMOD:4,13-UNIMOD:4	ms_run[1]:scan=8021	45.58130833333333	2	1831.8012	1831.7976	K	L	239	254
PSM	QSYKGSPMEISLPIALSK	1559	sp|P09960|LKHA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:28,4-UNIMOD:188,18-UNIMOD:188	ms_run[1]:scan=12118	70.411465	2	1943.0542	1943.0471	R	N	80	98
PSM	VGSGDTNNFPYLEK	1560	sp|Q9NR45|SIAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	14-UNIMOD:188	ms_run[1]:scan=7556	43.056785	2	1545.733538	1545.740667	K	T	132	146
PSM	VPSENVLGEVGSGFK	1561	sp|P49748|ACADV_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	15-UNIMOD:188	ms_run[1]:scan=9443	53.66082166666667	2	1524.793814	1523.792702	R	V	317	332
PSM	MSGGWELELNGTEAK	1562	sp|Q07021|C1QBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	1-UNIMOD:35,15-UNIMOD:188	ms_run[1]:scan=8466	48.092953333333334	2	1642.763960	1642.760416	K	L	105	120
PSM	CTDFDDISLLHAK	1563	sp|P20585|MSH3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=11308	65.19960833333333	2	1516.6900	1516.6863	K	N	166	179
PSM	CTDFDDISLLHAK	1564	sp|P20585|MSH3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:385,1-UNIMOD:4,13-UNIMOD:188	ms_run[1]:scan=11313	65.23184166666667	2	1522.7139	1522.7064	K	N	166	179
PSM	VDFEQLTENLGQLER	1565	sp|Q9Y613|FHOD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=12769	74.64744666666667	2	1790.888821	1789.884643	K	R	890	905
PSM	GPDALTLLEYTETR	1566	sp|Q96JB5|CK5P3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	14-UNIMOD:267	ms_run[1]:scan=11922	69.07573166666667	2	1587.815742	1587.801972	R	N	337	351
PSM	ALQSTAVEQIGMFLGK	1567	sp|Q8NI60|COQ8A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0		ms_run[1]:scan=12811	74.92210833333334	2	1693.8962	1691.8912	R	V	42	58
PSM	IDSILEVVQTGR	1568	sp|Q9NZW5|MPP6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=10135	57.68025333333333	2	1329.725248	1328.729980	K	T	419	431
PSM	MLNGLEDSIGLSK	1569	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=9191	52.23074166666667	2	1377.699048	1375.701716	K	M	1164	1177
PSM	AASCVLLHTGQK	1570	sp|P14550|AK1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:1,4-UNIMOD:4,12-UNIMOD:188	ms_run[2]:scan=6177	35.483	2	1331.6963	1331.6963	M	M	2	14
PSM	AFLEENNLDYIIR	1571	sp|P53041|PPP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:267	ms_run[2]:scan=11530	66.582	2	1618.823	1618.8230	K	S	413	426
PSM	AFLEENNLDYIIR	1572	sp|P53041|PPP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=11532	66.594	2	1608.8148	1608.8148	K	S	413	426
PSM	AGPGTLSVTIEGPSK	1573	sp|O75369-6|FLNB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	15-UNIMOD:188	ms_run[2]:scan=6637	37.958	2	1418.7712	1418.7712	R	V	2347	2362
PSM	AIDENNEPTACFLIR	1574	sp|Q9P2R3|ANFY1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:4	ms_run[2]:scan=9259	52.606	2	1761.8356	1761.8356	R	S	732	747
PSM	AIDNAADLLIFGK	1575	sp|Q9Y5X2|SNX8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:188	ms_run[2]:scan=12178	70.814	2	1365.7599	1365.7599	R	E	246	259
PSM	AILVDLEPGTMDSVR	1576	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	15-UNIMOD:267	ms_run[2]:scan=10471	59.956	2	1624.837	1624.8370	R	S	63	78
PSM	AINQGGLTSVAVR	1577	sp|P60900-2|PSA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:267	ms_run[2]:scan=5503	32.07	2	1294.7233	1294.7233	K	G	12	25
PSM	AINQGGLTSVAVR	1578	sp|P60900-2|PSA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5505	32.078	2	1284.715	1284.7150	K	G	12	25
PSM	ALCDVGTAISCSR	1579	sp|Q9BQB6-3|VKOR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=5751	33.278	2	1408.6439	1408.6439	R	V	41	54
PSM	ALCIDQLDVFLQK	1580	sp|Q5T8P6-6|RBM26_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:4	ms_run[2]:scan=13241	77.76	2	1561.8174	1561.8174	K	E	51	64
PSM	ALDQASEEIWNDFR	1581	sp|P50579|MAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:267	ms_run[2]:scan=11935	69.176	2	1702.7826	1702.7826	K	E	157	171
PSM	ALPAVQQNNLDEDLIR	1582	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9223	52.395	3	1807.9428	1807.9428	R	K	329	345
PSM	ALQPDWFQCLSDGEVSCK	1583	sp|Q9H974-2|QTRT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	9-UNIMOD:4,17-UNIMOD:4,18-UNIMOD:188	ms_run[2]:scan=11867	68.701	2	2144.9603	2144.9603	K	E	12	30
PSM	ALTVPELTQQVFDAK	1584	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=12220	71.101	3	1658.8879	1658.8879	R	N	283	298
PSM	AMDSDWFAENYMGR	1585	sp|P55084-2|ECHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:267	ms_run[2]:scan=11008	63.295	2	1701.6791	1701.6791	K	K	370	384
PSM	ANFLNSNDVFVLK	1586	sp|P09327|VILI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:188	ms_run[2]:scan=11574	66.85	2	1485.7923	1485.7923	R	T	537	550
PSM	ANLPQSFQVDTSK	1587	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:188	ms_run[2]:scan=6356	36.447	2	1439.7352	1439.7352	R	A	1465	1478
PSM	APNYSCVMTGSWDK	1588	sp|P78406|RAE1L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=8246	46.885	2	1620.7008	1620.7008	K	T	138	152
PSM	APPPSLTDCIGTVDSR	1589	sp|Q9NZZ3-2|CHMP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	9-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=7360	41.916	2	1694.8173	1694.8173	K	A	12	28
PSM	ASNTAEVFFDGVR	1590	sp|P49748-2|ACADV_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9212	52.34	2	1411.6732	1411.6732	K	V	282	295
PSM	ATSELILLPVTGLECVGDR	1591	sp|Q9NNW5|WDR6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	15-UNIMOD:4,19-UNIMOD:267	ms_run[2]:scan=13523	79.586	2	2052.0801	2052.0801	R	L	12	31
PSM	AVIFEDCAVPVANR	1592	sp|Q9UKU7-2|ACAD8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	7-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=8219	46.749	2	1569.7849	1569.7849	R	I	118	132
PSM	AVSDWLIASVEGR	1593	sp|Q969V3-2|NCLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:267	ms_run[2]:scan=12534	73.122	2	1411.7335	1411.7335	K	L	195	208
PSM	CLMDQATDPNILGR	1594	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:4	ms_run[2]:scan=8555	48.59	2	1602.7494	1602.7494	K	T	4106	4120
PSM	CQVFEETQIGGER	1595	sp|Q99832-3|TCPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=5969	34.387	2	1561.707	1561.7070	R	Y	301	314
PSM	DAGTIAGLNVLR	1596	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9351	53.13	2	1198.667	1198.6670	K	I	160	172
PSM	DAGTIAGLNVLR	1597	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:267	ms_run[2]:scan=9353	53.145	2	1208.6753	1208.6753	K	I	160	172
PSM	DASVPLIDVTNLPTPR	1598	sp|Q96A65-2|EXOC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=11280	65.023	2	1706.9203	1706.9203	K	K	224	240
PSM	DDGLFSGDPNWFPK	1599	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=12579	73.414	2	1593.71	1593.7100	R	K	140	154
PSM	DIILQSNPLLEAFGNAK	1600	sp|Q12965|MYO1E_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	17-UNIMOD:188	ms_run[2]:scan=13952	82.712	2	1848.0088	1848.0088	K	T	144	161
PSM	DNPNLLFNMCGFECR	1601	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	10-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=12194	70.921	2	1885.791	1885.7910	K	I	1181	1196
PSM	EGPVLATSSGAGVFK	1602	sp|Q9H4A3-2|WNK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	15-UNIMOD:188	ms_run[2]:scan=7210	40.985	2	1424.7607	1424.7607	K	M	1595	1610
PSM	ESADPLGAWLQDAR	1603	sp|Q15149-7|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=11925	69.098	2	1527.7318	1527.7318	R	R	1182	1196
PSM	ETLAQLQQEFQR	1604	sp|O15212|PFD6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:267	ms_run[2]:scan=9695	55.075	2	1499.7608	1499.7608	R	A	106	118
PSM	EVQGNESDLFMSYFPR	1605	sp|P40121-2|CAPG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	16-UNIMOD:267	ms_run[2]:scan=12645	73.843	2	1927.865	1927.8650	R	G	97	113
PSM	EYGGLDVLVNNAGIAFK	1606	sp|P16152-2|CBR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	17-UNIMOD:188	ms_run[2]:scan=12796	74.823	2	1784.9404	1784.9404	K	V	80	97
PSM	FISVGYVDDTQFVR	1607	sp|P01893|HLAH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:267	ms_run[2]:scan=10422	59.637	2	1654.823	1654.8230	R	F	46	60
PSM	FLSQESGVAQTLK	1608	sp|Q8N392-2|RHG18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6327	36.286	2	1406.7405	1406.7405	R	K	563	576
PSM	GAGTNEDALIEILTTR	1609	sp|P12429|ANXA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=13073	76.666	2	1672.8632	1672.8632	K	T	105	121
PSM	GDADQASNILASFGLSAR	1610	sp|P43243|MATR3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	18-UNIMOD:267	ms_run[2]:scan=12931	75.712	2	1801.8834	1801.8834	R	D	103	121
PSM	GDGPVQGIINFEQK	1611	sp|P00441|SODC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:188	ms_run[2]:scan=9358	53.17	2	1506.7774	1506.7774	K	E	11	25
PSM	GFGFVCFSSPEEATK	1612	sp|Q13310-3|PABP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:4	ms_run[2]:scan=10467	59.928	2	1661.7396	1661.7396	K	A	334	349
PSM	GFSEGLWEIENNPTVK	1613	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=10783	61.916	2	1818.8788	1818.8788	K	A	81	97
PSM	GIGMNEPLVDCEGYPR	1614	sp|O00233-2|PSMD9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=8412	47.793	2	1815.8159	1815.8159	K	S	49	65
PSM	GLPLVDDGGWNTVPISK	1615	sp|Q04637-6|IF4G1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	17-UNIMOD:188	ms_run[2]:scan=11193	64.464	2	1772.9404	1772.9404	R	G	847	864
PSM	GPVGTVSEAQLAR	1616	sp|Q9NZM1-2|MYOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=4954	29.309	2	1283.6834	1283.6834	K	R	126	139
PSM	GTDVNVFNTILTTR	1617	sp|P04083|ANXA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:267	ms_run[2]:scan=11785	68.162	2	1559.8183	1559.8183	K	S	215	229
PSM	GVEGLIDIENPNR	1618	sp|Q13442|HAP28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:267	ms_run[2]:scan=8792	49.838	2	1434.7342	1434.7342	K	V	76	89
PSM	GYPPEDIFNLVGK	1619	sp|Q9NR45|SIAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:188	ms_run[2]:scan=12310	71.675	2	1453.7549	1453.7549	K	K	321	334
PSM	IALTDNALIAR	1620	sp|P18124|RL7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:267	ms_run[2]:scan=7961	45.256	2	1179.6851	1179.6851	R	S	167	178
PSM	IALTDNALIAR	1621	sp|P18124|RL7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7979	45.352	2	1169.6768	1169.6768	R	S	167	178
PSM	IASLEVENQSLR	1622	sp|P29692|EF1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6115	35.161	2	1357.7201	1357.7201	R	G	84	96
PSM	IDMVPELLSSNLCSLK	1623	sp|Q9Y2L1-2|RRP44_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:4	ms_run[2]:scan=13245	77.788	2	1817.9267	1817.9267	R	C	507	523
PSM	IFVGGLSPDTPEEK	1624	sp|Q14103-4|HNRPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7351	41.867	2	1487.7508	1487.7508	K	I	165	179
PSM	IFVGGLSPDTPEEK	1625	sp|Q14103-4|HNRPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:188	ms_run[2]:scan=7352	41.871	2	1493.7709	1493.7709	K	I	165	179
PSM	IGYECLCPDGFQLVAQR	1626	sp|P01130-2|LDLR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	5-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=11136	64.099	2	2024.9448	2024.9448	K	R	207	224
PSM	IILDLISESPIK	1627	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:188	ms_run[2]:scan=12261	71.359	2	1345.8164	1345.8164	K	G	184	196
PSM	ILDNTSEPQPGEAR	1628	sp|P50416-2|CPT1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=3184	20.122	2	1525.7372	1525.7372	R	L	366	380
PSM	ILTFDQLALDSPK	1629	sp|Q07020-2|RL18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=11153	64.205	2	1459.7922	1459.7922	K	G	91	104
PSM	ILTFDQLALDSPK	1630	sp|Q07020-2|RL18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=11319	65.272	2	1459.7922	1459.7922	K	G	91	104
PSM	IPVEGEVPEAR	1631	sp|O60294|TYW4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:267	ms_run[2]:scan=4661	27.575	2	1204.6327	1204.6327	R	H	524	535
PSM	ISEIEDAAFLAR	1632	sp|O94905|ERLN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:267	ms_run[2]:scan=9203	52.291	2	1343.696	1343.6960	K	E	242	254
PSM	ISLLPNDEDSLPPLLVASGEK	1633	sp|Q7Z3T8|ZFY16_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=13236	77.73	2	2206.1733	2206.1733	K	G	1012	1033
PSM	ISVYYNEATGGK	1634	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:188	ms_run[2]:scan=4971	29.4	2	1306.6501	1306.6501	R	Y	47	59
PSM	ISVYYNEATGGK	1635	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=4979	29.444	2	1300.6299	1300.6299	R	Y	47	59
PSM	ITAEEMYDIFGK	1636	sp|Q9Y3B4|SF3B6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=11736	67.866	2	1415.6643	1415.6643	K	Y	30	42
PSM	IYPEEITPLLPAISGEK	1637	sp|Q2PPJ7-3|RGPA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=12367	72.042	2	1869.0135	1869.0135	K	I	186	203
PSM	LAALNPESNTAGLDIFAK	1638	sp|O00299|CLIC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	18-UNIMOD:188	ms_run[2]:scan=11389	65.714	3	1849.9881	1849.9881	K	F	96	114
PSM	LAALPENPPAIDWAYYK	1639	sp|O75947-2|ATP5H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	17-UNIMOD:188	ms_run[2]:scan=11650	67.331	2	1937.003	1937.0030	R	A	42	59
PSM	LAALPNVYEVISK	1640	sp|P33992|MCM5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=11428	65.955	2	1415.8024	1415.8024	R	S	325	338
PSM	LADGGATNQGR	1641	sp|Q08380|LG3BP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=676	7.4571	2	1058.5105	1058.5105	R	V	26	37
PSM	LADPVTPVETILQR	1642	sp|Q9NVN8|GNL3L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:267	ms_run[2]:scan=10941	62.877	2	1560.8751	1560.8751	K	C	328	342
PSM	LAGTQPLEVLEAVQR	1643	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	15-UNIMOD:267	ms_run[2]:scan=11170	64.312	2	1632.9074	1632.9074	R	S	639	654
PSM	LAGTQPLEVLEAVQR	1644	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	15-UNIMOD:267	ms_run[2]:scan=11328	65.33	2	1632.9074	1632.9074	R	S	639	654
PSM	LANQAADYFGDAFK	1645	sp|Q8WUM4-2|PDC6I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9813	55.72	2	1529.7151	1529.7151	K	Q	216	230
PSM	LAPDYDALDVANKIGII	1646	sp|P62750|RL23A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=13353	78.485	2	1799.9669	1799.9669	R	-	140	157
PSM	LCCPATAPQEAPAPEGR	1647	sp|Q96B54|ZN428_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:4,3-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=3899	23.701	2	1833.8377	1833.8377	R	A	113	130
PSM	LDLDLTADSQPPVFK	1648	sp|Q13263-2|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	15-UNIMOD:188	ms_run[2]:scan=10731	61.603	2	1663.8764	1663.8764	R	V	411	426
PSM	LENYPIPEPGPNEVLLR	1649	sp|Q00796-2|DHSO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	17-UNIMOD:267	ms_run[2]:scan=10624	60.931	2	1959.0341	1959.0341	R	M	22	39
PSM	LFSADPFDLEAQAK	1650	sp|Q5TDH0-2|DDI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:188	ms_run[2]:scan=11306	65.188	2	1556.7818	1556.7818	R	I	192	206
PSM	LGAAAADAVTGR	1651	sp|Q9H4A3-2|WNK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=3459	21.5	2	1071.5673	1071.5673	K	T	39	51
PSM	LIPVITSNCTSK	1652	sp|Q7Z460-4|CLAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	9-UNIMOD:4	ms_run[2]:scan=5939	34.237	2	1331.7119	1331.7119	R	S	445	457
PSM	LLEAQIATGGIIDPK	1653	sp|P15924-2|DESP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	15-UNIMOD:188	ms_run[2]:scan=9410	53.479	2	1543.8917	1543.8917	R	E	1768	1783
PSM	LQEVEVPEDFGPVR	1654	sp|O95834|EMAL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:267	ms_run[2]:scan=9198	52.263	2	1622.818	1622.8180	K	T	328	342
PSM	LSDETLIDIMTR	1655	sp|P19367-4|HXK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=12423	72.399	2	1405.7123	1405.7123	R	F	19	31
PSM	LSLFSDLPEDTELQR	1656	sp|Q9BST9|RTKN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=11749	67.947	2	1761.8785	1761.8785	R	K	29	44
PSM	LSPVTACAGQTLQFK	1657	sp|Q8NBF2-2|NHLC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	7-UNIMOD:4	ms_run[2]:scan=8030	45.635	2	1619.8341	1619.8341	R	L	244	259
PSM	LSSTWEGIQAGK	1658	sp|P37837|TALDO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:188	ms_run[2]:scan=6089	35.039	2	1281.666	1281.6660	K	E	143	155
PSM	LSVENVPCIVTLCK	1659	sp|Q15024|EXOS7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	8-UNIMOD:4,13-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=10398	59.482	2	1636.8624	1636.8624	R	I	192	206
PSM	LTFSCLGGSDNFK	1660	sp|Q15185-2|TEBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	5-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=8766	49.692	2	1450.6858	1450.6858	K	H	36	49
PSM	LTIFDEEVDPDEGLFGPGR	1661	sp|Q53T59|H1BP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	19-UNIMOD:267	ms_run[2]:scan=13156	77.217	2	2115.0036	2115.0036	R	K	228	247
PSM	LTITSNPEMTFPGER	1662	sp|Q9H3U1-2|UN45A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	15-UNIMOD:267	ms_run[2]:scan=9124	51.847	2	1701.8271	1701.8271	K	I	700	715
PSM	LTVMSLQESGLK	1663	sp|O75369-6|FLNB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:188	ms_run[2]:scan=8506	48.307	2	1310.7211	1310.7211	R	V	2225	2237
PSM	LVINSGNGAVEDR	1664	sp|P16070-18|CD44_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:267	ms_run[2]:scan=3961	24.016	2	1352.6924	1352.6924	K	K	280	293
PSM	LVLVGDGGTGK	1665	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=4430	26.38	2	1014.571	1014.5710	K	T	13	24
PSM	MDATANDVPSPYEVR	1666	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:35	ms_run[2]:scan=5682	32.939	2	1679.7461	1679.7461	K	G	434	449
PSM	MLGDQFNGELEASAK	1667	sp|Q5TBC7|B2L15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:35,15-UNIMOD:188	ms_run[2]:scan=7267	41.338	2	1630.7604	1630.7604	R	N	59	74
PSM	NAAQFLLSTNDK	1668	sp|P63151|2ABA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:188	ms_run[2]:scan=7712	43.952	2	1326.6875	1326.6875	K	T	106	118
PSM	NAVTQEFGPVPDTAR	1669	sp|Q99798|ACON_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6986	39.808	2	1600.7845	1600.7845	R	Y	634	649
PSM	NEEDAAELVALAQAVNAR	1670	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	18-UNIMOD:267	ms_run[2]:scan=12049	69.947	2	1892.9467	1892.9467	R	A	311	329
PSM	NEGVATYAAAVLFR	1671	sp|P35222|CTNB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=12377	72.107	2	1480.7674	1480.7674	R	M	648	662
PSM	NINSLQEELLQLK	1672	sp|Q8IWJ2|GCC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:188	ms_run[2]:scan=11779	68.125	2	1546.8662	1546.8662	K	A	233	246
PSM	NLATTVTEEILEK	1673	sp|O43390-3|HNRPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=12587	73.467	2	1459.777	1459.7770	R	S	309	322
PSM	NLDQEQLSQVLDAMFER	1674	sp|P13861-2|KAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	17-UNIMOD:267	ms_run[2]:scan=14521	88.436	2	2044.9763	2044.9763	K	I	142	159
PSM	NLNEDDTFLVFSK	1675	sp|Q9BYT8|NEUL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:188	ms_run[2]:scan=10990	63.184	2	1546.7611	1546.7611	K	A	205	218
PSM	NSEGWEQNGLYEFFR	1676	sp|Q8IWX8|CHERP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=12990	76.124	2	1874.8224	1874.8224	R	A	704	719
PSM	NSSYFVEWIPNNVK	1677	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:188	ms_run[2]:scan=11526	66.561	2	1701.8458	1701.8458	K	T	337	351
PSM	NVGTGLVGAPACGDVMK	1678	sp|Q9H1K1-2|ISCU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:4	ms_run[2]:scan=6975	39.751	2	1644.7964	1644.7964	K	L	33	50
PSM	NVLCSACSGQGGK	1679	sp|O60884|DNJA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=1808	13.208	2	1336.5864	1336.5864	K	S	140	153
PSM	PEFLEDPSVLTK	1680	sp|P42167-3|LAP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9295	52.824	2	1373.7078	1373.7078	M	D	2	14
PSM	QAALQVAEGFISR	1681	sp|P40121-2|CAPG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=10248	58.461	2	1388.7412	1388.7412	R	M	292	305
PSM	QALQDLLSEYMGNAGR	1682	sp|P35221|CTNA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	16-UNIMOD:267	ms_run[2]:scan=13228	77.678	2	1774.8548	1774.8548	R	K	342	358
PSM	QLLEAGADPNGVNR	1683	sp|P42772-2|CDN2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=4660	27.569	2	1452.7321	1452.7321	R	F	32	46
PSM	QMEQISQFLQAAER	1684	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:267	ms_run[2]:scan=11632	67.217	2	1687.8227	1687.8227	K	Y	89	103
PSM	SCDGNQELLNFLR	1685	sp|Q9UIG0-2|BAZ1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:4	ms_run[2]:scan=11687	67.565	2	1564.7304	1564.7304	K	S	1040	1053
PSM	SCENLAPFNTALK	1686	sp|Q13155-2|AIMP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:4	ms_run[2]:scan=8094	46.004	2	1463.7079	1463.7079	R	L	236	249
PSM	SCETDALINFFAK	1687	sp|O94855|SC24D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:4	ms_run[2]:scan=12918	75.622	2	1514.7075	1514.7075	K	S	779	792
PSM	SESVPPVTDWAWYK	1688	sp|P35613-3|BASI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:188	ms_run[2]:scan=11364	65.557	2	1669.8084	1669.8084	K	I	35	49
PSM	SGANVLICGPNGCGK	1689	sp|P28288-2|ABCD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	8-UNIMOD:4,13-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=4984	29.467	2	1508.7171	1508.7171	R	S	355	370
PSM	SGGMSNELNNIISR	1690	sp|P53396|ACLY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:267	ms_run[2]:scan=8737	49.548	2	1500.723	1500.7230	R	T	663	677
PSM	SGLRVYSTSVTGSR	1691	sp|Q9H299|SH3L3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:1	ms_run[2]:scan=6374	36.549	2	1510.774	1510.7740	M	E	2	16
PSM	SILLATDVASR	1692	sp|Q9H0S4-2|DDX47_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:267	ms_run[2]:scan=7079	40.279	2	1154.6535	1154.6535	R	G	266	277
PSM	SIQADGLVWGSSK	1693	sp|P24534|EF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:188	ms_run[2]:scan=7971	45.311	2	1352.7032	1352.7032	R	L	164	177
PSM	SIQADGLVWGSSK	1694	sp|P24534|EF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7981	45.36	2	1346.683	1346.6830	R	L	164	177
PSM	SLGSVQAPSYGAR	1695	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:267	ms_run[2]:scan=4904	28.999	2	1301.6603	1301.6603	R	P	15	28
PSM	SLTQTFATVEVGR	1696	sp|Q5QJE6|TDIF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:267	ms_run[2]:scan=8395	47.695	2	1417.7441	1417.7441	K	W	362	375
PSM	SMEDFVTWVDSSK	1697	sp|Q9NV31|IMP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=12363	72.018	2	1529.6708	1529.6708	R	I	153	166
PSM	SMVPVQVQLDVPVVK	1698	sp|P18754|RCC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=10984	63.145	2	1636.9222	1636.9222	K	V	162	177
PSM	SPDFTNENPLETR	1699	sp|P05023-3|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7421	42.262	2	1518.6951	1518.6951	R	N	197	210
PSM	SPVESTTEPPAVR	1700	sp|P53992|SC24C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:267	ms_run[2]:scan=3131	19.848	2	1378.6968	1378.6968	K	A	957	970
PSM	SQDFGNLFSFPSYSQK	1701	sp|Q02880-2|TOP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	16-UNIMOD:188	ms_run[2]:scan=12420	72.381	2	1856.8677	1856.8677	K	S	1436	1452
PSM	SQFEELCAELLQK	1702	sp|Q92598-2|HS105_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	7-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=11297	65.132	2	1599.791	1599.7910	R	I	304	317
PSM	SSGDYSATFLPGLIPAEK	1703	sp|Q96JH7|VCIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	18-UNIMOD:188	ms_run[2]:scan=11724	67.792	2	1857.9456	1857.9456	R	C	314	332
PSM	STGSFVGELMYK	1704	sp|Q9UJS0|CMC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9682	54.996	2	1317.6275	1317.6275	R	N	361	373
PSM	SVPLAATSMLITQGLISK	1705	sp|Q9NX40-3|OCAD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	9-UNIMOD:35	ms_run[2]:scan=12298	71.595	2	1845.0281	1845.0281	R	G	47	65
PSM	SWTAADMAAQITK	1706	sp|P04439|HLAA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9474	53.839	2	1392.6708	1392.6708	R	R	156	169
PSM	SYELPDGQVITIGNER	1707	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9827	55.789	2	1789.8846	1789.8846	K	F	239	255
PSM	TAMNVNEIFMAIAK	1708	sp|P51148|RAB5C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=13673	80.578	2	1551.7789	1551.7789	K	K	167	181
PSM	TAVETAVLLLR	1709	sp|P49368-2|TCPG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:267	ms_run[2]:scan=10767	61.822	2	1194.7211	1194.7211	K	I	470	481
PSM	TAVETAVLLLR	1710	sp|P49368-2|TCPG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=10769	61.831	2	1184.7129	1184.7129	K	I	470	481
PSM	TDKSSASAPDVDDPEAFPALA	1711	sp|Q8NC51-4|PAIRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9477	53.857	2	2102.9644	2102.9644	R	-	367	388
PSM	TENPVIMGLSSQNGQLR	1712	sp|P26196|DDX6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8877	50.322	2	1842.9258	1842.9258	R	G	6	23
PSM	TFGENYVQELLEK	1713	sp|O94903|PLPHP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=12521	73.036	2	1568.7722	1568.7722	R	A	64	77
PSM	TFGENYVQELLEK	1714	sp|O94903|PLPHP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:188	ms_run[2]:scan=12524	73.059	2	1574.7924	1574.7924	R	A	64	77
PSM	TFQCELCSYTCPR	1715	sp|P49711|CTCF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:4,7-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=7693	43.844	2	1720.7007	1720.7007	K	R	265	278
PSM	TGLIDYNQLALTAR	1716	sp|P34897-3|GLYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9876	56.042	2	1547.8308	1547.8308	K	L	180	194
PSM	TIQQCCENILLNAAWLK	1717	sp|P55786-2|PSA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	5-UNIMOD:4,6-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=13028	76.376	2	2080.0541	2080.0541	R	R	803	820
PSM	TLQEEVMEAMGIK	1718	sp|Q96A35|RM24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:188	ms_run[2]:scan=13553	79.784	2	1483.7358	1483.7358	K	E	193	206
PSM	TLQNTSSEGSR	1719	sp|Q06787-8|FMR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:267	ms_run[2]:scan=667	7.4067	2	1188.561	1188.5610	K	L	548	559
PSM	TLSFGSDLNYATR	1720	sp|Q14152|EIF3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:267	ms_run[2]:scan=8629	48.985	2	1453.7077	1453.7077	R	E	490	503
PSM	TLSSVQNEVQEALQR	1721	sp|P12270|TPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9839	55.853	2	1700.8693	1700.8693	K	A	1039	1054
PSM	TMPILSPGNTQTLTELELK	1722	sp|Q9BW27-2|NUP85_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=12132	70.508	2	2085.1028	2085.1028	R	W	71	90
PSM	TPAQFDADELR	1723	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:267	ms_run[2]:scan=5951	34.296	2	1271.6021	1271.6021	K	A	114	125
PSM	TPEILTVNSIGQLK	1724	sp|Q8NFH3|NUP43_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:188	ms_run[2]:scan=9842	55.867	2	1517.876	1517.8760	R	I	183	197
PSM	TPEILTVNSIGQLK	1725	sp|Q8NFH3|NUP43_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9845	55.88	2	1511.8559	1511.8559	R	I	183	197
PSM	TTPSVVAFTADGER	1726	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6941	39.564	2	1449.71	1449.7100	R	L	86	100
PSM	TTSGGEWPQILVFPEGTCTNR	1727	sp|Q7L5N7|PCAT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	18-UNIMOD:4,21-UNIMOD:267	ms_run[2]:scan=12623	73.702	2	2359.1142	2359.1142	R	S	206	227
PSM	TVQSLEIDLDSMR	1728	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=10440	59.757	2	1505.7396	1505.7396	R	N	302	315
PSM	TYGESMLYLDGQR	1729	sp|Q9Y305-3|ACOT9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8435	47.918	2	1531.6977	1531.6977	K	H	348	361
PSM	VALWNEVDGQTK	1730	sp|Q5JSH3-3|WDR44_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7941	45.148	2	1358.683	1358.6830	K	L	209	221
PSM	VAMFLTDSNNIK	1731	sp|Q15046|SYK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8241	46.863	2	1351.6806	1351.6806	R	E	554	566
PSM	VASSPVMVSNPATR	1732	sp|P51610-2|HCFC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:267	ms_run[2]:scan=4564	27.084	2	1424.7321	1424.7321	K	M	526	540
PSM	VDFPQDQLTALTGR	1733	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=10831	62.209	2	1559.7944	1559.7944	K	I	216	230
PSM	VEQLFQVMNGILAQDSACSQR	1734	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	18-UNIMOD:4	ms_run[2]:scan=13920	82.498	3	2393.1468	2393.1468	R	A	3764	3785
PSM	VERADGYEPPVQESV	1735	sp|P61247|RS3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:267	ms_run[2]:scan=5630	32.67	2	1683.7979	1683.7979	K	-	250	265
PSM	VFANAPDSACVIGLK	1736	sp|P17858|PFKAL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	10-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=8415	47.808	2	1566.8171	1566.8171	R	K	699	714
PSM	VFFTCNACGESVK	1737	sp|Q9NX58|LYAR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	5-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=6290	36.073	2	1517.6643	1517.6643	M	K	2	15
PSM	VFPGSTTEDYNLIVIER	1738	sp|Q13263-2|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=11042	63.509	2	1951.9891	1951.9891	K	G	426	443
PSM	VGDPQELNGITR	1739	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5061	29.862	2	1297.6626	1297.6626	K	A	299	311
PSM	VGEGPGVCWLAPEQTAGK	1740	sp|Q9H4A4|AMPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	8-UNIMOD:4,18-UNIMOD:188	ms_run[2]:scan=8910	50.525	2	1860.9136	1860.9136	R	K	144	162
PSM	VGIPVTDENGNR	1741	sp|Q9H9B4|SFXN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:267	ms_run[2]:scan=3752	22.979	2	1279.6396	1279.6396	K	L	203	215
PSM	VIGSGCNLDSAR	1742	sp|P00338-3|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:4	ms_run[2]:scan=2986	19.155	2	1247.5928	1247.5928	R	F	187	199
PSM	VISFEEQVASIR	1743	sp|Q9BT78|CSN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9627	54.711	2	1376.73	1376.7300	R	Q	96	108
PSM	VLEQLTGQTPVFSK	1744	sp|P62913-2|RL11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8451	48.008	2	1545.8403	1545.8403	K	A	38	52
PSM	VLGQVSCELVSPK	1745	sp|Q06265|EXOS9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	7-UNIMOD:4	ms_run[2]:scan=6860	39.149	2	1414.749	1414.7490	R	L	55	68
PSM	VLNYAPGPLDTDMQQLAR	1746	sp|P35270|SPRE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=10706	61.446	2	2000.999	2000.9990	R	E	193	211
PSM	VLTFDLTKYPDANPNPNEQ	1747	sp|Q14683|SMC1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	8-UNIMOD:188	ms_run[2]:scan=9795	55.628	2	2181.0685	2181.0685	K	-	1215	1234
PSM	VLVDQTTGLSR	1748	sp|Q15717|ELAV1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=4618	27.356	2	1187.651	1187.6510	R	G	137	148
PSM	VQAWYMDDAPGDPR	1749	sp|Q9BV57|MTND_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8030	45.635	2	1619.7038	1619.7038	M	Q	2	16
PSM	VQTDPPSVPICDLYPNGVFPK	1750	sp|P50579|MAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:4	ms_run[2]:scan=11795	68.223	2	2342.1617	2342.1617	K	G	111	132
PSM	VSYFPTVPGVYIVSTK	1751	sp|O75369-6|FLNB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	16-UNIMOD:188	ms_run[2]:scan=12004	69.644	2	1761.9649	1761.9649	K	F	2035	2051
PSM	VTFEDATDFFGR	1752	sp|Q86WQ0|NR2CA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=11504	66.424	2	1403.6357	1403.6357	K	V	115	127
PSM	VTFEDATDFFGR	1753	sp|Q86WQ0|NR2CA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:267	ms_run[2]:scan=11511	66.469	2	1413.644	1413.6440	K	V	115	127
PSM	VTNGAFTGEISPGMIK	1754	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8600	48.831	2	1620.8181	1620.8181	K	D	107	123
PSM	VVAEPVELAQEFR	1755	sp|O75489|NDUS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9948	56.454	2	1485.7827	1485.7827	R	K	219	232
PSM	VVLIGDSGVGK	1756	sp|P62491-2|RB11A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:188	ms_run[2]:scan=5574	32.404	2	1048.6224	1048.6224	K	S	14	25
PSM	VYVGNLGNNGNK	1757	sp|P84103-2|SRSF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=3049	19.465	2	1247.6258	1247.6258	K	T	12	24
PSM	YIQPWESEFIDSQR	1758	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:267	ms_run[2]:scan=10763	61.795	2	1806.8452	1806.8452	R	V	1371	1385
PSM	YVASYLLAALGGNSSPSAK	1759	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	19-UNIMOD:188	ms_run[2]:scan=12544	73.186	2	1873.9881	1873.9881	R	D	3	22
PSM	YVVVTGITPTPLGEGK	1760	sp|P11586|C1TC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	16-UNIMOD:188	ms_run[2]:scan=8802	49.894	2	1635.9179	1635.9179	K	S	371	387
PSM	VEIIANDQGNR	1761	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	11-UNIMOD:267	ms_run[1]:scan=2816	18.31371833333333	2	1237.626654	1237.629033	R	I	50	61
PSM	QIATLHAQVADMK	1762	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:28	ms_run[1]:scan=8046	45.72635666666667	2	1407.7189	1407.7175	K	K	1358	1371
PSM	CLELFSELAEDKENYK	1763	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=14471	87.80846666666666	2	1969.8981	1969.8974	K	K	412	428
PSM	ISFLENNLEQLTK	1764	sp|Q12840|KIF5A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	13-UNIMOD:188	ms_run[1]:scan=11639	67.26339	2	1554.815650	1553.839652	K	V	830	843
PSM	SALENMLSETQSR	1765	sp|Q9C075|K1C23_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	6-UNIMOD:35,13-UNIMOD:267	ms_run[1]:scan=4498	26.740640000000003	2	1490.691071	1490.691041	K	Y	309	322
PSM	SSLLDDLLTESEDMAQR	1766	sp|O00429|DNM1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	14-UNIMOD:35,17-UNIMOD:267	ms_run[1]:scan=13300	78.14079333333333	2	1948.902943	1947.897071	K	R	693	710
PSM	ASASYHISNLLEK	1767	sp|Q86VP6|CAND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1	ms_run[1]:scan=9192	52.23509666666667	2	1473.7481	1473.7458	M	M	2	15
PSM	QAEEEKMALPELVR	1768	sp|P45974|UBP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:28,6-UNIMOD:188,14-UNIMOD:267	ms_run[1]:scan=9762	55.44923000000001	2	1640.8449	1640.8409	R	A	511	525
PSM	CMPAPEEIVEELPASKK	1769	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:385,1-UNIMOD:4,16-UNIMOD:188,17-UNIMOD:188	ms_run[1]:scan=12064	70.04047333333332	2	1921.9612	1921.9563	R	Q	3014	3031
PSM	SLTQTFATVEVGR	1770	sp|Q5QJE6|TDIF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=8396	47.700563333333335	2	1408.735733	1407.735794	K	W	362	375
PSM	LGTEGGEGFVVK	1771	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	12-UNIMOD:188	ms_run[1]:scan=5600	32.525975	2	1197.6295	1197.6332	M	V	3	15
PSM	ATENDIANFFSPLNPIR	1772	sp|P31942|HNRH3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=12467	72.68055333333334	2	1918.942523	1917.958477	R	V	206	223
PSM	ATENDIANFFSPLNPIR	1773	sp|P31942|HNRH3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	17-UNIMOD:267	ms_run[1]:scan=12484	72.79181	2	1928.952880	1927.966746	R	V	206	223
PSM	QSIAIDDCTFHQCVR	1774	sp|Q96CW1|AP2M1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:28,8-UNIMOD:4,13-UNIMOD:4,15-UNIMOD:267	ms_run[1]:scan=8018	45.56413333333333	2	1841.8107	1841.8059	K	L	239	254
PSM	IVNGWQVEEADDWLR	1775	sp|P11216|PYGB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=11914	69.02510500000001	2	1829.873064	1828.874413	K	Y	171	186
PSM	GIPGFGNTGNISGAPVTYPSAGAQGVNNTASGNNSR	1776	sp|Q86XP3|DDX42_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=9381	53.308658333333334	2	3403.616728	3403.614123	K	E	762	798
PSM	SLDIQVPNFPADETK	1777	sp|P47897|SYQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	15-UNIMOD:188	ms_run[1]:scan=10308	58.90273333333334	2	1679.841475	1678.850945	K	G	587	602
PSM	QALLAELEEQKIVQAK	1778	sp|Q9H081|MIS12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:28	ms_run[1]:scan=12215	71.06708666666667	2	1792.9982	1792.9929	K	L	136	152
PSM	AEAGAGSATEFQFR	1779	sp|Q9NQ39|RS10L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	14-UNIMOD:267	ms_run[1]:scan=6474	37.10720333333333	2	1450.695615	1450.671626	K	G	151	165
PSM	YEDAYQYQNIFGPLVK	1780	sp|Q92900|RENT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	16-UNIMOD:188	ms_run[1]:scan=12358	71.98388833333333	2	1954.9652	1952.9612	R	L	296	312
PSM	GKVEIDQQQLTQQQLNGN	1781	sp|Q8IWS0|PHF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=5996	34.53603333333333	2	2041.006311	2040.023596	R	-	348	366
PSM	LQEVEVPEDFGPVR	1782	sp|O95834|EMAL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=9205	52.301325	2	1612.826306	1612.809687	K	T	328	342
PSM	LMTQAQLEEATR	1783	sp|P82650|RT22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=6079	34.991945	2	1390.675590	1389.692214	K	Q	105	117
PSM	SAAQMEVASFLLSK	1784	sp|Q12834|CDC20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	14-UNIMOD:188	ms_run[1]:scan=11967	69.38753833333332	2	1486.778410	1486.779695	R	E	84	98
PSM	CLVGEFVSDALLVPDKCK	1785	sp|P05067|A4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:385,1-UNIMOD:4,17-UNIMOD:4	ms_run[1]:scan=14737	91.10272166666667	2	2032.0018	2032.0004	R	F	117	135
PSM	FSASGELGNGNIK	1786	sp|P12004|PCNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=5324	31.179785	2	1293.616556	1292.636080	K	L	169	182
PSM	SVPLAATSMLITQGLISK	1787	sp|Q9NX40|OCAD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=13439	79.038225	2	1829.033344	1829.033221	R	G	47	65
PSM	VFLDPNILSDDGTVALR	1788	sp|P48147|PPCE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	17-UNIMOD:267	ms_run[1]:scan=12420	72.381095	2	1856.961082	1853.976248	R	G	112	129
PSM	AALEALGSCLNNK	1789	sp|P34897-3|GLYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	9-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=6974	39.746	2	1365.7018	1365.7018	R	Y	62	75
PSM	AAVPSGASTGIYEALELR	1790	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11200	64.511	2	1803.9367	1803.9367	R	D	33	51
PSM	AEAGAGSATEFQFR	1791	sp|P46783|RS10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6464	37.054	2	1440.6634	1440.6634	K	G	140	154
PSM	AEPMQWASLELPAAK	1792	sp|Q9UHD1|CHRD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11299	65.143	2	1640.8232	1640.8232	K	K	307	322
PSM	AGALNSNDAFVLK	1793	sp|P06396-2|GELS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7653	43.611	2	1318.6881	1318.6881	K	T	534	547
PSM	AGGIETIANEFSDR	1794	sp|Q92598-2|HS105_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9727	55.252	2	1478.7001	1478.7001	R	C	20	34
PSM	AGGSASAMLQPLLDNQVGFK	1795	sp|P20618|PSB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	20-UNIMOD:188	ms_run[2]:scan=12137	70.543	2	2009.0347	2009.0347	K	N	165	185
PSM	AGYIIPLQGPGLTTTESR	1796	sp|P10253|LYAG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	18-UNIMOD:267	ms_run[2]:scan=9907	56.208	2	1883.0028	1883.0028	R	Q	820	838
PSM	AIAELGIYPAVDPLDSTSR	1797	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	19-UNIMOD:267	ms_run[2]:scan=11675	67.492	2	1997.0345	1997.0345	R	I	388	407
PSM	AIANECQANFISIK	1798	sp|P55072|TERA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	6-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=7859	44.723	2	1583.8073	1583.8073	K	G	530	544
PSM	AIDNAADLLIFGK	1799	sp|Q9Y5X2|SNX8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=12191	70.899	2	1359.7398	1359.7398	R	E	246	259
PSM	AIGAVPLIQGEYMIPCEK	1800	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	16-UNIMOD:4,18-UNIMOD:188	ms_run[2]:scan=11493	66.355	2	1994.0312	1994.0312	K	V	314	332
PSM	AKYPDYEVTWANDGY	1801	sp|Q9NRX4|PHP14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:188	ms_run[2]:scan=9413	53.495	2	1796.7989	1796.7989	K	-	111	126
PSM	ALCIDQLDVFLQK	1802	sp|Q5T8P6-6|RBM26_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=13239	77.748	2	1567.8375	1567.8375	K	E	51	64
PSM	ALLQEFDNAVLSK	1803	sp|Q02241-3|KIF23_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:188	ms_run[2]:scan=11622	67.158	2	1452.792	1452.7920	K	E	341	354
PSM	ALTVPELTQQVFDAK	1804	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	15-UNIMOD:188	ms_run[2]:scan=12265	71.388	2	1664.9081	1664.9081	R	N	283	298
PSM	ANFLNSNDVFVLK	1805	sp|P09327|VILI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11562	66.781	2	1479.7722	1479.7722	R	T	537	550
PSM	AQIFANTVDNAR	1806	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5335	31.233	2	1318.663	1318.6630	R	I	138	150
PSM	ASASYHISNLLEK	1807	sp|Q86VP6|CAND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:1	ms_run[2]:scan=9157	52.04	2	1473.7464	1473.7464	M	M	2	15
PSM	ASFENNCEIGCFAK	1808	sp|P56537|IF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	7-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=7134	40.547	2	1645.6865	1645.6865	R	L	5	19
PSM	ASLLDDYQLPEILR	1809	sp|Q9H2U1-3|DHX36_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=13347	78.446	2	1644.8723	1644.8723	R	T	620	634
PSM	ASVGECPAPVPVKDK	1810	sp|P56134-3|ATPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:1,6-UNIMOD:4,13-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=4707	27.805	2	1606.8428	1606.8428	M	K	2	17
PSM	ATAEVLNIGKK	1811	sp|P22234|PUR6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:1,10-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=7077	40.269	2	1196.7167	1196.7167	M	L	2	13
PSM	AVFVDLEPTVIDEIR	1812	sp|P68366-2|TBA4A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	15-UNIMOD:267	ms_run[2]:scan=12815	74.946	2	1724.9224	1724.9224	R	N	50	65
PSM	AVLIAGQPGTGK	1813	sp|Q9Y230|RUVB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=3496	21.672	2	1110.6397	1110.6397	R	T	72	84
PSM	CAGNEDIITLR	1814	sp|P12004|PCNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:4,11-UNIMOD:267	ms_run[2]:scan=6527	37.401	2	1270.6215	1270.6215	K	A	81	92
PSM	CEFQDAYVLLSEK	1815	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:4	ms_run[2]:scan=10906	62.661	2	1600.7443	1600.7443	K	K	237	250
PSM	CNEPAVWSQLAK	1816	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:4,12-UNIMOD:188	ms_run[2]:scan=8223	46.773	2	1407.6912	1407.6912	R	A	1102	1114
PSM	CQQLAAYGILEK	1817	sp|Q9BT78|CSN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:4	ms_run[2]:scan=8279	47.064	2	1392.7071	1392.7071	R	M	255	267
PSM	CQQLAAYGILEK	1818	sp|Q9BT78|CSN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:4,12-UNIMOD:188	ms_run[2]:scan=8283	47.084	2	1398.7273	1398.7273	R	M	255	267
PSM	CTGGEVGATSALAPK	1819	sp|P30050|RL12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:4	ms_run[2]:scan=3927	23.853	2	1417.6871	1417.6871	R	I	17	32
PSM	DAGQISGLNVLR	1820	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:267	ms_run[2]:scan=8457	48.044	2	1251.6811	1251.6811	K	V	207	219
PSM	DAGQISGLNVLR	1821	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8465	48.089	2	1241.6728	1241.6728	K	V	207	219
PSM	DLGTESQIFISR	1822	sp|P50395|GDIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8908	50.515	2	1364.6936	1364.6936	K	T	391	403
PSM	DSLIFLVDASK	1823	sp|P12956|XRCC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11470	66.21	2	1206.6496	1206.6496	R	A	36	47
PSM	EAFQSVVLPAFEK	1824	sp|Q6P2E9|EDC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11002	63.262	2	1463.766	1463.7660	R	S	1116	1129
PSM	EAFQSVVLPAFEK	1825	sp|Q6P2E9|EDC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11010	63.312	2	1463.766	1463.7660	R	S	1116	1129
PSM	EAINVEQAFQTIAR	1826	sp|P51149|RAB7A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	14-UNIMOD:267	ms_run[2]:scan=11715	67.738	2	1598.8292	1598.8292	K	N	158	172
PSM	EANLLNAVIVQR	1827	sp|Q9UNZ2-4|NSF1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9857	55.945	2	1338.7619	1338.7619	K	L	326	338
PSM	EGPAVVGQFIQDVK	1828	sp|Q86VP6|CAND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10543	60.413	2	1485.7827	1485.7827	K	N	813	827
PSM	EGPTLSVPMVQGECLLK	1829	sp|Q9BQ52-4|RNZ2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	14-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=11294	65.114	2	1862.9577	1862.9577	K	Y	368	385
PSM	ELDPILTEVTLMNAR	1830	sp|Q9H9E3-3|COG4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=13025	76.359	2	1713.8971	1713.8971	R	S	278	293
PSM	ENGLEVLQEAFSR	1831	sp|O75165|DJC13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=12878	75.329	2	1490.7365	1490.7365	R	C	1443	1456
PSM	EQLLQSNPVLEAFGNAK	1832	sp|O43795|MYO1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=12342	71.878	2	1856.9632	1856.9632	K	T	140	157
PSM	EQWANLEQLSAIR	1833	sp|Q01082|SPTB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:267	ms_run[2]:scan=10876	62.483	2	1566.803	1566.8030	R	K	724	737
PSM	ETLAQLQQEFQR	1834	sp|O15212|PFD6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9696	55.079	2	1489.7525	1489.7525	R	A	106	118
PSM	EVDDLEQWIAER	1835	sp|Q01082|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:267	ms_run[2]:scan=11519	66.517	2	1511.7132	1511.7132	R	E	1706	1718
PSM	EVIELPLTNPELFQR	1836	sp|P62333|PRS10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	15-UNIMOD:267	ms_run[2]:scan=12808	74.899	2	1806.9755	1806.9755	R	V	147	162
PSM	EVIELPLTNPELFQR	1837	sp|P62333|PRS10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=12809	74.905	2	1796.9672	1796.9672	R	V	147	162
PSM	FGFPEGSVELYAEK	1838	sp|P23396|RS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	14-UNIMOD:188	ms_run[2]:scan=10493	60.093	2	1577.7709	1577.7709	R	V	77	91
PSM	FSMVVQDGIVK	1839	sp|P30044-4|PRDX5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8348	47.43	2	1221.6427	1221.6427	R	A	92	103
PSM	FSYLAVIEGAK	1840	sp|P18031|PTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:188	ms_run[2]:scan=11058	63.61	2	1202.6643	1202.6643	R	F	269	280
PSM	GALQNIIPASTGAAK	1841	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7538	42.95	2	1410.7831	1410.7831	R	A	159	174
PSM	GALQNIIPASTGAAK	1842	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	15-UNIMOD:188	ms_run[2]:scan=7519	42.836	2	1416.8032	1416.8032	R	A	159	174
PSM	GEELGGGQDPVQLLSGFPR	1843	sp|Q04323|UBXN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=12358	71.984	2	1954.9749	1954.9749	R	R	248	267
PSM	GFAFVTFESPADAK	1844	sp|O75526|RMXL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10972	63.072	2	1485.714	1485.7140	R	A	50	64
PSM	GFALVGVGSEASSK	1845	sp|Q16630-3|CPSF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7348	41.846	2	1307.6721	1307.6721	K	K	125	139
PSM	GGCPGGEATLSQPPPR	1846	sp|P20290|BTF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:4	ms_run[2]:scan=3130	19.843	2	1579.7413	1579.7413	R	G	20	36
PSM	GGNIGDGGGAADR	1847	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:267	ms_run[2]:scan=811	8.1734	2	1125.5038	1125.5038	R	V	587	600
PSM	GISLNPEQWSQLK	1848	sp|P53999|TCP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10898	62.612	2	1498.778	1498.7780	K	E	102	115
PSM	GLEMDPIDCTPPEYILPGSR	1849	sp|O75153|CLU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	9-UNIMOD:4,20-UNIMOD:267	ms_run[2]:scan=11578	66.872	2	2269.0634	2269.0634	K	E	176	196
PSM	GLIDGAESYVSFSR	1850	sp|Q12913|PTPRJ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10500	60.139	2	1499.7256	1499.7256	K	Y	946	960
PSM	GMDADPYNPVLPTNR	1851	sp|Q9H6T3|RPAP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7554	43.046	2	1658.7723	1658.7723	K	A	159	174
PSM	GPAGDATVASEKESVM	1852	sp|Q15758|AAAT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=4755	28.084	2	1547.7137	1547.7137	R	-	526	542
PSM	GPVGTVSEAQLAR	1853	sp|Q9NZM1-2|MYOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:267	ms_run[2]:scan=4955	29.313	2	1293.6916	1293.6916	K	R	126	139
PSM	GTQGVVTNFEIFR	1854	sp|P55884|EIF3B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:267	ms_run[2]:scan=10727	61.575	2	1476.76	1476.7600	K	M	536	549
PSM	GVDLQENNPASR	1855	sp|P51148|RAB5C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:267	ms_run[2]:scan=2980	19.122	2	1308.6298	1308.6298	R	S	199	211
PSM	GVIDMGNSLIER	1856	sp|Q13813-3|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:267	ms_run[2]:scan=9083	51.599	2	1312.6685	1312.6685	R	G	1588	1600
PSM	GVPLQFDINSVGK	1857	sp|Q96QD9-3|UIF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:188	ms_run[2]:scan=9688	55.03	2	1378.7552	1378.7552	K	Q	206	219
PSM	IANPVEGSTDR	1858	sp|Q15366-7|PCBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=2579	17.019	2	1157.5677	1157.5677	K	Q	276	287
PSM	IAQPNYIPTQQDVLR	1859	sp|P63096-2|GNAI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	15-UNIMOD:267	ms_run[2]:scan=8183	46.544	2	1764.9398	1764.9398	R	T	110	125
PSM	IDFYFDENPYFENK	1860	sp|Q01105-3|SET_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=12156	70.665	2	1839.7992	1839.7992	R	V	112	126
PSM	IEPTELSENCFWLR	1861	sp|O60879-2|DIAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	10-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=11628	67.192	2	1802.8537	1802.8537	K	V	646	660
PSM	IEPTELSENCFWLR	1862	sp|O60879-2|DIAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	10-UNIMOD:4	ms_run[2]:scan=11636	67.241	2	1792.8454	1792.8454	K	V	646	660
PSM	IESLSSQLSNLQK	1863	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8225	46.782	2	1445.7726	1445.7726	R	E	300	313
PSM	IFVGGLSPDTPEEK	1864	sp|Q14103-4|HNRPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7530	42.904	2	1487.7508	1487.7508	K	I	165	179
PSM	ILATPPQEDAPSVDIANIR	1865	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	19-UNIMOD:267	ms_run[2]:scan=9380	53.304	3	2029.0719	2029.0719	K	M	284	303
PSM	ILQDGGLQVVEK	1866	sp|O43175|SERA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:188	ms_run[2]:scan=6360	36.473	2	1303.7443	1303.7443	K	Q	22	34
PSM	INISQVIAVVGQQNVEGK	1867	sp|P24928|RPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=12545	73.192	2	1895.0476	1895.0476	K	R	779	797
PSM	ISATSIFFESMPYK	1868	sp|P34897-3|GLYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	14-UNIMOD:188	ms_run[2]:scan=12803	74.87	2	1625.8107	1625.8107	R	L	162	176
PSM	ISLLPNDEDSLPPLLVASGEK	1869	sp|Q7Z3T8|ZFY16_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	21-UNIMOD:188	ms_run[2]:scan=13240	77.754	2	2212.1934	2212.1934	K	G	1012	1033
PSM	ITSGPFEPDLYK	1870	sp|Q9UQ80-2|PA2G4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:188	ms_run[2]:scan=8289	47.115	2	1371.7018	1371.7018	R	S	279	291
PSM	IVFEDGNINVNK	1871	sp|Q14194|DPYL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:188	ms_run[2]:scan=7184	40.831	2	1366.7188	1366.7188	K	G	452	464
PSM	IVLTNPVCTEVGEK	1872	sp|P41091|IF2G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	8-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=7585	43.231	2	1563.8274	1563.8274	K	I	427	441
PSM	IYIDSNNNPER	1873	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:267	ms_run[2]:scan=3163	20.018	2	1343.6345	1343.6345	K	F	882	893
PSM	IYIDSNNNPER	1874	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=3164	20.022	2	1333.6262	1333.6262	K	F	882	893
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVK	1875	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6324	36.271	3	4117.4483	4117.4483	K	K	158	194
PSM	LAAIAESGVER	1876	sp|P28072|PSB6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=3999	24.207	2	1114.5982	1114.5982	R	Q	210	221
PSM	LAALPNVYEVISK	1877	sp|P33992|MCM5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:188	ms_run[2]:scan=11427	65.951	2	1421.8225	1421.8225	R	S	325	338
PSM	LADGGATNQGR	1878	sp|Q08380|LG3BP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:267	ms_run[2]:scan=672	7.4326	2	1068.5188	1068.5188	R	V	26	37
PSM	LADPVTPVETILQR	1879	sp|Q9NVN8|GNL3L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10931	62.818	2	1550.8668	1550.8668	K	C	328	342
PSM	LCVPAMNVNDSVTK	1880	sp|O43865|SAHH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=7607	43.351	2	1552.7685	1552.7685	K	Q	271	285
PSM	LDGMGCLEFDEER	1881	sp|Q13951|PEBB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	6-UNIMOD:4	ms_run[2]:scan=8886	50.377	2	1569.6439	1569.6439	R	A	119	132
PSM	LDIDPETITWQR	1882	sp|P11586|C1TC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10268	58.618	2	1485.7464	1485.7464	R	V	521	533
PSM	LDIDPSTITWQR	1883	sp|Q6UB35|C1TM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:267	ms_run[2]:scan=9778	55.541	2	1453.7441	1453.7441	R	V	564	576
PSM	LEVAPISDIIAIK	1884	sp|P13804|ETFA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=12309	71.67	2	1380.8228	1380.8228	K	S	127	140
PSM	LIGTNCIIYPVNSK	1885	sp|Q9C0C9|UBE2O_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	6-UNIMOD:4	ms_run[2]:scan=8423	47.853	2	1590.844	1590.8440	K	D	177	191
PSM	LLDLVQQSCNYK	1886	sp|P55769|NH2L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	9-UNIMOD:4,12-UNIMOD:188	ms_run[2]:scan=7772	44.266	2	1485.7593	1485.7593	K	Q	22	34
PSM	LLDMDGIIVEK	1887	sp|Q14152|EIF3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:188	ms_run[2]:scan=9939	56.401	2	1250.6888	1250.6888	R	Q	341	352
PSM	LLVPANEGDPTETLR	1888	sp|O14763-2|TR10B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	15-UNIMOD:267	ms_run[2]:scan=7704	43.904	2	1633.8551	1633.8551	R	Q	296	311
PSM	LMCELGNDVINR	1889	sp|Q15057|ACAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=7587	43.242	2	1442.6885	1442.6885	K	V	466	478
PSM	LNVDEAFEQLVR	1890	sp|P10301|RRAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:267	ms_run[2]:scan=12731	74.401	2	1441.7441	1441.7441	R	A	177	189
PSM	LQMEQQQQLQQR	1891	sp|Q9NS69|TOM22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:267	ms_run[2]:scan=3399	21.208	2	1566.7812	1566.7812	K	Q	106	118
PSM	LQMEQQQQLQQR	1892	sp|Q9NS69|TOM22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=3401	21.217	2	1556.7729	1556.7729	K	Q	106	118
PSM	LQVEPAVDTSGVQCYGPGIEGQGVFR	1893	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	14-UNIMOD:4	ms_run[2]:scan=10451	59.825	2	2762.3334	2762.3334	K	E	1247	1273
PSM	LSFYETGEIPR	1894	sp|O00567|NOP56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:267	ms_run[2]:scan=8452	48.014	2	1320.6589	1320.6589	R	K	405	416
PSM	LSFYETGEIPR	1895	sp|O00567|NOP56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:267	ms_run[2]:scan=8484	48.192	2	1320.6589	1320.6589	R	K	405	416
PSM	LSQLEGVNVER	1896	sp|Q96QK1|VPS35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5357	31.347	2	1242.6568	1242.6568	R	Y	227	238
PSM	LVAIVDVIDQNR	1897	sp|P50914|RL14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10191	58.06	2	1353.7616	1353.7616	K	A	24	36
PSM	LVGDVDFEGVR	1898	sp|P13995-2|MTDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:267	ms_run[2]:scan=7831	44.578	2	1214.6171	1214.6171	K	Q	187	198
PSM	LVGEIMQETGTR	1899	sp|Q00341|VIGLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6354	36.438	2	1332.6708	1332.6708	R	I	244	256
PSM	LVIVGDGACGK	1900	sp|P08134|RHOC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	9-UNIMOD:4	ms_run[2]:scan=4359	26.046	2	1087.5696	1087.5696	K	T	8	19
PSM	LVIVGDGACGK	1901	sp|P08134|RHOC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	9-UNIMOD:4,11-UNIMOD:188	ms_run[2]:scan=4349	25.998	2	1093.5897	1093.5897	K	T	8	19
PSM	LVTDQNISENWR	1902	sp|P24666|PPAC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:267	ms_run[2]:scan=6897	39.318	2	1483.7295	1483.7295	K	V	30	42
PSM	LVVPATQCGSLIGK	1903	sp|Q15365|PCBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	8-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=7319	41.674	2	1447.8164	1447.8164	R	G	102	116
PSM	LWEPLVEEPPADQWK	1904	sp|Q16718-2|NDUA5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11555	66.735	2	1835.9094	1835.9094	K	W	99	114
PSM	LYDNLLEQNLIR	1905	sp|O00231|PSD11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:267	ms_run[2]:scan=11073	63.706	2	1512.8176	1512.8176	K	V	326	338
PSM	MFVLDEADEMLSR	1906	sp|P60842|IF4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	10-UNIMOD:35,13-UNIMOD:267	ms_run[2]:scan=9801	55.656	2	1580.709	1580.7090	K	G	178	191
PSM	MLVNENFEEYLR	1907	sp|P09455|RET1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:35,12-UNIMOD:267	ms_run[2]:scan=10304	58.87	2	1581.7373	1581.7373	K	A	11	23
PSM	MQGQEAVLAMSSR	1908	sp|Q15393|SF3B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:35	ms_run[2]:scan=5040	29.755	2	1422.6595	1422.6595	R	S	706	719
PSM	MTDVFEGSIIR	1909	sp|P42285|MTREX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:267	ms_run[2]:scan=9495	53.965	2	1276.6361	1276.6361	K	C	985	996
PSM	NALESYAFNMK	1910	sp|P0DMV8-2|HS71A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:188	ms_run[2]:scan=8727	49.499	2	1292.6167	1292.6167	K	S	485	496
PSM	NAMGSLASQATK	1911	sp|P55036|PSMD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:188	ms_run[2]:scan=4062	24.529	2	1183.5963	1183.5963	R	D	354	366
PSM	NDLSPASSGNAVYDFFIGR	1912	sp|Q14739|LBR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	19-UNIMOD:267	ms_run[2]:scan=13500	79.436	2	2038.9624	2038.9624	R	E	354	373
PSM	NEGNIFPNPEATFVK	1913	sp|Q9Y5B9|SP16H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	15-UNIMOD:188	ms_run[2]:scan=9852	55.916	2	1681.8407	1681.8407	R	E	582	597
PSM	NFSDNQLQEGK	1914	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:188	ms_run[2]:scan=3109	19.743	2	1284.6042	1284.6042	R	N	161	172
PSM	NIEDVIAQGIGK	1915	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:188	ms_run[2]:scan=9920	56.29	2	1261.6973	1261.6973	K	L	50	62
PSM	NITLDDASAPR	1916	sp|O75534-2|CSDE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:267	ms_run[2]:scan=4751	28.064	2	1181.5916	1181.5916	K	L	728	739
PSM	NLANTVTEEILEK	1917	sp|O60506-4|HNRPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:188	ms_run[2]:scan=11082	63.761	2	1478.7924	1478.7924	R	A	309	322
PSM	NLATTVTEEILEK	1918	sp|O43390-3|HNRPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=12410	72.318	2	1459.777	1459.7770	R	S	309	322
PSM	NLCSDDTPMVR	1919	sp|P30153|2AAA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:4,11-UNIMOD:267	ms_run[2]:scan=4438	26.418	2	1316.5728	1316.5728	R	R	172	183
PSM	NLSSDEATNPISR	1920	sp|Q7Z417|NUFP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:267	ms_run[2]:scan=4170	25.08	2	1412.6771	1412.6771	K	V	110	123
PSM	NNLAGAEELFAR	1921	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9166	52.089	2	1303.6521	1303.6521	R	K	355	367
PSM	NQLTAMSSVLAK	1922	sp|Q14152|EIF3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:188	ms_run[2]:scan=8564	48.634	2	1267.6902	1267.6902	R	A	521	533
PSM	NQLTAMSSVLAK	1923	sp|Q14152|EIF3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8565	48.638	2	1261.67	1261.6700	R	A	521	533
PSM	NSLESYAFNMK	1924	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:188	ms_run[2]:scan=8627	48.977	2	1308.6116	1308.6116	K	A	540	551
PSM	NSLESYAFNMK	1925	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8636	49.023	2	1302.5914	1302.5914	K	A	540	551
PSM	NSPGSQVASNPR	1926	sp|Q9H0D6-2|XRN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=870	8.4639	2	1212.5847	1212.5847	R	Q	371	383
PSM	NTLCAPEVISLINTR	1927	sp|Q96CS3|FAF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	4-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=11696	67.622	2	1709.901	1709.9010	R	M	191	206
PSM	PALELLEPIEQK	1928	sp|P50395|GDIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:188	ms_run[2]:scan=10350	59.168	2	1384.7909	1384.7909	R	F	368	380
PSM	PMCIPPSYADLGK	1929	sp|P45880|VDAC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:4	ms_run[2]:scan=8202	46.654	2	1447.684	1447.6840	R	A	11	24
PSM	QFLEVELDQAR	1930	sp|Q14980-4|NUMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9080	51.578	2	1346.683	1346.6830	R	E	1463	1474
PSM	QLLTLSSELSQAR	1931	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:267	ms_run[2]:scan=9282	52.746	2	1454.7968	1454.7968	R	D	530	543
PSM	QWCNCAFLESSAK	1932	sp|P62834|RAP1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:4,5-UNIMOD:4	ms_run[2]:scan=7868	44.768	2	1599.681	1599.6810	R	S	137	150
PSM	SEGVVAVLLTK	1933	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:188	ms_run[2]:scan=9783	55.565	2	1120.6799	1120.6799	R	K	225	236
PSM	SELPLDPLPVPTEEGNPLLK	1934	sp|Q15758|AAAT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	20-UNIMOD:188	ms_run[2]:scan=13136	77.081	2	2163.177	2163.1770	K	H	503	523
PSM	SEQLEELFSQVGPVK	1935	sp|Q9NW13-2|RBM28_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	15-UNIMOD:188	ms_run[2]:scan=11702	67.661	2	1694.8822	1694.8822	R	Q	17	32
PSM	SGANVLICGPNGCGK	1936	sp|P28288-2|ABCD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	8-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=4967	29.376	2	1502.697	1502.6970	R	S	355	370
PSM	SGAQASSTPLSPTR	1937	sp|P02545-2|LMNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=2068	14.507	2	1358.679	1358.6790	R	I	12	26
PSM	SGGMSNELNNIISR	1938	sp|P53396|ACLY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8756	49.642	2	1490.7147	1490.7147	R	T	663	677
PSM	SGNELPLAVASTADLIR	1939	sp|Q9Y4W2-4|LAS1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11958	69.327	2	1725.9261	1725.9261	R	C	80	97
PSM	SGSGTMNLGGSLTR	1940	sp|P47756-2|CAPZB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5537	32.229	2	1336.6405	1336.6405	K	Q	182	196
PSM	SINSILDYISTSK	1941	sp|P61201|CSN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:188	ms_run[2]:scan=12476	72.739	2	1445.7709	1445.7709	K	Q	111	124
PSM	SLAEGYFDAAGR	1942	sp|O43813|LANC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:267	ms_run[2]:scan=7308	41.604	2	1265.5916	1265.5916	K	L	16	28
PSM	SLDMDSIIAEVK	1943	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11627	67.187	2	1319.6643	1319.6643	R	A	253	265
PSM	SLDMDSIIAEVK	1944	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:188	ms_run[2]:scan=11630	67.208	2	1325.6844	1325.6844	R	A	253	265
PSM	SNCVLEAFGNAK	1945	sp|O94832|MYO1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:4,12-UNIMOD:188	ms_run[2]:scan=7899	44.941	2	1314.6334	1314.6334	K	T	141	153
PSM	SNCVLEAFGNAK	1946	sp|O94832|MYO1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:4	ms_run[2]:scan=7914	45.015	2	1308.6132	1308.6132	K	T	141	153
PSM	SPDFTNENPLETR	1947	sp|P05023-3|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7251	41.23	2	1518.6951	1518.6951	R	N	197	210
PSM	SPEACCELTLQPLR	1948	sp|P06132|DCUP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	5-UNIMOD:4,6-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=8305	47.199	2	1682.7995	1682.7995	R	R	61	75
PSM	SSLLTELSNSLTK	1949	sp|Q9UBK9|UXT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:188	ms_run[2]:scan=12422	72.393	2	1397.7709	1397.7709	K	D	114	127
PSM	SSQSSSQQFSGIGR	1950	sp|Q92841-1|DDX17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=3324	20.839	2	1454.675	1454.6750	R	S	592	606
PSM	STLINSLFLTDLYPER	1951	sp|Q15019|SEPT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	16-UNIMOD:267	ms_run[2]:scan=14224	85.256	2	1890.9966	1890.9966	K	V	51	67
PSM	SVEGLQEGSVLR	1952	sp|O75153|CLU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:267	ms_run[2]:scan=6005	34.589	2	1282.6756	1282.6756	R	V	106	118
PSM	SVGNTIDPVILFQK	1953	sp|P46821|MAP1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	14-UNIMOD:188	ms_run[2]:scan=11456	66.125	2	1535.8655	1535.8655	R	M	401	415
PSM	SYELPDGQVITIGNER	1954	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	16-UNIMOD:267	ms_run[2]:scan=10652	61.107	2	1799.8929	1799.8929	K	F	239	255
PSM	TALINSTGEEVAMR	1955	sp|P02545-2|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	14-UNIMOD:267	ms_run[2]:scan=6457	37.015	2	1500.7482	1500.7482	R	K	528	542
PSM	TALPAQSAATLPAR	1956	sp|Q01082|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5232	30.738	2	1366.7569	1366.7569	K	T	2178	2192
PSM	TAVHAGNINFK	1957	sp|P35221|CTNA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:1	ms_run[2]:scan=5816	33.625	2	1212.6251	1212.6251	M	W	2	13
PSM	TEDFIIDTLELR	1958	sp|Q01780-2|EXOSX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=13074	76.672	2	1463.7508	1463.7508	R	S	335	347
PSM	TFAPEEISAMVLTK	1959	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	10-UNIMOD:35,14-UNIMOD:188	ms_run[2]:scan=9816	55.734	2	1557.8056	1557.8056	K	M	139	153
PSM	TFEMSDFIVDTR	1960	sp|O75369-6|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:267	ms_run[2]:scan=11482	66.288	2	1469.6736	1469.6736	R	D	1993	2005
PSM	TGAAPIIDVVR	1961	sp|P46776|RL27A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:267	ms_run[2]:scan=7206	40.966	2	1120.648	1120.6480	K	S	95	106
PSM	TGAAPIIDVVR	1962	sp|P46776|RL27A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7207	40.97	2	1110.6397	1110.6397	K	S	95	106
PSM	TIAMDGTEGLVR	1963	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	4-UNIMOD:35	ms_run[2]:scan=4803	28.373	2	1277.6286	1277.6286	R	G	110	122
PSM	TIAMDGTEGLVR	1964	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	4-UNIMOD:35,12-UNIMOD:267	ms_run[2]:scan=4948	29.274	2	1287.6368	1287.6368	R	G	110	122
PSM	TIAMDGTEGLVR	1965	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:267	ms_run[2]:scan=6680	38.171	2	1271.6419	1271.6419	R	G	110	122
PSM	TIGGGDDSFNTFFSETGAGK	1966	sp|Q9BQE3|TBA1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11037	63.48	2	2006.8858	2006.8858	K	H	41	61
PSM	TIGGGDDSFNTFFSETGAGK	1967	sp|Q9BQE3|TBA1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10927	62.796	3	2006.8858	2006.8858	K	H	41	61
PSM	TINEVENQILTR	1968	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:267	ms_run[2]:scan=7925	45.074	2	1438.7655	1438.7655	R	D	746	758
PSM	TLADVLVQEVIK	1969	sp|P49441|INPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=13187	77.414	2	1326.7759	1326.7759	K	Q	51	63
PSM	TLNDELEIIEGMK	1970	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:188	ms_run[2]:scan=11955	69.31	2	1509.7692	1509.7692	K	F	206	219
PSM	TLQEEVMEAMGIK	1971	sp|Q96A35|RM24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=13549	79.755	2	1477.7157	1477.7157	K	E	193	206
PSM	TLSFGSDLNYATR	1972	sp|Q14152|EIF3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8633	49.003	2	1443.6994	1443.6994	R	E	490	503
PSM	TLWEDPGIQECYDR	1973	sp|P29992|GNA11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:4	ms_run[2]:scan=8780	49.771	2	1780.7726	1780.7726	K	R	134	148
PSM	TLYSEATSLFIK	1974	sp|Q5T1C6|THEM4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=12671	74.013	2	1371.7286	1371.7286	K	L	221	233
PSM	TSQTVATFLDELAQK	1975	sp|P52888|THOP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	15-UNIMOD:188	ms_run[2]:scan=13112	76.924	3	1656.8666	1656.8666	K	L	287	302
PSM	TVDNFVALATGEK	1976	sp|P23284|PPIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:188	ms_run[2]:scan=9598	54.555	2	1369.7185	1369.7185	K	G	72	85
PSM	TVLITGANSGLGR	1977	sp|Q9HBH5|RDH14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:267	ms_run[2]:scan=5902	34.056	2	1267.7124	1267.7124	K	A	45	58
PSM	TVNTFSQSVSSLFGEDNVR	1978	sp|Q8WY22|BRI3B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=12351	71.937	2	2085.9967	2085.9967	R	A	49	68
PSM	TWCAQDSSLAYER	1979	sp|Q5TBC7|B2L15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=6232	35.754	2	1595.6914	1595.6914	K	A	98	111
PSM	VAGSVTELIQAAEAMK	1980	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=13174	77.335	2	1616.8444	1616.8444	R	G	2276	2292
PSM	VAMFLTDSNNIK	1981	sp|Q15046|SYK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8229	46.801	2	1351.6806	1351.6806	R	E	554	566
PSM	VANEAEFILSR	1982	sp|P50851-2|LRBA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:267	ms_run[2]:scan=8561	48.616	2	1257.6593	1257.6593	R	Q	1895	1906
PSM	VEILANDQGNR	1983	sp|P17066|HSP76_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=2820	18.331	2	1227.6208	1227.6208	R	T	28	39
PSM	VFANNADQQLVK	1984	sp|Q5JVF3-3|PCID2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=4962	29.353	2	1345.699	1345.6990	R	K	94	106
PSM	VFEVNASNLEK	1985	sp|Q9P2J5|SYLC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6581	37.687	2	1248.635	1248.6350	R	Q	29	40
PSM	VGQLSEGAIAAIMQK	1986	sp|P27694|RFA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	15-UNIMOD:188	ms_run[2]:scan=10127	57.626	2	1520.8328	1520.8328	M	G	2	17
PSM	VIGDNPWTPEQLEQCK	1987	sp|Q5VYK3|ECM29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	15-UNIMOD:4	ms_run[2]:scan=9063	51.476	2	1912.8989	1912.8989	R	L	229	245
PSM	VIILGDSGVGK	1988	sp|P51149|RAB7A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6224	35.716	2	1056.6179	1056.6179	K	T	11	22
PSM	VLELVSITANK	1989	sp|P34897-3|GLYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:188	ms_run[2]:scan=8735	49.539	2	1191.717	1191.7170	R	N	378	389
PSM	VLELVSITANK	1990	sp|P34897-3|GLYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8747	49.598	2	1185.6969	1185.6969	R	N	378	389
PSM	VLGQVSCELVSPK	1991	sp|Q06265|EXOS9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	7-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=6854	39.117	2	1420.7691	1420.7691	R	L	55	68
PSM	VLIGGDETPEGQR	1992	sp|O60701-3|UGDH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:267	ms_run[2]:scan=4206	25.251	2	1379.692	1379.6920	R	A	81	94
PSM	VLISDSLDPCCR	1993	sp|O43175|SERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	10-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=7633	43.501	2	1433.6643	1433.6643	K	K	9	21
PSM	VLNYAPGPLDTDMQQLAR	1994	sp|P35270|SPRE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	18-UNIMOD:267	ms_run[2]:scan=10709	61.463	2	2011.0072	2011.0072	R	E	193	211
PSM	VLQQFADNDVSR	1995	sp|P51659-3|DHB4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5078	29.951	2	1390.6841	1390.6841	R	F	526	538
PSM	VLQSEFCNAVR	1996	sp|Q9NUP9|LIN7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	7-UNIMOD:4,11-UNIMOD:267	ms_run[2]:scan=5939	34.237	2	1331.6531	1331.6531	R	E	41	52
PSM	VLVDQTTGLSR	1997	sp|Q15717|ELAV1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:267	ms_run[2]:scan=4610	27.314	2	1197.6593	1197.6593	R	G	137	148
PSM	VLYPNDNFFEGK	1998	sp|P11216|PYGB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9309	52.901	2	1441.6878	1441.6878	R	E	279	291
PSM	VMENSSGTPDILTR	1999	sp|Q96GD4-3|AURKB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6072	34.953	2	1518.7348	1518.7348	K	R	57	71
PSM	VMQPQILEVNFNPDCER	2000	sp|Q14166|TTL12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	15-UNIMOD:4	ms_run[2]:scan=10760	61.778	2	2087.9768	2087.9768	R	A	598	615
PSM	VQAWYMDDAPGDPR	2001	sp|Q9BV57|MTND_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	14-UNIMOD:267	ms_run[2]:scan=8031	45.641	2	1629.7121	1629.7121	M	Q	2	16
PSM	VVAEPVELAQEFR	2002	sp|O75489|NDUS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:267	ms_run[2]:scan=9922	56.299	2	1495.791	1495.7910	R	K	219	232
PSM	VVIFQQEQENK	2003	sp|P63151|2ABA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:188	ms_run[2]:scan=5051	29.811	2	1366.7188	1366.7188	R	I	52	63
PSM	VVIFQQEQENK	2004	sp|P63151|2ABA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5054	29.824	2	1360.6987	1360.6987	R	I	52	63
PSM	VVLAYEPVWAIGTGK	2005	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	15-UNIMOD:188	ms_run[2]:scan=11844	68.545	2	1607.9019	1607.9019	K	T	198	213
PSM	VVLIGDSGVGK	2006	sp|P62491-2|RB11A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5573	32.4	2	1042.6023	1042.6023	K	S	14	25
PSM	YCAQDAFFQVK	2007	sp|Q13011|ECH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:4	ms_run[2]:scan=8568	48.65	2	1375.6231	1375.6231	R	E	186	197
PSM	YIVPMLTVDGK	2008	sp|P14550|AK1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:188	ms_run[2]:scan=9930	56.347	2	1240.6833	1240.6833	R	R	298	309
PSM	YLAEVACGDDR	2009	sp|P27348|1433T_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	7-UNIMOD:4,11-UNIMOD:267	ms_run[2]:scan=3906	23.74	2	1277.5586	1277.5586	R	K	128	139
PSM	YPASTVQILGAEK	2010	sp|O00567|NOP56_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:188	ms_run[2]:scan=7001	39.878	2	1381.7549	1381.7549	K	A	321	334
PSM	LEGLTDEINFLR	2011	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=12252	71.30229333333334	2	1419.722121	1418.740545	R	Q	214	226
PSM	QQCFSKDIVENYFMR	2012	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:28,3-UNIMOD:4,6-UNIMOD:188,14-UNIMOD:35,15-UNIMOD:267	ms_run[1]:scan=11157	64.22686333333333	2	1979.8922	1978.8882	K	D	122	137
PSM	QAVTNPNNTFYATKR	2013	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:28	ms_run[1]:scan=5430	31.6947	2	1706.8359	1706.8371	R	L	108	123
PSM	SYELPDGQVITIGNER	2014	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=10844	62.289291666666664	2	1792.869246	1789.884643	K	F	241	257
PSM	LDIDPETITWQR	2015	sp|P11586|C1TC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=10356	59.20874499999999	2	1485.746196	1485.746358	R	V	521	533
PSM	GVVDSEDLPLNISR	2016	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	14-UNIMOD:267	ms_run[1]:scan=8961	50.82132166666667	2	1522.787893	1522.786656	R	E	387	401
PSM	FAMEPEEFDSDTLR	2017	sp|P13667|PDIA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=9599	54.55992166666667	2	1685.724165	1685.724302	K	E	486	500
PSM	QASPNIVIALAGNKADLASK	2018	sp|P51148|RAB5C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:28,14-UNIMOD:188,20-UNIMOD:188	ms_run[1]:scan=11194	64.46975833333333	2	1975.1149	1975.1136	R	R	122	142
PSM	ACANPAAGSVILLENLR	2019	sp|P00558|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	2-UNIMOD:4,17-UNIMOD:267	ms_run[1]:scan=12405	72.28413666666667	2	1778.916939	1777.938423	K	F	107	124
PSM	FQDGDLTLYQSNTILR	2020	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=10654	61.119315	2	1883.929551	1882.942492	K	H	56	72
PSM	NALLQLTDSQIADVAR	2021	sp|O75643|U520_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=11311	65.22062333333332	2	1727.928144	1726.921363	R	F	1994	2010
PSM	QELILSNSEDKSIR	2022	sp|P53621|COPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:28	ms_run[1]:scan=7795	44.385686666666665	2	1613.8291	1613.8255	R	V	261	275
PSM	LVLCQVNEIQK	2023	sp|Q9C075|K1C23_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	4-UNIMOD:4,11-UNIMOD:188	ms_run[1]:scan=6529	37.40940166666667	2	1348.749638	1348.748001	R	H	410	421
PSM	QAEEEKMALPELVR	2024	sp|P45974|UBP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:28	ms_run[1]:scan=9744	55.34676166666667	2	1624.8129	1624.8125	R	A	511	525
PSM	AIFTTGQGASAVGLTAYVQR	2025	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	20-UNIMOD:267	ms_run[1]:scan=10457	59.864475	2	2021.0302	2020.0612	R	H	543	563
PSM	QAVSMFLGAVEEAKK	2026	sp|P49419|AL7A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:28,14-UNIMOD:188,15-UNIMOD:188	ms_run[1]:scan=13040	76.45808166666667	2	1601.8488	1601.8521	K	E	376	391
PSM	VEFEELCADLFER	2027	sp|Q9Y4L1|HYOU1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	7-UNIMOD:4	ms_run[1]:scan=12764	74.61194	2	1656.751094	1655.750124	R	V	346	359
PSM	QKLDPAASVTGSK	2028	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:28,2-UNIMOD:188,13-UNIMOD:188	ms_run[1]:scan=4728	27.928811666666665	2	1295.7052	1295.7119	K	R	1440	1453
PSM	CNVWILDGDLYHK	2029	sp|O43237|DC1L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=12877	75.32332833333334	2	1614.7516	1614.7495	R	G	104	117
PSM	CNVWILDGDLYHK	2030	sp|O43237|DC1L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:385,1-UNIMOD:4,13-UNIMOD:188	ms_run[1]:scan=12883	75.36263833333334	2	1620.7698	1620.7697	R	G	104	117
PSM	ATENDIYNFFSPLNPVR	2031	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=13609	80.15841833333333	2	1996.954765	1995.969041	R	V	300	317
PSM	QVHCEEFIPEFEK	2032	sp|Q14166|TTL12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:28,4-UNIMOD:4,13-UNIMOD:188	ms_run[1]:scan=9731	55.27520333333333	2	1679.7584	1679.7592	K	Q	525	538
PSM	QVHCEEFIPEFEK	2033	sp|Q14166|TTL12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:28,4-UNIMOD:4	ms_run[1]:scan=9723	55.233394999999994	2	1673.7393	1673.7390	K	Q	525	538
PSM	SLEEGEGPIAVIMTPTR	2034	sp|Q7L014|DDX46_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	17-UNIMOD:267	ms_run[1]:scan=11118	63.98215333333333	2	1809.920303	1808.921769	R	E	439	456
PSM	SLEEGEGPIAVIMTPTR	2035	sp|Q7L014|DDX46_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	17-UNIMOD:267	ms_run[1]:scan=11147	64.16564666666667	2	1809.920303	1808.921769	R	E	439	456
PSM	QKQSLEYLEQVR	2036	sp|Q9BZE4|NOG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:28	ms_run[1]:scan=8403	47.742595	2	1502.7755	1502.7724	R	Q	144	156
PSM	NSEGWEQNGLYEFFR	2037	sp|Q8IWX8|CHERP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	15-UNIMOD:267	ms_run[1]:scan=13235	77.723835	2	1885.815245	1884.830646	R	A	704	719
PSM	LAATNALLNSLEFTK	2038	sp|Q14974|IMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	15-UNIMOD:188	ms_run[1]:scan=12768	74.64170333333334	2	1611.884681	1610.897502	K	A	192	207
PSM	IMPEDIIINCSK	2039	sp|P11387|TOP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	10-UNIMOD:4	ms_run[1]:scan=9321	52.963776666666675	2	1431.711276	1431.710173	R	D	377	389
PSM	DFNLILESLCRGNSVER	2040	sp|Q92542-2|NICA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	10-UNIMOD:4	ms_run[1]:scan=11366	65.56843666666667	2	2021.0242	2020.9992	M	K	2	19
PSM	LENYPIPEPGPNEVLLR	2041	sp|Q00796|DHSO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=10622	60.919675	2	1950.034308	1949.025828	R	M	22	39
PSM	YFEIQFSPGGEPDGGK	2042	sp|Q12965|MYO1E_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=9700	55.10105333333333	2	1727.817201	1726.783866	K	I	173	189
PSM	QSIWTSTISSHLATK	2043	sp|P09417|DHPR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:28	ms_run[1]:scan=10772	61.847206666666665	2	1643.8432	1641.8362	K	H	110	125
PSM	SPVEVAQDVLAAVGK	2044	sp|Q6IAN0|DRS7B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=13094	76.80686333333333	2	1481.799633	1481.808959	R	K	268	283
PSM	FGPYYTEPVIAGLDPK	2045	sp|P49720|PSB3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	16-UNIMOD:188	ms_run[1]:scan=11193	64.46372833333334	2	1772.943434	1771.912817	R	T	100	116
PSM	SINSILDYISTSK	2046	sp|P61201|CSN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=12474	72.72699	2	1439.758153	1439.750775	K	Q	111	124
PSM	TEDFIIDTLELR	2047	sp|Q01780|EXOSX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	12-UNIMOD:267	ms_run[1]:scan=13071	76.65472166666667	2	1475.736235	1473.759044	R	S	335	347
PSM	FLEGTSCIAGVFVDATK	2048	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	7-UNIMOD:4,17-UNIMOD:188	ms_run[1]:scan=12203	70.98525333333333	2	1819.916956	1819.912166	K	E	4065	4082
PSM	AAGPLLTDECR	2049	sp|Q9BQ69|MACD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	10-UNIMOD:4	ms_run[2]:scan=4215	25.293	2	1201.5761	1201.5761	R	T	190	201
PSM	AALEALGSCLNNK	2050	sp|P34897-3|GLYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	9-UNIMOD:4	ms_run[2]:scan=6971	39.731	2	1359.6816	1359.6816	R	Y	62	75
PSM	AANPGCSLEDFVR	2051	sp|Q15042-4|RB3GP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:4	ms_run[2]:scan=8741	49.566	2	1434.6562	1434.6562	K	W	644	657
PSM	AASCVLLHTGQK	2052	sp|P14550|AK1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:1,4-UNIMOD:4	ms_run[2]:scan=6176	35.479	2	1325.6762	1325.6762	M	M	2	14
PSM	ADLINNLGTIAK	2053	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:188	ms_run[2]:scan=8863	50.248	2	1247.7181	1247.7181	K	S	101	113
PSM	AFCADQLDVFLQK	2054	sp|Q9P2N5|RBM27_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=11837	68.494	2	1559.7749	1559.7749	K	E	47	60
PSM	AFQYADGLEQLR	2055	sp|Q9BU89|DOHH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9086	51.616	2	1409.6939	1409.6939	R	G	287	299
PSM	AIAELGIYPAVDPLDSTSR	2056	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11670	67.458	2	1987.0262	1987.0262	R	I	388	407
PSM	AIDTTQLFSLPK	2057	sp|Q16822|PCKGM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10929	62.806	2	1332.7289	1332.7289	R	D	589	601
PSM	AIEMLGGELGSK	2058	sp|P07954-2|FUMH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:188	ms_run[2]:scan=7927	45.082	2	1209.6371	1209.6371	R	I	118	130
PSM	AKYPDYEVTWANDGY	2059	sp|Q9NRX4|PHP14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9414	53.501	2	1790.7788	1790.7788	K	-	111	126
PSM	ALAGCDFLTISPK	2060	sp|P37837|TALDO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	5-UNIMOD:4	ms_run[2]:scan=9677	54.973	2	1391.7119	1391.7119	K	L	246	259
PSM	ALDELFEAIEQK	2061	sp|Q27J81|INF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:188	ms_run[2]:scan=12605	73.585	2	1410.7338	1410.7338	R	Q	878	890
PSM	ALTSEIALLQSR	2062	sp|P04843|RPN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:267	ms_run[2]:scan=9643	54.794	2	1310.7433	1310.7433	K	L	525	537
PSM	AMDLVQEEFLQR	2063	sp|Q9HB07|MYG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9905	56.198	2	1477.7235	1477.7235	R	L	220	232
PSM	ANDTTFGLAAGVFTR	2064	sp|P49189-2|AL9A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10942	62.883	2	1539.7682	1539.7682	R	D	342	357
PSM	ANLNLENLLEATK	2065	sp|Q9NS87-4|KIF15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:188	ms_run[2]:scan=11942	69.221	2	1447.7978	1447.7978	K	A	626	639
PSM	APPPSLTDCIGTVDSR	2066	sp|Q9NZZ3-2|CHMP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	9-UNIMOD:4	ms_run[2]:scan=7353	41.876	2	1684.809	1684.8090	K	A	12	28
PSM	AQFEGIVTDLIR	2067	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=12122	70.44	2	1360.7351	1360.7351	R	R	349	361
PSM	AQIFANTVDNAR	2068	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:267	ms_run[2]:scan=5331	31.216	2	1328.6712	1328.6712	R	I	138	150
PSM	AQSVGDSEVAAIGQLAFLR	2069	sp|Q96ME1-2|FXL18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=13295	78.106	2	1931.0112	1931.0112	R	H	516	535
PSM	ATAEVLNIGKK	2070	sp|P22234|PUR6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:1	ms_run[2]:scan=7076	40.265	2	1184.6765	1184.6765	M	L	2	13
PSM	AVGQGCVEIGSQR	2071	sp|P06400|RB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=3309	20.756	2	1369.6648	1369.6648	K	Y	433	446
PSM	AVLENNLGAAVLR	2072	sp|Q9NZL9-3|MAT2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8566	48.642	2	1338.7619	1338.7619	K	I	169	182
PSM	AYGPGIEPTGNMVK	2073	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5909	34.091	2	1432.7021	1432.7021	R	K	286	300
PSM	AYTSPLIDMFNNPATAAPNSQR	2074	sp|Q9UHR4|BI2L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	22-UNIMOD:267	ms_run[2]:scan=12144	70.59	2	2388.1408	2388.1408	R	V	292	314
PSM	CCSGAIIVLTK	2075	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:4,2-UNIMOD:4	ms_run[2]:scan=6545	37.495	2	1220.6257	1220.6257	K	S	423	434
PSM	CQSLTEDLEFR	2076	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:4,11-UNIMOD:267	ms_run[2]:scan=8726	49.495	2	1406.6375	1406.6375	R	K	198	209
PSM	CQSLTEDLEFR	2077	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:4	ms_run[2]:scan=8728	49.503	2	1396.6293	1396.6293	R	K	198	209
PSM	CSVLAAANPVYGR	2078	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=6665	38.095	2	1386.6953	1386.6953	R	Y	446	459
PSM	DGPNALTPPPTTPEWIK	2079	sp|P05023-3|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9607	54.605	2	1832.9309	1832.9309	R	F	44	61
PSM	DILYVFQGIDGK	2080	sp|Q96CW5-3|GCP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:188	ms_run[2]:scan=12468	72.687	2	1372.7334	1372.7334	R	N	253	265
PSM	DLGTESQIFISR	2081	sp|P50395|GDIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:267	ms_run[2]:scan=8911	50.531	2	1374.7019	1374.7019	K	T	391	403
PSM	DLSIGNPIPTVVSGAR	2082	sp|O95104-3|SCAF4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10428	59.677	2	1594.8679	1594.8679	K	G	763	779
PSM	EANLLNAVIVQR	2083	sp|Q9UNZ2-4|NSF1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:267	ms_run[2]:scan=9859	55.953	2	1348.7702	1348.7702	K	L	326	338
PSM	EDGVTPYMIFFK	2084	sp|P13693-2|TCTP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=13323	78.291	2	1445.6901	1445.6901	R	D	119	131
PSM	EGDVLTLLESER	2085	sp|P62857|RS28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:267	ms_run[2]:scan=11449	66.083	2	1369.6964	1369.6964	R	E	52	64
PSM	EGPAVVGQFIQDVK	2086	sp|Q86VP6|CAND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	14-UNIMOD:188	ms_run[2]:scan=10723	61.553	2	1491.8029	1491.8029	K	N	813	827
PSM	EGPVLATSSGAGVFK	2087	sp|Q9H4A3-2|WNK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7181	40.81	2	1418.7405	1418.7405	K	M	1595	1610
PSM	ELDPILTEVTLMNAR	2088	sp|Q9H9E3-3|COG4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	15-UNIMOD:267	ms_run[2]:scan=13024	76.353	2	1723.9054	1723.9054	R	S	278	293
PSM	ELPPDQAEYCIAR	2089	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	10-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=5997	34.542	2	1570.7325	1570.7325	R	M	870	883
PSM	EQLLQSNPVLEAFGNAK	2090	sp|O43795|MYO1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	17-UNIMOD:188	ms_run[2]:scan=12365	72.03	2	1862.9834	1862.9834	K	T	140	157
PSM	EVDDLEQWIAER	2091	sp|Q01082|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11521	66.528	2	1501.7049	1501.7049	R	E	1706	1718
PSM	FAIQDISVEETSAK	2092	sp|O43707|ACTN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	14-UNIMOD:188	ms_run[2]:scan=8621	48.943	2	1542.7873	1542.7873	R	E	153	167
PSM	FDDGAGGDNEVQR	2093	sp|P35998|PRS7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=1921	13.748	2	1378.5749	1378.5749	R	T	285	298
PSM	FDQPLEASTWLK	2094	sp|P51398-2|RT29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10583	60.669	2	1433.7191	1433.7191	R	N	137	149
PSM	FGDLLNIDDTAK	2095	sp|Q9BX66-8|SRBS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:188	ms_run[2]:scan=9591	54.514	2	1326.6763	1326.6763	R	R	554	566
PSM	FLEQLQELDAK	2096	sp|Q8N1B4-2|VPS52_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9549	54.274	2	1332.6925	1332.6925	R	A	70	81
PSM	FMQDPMEIFVDDETK	2097	sp|Q13838|DX39B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	15-UNIMOD:188	ms_run[2]:scan=13045	76.487	2	1849.821	1849.8210	K	L	242	257
PSM	FSGDLDDQTCR	2098	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	10-UNIMOD:4,11-UNIMOD:267	ms_run[2]:scan=3290	20.654	2	1322.5436	1322.5436	K	E	236	247
PSM	FSMVVQDGIVK	2099	sp|P30044-4|PRDX5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:188	ms_run[2]:scan=8345	47.412	2	1227.6629	1227.6629	R	A	92	103
PSM	FVAPEEVLPFTEGDILEK	2100	sp|P49770|EI2BB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	18-UNIMOD:188	ms_run[2]:scan=13264	77.909	2	2038.0606	2038.0606	K	V	288	306
PSM	GADFLVTEVENGGSLGSK	2101	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	18-UNIMOD:188	ms_run[2]:scan=10551	60.465	2	1784.8888	1784.8888	K	K	189	207
PSM	GALQNIIPASTGAAK	2102	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	15-UNIMOD:188	ms_run[2]:scan=7703	43.9	2	1416.8032	1416.8032	R	A	159	174
PSM	GALTTVEGLITR	2103	sp|O75312|ZPR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:267	ms_run[2]:scan=10867	62.432	2	1239.7062	1239.7062	K	A	141	153
PSM	GANDFMCDEMER	2104	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	7-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=6844	39.065	2	1483.5406	1483.5406	R	S	379	391
PSM	GASQAGMTGYGMPR	2105	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	14-UNIMOD:267	ms_run[2]:scan=4921	29.113	2	1392.6154	1392.6154	R	Q	183	197
PSM	GAVSAEQVIAGFNR	2106	sp|Q9UHV9|PFD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	14-UNIMOD:267	ms_run[2]:scan=9497	53.98	2	1427.7396	1427.7396	K	L	19	33
PSM	GDIIGVQGNPGK	2107	sp|Q15046|SYK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=3787	23.152	2	1153.6091	1153.6091	R	T	179	191
PSM	GFVLQDTVEQLR	2108	sp|P56192-2|SYMC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10151	57.783	2	1403.7409	1403.7409	R	C	377	389
PSM	GIDPFSLDALSK	2109	sp|P40227-2|TCPZ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:188	ms_run[2]:scan=11433	65.983	2	1267.6755	1267.6755	K	E	251	263
PSM	GIDPFSLDALSK	2110	sp|P40227-2|TCPZ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11434	65.988	2	1261.6554	1261.6554	K	E	251	263
PSM	GIGELVSEEPFVVK	2111	sp|Q9NVH0-2|EXD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	14-UNIMOD:188	ms_run[2]:scan=11173	64.33	2	1507.8229	1507.8229	K	L	258	272
PSM	GISDPLTVFEQTEAAAR	2112	sp|O00116|ADAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	17-UNIMOD:267	ms_run[2]:scan=12670	74.007	3	1813.9086	1813.9086	R	E	587	604
PSM	GISLNPEQWSQLK	2113	sp|P53999|TCP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:188	ms_run[2]:scan=10909	62.683	2	1504.7981	1504.7981	K	E	102	115
PSM	GSGIFDESTPVQTR	2114	sp|Q9H910-2|JUPI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6543	37.481	2	1492.7158	1492.7158	K	Q	52	66
PSM	GTVTDFPGFDER	2115	sp|P08758|ANXA5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:267	ms_run[2]:scan=8331	47.336	2	1349.6127	1349.6127	R	A	7	19
PSM	GVDEVTIVNILTNR	2116	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=12833	75.052	3	1541.8413	1541.8413	K	S	50	64
PSM	GVIDMGNSLIER	2117	sp|Q13813-3|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9104	51.726	2	1302.6602	1302.6602	R	G	1588	1600
PSM	GVVDSEDLPLNISR	2118	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8964	50.839	2	1512.7784	1512.7784	R	E	387	401
PSM	GYISPYFINTSK	2119	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:188	ms_run[2]:scan=8744	49.586	2	1394.7177	1394.7177	R	G	222	234
PSM	GYISPYFINTSK	2120	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8746	49.594	2	1388.6976	1388.6976	R	G	222	234
PSM	IANLQTDLSDGLR	2121	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8665	49.185	2	1414.7416	1414.7416	R	L	64	77
PSM	IANPVEGSSGR	2122	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:267	ms_run[2]:scan=2056	14.446	2	1095.5548	1095.5548	K	Q	315	326
PSM	IGEGTYGTVFK	2123	sp|Q00535-2|CDK5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6587	37.71	2	1170.5921	1170.5921	K	A	10	21
PSM	IGELLDQASVTR	2124	sp|Q9NX46|ARHL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:267	ms_run[2]:scan=6932	39.512	2	1310.7069	1310.7069	K	E	249	261
PSM	IIAINSELTQPK	2125	sp|Q8WVX9|FACR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:188	ms_run[2]:scan=7074	40.251	2	1331.7756	1331.7756	K	L	79	91
PSM	IIYGGSVTGATCK	2126	sp|P60174|TPIS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=4297	25.69	2	1331.6851	1331.6851	R	E	244	257
PSM	ILAQSASVEEVFR	2127	sp|Q15643-2|TRIPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:267	ms_run[2]:scan=8973	50.896	2	1457.7754	1457.7754	R	L	377	390
PSM	ILYSQCGDVMR	2128	sp|P60660-2|MYL6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:4,11-UNIMOD:267	ms_run[2]:scan=5539	32.237	2	1350.63	1350.6300	K	A	27	38
PSM	IMPEDIIINCSK	2129	sp|P11387|TOP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	10-UNIMOD:4,12-UNIMOD:188	ms_run[2]:scan=9247	52.534	2	1437.7303	1437.7303	R	D	377	389
PSM	INISEGNCPER	2130	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	8-UNIMOD:4,11-UNIMOD:267	ms_run[2]:scan=2822	18.34	2	1297.596	1297.5960	R	I	47	58
PSM	INVYYNEATGGK	2131	sp|P68371|TBB4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:188	ms_run[2]:scan=4998	29.541	2	1333.661	1333.6610	R	Y	47	59
PSM	IQSIAPSLQVITSK	2132	sp|P42345|MTOR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9133	51.902	2	1483.861	1483.8610	R	Q	2153	2167
PSM	ISANENSLAVR	2133	sp|Q9UHB6|LIMA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:267	ms_run[2]:scan=3764	23.034	2	1182.6232	1182.6232	K	S	325	336
PSM	ISGLGLTPEQK	2134	sp|O95831-3|AIFM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:188	ms_run[2]:scan=5519	32.146	2	1147.6544	1147.6544	R	Q	95	106
PSM	ITSGPFEPDLYK	2135	sp|Q9UQ80-2|PA2G4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8286	47.102	2	1365.6816	1365.6816	R	S	279	291
PSM	IVDNLGASGNSLYQR	2136	sp|Q6PGP7|TTC37_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6383	36.602	2	1605.8111	1605.8111	K	N	335	350
PSM	IVEIPFNSTNK	2137	sp|P05023-3|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7122	40.493	2	1260.6714	1260.6714	K	Y	446	457
PSM	LAAIAESGVER	2138	sp|P28072|PSB6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:267	ms_run[2]:scan=3987	24.15	2	1124.6065	1124.6065	R	Q	210	221
PSM	LAPALATGNTVVMK	2139	sp|P30837|AL1B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6782	38.714	2	1384.7748	1384.7748	K	V	196	210
PSM	LAPDYDALDVANKIGII	2140	sp|P62750|RL23A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:188	ms_run[2]:scan=13351	78.474	2	1805.987	1805.9870	R	-	140	157
PSM	LAQLEAALQQAK	2141	sp|Q6KB66-2|K2C80_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:188	ms_run[2]:scan=7686	43.801	2	1288.7446	1288.7446	K	Q	345	357
PSM	LCVPAMNVNDSVTK	2142	sp|O43865|SAHH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:4	ms_run[2]:scan=7612	43.384	2	1546.7483	1546.7483	K	Q	271	285
PSM	LDPSIFESLQK	2143	sp|Q9Y265|RUVB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10039	57.011	2	1275.6711	1275.6711	K	E	172	183
PSM	LDQPMTEIVSR	2144	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6695	38.24	2	1287.6493	1287.6493	R	V	971	982
PSM	LEEGPPVTTVLTR	2145	sp|P08559-3|ODPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7756	44.186	2	1410.7718	1410.7718	R	E	46	59
PSM	LEGLTDEINFLR	2146	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:267	ms_run[2]:scan=12080	70.152	2	1428.7488	1428.7488	R	Q	214	226
PSM	LEGLTDEINFLR	2147	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:267	ms_run[2]:scan=12536	73.134	2	1428.7488	1428.7488	R	Q	214	226
PSM	LEGLTDEINFLR	2148	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=12230	71.165	2	1418.7405	1418.7405	R	Q	214	226
PSM	LEIEPEWAYGK	2149	sp|Q00688|FKBP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:188	ms_run[2]:scan=9277	52.715	2	1339.6755	1339.6755	R	K	190	201
PSM	LELFLPEEYPMAAPK	2150	sp|P61088|UBE2N_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:35	ms_run[2]:scan=11457	66.13	2	1762.8852	1762.8852	K	V	54	69
PSM	LEYCEALAMLR	2151	sp|P14868|SYDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	4-UNIMOD:4,11-UNIMOD:267	ms_run[2]:scan=11391	65.73	2	1377.666	1377.6660	R	E	346	357
PSM	LEYCEALAMLR	2152	sp|P14868|SYDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	4-UNIMOD:4	ms_run[2]:scan=11392	65.736	2	1367.6577	1367.6577	R	E	346	357
PSM	LFSADPFDLEAQAK	2153	sp|Q5TDH0-2|DDI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11305	65.182	2	1550.7617	1550.7617	R	I	192	206
PSM	LGADAVGMSTVPEVIVAR	2154	sp|P00491|PNPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10373	59.314	2	1783.9502	1783.9502	K	H	212	230
PSM	LGEMWSEQSAK	2155	sp|P26583|HMGB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:188	ms_run[2]:scan=5559	32.332	2	1270.5959	1270.5959	K	D	129	140
PSM	LGEMWSEQSAK	2156	sp|P26583|HMGB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5569	32.378	2	1264.5758	1264.5758	K	D	129	140
PSM	LGNYAGAVQDCER	2157	sp|O43765|SGTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=4110	24.785	2	1461.6546	1461.6546	K	A	138	151
PSM	LICCDILDVLDK	2158	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:4,4-UNIMOD:4	ms_run[2]:scan=12865	75.253	2	1475.7364	1475.7364	K	H	95	107
PSM	LLDLVQQSCNYK	2159	sp|P55769|NH2L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	9-UNIMOD:4	ms_run[2]:scan=7773	44.27	2	1479.7392	1479.7392	K	Q	22	34
PSM	LLESLDQLELR	2160	sp|O95816|BAG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10787	61.936	2	1327.7347	1327.7347	R	V	28	39
PSM	LLLENYEEYAAR	2161	sp|Q16763|UBE2S_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:267	ms_run[2]:scan=9314	52.925	2	1492.7437	1492.7437	R	A	136	148
PSM	LLQEALEAEER	2162	sp|Q96JY6-4|PDLI2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6821	38.929	2	1299.667	1299.6670	R	G	244	255
PSM	LLSSGFDIDTPDDFGR	2163	sp|O15084-2|ANR28_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10833	62.221	2	1753.8159	1753.8159	K	T	237	253
PSM	LNVDEAFEQLVR	2164	sp|P10301|RRAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=12726	74.367	2	1431.7358	1431.7358	R	A	177	189
PSM	LQEVIETLLSLEK	2165	sp|O00232|PSD12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=14020	83.269	2	1513.8603	1513.8603	R	Q	40	53
PSM	LQGETLDQQLGR	2166	sp|O15118-2|NPC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5332	31.22	2	1356.6997	1356.6997	R	V	397	409
PSM	LSGLADQMVAR	2167	sp|O95400|CD2B2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:267	ms_run[2]:scan=6039	34.768	2	1169.6102	1169.6102	R	G	202	213
PSM	LSLQNCCLTGAGCGVLSSTLR	2168	sp|P13489|RINI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:4,7-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=10610	60.841	3	2266.0868	2266.0868	K	T	90	111
PSM	LSQLEGVNVER	2169	sp|Q96QK1|VPS35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5349	31.305	2	1242.6568	1242.6568	R	Y	227	238
PSM	LSSDVLTLLIK	2170	sp|P36776-3|LONM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=12929	75.701	2	1200.7329	1200.7329	K	Q	495	506
PSM	LSSTWEGIQAGK	2171	sp|P37837|TALDO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6092	35.052	2	1275.6459	1275.6459	K	E	143	155
PSM	LSTMETGTGLIR	2172	sp|P29144|TPP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6629	37.919	2	1277.6649	1277.6649	R	A	301	313
PSM	LTFSCLGGSDNFK	2173	sp|Q15185-2|TEBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	5-UNIMOD:4	ms_run[2]:scan=8760	49.662	2	1444.6657	1444.6657	K	H	36	49
PSM	LTPITYPQGLAMAK	2174	sp|P63000|RAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9182	52.181	2	1502.8167	1502.8167	K	E	134	148
PSM	LVLVGDGGTGK	2175	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:188	ms_run[2]:scan=4429	26.376	2	1020.5911	1020.5911	K	T	13	24
PSM	LVQSPNSYFMDVK	2176	sp|Q71UM5|RS27L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:188	ms_run[2]:scan=8717	49.452	2	1532.764	1532.7640	R	C	24	37
PSM	LVSDGNINSDR	2177	sp|Q01082|SPTB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:267	ms_run[2]:scan=2063	14.485	2	1198.5817	1198.5817	R	I	1235	1246
PSM	LVSESSDVLPK	2178	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4974	29.415	2	1172.6289	1172.6289	K	-	473	484
PSM	LYDNLLEQNLIR	2179	sp|O00231|PSD11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11076	63.723	2	1502.8093	1502.8093	K	V	326	338
PSM	LYEIGAGTSEVR	2180	sp|P26440-2|IVD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5757	33.313	2	1293.6565	1293.6565	K	R	372	384
PSM	MDDEEETYRLWK	2181	sp|P19388|RPAB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:1	ms_run[2]:scan=9764	55.46	2	1655.7137	1655.7137	-	I	1	13
PSM	MIEEAGAIISTR	2182	sp|O00154-2|BACH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:35,12-UNIMOD:267	ms_run[2]:scan=5877	33.928	2	1315.6681	1315.6681	K	H	37	49
PSM	MLLCEAVAAVMAK	2183	sp|P54136-2|SYRC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	4-UNIMOD:4	ms_run[2]:scan=13521	79.574	2	1405.7131	1405.7132	R	G	563	576
PSM	MLTAQDVSYDEAR	2184	sp|O15020-2|SPTN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:35	ms_run[2]:scan=4943	29.245	2	1513.6719	1513.6719	K	N	1298	1311
PSM	MLVNENFEEYLR	2185	sp|P09455|RET1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:35,12-UNIMOD:267	ms_run[2]:scan=10402	59.505	2	1581.7373	1581.7373	K	A	11	23
PSM	MLVNENFEEYLR	2186	sp|P09455|RET1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:267	ms_run[2]:scan=11320	65.278	2	1565.7423	1565.7423	K	A	11	23
PSM	MTDQEAIQDLWQWR	2187	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	14-UNIMOD:267	ms_run[2]:scan=13439	79.038	2	1828.8442	1828.8442	R	K	278	292
PSM	MVVESAYEVIK	2188	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:35,11-UNIMOD:188	ms_run[2]:scan=6586	37.706	2	1288.668	1288.6680	K	L	234	245
PSM	MVVESAYEVIK	2189	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:35	ms_run[2]:scan=6592	37.736	2	1282.6479	1282.6479	K	L	234	245
PSM	NAFYIGSYQQCINEAQR	2190	sp|O14579|COPE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:4	ms_run[2]:scan=9105	51.731	3	2060.9374	2060.9374	K	V	24	41
PSM	NALANPLYCPDYR	2191	sp|P22695|QCR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	9-UNIMOD:4	ms_run[2]:scan=8081	45.931	2	1565.7297	1565.7297	R	I	184	197
PSM	NALFPEVFSPTPDENSDQNSR	2192	sp|Q8IVT2|MISP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10966	63.033	2	2363.0666	2363.0666	R	S	567	588
PSM	NAVTQEFGPVPDTAR	2193	sp|Q99798|ACON_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	15-UNIMOD:267	ms_run[2]:scan=6969	39.722	2	1610.7928	1610.7928	R	Y	634	649
PSM	NCIVLIDSTPYR	2194	sp|P62241|RS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=8556	48.594	2	1459.7369	1459.7369	K	Q	99	111
PSM	NEPQNATGAPGR	2195	sp|P51148|RAB5C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=708	7.6262	2	1210.5691	1210.5691	K	N	185	197
PSM	NEPQNPGANSAR	2196	sp|P20339-2|RAB5A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:267	ms_run[2]:scan=637	7.2392	2	1263.5831	1263.5831	K	G	170	182
PSM	NGPALQEAYVR	2197	sp|Q9UJU6|DBNL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4992	29.51	2	1216.62	1216.6200	R	V	8	19
PSM	NIFIECTGTDFTK	2198	sp|Q9NSD9-2|SYFB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:4	ms_run[2]:scan=9066	51.497	2	1544.7181	1544.7181	R	A	151	164
PSM	NINSINFDNPVYQK	2199	sp|P01130-2|LDLR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8411	47.788	2	1664.8158	1664.8158	K	T	639	653
PSM	NLAMGVNLTSMSK	2200	sp|P12004|PCNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:188	ms_run[2]:scan=8693	49.328	2	1370.6993	1370.6993	R	I	65	78
PSM	NLDLDSIIAEVK	2201	sp|P13647|K2C5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:188	ms_run[2]:scan=13002	76.208	2	1334.7389	1334.7389	R	A	332	344
PSM	NLDLDSIIAEVK	2202	sp|P13647|K2C5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:188	ms_run[2]:scan=13163	77.265	2	1334.7389	1334.7389	R	A	332	344
PSM	NLGMTDAFELGK	2203	sp|P35237|SPB6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:188	ms_run[2]:scan=9558	54.325	2	1300.6429	1300.6429	R	A	288	300
PSM	NLGMTDAFELGK	2204	sp|P35237|SPB6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9564	54.358	2	1294.6227	1294.6227	R	A	288	300
PSM	NLQCLVIDEADR	2205	sp|Q9NVP1|DDX18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	4-UNIMOD:4	ms_run[2]:scan=8522	48.395	2	1444.698	1444.6980	K	I	326	338
PSM	NLQQELETQNQK	2206	sp|Q02241-3|KIF23_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:188	ms_run[2]:scan=4892	28.924	2	1477.7468	1477.7468	R	L	405	417
PSM	NPPSESEGSDGR	2207	sp|Q8TBX8-3|PI42C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:267	ms_run[2]:scan=539	6.6655	2	1240.5195	1240.5195	R	F	111	123
PSM	NQGFDVVLVDTAGR	2208	sp|P08240-2|SRPRA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	14-UNIMOD:267	ms_run[2]:scan=9488	53.93	2	1499.7608	1499.7608	R	M	483	497
PSM	NTVVLFVPQQEAWVVER	2209	sp|Q9UJZ1-2|STML2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	17-UNIMOD:267	ms_run[2]:scan=12356	71.972	3	2023.0766	2023.0766	R	M	35	52
PSM	NVEAMNFADIER	2210	sp|P36957|ODO2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:267	ms_run[2]:scan=8739	49.557	2	1417.6535	1417.6535	R	T	334	346
PSM	NVLLLGEDGAGK	2211	sp|Q9Y6G9|DC1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:188	ms_run[2]:scan=7130	40.53	2	1190.6602	1190.6602	K	T	69	81
PSM	PEFLEDPSVLTK	2212	sp|P42167-3|LAP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:188	ms_run[2]:scan=9296	52.828	2	1379.728	1379.7280	M	D	2	14
PSM	QAAPCVLFFDELDSIAK	2213	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	5-UNIMOD:4	ms_run[2]:scan=14746	91.184	2	1922.9448	1922.9448	R	A	568	585
PSM	QEAKPEAFVLSPLEMSST	2214	sp|Q14676-3|MDC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11618	67.129	2	1962.9608	1962.9608	K	-	1785	1803
PSM	QLEQTLQQFNIK	2215	sp|P53365-2|ARFP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:188	ms_run[2]:scan=9405	53.45	2	1494.8138	1494.8138	K	L	230	242
PSM	QNLSQFEAQAR	2216	sp|Q8N684-2|CPSF7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5052	29.815	2	1290.6317	1290.6317	R	K	163	174
PSM	QSSFALLGDLTK	2217	sp|Q92973-2|TNPO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11355	65.503	2	1278.682	1278.6820	R	A	685	697
PSM	SADIALVAGGSR	2218	sp|Q5T653|RM02_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5188	30.509	2	1115.5935	1115.5935	R	K	136	148
PSM	SEWSDLLSDLQK	2219	sp|P08237-2|PFKAM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=13262	77.898	2	1419.6882	1419.6882	R	A	130	142
PSM	SLGPPQGEEDSVPR	2220	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	14-UNIMOD:267	ms_run[2]:scan=4648	27.506	2	1476.7084	1476.7084	R	D	2107	2121
PSM	SLIEEGGDWDR	2221	sp|Q15008|PSMD6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7195	40.896	2	1275.5731	1275.5731	K	R	166	177
PSM	SNDPVAIAFADMLK	2222	sp|Q9NZR1|TMOD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	14-UNIMOD:188	ms_run[2]:scan=13956	82.737	2	1496.764	1496.7640	R	V	238	252
PSM	SPVESTTEPPAVR	2223	sp|P53992|SC24C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=3129	19.837	2	1368.6885	1368.6885	K	A	957	970
PSM	SQFTITPGSEQIR	2224	sp|Q99798|ACON_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:267	ms_run[2]:scan=6613	37.838	2	1472.7499	1472.7499	K	A	412	425
PSM	SQLDLFDDVGTFASGPPK	2225	sp|Q8N6H7-3|ARFG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=12573	73.372	3	1892.9156	1892.9156	R	Y	71	89
PSM	SSGIHVALVTGGNK	2226	sp|P16152-2|CBR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:1,14-UNIMOD:188	ms_run[2]:scan=6736	38.453	2	1386.7563	1386.7563	M	G	2	16
PSM	SSSGLLEWESK	2227	sp|P14866-2|HNRPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7838	44.614	2	1221.5877	1221.5877	R	S	409	420
PSM	SYEGEEDTPMGLLLGGVK	2228	sp|Q96K76-2|UBP47_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	18-UNIMOD:188	ms_run[2]:scan=13487	79.347	2	1899.9231	1899.9231	R	S	583	601
PSM	SYSPYDMLESIR	2229	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:267	ms_run[2]:scan=11723	67.786	2	1469.6736	1469.6736	K	K	234	246
PSM	TALPAQSAATLPAR	2230	sp|Q01082|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	14-UNIMOD:267	ms_run[2]:scan=5189	30.513	2	1376.7651	1376.7651	K	T	2178	2192
PSM	TAMNVNDLFLAIAK	2231	sp|P61020|RAB5B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	14-UNIMOD:188	ms_run[2]:scan=13636	80.338	2	1525.827	1525.8270	K	K	166	180
PSM	TFAPEEISAMVLTK	2232	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	14-UNIMOD:188	ms_run[2]:scan=11872	68.739	2	1541.8107	1541.8107	K	M	139	153
PSM	TFEMSDFIVDTR	2233	sp|O75369-6|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	4-UNIMOD:35,12-UNIMOD:267	ms_run[2]:scan=8380	47.607	2	1485.6685	1485.6685	R	D	1993	2005
PSM	TFSYAGFEMQPK	2234	sp|Q99832-3|TCPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8865	50.257	2	1404.6384	1404.6384	K	K	175	187
PSM	TIAMDGTEGLVR	2235	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6681	38.175	2	1261.6336	1261.6336	R	G	110	122
PSM	TIDDLKNQILNLTTDNANILLQIDNAR	2236	sp|P13645|K1C10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=14718	90.913	3	3051.62	3051.6200	K	L	202	229
PSM	TIISYIDEQFER	2237	sp|Q15019|SEPT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:267	ms_run[2]:scan=12676	74.048	2	1522.7543	1522.7543	K	Y	117	129
PSM	TLADVLVQEVIK	2238	sp|P49441|INPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:188	ms_run[2]:scan=13208	77.553	2	1332.796	1332.7960	K	Q	51	63
PSM	TLASAGGPDNLVLLNPEK	2239	sp|P35611-2|ADDA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	18-UNIMOD:188	ms_run[2]:scan=9710	55.155	2	1813.9881	1813.9881	R	Y	331	349
PSM	TPAQFDADELR	2240	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5963	34.353	2	1261.5939	1261.5939	K	A	114	125
PSM	TPPEAIALCSSLLEYTPSSR	2241	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	9-UNIMOD:4,20-UNIMOD:267	ms_run[2]:scan=11984	69.506	2	2201.0914	2201.0914	R	L	372	392
PSM	TPVPSDIDISR	2242	sp|P11586|C1TC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:267	ms_run[2]:scan=5826	33.677	2	1208.6276	1208.6276	K	S	314	325
PSM	TQVAGGQLSFK	2243	sp|P46060|RAGP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5255	30.844	2	1134.6033	1134.6033	K	G	16	27
PSM	TSFVNFTDICK	2244	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	10-UNIMOD:4,11-UNIMOD:188	ms_run[2]:scan=9508	54.035	2	1336.6429	1336.6429	K	L	217	228
PSM	VANEAEFILSR	2245	sp|P50851-2|LRBA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8557	48.599	2	1247.651	1247.6510	R	Q	1895	1906
PSM	VCTLAIIDPGDSDIIR	2246	sp|P62888|RL30_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=11064	63.649	2	1766.9112	1766.9112	R	S	91	107
PSM	VDAQFGGIDQR	2247	sp|P54577|SYYC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:267	ms_run[2]:scan=5053	29.82	2	1214.5919	1214.5919	K	K	179	190
PSM	VFANNADQQLVK	2248	sp|Q5JVF3-3|PCID2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:188	ms_run[2]:scan=4963	29.357	2	1351.7191	1351.7191	R	K	94	106
PSM	VFFTCNACGESVK	2249	sp|Q9NX58|LYAR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	5-UNIMOD:4,8-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=6295	36.104	2	1523.6844	1523.6844	M	K	2	15
PSM	VFLLGEEVAQYDGAYK	2250	sp|P11177-3|ODPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	16-UNIMOD:188	ms_run[2]:scan=11884	68.823	2	1806.9135	1806.9135	K	V	53	69
PSM	VGAPLICCEIK	2251	sp|O60488-2|ACSL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	7-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=7107	40.419	2	1258.6414	1258.6414	R	L	447	458
PSM	VGETIIDLENR	2252	sp|Q9NZM1-2|MYOF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7855	44.703	2	1257.6565	1257.6565	K	F	1592	1603
PSM	VGGSGVNVNAK	2253	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:188	ms_run[2]:scan=1117	9.6741	2	1006.5503	1006.5503	K	G	253	264
PSM	VGSGDTNNFPYLEK	2254	sp|Q9NR45|SIAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7544	42.982	2	1539.7205	1539.7205	K	T	132	146
PSM	VGSVLQEGCGK	2255	sp|P31040-3|SDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	9-UNIMOD:4	ms_run[2]:scan=2410	16.213	2	1132.5547	1132.5547	R	I	383	394
PSM	VGVPTVDLDAQGR	2256	sp|O60306|AQR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6954	39.635	2	1325.6939	1325.6939	R	A	1126	1139
PSM	VIILGDSGVGK	2257	sp|P51149|RAB7A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:188	ms_run[2]:scan=6222	35.709	2	1062.638	1062.6380	K	T	11	22
PSM	VISESPPDQWEAR	2258	sp|Q92616|GCN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6063	34.904	2	1512.7209	1512.7209	R	C	1222	1235
PSM	VIVDFSSPNIAK	2259	sp|P54136-2|SYRC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8069	45.866	2	1288.7027	1288.7027	K	E	122	134
PSM	VLEEGGFFEEK	2260	sp|Q9NR12|PDLI7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:188	ms_run[2]:scan=7945	45.17	2	1288.6283	1288.6283	K	G	314	325
PSM	VLEEGGFFEEK	2261	sp|Q9NR12|PDLI7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7956	45.225	2	1282.6081	1282.6081	K	G	314	325
PSM	VLLSDSNLHDA	2262	sp|Q6FI81-2|CPIN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5789	33.479	2	1182.5881	1182.5881	K	-	98	109
PSM	VLSECSPLMNDIFNK	2263	sp|P53618|COPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	5-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=11502	66.413	2	1771.858	1771.8580	K	E	619	634
PSM	VNQPASFAVSLNGAK	2264	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7249	41.215	2	1501.7889	1501.7889	K	G	2339	2354
PSM	VSSLQAEPLPR	2265	sp|Q9H2M9|RBGPR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5063	29.871	2	1195.6561	1195.6561	K	L	914	925
PSM	VVGAVIDQGLITR	2266	sp|E9PRG8|CK098_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:267	ms_run[2]:scan=8241	46.863	2	1349.7906	1349.7906	R	H	36	49
PSM	VWDDGIIDPADTR	2267	sp|Q9HCC0-2|MCCB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:267	ms_run[2]:scan=8768	49.702	2	1481.7026	1481.7026	R	L	488	501
PSM	YLAEFATGNDR	2268	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:267	ms_run[2]:scan=5844	33.767	2	1265.5916	1265.5916	R	K	131	142
PSM	YNFPVEVEVPMER	2269	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:267	ms_run[2]:scan=10865	62.42	2	1617.7736	1617.7736	R	K	1988	2001
PSM	YNPENLATLER	2270	sp|Q9UBQ5-2|EIF3K_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7028	40.012	2	1318.6517	1318.6517	R	Y	21	32
PSM	YQLEIPENFTTR	2271	sp|P52701|MSH6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:267	ms_run[2]:scan=9769	55.489	2	1519.7546	1519.7546	R	N	977	989
PSM	YSPPAISPLVSEK	2272	sp|Q14694|UBP10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:188	ms_run[2]:scan=7842	44.633	2	1392.7596	1392.7596	K	Q	364	377
PSM	YVDIAIPCNNK	2273	sp|P08865|RSSA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	8-UNIMOD:4	ms_run[2]:scan=6469	37.079	2	1305.6387	1305.6387	R	G	156	167
PSM	QAQEYEALLNIK	2274	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:28,12-UNIMOD:188	ms_run[1]:scan=12357	71.97825	2	1407.7281	1407.7336	R	V	359	371
PSM	TFEMSDFIVDTR	2275	sp|O75369|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	12-UNIMOD:267	ms_run[1]:scan=11517	66.508705	2	1469.676475	1469.673600	R	D	2017	2029
PSM	SYELPDGQVITIGNER	2276	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	16-UNIMOD:267	ms_run[1]:scan=13417	78.89705333333333	2	1800.896521	1799.892912	K	F	241	257
PSM	SYELPDGQVITIGNER	2277	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=10923	62.76758833333333	2	1790.886949	1789.884643	K	F	241	257
PSM	AALEDTLAETEAR	2278	sp|P08727|K1C19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0		ms_run[1]:scan=6620	37.875413333333334	2	1389.7132	1388.6782	K	F	318	331
PSM	ANFLNSNDVFVLK	2279	sp|P09327|VILI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=11613	67.09986666666666	2	1480.757815	1479.772179	R	T	537	550
PSM	VVGAMQLYSVDR	2280	sp|Q00610|CLH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	12-UNIMOD:267	ms_run[1]:scan=7752	44.16357166666667	2	1347.7202	1346.6882	R	K	177	189
PSM	AGAGSATLSMAYAGAR	2281	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=6178	35.486705	2	1453.696920	1453.698362	K	F	242	258
PSM	GPCIIYNEDNGIIK	2282	sp|P36578|RL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:4	ms_run[1]:scan=8280	47.068911666666665	2	1605.772362	1604.786843	R	A	206	220
PSM	LISWYDNEFGYSNR	2283	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	14-UNIMOD:267	ms_run[1]:scan=10842	62.27816166666667	2	1773.791467	1772.803369	K	V	310	324
PSM	CQSLTEDLEFRK	2284	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=9435	53.61859166666666	2	1507.6993	1507.6972	R	S	198	210
PSM	QMADTGKLNTLLQR	2285	sp|Q00839|HNRPU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:28	ms_run[1]:scan=9251	52.55615	2	1570.8170	1570.8132	K	A	545	559
PSM	IVEPYIAWGYPNLK	2286	sp|P18124|RL7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=11776	68.10757	2	1662.890853	1661.881730	R	S	135	149
PSM	QELILSNSEDKSIR	2287	sp|P53621|COPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:28,11-UNIMOD:188,14-UNIMOD:267	ms_run[1]:scan=7785	44.33255833333333	2	1629.8570	1629.8539	R	V	261	275
PSM	TFSYAGFEMQPK	2288	sp|Q99832|TCPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	12-UNIMOD:188	ms_run[1]:scan=8853	50.19618	2	1410.657677	1410.658517	K	K	219	231
PSM	LAAVDATVNQVLASR	2289	sp|Q15084|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	15-UNIMOD:267	ms_run[1]:scan=9785	55.57855166666667	2	1538.8522	1536.8492	K	Y	217	232
PSM	CLACESAKPGTK	2290	sp|P49790|NU153_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:385,1-UNIMOD:4,4-UNIMOD:4,8-UNIMOD:188,12-UNIMOD:188	ms_run[1]:scan=3438	21.398711666666667	2	1315.6248	1315.6298	K	S	871	883
PSM	QFLEVELDQAR	2291	sp|Q14980|NUMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	11-UNIMOD:267	ms_run[1]:scan=9081	51.583684999999996	2	1357.700363	1356.691299	R	E	1463	1474
PSM	QKVDSLLENLEK	2292	sp|P07910|HNRPC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:28	ms_run[1]:scan=10339	59.101643333333335	2	1397.7401	1397.7397	K	I	205	217
PSM	SGAAQGLAEVMAGLGVEK	2293	sp|Q92616|GCN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	18-UNIMOD:188	ms_run[1]:scan=12811	74.92210833333334	2	1692.850217	1692.881200	R	L	1714	1732
PSM	TLFATEDALEVR	2294	sp|O00159|MYO1C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=9398	53.41381333333333	2	1364.685590	1363.698346	K	R	722	734
PSM	GFALVGVGSEASSK	2295	sp|Q16630|CPSF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	14-UNIMOD:188	ms_run[1]:scan=7235	41.131928333333335	2	1313.690199	1313.692260	K	K	125	139
PSM	IFVGGLSPDTPEEK	2296	sp|Q14103|HNRPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=7339	41.789496666666665	2	1487.751572	1487.750775	K	I	184	198
PSM	QKQLEDILVLAK	2297	sp|Q9UPN3|MACF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:28,2-UNIMOD:188,12-UNIMOD:188	ms_run[1]:scan=12294	71.57126666666666	2	1391.8400	1391.8422	R	Q	5445	5457
PSM	ALGQNPTNAEVLK	2298	sp|P14649|MYL6B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	13-UNIMOD:188	ms_run[1]:scan=4783	28.256213333333335	2	1359.738930	1359.745358	R	V	95	108
PSM	ATENDIYNFFSPLNPVR	2299	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	17-UNIMOD:267	ms_run[1]:scan=12477	72.74439	2	2006.959185	2005.977310	R	V	300	317
PSM	GFAFVTFESPADAK	2300	sp|P38159|RBMX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=10958	62.983896666666666	2	1485.716994	1485.713996	R	D	50	64
PSM	GSAFAIGSDGLCCQSR	2301	sp|Q92499|DDX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	12-UNIMOD:4,13-UNIMOD:4	ms_run[1]:scan=7353	41.875751666666666	2	1684.731872	1684.729739	R	E	99	115
PSM	AEAGDNLGALVR	2302	sp|P49411|EFTU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=6528	37.40510666666667	2	1184.613399	1184.614950	R	G	316	328
PSM	LGTEGGEGFVVK	2303	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0		ms_run[1]:scan=5601	32.53024	2	1191.6108	1191.6130	M	V	3	15
PSM	QQQQQQQHQQPNR	2304	sp|Q6Y7W6|GGYF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:28,13-UNIMOD:267	ms_run[1]:scan=421	5.9151283333333335	2	1667.7740	1667.7747	K	A	1016	1029
PSM	GMYDGPVFDLTTTPK	2305	sp|Q14195|DPYL3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=10633	60.98843333333334	2	1640.787576	1640.775610	R	G	497	512
PSM	NVTVQPDDPISFMQLTAK	2306	sp|P53618|COPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=12235	71.19440666666667	2	2003.018729	2003.003378	R	N	662	680
PSM	QDPSVLHTEEMR	2307	sp|P50502|F10A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:28	ms_run[1]:scan=5882	33.954735	2	1423.6369	1423.6397	K	F	18	30
PSM	CCLTYCFNKPEDK	2308	sp|P62979|RS27A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:4,6-UNIMOD:4,9-UNIMOD:188,13-UNIMOD:188	ms_run[1]:scan=8071	45.874390000000005	2	1728.7382	1728.7343	K	-	144	157
PSM	CCLTYCFNKPEDK	2309	sp|P62979|RS27A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:4,6-UNIMOD:4	ms_run[1]:scan=8080	45.925686666666664	2	1716.6966	1716.6941	K	-	144	157
PSM	CSQAVYAAEKVIGAGK	2310	sp|P21291|CSRP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:385,1-UNIMOD:4,10-UNIMOD:188,16-UNIMOD:188	ms_run[1]:scan=11900	68.929795	2	1645.8583	1645.8531	R	S	122	138
PSM	CCAFNDTREEGK	2311	sp|Q9UJX2|CDC23_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:4	ms_run[1]:scan=3737	22.898476666666667	2	1468.5694	1468.5706	K	A	536	548
PSM	YPFESAEAQLLNK	2312	sp|P23921|RIR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0		ms_run[1]:scan=9770	55.49353000000001	2	1509.7502	1508.7502	R	Q	517	530
PSM	QLDLTKNEIDVVR	2313	sp|O00220|TR10A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:28,6-UNIMOD:188,13-UNIMOD:267	ms_run[1]:scan=9626	54.70645833333334	2	1542.8372	1540.8422	R	A	386	399
PSM	EITDQGATLIAQSSK	2314	sp|Q9UF56|FXL17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:27,15-UNIMOD:188	ms_run[1]:scan=8723	49.47634166666667	2	1549.8092	1548.8082	K	S	629	644
PSM	IFDEILVNAADNK	2315	sp|P11388|TOP2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	13-UNIMOD:188	ms_run[1]:scan=9803	55.670673333333326	2	1468.776934	1466.771238	K	Q	84	97
PSM	CADLSLSPIYPAAR	2316	sp|P18858|DNLI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:4	ms_run[1]:scan=8998	51.05618666666666	2	1532.766417	1532.765714	K	G	846	860
PSM	LCFDNSFSTISEK	2317	sp|Q13445|TMED1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	2-UNIMOD:4	ms_run[1]:scan=8918	50.572540000000004	2	1549.711946	1546.697360	K	L	105	118
PSM	YNVLGAETVLNQMR	2318	sp|Q1KMD3|HNRL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=11004	63.272725	2	1606.808639	1606.813727	R	M	481	495
PSM	ADKPDMGEIASFDK	2319	sp|P63313|TYB10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:1	ms_run[2]:scan=8309	47.219	2	1564.7079	1564.7079	M	A	2	16
PSM	ADSKEGVLPLTAASTAPISFGFTR	2320	sp|Q92917|GPKOW_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:1	ms_run[2]:scan=13143	77.129	2	2477.2802	2477.2802	M	T	2	26
PSM	AESDWDTVTVLRK	2321	sp|O60869|EDF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:1	ms_run[2]:scan=9338	53.06	2	1560.7784	1560.7784	M	K	2	15
PSM	AGGIETIANEYSDR	2322	sp|P34932|HSP74_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7330	41.736	2	1494.6951	1494.6951	R	C	20	34
PSM	AIEHADGGVAAGVAVLDNPYPV	2323	sp|P48637-2|GSHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10812	62.089	2	2134.0695	2134.0695	K	-	342	364
PSM	AIEMLGGELGSK	2324	sp|P07954-2|FUMH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7928	45.086	2	1203.6169	1203.6169	R	I	118	130
PSM	AIGAVPLIQGEYMIPCEK	2325	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=10571	60.594	2	2004.006	2004.0060	K	V	314	332
PSM	AILVDLEPGTMDSVR	2326	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:35	ms_run[2]:scan=8862	50.244	2	1630.8236	1630.8236	R	S	63	78
PSM	AILVDLEPGTMDSVR	2327	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10313	58.937	2	1614.8287	1614.8287	R	S	63	78
PSM	AINCATSGVVGLVNCLR	2328	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	4-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=11384	65.684	3	1802.9131	1802.9131	K	R	1445	1462
PSM	ALESDMAPVLIMATNR	2329	sp|Q9Y230|RUVB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11697	67.628	2	1730.8695	1730.8695	R	G	315	331
PSM	ALGQNPTNAEVLK	2330	sp|P60660-2|MYL6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:188	ms_run[2]:scan=4842	28.617	2	1359.7454	1359.7454	R	V	38	51
PSM	ALTSEIALLQSR	2331	sp|P04843|RPN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9644	54.798	2	1300.7351	1300.7351	K	L	525	537
PSM	ALTSELANAR	2332	sp|P26038|MOES_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=4412	26.294	2	1054.5646	1054.5646	K	D	524	534
PSM	ALVQNDTLLQVK	2333	sp|Q92522|H1X_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7894	44.912	2	1340.7664	1340.7664	K	G	95	107
PSM	AMGTLLNTAISEVIGK	2334	sp|O43264-2|ZW10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:35,16-UNIMOD:188	ms_run[2]:scan=13336	78.374	2	1638.8958	1638.8958	K	I	652	668
PSM	ANDDIIVNWVNR	2335	sp|P13797-3|PLST_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:267	ms_run[2]:scan=10007	56.817	2	1437.724	1437.7240	K	T	474	486
PSM	APASEEEFQFLR	2336	sp|P29590-14|PML_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9491	53.944	2	1422.6779	1422.6779	R	C	45	57
PSM	ASGPPVSELITK	2337	sp|P10412|H14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6671	38.126	2	1197.6605	1197.6605	K	A	35	47
PSM	ASIPFSVVGSNQLIEAK	2338	sp|Q15019|SEPT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	17-UNIMOD:188	ms_run[2]:scan=10837	62.249	2	1764.9717	1764.9717	K	G	233	250
PSM	ASSSLGLQDFDLLR	2339	sp|P41743|KPCI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:267	ms_run[2]:scan=12543	73.181	2	1530.7917	1530.7917	K	V	245	259
PSM	ASVGECPAPVPVKDK	2340	sp|P56134-3|ATPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:1,6-UNIMOD:4	ms_run[2]:scan=4708	27.81	2	1594.8025	1594.8025	M	K	2	17
PSM	ATENDIYNFFSPLNPVR	2341	sp|P52597|HNRPF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	17-UNIMOD:267	ms_run[2]:scan=13608	80.152	2	2005.9773	2005.9773	K	V	300	317
PSM	ATGPPVSELITK	2342	sp|P16401|H15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6869	39.191	2	1211.6762	1211.6762	K	A	38	50
PSM	ATVTATTKVPEIR	2343	sp|Q9Y230|RUVB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:1	ms_run[2]:scan=6459	37.025	2	1427.7984	1427.7984	M	D	2	15
PSM	AVAQALEVIPR	2344	sp|P49368-2|TCPG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8024	45.604	2	1165.6819	1165.6819	R	T	401	412
PSM	AVGSISSTAFDIR	2345	sp|O75153|CLU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8433	47.908	2	1322.683	1322.6830	K	F	704	717
PSM	AVLEPIQSTSLIGTLTR	2346	sp|Q6ZMI0|PPR21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	17-UNIMOD:267	ms_run[2]:scan=11995	69.587	2	1808.0283	1808.0283	K	T	635	652
PSM	CDKEFMWALK	2347	sp|P58546|MTPN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:1,1-UNIMOD:4,3-UNIMOD:188,10-UNIMOD:188	ms_run[2]:scan=10855	62.36	2	1380.6609	1380.6609	M	N	2	12
PSM	CDLELETNGR	2348	sp|P21980|TGM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:4,10-UNIMOD:267	ms_run[2]:scan=4106	24.767	2	1215.5429	1215.5429	R	D	10	20
PSM	CIENLEELQSLR	2349	sp|Q15435-2|PP1R7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:4	ms_run[2]:scan=9399	53.418	2	1502.7399	1502.7399	K	E	69	81
PSM	CQNALQQVVAR	2350	sp|Q06210-2|GFPT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:4,11-UNIMOD:267	ms_run[2]:scan=5411	31.606	2	1295.6644	1295.6644	K	Q	602	613
PSM	CVIFEIPGAPDDEAVR	2351	sp|Q96I25|SPF45_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=10959	62.989	2	1796.8643	1796.8643	K	I	339	355
PSM	CVSELVIESR	2352	sp|Q8N1F7|NUP93_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:4,10-UNIMOD:267	ms_run[2]:scan=5936	34.226	2	1200.6048	1200.6048	R	E	569	579
PSM	DADPILISLR	2353	sp|Q9BR76|COR1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9924	56.309	2	1111.6237	1111.6237	R	E	384	394
PSM	DGALTQLNVAFSR	2354	sp|P16435|NCPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9792	55.61	2	1390.7205	1390.7205	R	E	585	598
PSM	DGPNALTPPPTTPEWIK	2355	sp|P05023-3|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	17-UNIMOD:188	ms_run[2]:scan=9606	54.599	2	1838.951	1838.9510	R	F	44	61
PSM	DLPIPLITYDAYPK	2356	sp|P15882-2|CHIN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=12906	75.538	2	1617.8654	1617.8654	R	F	224	238
PSM	DLQNVNITLR	2357	sp|P35232|PHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7702	43.896	2	1184.6513	1184.6513	K	I	84	94
PSM	DTQSGSLLFIGR	2358	sp|P50454|SERPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9684	55.007	2	1292.6725	1292.6725	R	L	394	406
PSM	EAGNINQSLLTLGR	2359	sp|P52732|KIF11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9042	51.346	2	1484.7947	1484.7947	R	V	284	298
PSM	EAPVDVLTQIGR	2360	sp|Q9BVC6|TM109_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9855	55.931	2	1296.7038	1296.7038	R	S	48	60
PSM	EAPVDVLTQIGR	2361	sp|Q9BVC6|TM109_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:267	ms_run[2]:scan=9860	55.957	2	1306.712	1306.7120	R	S	48	60
PSM	ELDEEGSDPPLPGR	2362	sp|Q9BRJ6|CG050_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:267	ms_run[2]:scan=5291	31.014	2	1519.703	1519.7030	R	A	169	183
PSM	ELLEQISAFDNVPR	2363	sp|Q9NX58|LYAR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:267	ms_run[2]:scan=11340	65.405	2	1639.8445	1639.8445	R	K	96	110
PSM	EQTADGVAVIPVLQR	2364	sp|Q9UKK9|NUDT5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9237	52.479	2	1594.8679	1594.8679	K	T	56	71
PSM	EVLDSFLDLAR	2365	sp|Q15758|AAAT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:267	ms_run[2]:scan=12730	74.396	2	1286.6746	1286.6746	K	N	179	190
PSM	FASGGCDNLIK	2366	sp|P55735-2|SEC13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:4,11-UNIMOD:188	ms_run[2]:scan=4679	27.661	2	1186.5748	1186.5748	R	L	168	179
PSM	FCDNSSAIQGK	2367	sp|O15067|PUR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:4	ms_run[2]:scan=2091	14.62	2	1225.5397	1225.5397	K	E	269	280
PSM	FITDNTVEER	2368	sp|O60264|SMCA5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=4406	26.265	2	1232.5912	1232.5913	R	I	607	617
PSM	FITDNTVEER	2369	sp|O60264|SMCA5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4408	26.273	2	1222.583	1222.5830	R	I	607	617
PSM	FLQMCNDDPDVLPDLK	2370	sp|Q02218-2|ODO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	5-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=11110	63.93	2	1924.9006	1924.9006	R	E	794	810
PSM	FNVWDTAGQEK	2371	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7252	41.236	2	1293.599	1293.5990	K	F	61	72
PSM	FNVWDTAGQEK	2372	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:188	ms_run[2]:scan=7255	41.257	2	1299.6191	1299.6191	K	F	61	72
PSM	FQQVPTDALANK	2373	sp|Q6PKG0-3|LARP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:188	ms_run[2]:scan=5484	31.975	2	1336.7082	1336.7082	R	L	665	677
PSM	GANDFMCDEMER	2374	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	7-UNIMOD:4	ms_run[2]:scan=6843	39.06	2	1473.5323	1473.5323	R	S	379	391
PSM	GAVSAEQVIAGFNR	2375	sp|Q9UHV9|PFD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9499	53.99	2	1417.7314	1417.7314	K	L	19	33
PSM	GFSVVADTPELQR	2376	sp|Q14847-3|LASP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8026	45.612	2	1417.7201	1417.7201	K	I	41	54
PSM	GGAEQFMEETER	2377	sp|Q99832-3|TCPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:267	ms_run[2]:scan=5949	34.282	2	1392.5855	1392.5855	R	S	332	344
PSM	GLGLDESGLAK	2378	sp|Q9Y265|RUVB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:188	ms_run[2]:scan=6086	35.029	2	1064.5809	1064.5809	K	Q	23	34
PSM	GLGTDEDSLIEIICSR	2379	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=12242	71.24	2	1786.8646	1786.8646	K	T	120	136
PSM	GLGTDEESILTLLTSR	2380	sp|P08758|ANXA5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	16-UNIMOD:267	ms_run[2]:scan=14261	85.615	2	1713.9024	1713.9024	K	S	30	46
PSM	GMNQVLDVPLTVK	2381	sp|Q96G46-3|DUS3L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9899	56.165	2	1412.7697	1412.7697	R	I	181	194
PSM	GSPLGEVVEQGITR	2382	sp|P51398-2|RT29_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8837	50.102	2	1440.7573	1440.7573	K	V	178	192
PSM	GSQAQPDSPSAQLALIAASQSFLQPGGK	2383	sp|Q9Y490|TLN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=13381	78.666	3	2753.3984	2753.3984	R	M	972	1000
PSM	GTGLQPGEEELPDIAPPLVTPDEPK	2384	sp|P45974-2|UBP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	25-UNIMOD:188	ms_run[2]:scan=11281	65.029	2	2604.3266	2604.3266	R	A	604	629
PSM	GTVTDFPGFDER	2385	sp|P08758|ANXA5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8332	47.34	2	1339.6044	1339.6044	R	A	7	19
PSM	GYPPEDIFNLVGK	2386	sp|Q9NR45|SIAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=12345	71.901	2	1447.7347	1447.7347	K	K	321	334
PSM	IAACQEQILR	2387	sp|Q9BRP1|PDD2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	4-UNIMOD:4,10-UNIMOD:267	ms_run[2]:scan=4692	27.724	2	1210.6368	1210.6368	R	Y	257	267
PSM	IAACQEQILR	2388	sp|Q9BRP1|PDD2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	4-UNIMOD:4	ms_run[2]:scan=4698	27.755	2	1200.6285	1200.6285	R	Y	257	267
PSM	IADGYEQAAR	2389	sp|P48643|TCPE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=1862	13.467	2	1102.5283	1102.5283	R	V	133	143
PSM	IADGYEQAAR	2390	sp|P48643|TCPE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=1869	13.501	2	1092.52	1092.5200	R	V	133	143
PSM	IANPVEGSSGR	2391	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=2066	14.498	2	1085.5465	1085.5465	K	Q	315	326
PSM	IANPVEGSTDR	2392	sp|Q15366-7|PCBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:267	ms_run[2]:scan=2540	16.839	2	1167.5759	1167.5759	K	Q	276	287
PSM	IAPLEEGTLPFNLAEAQR	2393	sp|Q9UJS0|CMC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11973	69.432	2	1968.0316	1968.0316	R	Q	293	311
PSM	IASQMITEGR	2394	sp|Q9BT78|CSN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3514	21.752	2	1104.5597	1104.5597	K	M	338	348
PSM	IATEAIENFR	2395	sp|P08183-2|MDR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6655	38.046	2	1162.5982	1162.5982	K	T	832	842
PSM	IAWPPPTELGSSGSALEEGIK	2396	sp|Q9UHB6|LIMA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11130	64.059	2	2138.0895	2138.0895	R	M	530	551
PSM	ICPVETLVEEAIQCAEK	2397	sp|P30084|ECHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:4,14-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=14762	91.295	2	1993.9796	1993.9796	K	I	212	229
PSM	IDTIEIITDR	2398	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=8762	49.676	2	1197.648	1197.6480	K	Q	138	148
PSM	IDTIEIITDR	2399	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8764	49.684	2	1187.6398	1187.6398	K	Q	138	148
PSM	IEVIEIMTDR	2400	sp|P09651-3|ROA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9903	56.19	2	1217.6326	1217.6326	K	G	131	141
PSM	IEVIEIMTDR	2401	sp|P09651-3|ROA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=9904	56.194	2	1227.6408	1227.6408	K	G	131	141
PSM	IIENELEGFGIR	2402	sp|Q9Y295|DRG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:267	ms_run[2]:scan=10070	57.215	2	1398.7382	1398.7382	K	L	160	172
PSM	ILGTAGTEEGQK	2403	sp|Q08257|QOR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=1789	13.125	2	1202.6143	1202.6143	K	I	176	188
PSM	ILPEYLSNWTMEK	2404	sp|O95831-3|AIFM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11501	66.407	2	1622.8014	1622.8014	K	V	339	352
PSM	ILYSQCGDVMR	2405	sp|P60660-2|MYL6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:4	ms_run[2]:scan=5547	32.275	2	1340.6217	1340.6217	K	A	27	38
PSM	IMYDLTSKPPGTTEWE	2406	sp|P49915-2|GUAA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9534	54.187	2	1866.871	1866.8710	R	-	579	595
PSM	INISEGNCPER	2407	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	8-UNIMOD:4	ms_run[2]:scan=2826	18.362	2	1287.5877	1287.5877	R	I	47	58
PSM	INPSSMFDVQVK	2408	sp|P06737-2|PYGL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:188	ms_run[2]:scan=9567	54.373	2	1369.7007	1369.7007	K	R	524	536
PSM	IQELENLPGSLAGDLR	2409	sp|P51532-5|SMCA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11205	64.545	2	1723.9105	1723.9105	R	T	382	398
PSM	IQLVEEELDR	2410	sp|P06753-3|TPM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=7676	43.744	2	1252.6539	1252.6539	R	A	56	66
PSM	IQSIAPSLQVITSK	2411	sp|P42345|MTOR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:188	ms_run[2]:scan=9142	51.953	2	1489.8811	1489.8811	R	Q	2153	2167
PSM	IQTQPGYANTLR	2412	sp|Q00325-2|MPCP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:267	ms_run[2]:scan=4150	24.989	2	1370.7182	1370.7182	R	D	189	201
PSM	ISGLIYEETR	2413	sp|P62805|H4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6405	36.727	2	1179.6136	1179.6136	R	G	47	57
PSM	ISGLIYEETR	2414	sp|P62805|H4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=6221	35.705	2	1189.6218	1189.6218	R	G	47	57
PSM	ISGLIYEETR	2415	sp|P62805|H4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=6406	36.731	2	1189.6218	1189.6218	R	G	47	57
PSM	ITVNEVELLVMK	2416	sp|Q9UNM6|PSD13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=12772	74.665	2	1386.7792	1386.7792	K	A	302	314
PSM	IVLVDDSIVR	2417	sp|Q06203|PUR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8316	47.256	2	1127.655	1127.6550	R	G	385	395
PSM	IVLVDDSIVR	2418	sp|Q06203|PUR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=8319	47.268	2	1137.6633	1137.6633	R	G	385	395
PSM	LAEGVQLLCLIDK	2419	sp|Q9BZH6|WDR11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	9-UNIMOD:4	ms_run[2]:scan=12835	75.063	2	1470.8116	1470.8116	K	A	1063	1076
PSM	LAGESESNLR	2420	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=1760	12.986	2	1084.5388	1084.5388	K	K	278	288
PSM	LAGESESNLR	2421	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=1762	12.993	2	1074.5306	1074.5306	K	K	278	288
PSM	LCSLFYTNEEVAK	2422	sp|P43243|MATR3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:4	ms_run[2]:scan=8468	48.103	2	1572.7494	1572.7494	K	N	805	818
PSM	LDLDLTADSQPPVFK	2423	sp|Q13263-2|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10739	61.653	2	1657.8563	1657.8563	R	V	411	426
PSM	LDSIVIQQGR	2424	sp|O60264|SMCA5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=5152	30.335	2	1137.6381	1137.6381	R	L	627	637
PSM	LDVATDNFFQNPELYIR	2425	sp|Q96GG9|DCNL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	17-UNIMOD:267	ms_run[2]:scan=13149	77.169	2	2064.0192	2064.0192	K	E	37	54
PSM	LELFLPEEYPMAAPK	2426	sp|P61088|UBE2N_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:35,15-UNIMOD:188	ms_run[2]:scan=11461	66.154	2	1768.9053	1768.9053	K	V	54	69
PSM	LFADAVQELLPQYK	2427	sp|P33993-2|MCM7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:188	ms_run[2]:scan=12751	74.529	2	1639.8917	1639.8917	K	E	76	90
PSM	LGDDIDLIVR	2428	sp|O15371-2|EIF3D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=9292	52.807	2	1137.6269	1137.6269	K	C	316	326
PSM	LGDDIDLIVR	2429	sp|O15371-2|EIF3D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9312	52.915	2	1127.6186	1127.6186	K	C	316	326
PSM	LGNYAGAVQDCER	2430	sp|O43765|SGTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:4	ms_run[2]:scan=4118	24.828	2	1451.6463	1451.6463	K	A	138	151
PSM	LGPGGLDPVEVYESLPEELQK	2431	sp|Q16543|CDC37_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=13526	79.61	2	2268.1525	2268.1525	R	C	287	308
PSM	LGSTVVDLSVPGK	2432	sp|Q86U90|YRDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:188	ms_run[2]:scan=7685	43.795	2	1276.7334	1276.7334	R	F	236	249
PSM	LGVSCEVIDLR	2433	sp|P21953|ODBB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	5-UNIMOD:4,11-UNIMOD:267	ms_run[2]:scan=8687	49.297	2	1269.6626	1269.6626	K	T	295	306
PSM	LLLDTFEYQGLVK	2434	sp|Q7Z7K6-3|CENPV_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=12286	71.52	2	1537.8392	1537.8392	K	H	132	145
PSM	LLSDFLDSEVSELR	2435	sp|Q9BPX3|CND3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=13055	76.55	2	1621.8199	1621.8199	K	T	695	709
PSM	LLYEANLPENFR	2436	sp|Q8IYB5-3|SMAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9601	54.57	2	1477.7565	1477.7565	R	R	96	108
PSM	LNECPLDPGGYFIVK	2437	sp|Q9NW08-2|RPC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	4-UNIMOD:4	ms_run[2]:scan=11370	65.592	2	1720.8494	1720.8494	K	G	100	115
PSM	LQPALPPEAQSVPELEEVAR	2438	sp|Q8WUF5|IASPP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	20-UNIMOD:267	ms_run[2]:scan=10663	61.175	2	2182.1509	2182.1509	R	V	493	513
PSM	LSAAEDPLVQSLR	2439	sp|P48449-2|ERG7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8620	48.938	2	1397.7514	1397.7514	R	Q	168	181
PSM	LSAAVTEAFVR	2440	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7918	45.038	2	1162.6346	1162.6346	K	L	451	462
PSM	LSFYETGEIPR	2441	sp|O00567|NOP56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8458	48.048	2	1310.6507	1310.6507	R	K	405	416
PSM	LSPEIVELSEPLQVVR	2442	sp|Q9NXG6-2|P4HTM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=12211	71.037	2	1807.0091	1807.0091	R	Y	303	319
PSM	LSSDVLTLLIK	2443	sp|P36776-3|LONM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:188	ms_run[2]:scan=12928	75.695	2	1206.7531	1206.7531	K	Q	495	506
PSM	LSVAAQEAAR	2444	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=2080	14.57	2	1024.5541	1024.5541	R	L	2251	2261
PSM	LSVAAQEAAR	2445	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=2082	14.577	2	1014.5458	1014.5458	R	L	2251	2261
PSM	LSVISVEDPPQR	2446	sp|P38117|ETFB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6539	37.461	2	1338.7143	1338.7143	K	T	222	234
PSM	LTAEDLFEAR	2447	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=9557	54.321	2	1173.5905	1173.5905	R	I	3615	3625
PSM	LTDQVMQNPR	2448	sp|Q99733|NP1L4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=3107	19.729	2	1210.6004	1210.6004	K	V	27	37
PSM	LTPTSVLDYFGTGSVQR	2449	sp|P35251-2|RFC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=12503	72.918	2	1839.9367	1839.9367	K	S	160	177
PSM	LTTLELLEVR	2450	sp|Q01082|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=11083	63.766	2	1195.7052	1195.7052	R	R	2079	2089
PSM	LYYFWDPDYQEALR	2451	sp|Q9HC16|ABC3G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:267	ms_run[2]:scan=13106	76.883	2	1887.8707	1887.8707	R	S	123	137
PSM	MAGDETQPTR	2452	sp|Q8WXA9-2|SREK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:35	ms_run[2]:scan=541	6.6827	2	1120.4819	1120.4819	R	F	214	224
PSM	MCDLVSDFDGFSER	2453	sp|P30520|PURA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=11416	65.879	2	1686.6893	1686.6893	R	F	181	195
PSM	MGPGATAGGAEK	2454	sp|P62820|RAB1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:35,12-UNIMOD:188	ms_run[2]:scan=577	6.8949	2	1067.5013	1067.5013	R	S	176	188
PSM	MIAGQVLDINLAAEPK	2455	sp|P07910-4|HNRPC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:35	ms_run[2]:scan=9798	55.642	2	1697.9022	1697.9022	R	V	74	90
PSM	MINLSVPDTIDER	2456	sp|P13797-3|PLST_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:35,13-UNIMOD:267	ms_run[2]:scan=8584	48.737	2	1527.7478	1527.7478	K	A	124	137
PSM	MQNDAGEFVDLYVPRK	2457	sp|P63220|RS21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:1,15-UNIMOD:267,16-UNIMOD:188	ms_run[2]:scan=11537	66.625	2	1938.948	1934.9599	-	C	1	17
PSM	MVVYQGGTSR	2458	sp|P09327|VILI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=2419	16.256	2	1096.5335	1096.5335	R	T	496	506
PSM	NAALEQENGLLR	2459	sp|Q9Y3Q8-2|T22D4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:267	ms_run[2]:scan=6066	34.92	2	1336.6974	1336.6974	R	A	116	128
PSM	NADGLIVASR	2460	sp|Q9UJA5-4|TRM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3994	24.187	2	1014.5458	1014.5458	R	F	198	208
PSM	NADGLIVASR	2461	sp|Q9UJA5-4|TRM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=3995	24.191	2	1024.5541	1024.5541	R	F	198	208
PSM	NAFYIGSYQQCINEAQR	2462	sp|O14579|COPE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=9099	51.695	3	2070.9457	2070.9457	K	V	24	41
PSM	NELEIPGQYDGR	2463	sp|P78527|PRKDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:267	ms_run[2]:scan=6617	37.863	2	1399.6607	1399.6607	R	G	3697	3709
PSM	NFVDSPIIVDITK	2464	sp|P04062-4|GLCM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:188	ms_run[2]:scan=11691	67.589	2	1465.8124	1465.8124	R	D	348	361
PSM	NGPALQEAYVR	2465	sp|Q9UJU6|DBNL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:267	ms_run[2]:scan=4990	29.501	2	1226.6283	1226.6283	R	V	8	19
PSM	NLATTVTEEILEK	2466	sp|O43390-3|HNRPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=12736	74.43	2	1459.777	1459.7770	R	S	309	322
PSM	NLDENGLDLLSK	2467	sp|P06493-2|CDK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9224	52.4	2	1329.6776	1329.6776	K	M	198	210
PSM	NLQEIQQAGER	2468	sp|Q8N1F7|NUP93_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:267	ms_run[2]:scan=3473	21.564	2	1294.6505	1294.6505	R	L	32	43
PSM	NNSGEEFDCAFR	2469	sp|Q08J23-3|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	9-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=6178	35.487	2	1454.576	1454.5760	R	L	355	367
PSM	NNTQVLINCR	2470	sp|P62316-2|SMD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	9-UNIMOD:4,10-UNIMOD:267	ms_run[2]:scan=3488	21.634	2	1240.6222	1240.6222	K	N	28	38
PSM	NSSQFFQSYVER	2471	sp|Q14008-2|CKAP5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:267	ms_run[2]:scan=8282	47.079	2	1500.6873	1500.6873	K	G	1811	1823
PSM	NSSYFVEWIPNNVK	2472	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11527	66.566	2	1695.8257	1695.8257	K	T	337	351
PSM	NSTPSEPGSGR	2473	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=649	7.3095	2	1087.4894	1087.4894	K	G	198	209
PSM	NVGTGLVGAPACGDVMK	2474	sp|Q9H1K1-2|ISCU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=6973	39.74	2	1650.8165	1650.8165	K	L	33	50
PSM	NVLIVEDVVGTGR	2475	sp|Q9NRG1-2|PRDC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9698	55.09	2	1369.7565	1369.7565	K	T	136	149
PSM	NVLLLGEDGAGK	2476	sp|Q9Y6G9|DC1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7131	40.534	2	1184.6401	1184.6401	K	T	69	81
PSM	NVQLTENEIR	2477	sp|P62136-2|PP1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4760	28.116	2	1214.6255	1214.6255	K	G	38	48
PSM	NVVACESIGR	2478	sp|Q9H0U6|RM18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	5-UNIMOD:4,10-UNIMOD:267	ms_run[2]:scan=3114	19.762	2	1113.5476	1113.5476	R	V	121	131
PSM	QAASGLVGQENAR	2479	sp|Q9Y265|RUVB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=2067	14.502	2	1299.6531	1299.6531	K	E	34	47
PSM	QAQEYEALLNIK	2480	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9588	54.499	2	1418.7405	1418.7405	R	V	359	371
PSM	QASPNIVIALSGNK	2481	sp|P20339-2|RAB5A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8510	48.332	2	1410.7831	1410.7831	R	A	107	121
PSM	QGCDCECLGGGR	2482	sp|Q9NRX4|PHP14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:4,5-UNIMOD:4,7-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=1299	10.638	2	1377.5099	1377.5099	K	I	67	79
PSM	QIIVDPLSFSEER	2483	sp|P35221|CTNA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:267	ms_run[2]:scan=11013	63.329	2	1541.7965	1541.7965	K	F	288	301
PSM	QITVNDLPVGR	2484	sp|Q06830|PRDX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:267	ms_run[2]:scan=6995	39.851	2	1220.6753	1220.6753	R	S	141	152
PSM	QITVNDLPVGR	2485	sp|Q06830|PRDX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6996	39.855	2	1210.667	1210.6670	R	S	141	152
PSM	QLLQTVNVPIIDGAK	2486	sp|Q02952-3|AKA12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	15-UNIMOD:188	ms_run[2]:scan=10894	62.591	2	1613.9448	1613.9448	K	E	1268	1283
PSM	QMEQISQFLQAAER	2487	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:35,14-UNIMOD:267	ms_run[2]:scan=9832	55.817	2	1703.8176	1703.8176	K	Y	89	103
PSM	QNFIDPLQNLCEK	2488	sp|Q99961|SH3G1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:4	ms_run[2]:scan=10661	61.164	2	1617.7821	1617.7821	K	D	137	150
PSM	QQIQSIQQSIER	2489	sp|P55769|NH2L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5651	32.778	2	1456.7634	1456.7634	K	L	114	126
PSM	QVGVGYVDSIQR	2490	sp|P43246-2|MSH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6152	35.344	2	1319.6834	1319.6834	R	K	94	106
PSM	QVGYEDQWLQLLR	2491	sp|O60568|PLOD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:267	ms_run[2]:scan=13433	78.999	2	1656.8499	1656.8499	K	T	616	629
PSM	QVQQPSVAQLR	2492	sp|Q15007|FL2D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:267	ms_run[2]:scan=4463	26.546	2	1262.6971	1262.6971	K	S	99	110
PSM	QWCNCAFLESSAK	2493	sp|P62834|RAP1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:4,5-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=7866	44.76	2	1605.7011	1605.7011	R	S	137	150
PSM	SADIALVAGGSR	2494	sp|Q5T653|RM02_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:267	ms_run[2]:scan=5181	30.473	2	1125.6018	1125.6018	R	K	136	148
PSM	SASSLLEQRPK	2495	sp|Q9Y5A9|YTHD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:1	ms_run[2]:scan=5973	34.408	2	1256.6725	1256.6725	M	G	2	13
PSM	SCDGNQELLNFLR	2496	sp|Q9UIG0-2|BAZ1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=11693	67.605	2	1574.7387	1574.7387	K	S	1040	1053
PSM	SDPLLIGIPTSENPFK	2497	sp|Q9UBI6|GBG12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=12581	73.425	2	1726.9142	1726.9142	R	D	49	65
PSM	SECLNNIGDSSPLIR	2498	sp|Q92973-2|TNPO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:4	ms_run[2]:scan=7900	44.945	2	1673.8043	1673.8043	K	A	93	108
PSM	SEQLEELFSQVGPVK	2499	sp|Q9NW13-2|RBM28_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	15-UNIMOD:188	ms_run[2]:scan=11709	67.7	3	1694.8822	1694.8822	R	Q	17	32
PSM	SESVPPVTDWAWYK	2500	sp|P35613-3|BASI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11367	65.575	2	1663.7882	1663.7882	K	I	35	49
PSM	SGLDSVSSWLPLAK	2501	sp|Q6PD74|AAGAB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:188	ms_run[2]:scan=12794	74.812	2	1464.792	1464.7920	K	A	90	104
PSM	SICEVLDLER	2502	sp|P35659|DEK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:4	ms_run[2]:scan=9327	52.998	2	1232.6071	1232.6071	K	S	159	169
PSM	SLGSVQAPSYGAR	2503	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4889	28.91	2	1291.6521	1291.6521	R	P	15	28
PSM	SLGSVQAPSYGAR	2504	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:267	ms_run[2]:scan=4735	27.972	2	1301.6603	1301.6603	R	P	15	28
PSM	SLLSAEEAAK	2505	sp|Q7KZF4|SND1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:188	ms_run[2]:scan=4358	26.042	2	1023.5544	1023.5544	K	Q	642	652
PSM	SLTLDTWEPELLK	2506	sp|Q15057|ACAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=12561	73.297	2	1543.8134	1543.8134	R	L	453	466
PSM	SLTSCSSDITLR	2507	sp|Q8WWI1|LMO7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	5-UNIMOD:4	ms_run[2]:scan=5784	33.45	2	1338.6449	1338.6449	R	G	257	269
PSM	SSFADISNLLQIEPR	2508	sp|Q15785|TOM34_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	15-UNIMOD:267	ms_run[2]:scan=13191	77.442	2	1698.8816	1698.8816	K	N	279	294
PSM	SSSAGSGHQPSQSR	2509	sp|Q13542|4EBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:1,14-UNIMOD:267	ms_run[2]:scan=449	6.1171	2	1423.6316	1423.6316	M	A	2	16
PSM	SSSGLLEWESK	2510	sp|P14866-2|HNRPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:188	ms_run[2]:scan=7837	44.609	2	1227.6079	1227.6079	R	S	409	420
PSM	STGDSFETRFEK	2511	sp|Q13464|ROCK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:1	ms_run[2]:scan=6390	36.641	2	1444.647	1444.6470	M	M	2	14
PSM	STIIGESISR	2512	sp|P54136-2|SYRC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=5150	30.328	2	1071.58	1071.5800	R	L	142	152
PSM	SVEELLEAELLK	2513	sp|Q86UP2-2|KTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:188	ms_run[2]:scan=13278	77.996	2	1377.7698	1377.7698	K	V	812	824
PSM	SVEELLEAELLK	2514	sp|Q86UP2-2|KTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=13284	78.036	2	1371.7497	1371.7497	K	V	812	824
PSM	SVEGLQEGSVLR	2515	sp|O75153|CLU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6024	34.689	2	1272.6674	1272.6674	R	V	106	118
PSM	SVYGGEFIQQLK	2516	sp|Q9NQG5|RPR1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:188	ms_run[2]:scan=9213	52.344	2	1373.7286	1373.7286	R	L	115	127
PSM	SYGIPFIETSAK	2517	sp|P01111|RASN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9884	56.084	2	1311.6711	1311.6711	K	T	136	148
PSM	SYSPYDMLESIR	2518	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11731	67.836	2	1459.6653	1459.6653	K	K	234	246
PSM	TAGPQSQVLCGVVMDR	2519	sp|P35611-2|ADDA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=8200	46.645	2	1726.837	1726.8370	K	S	516	532
PSM	TFAPEEISAMVLTK	2520	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:188	ms_run[2]:scan=12021	69.76	2	1541.8107	1541.8107	K	M	139	153
PSM	TFSYAGFEMQPK	2521	sp|Q99832-3|TCPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:188	ms_run[2]:scan=8864	50.252	2	1410.6585	1410.6585	K	K	175	187
PSM	TGEAIVDAALSALR	2522	sp|Q15084-3|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=13190	77.436	2	1385.7514	1385.7514	R	Q	116	130
PSM	TGYGVEELISALQR	2523	sp|Q8NC60|NOA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:267	ms_run[2]:scan=13596	80.07	2	1544.8074	1544.8074	K	S	320	334
PSM	TIALNGVEDVR	2524	sp|Q3ZCQ8-2|TIM50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6528	37.405	2	1185.6354	1185.6354	K	T	388	399
PSM	TIEDDLVSALVR	2525	sp|Q9Y606-2|TRUA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=12688	74.122	2	1329.714	1329.7140	K	S	83	95
PSM	TINLYPLTNYTFGTK	2526	sp|O43809|CPSF5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=12209	71.02	3	1744.9036	1744.9036	R	E	36	51
PSM	TLGDFAAEYAK	2527	sp|P09874|PARP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:188	ms_run[2]:scan=7811	44.47	2	1190.5915	1190.5915	K	S	109	120
PSM	TLIQNCGASTIR	2528	sp|P49368-2|TCPG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=4447	26.464	2	1342.6903	1342.6903	R	L	412	424
PSM	TLLADQGEIR	2529	sp|O94776|MTA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5313	31.129	2	1114.5982	1114.5982	K	V	139	149
PSM	TMTCEYALCSFFVPGDR	2530	sp|Q9UNX4|WDR3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	4-UNIMOD:4,9-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=12718	74.314	2	2062.8826	2062.8826	R	Q	451	468
PSM	TNDPGVLQAAR	2531	sp|O76096|CYTF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:267	ms_run[2]:scan=3146	19.927	2	1150.597	1150.5970	K	Y	44	55
PSM	TNGKEPELLEPIPYEFMA	2532	sp|P46778|RL21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	4-UNIMOD:188,17-UNIMOD:35	ms_run[2]:scan=12112	70.367	2	2099.0228	2099.0228	R	-	143	161
PSM	TNGKEPELLEPIPYEFMA	2533	sp|P46778|RL21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=13393	78.741	2	2077.0078	2077.0078	R	-	143	161
PSM	TNQELQEINR	2534	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=3064	19.536	2	1253.6239	1253.6239	R	V	136	146
PSM	TPYTDVNIVTIR	2535	sp|P50213|IDH3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:267	ms_run[2]:scan=8503	48.293	2	1400.7539	1400.7539	K	E	135	147
PSM	TVIIEQSWGSPK	2536	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:188	ms_run[2]:scan=7049	40.124	2	1349.7286	1349.7286	R	V	61	73
PSM	TVIIEQSWGSPK	2537	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7052	40.138	2	1343.7085	1343.7085	R	V	61	73
PSM	TVQSLEIDLDSMR	2538	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:267	ms_run[2]:scan=10662	61.17	2	1515.7478	1515.7478	R	N	302	315
PSM	TWNDPSVQQDIK	2539	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:188	ms_run[2]:scan=5708	33.07	2	1435.7039	1435.7039	R	F	102	114
PSM	VAAAESMPLLLECAR	2540	sp|O00410-2|IPO5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:4	ms_run[2]:scan=10412	59.573	2	1629.8218	1629.8218	R	V	661	676
PSM	VAAPDVVVPTLDTVR	2541	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9645	54.802	2	1550.8668	1550.8668	K	H	2562	2577
PSM	VDFPQDQLTALTGR	2542	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10648	61.086	2	1559.7944	1559.7944	K	I	216	230
PSM	VDGMDILCVR	2543	sp|P08559-3|ODPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	8-UNIMOD:4	ms_run[2]:scan=9509	54.039	2	1176.5631	1176.5631	R	E	223	233
PSM	VDGMDILCVR	2544	sp|P08559-3|ODPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	8-UNIMOD:4,10-UNIMOD:267	ms_run[2]:scan=9510	54.043	2	1186.5714	1186.5714	R	E	223	233
PSM	VEFEELCADLFER	2545	sp|Q9Y4L1-2|HYOU1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	7-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=12770	74.653	2	1665.7584	1665.7584	R	V	259	272
PSM	VFIWTCDDASSNTWSPK	2546	sp|P55735-2|SEC13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:4	ms_run[2]:scan=10750	61.719	2	2012.8938	2012.8938	R	L	226	243
PSM	VFPGSTTEDYNLIVIER	2547	sp|Q13263-2|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11197	64.492	2	1951.9891	1951.9891	K	G	426	443
PSM	VGAPLICCEIK	2548	sp|O60488-2|ACSL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	7-UNIMOD:4,8-UNIMOD:4,11-UNIMOD:188	ms_run[2]:scan=7114	40.452	2	1264.6615	1264.6615	R	L	447	458
PSM	VGDDPAVWQLK	2549	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7976	45.333	2	1226.6295	1226.6295	K	N	2105	2116
PSM	VGIGAFPTEQDNEIGELLQTR	2550	sp|P30520|PURA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=12919	75.627	2	2286.1492	2286.1492	R	G	304	325
PSM	VGSVLQEGCGK	2551	sp|P31040-3|SDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	9-UNIMOD:4,11-UNIMOD:188	ms_run[2]:scan=2408	16.203	2	1138.5748	1138.5748	R	I	383	394
PSM	VINLNDNTFTEK	2552	sp|P46060|RAGP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:188	ms_run[2]:scan=6968	39.718	2	1412.7243	1412.7243	R	G	240	252
PSM	VIQCFAETGQVQK	2553	sp|Q00610-2|CLH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	4-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=4943	29.245	2	1512.7702	1512.7702	K	I	488	501
PSM	VLEAAAQAAR	2554	sp|Q9NPD3|EXOS4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=2071	14.527	2	1008.5592	1008.5592	R	D	213	223
PSM	VLEAAAQAAR	2555	sp|Q9NPD3|EXOS4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=2072	14.531	2	998.55089	998.5509	R	D	213	223
PSM	VLIANNGIAAVK	2556	sp|O00763-3|ACACB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6140	35.286	2	1181.7132	1181.7132	K	C	61	73
PSM	VLITTDLLAR	2557	sp|P60842|IF4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=9705	55.133	2	1123.684	1123.6840	R	G	325	335
PSM	VLITTDLLAR	2558	sp|P60842|IF4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9708	55.146	2	1113.6758	1113.6758	R	G	325	335
PSM	VLTELLEQER	2559	sp|Q13428-2|TCOF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=8141	46.285	2	1238.6746	1238.6746	K	K	1241	1251
PSM	VLTFDLTKYPDANPNPNEQ	2560	sp|Q14683|SMC1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9789	55.595	2	2175.0484	2175.0484	K	-	1215	1234
PSM	VMTIPYQPMPASSPVICAGGQDR	2561	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	9-UNIMOD:35,17-UNIMOD:4,23-UNIMOD:267	ms_run[2]:scan=9005	51.101	2	2500.1788	2500.1788	R	C	178	201
PSM	VNDVPEEFLYNPLTR	2562	sp|O95486-2|SC24A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=12009	69.679	2	1804.8996	1804.8996	R	V	458	473
PSM	VQVLAAQLLSDMK	2563	sp|Q6P9B6|MEAK7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:188	ms_run[2]:scan=12341	71.873	2	1420.8055	1420.8055	R	L	162	175
PSM	VVQMLGSLGGQINK	2564	sp|P78527|PRKDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:188	ms_run[2]:scan=8476	48.149	2	1448.8117	1448.8117	R	N	855	869
PSM	YALYDATYETK	2565	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6418	36.794	2	1336.6187	1336.6187	R	E	82	93
PSM	YAQGADSVEPMFR	2566	sp|Q9H9G7-2|AGO3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6962	39.682	2	1469.6609	1469.6609	K	H	261	274
PSM	YCAQDAFFQVK	2567	sp|Q13011|ECH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:4,11-UNIMOD:188	ms_run[2]:scan=8574	48.686	2	1381.6432	1381.6432	R	E	186	197
PSM	YGQGAGEGSTR	2568	sp|Q9C0C2-2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:267	ms_run[2]:scan=623	7.1628	2	1091.4871	1091.4871	K	E	229	240
PSM	YLECSALTQR	2569	sp|P63000|RAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	4-UNIMOD:4	ms_run[2]:scan=5047	29.788	2	1239.5918	1239.5918	K	G	154	164
PSM	YLGQDYEQLR	2570	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=6446	36.958	2	1293.6229	1293.6229	K	V	37	47
PSM	YLQEEVNINR	2571	sp|Q9UHD8-7|SEPT9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=5231	30.734	2	1286.6494	1286.6494	K	K	371	381
PSM	YNILGTNAIMDK	2572	sp|Q9BUJ2-3|HNRL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9112	51.776	2	1351.6806	1351.6806	K	M	336	348
PSM	YQLEIPENFTTR	2573	sp|P52701|MSH6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9770	55.494	2	1509.7464	1509.7464	R	N	977	989
PSM	ISMPDIDLNLK	2574	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	11-UNIMOD:188	ms_run[1]:scan=10904	62.650643333333335	2	1263.685664	1263.684003	K	G	2707	2718
PSM	QEYDESGPSIVHR	2575	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:28	ms_run[1]:scan=5243	30.789884999999998	2	1498.6677	1498.6683	K	K	360	373
PSM	QIILEKEETEELK	2576	sp|P12956|XRCC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:28,6-UNIMOD:188,13-UNIMOD:188	ms_run[1]:scan=8650	49.09932833333333	2	1595.8732	1595.8692	R	R	326	339
PSM	GVDEVTIVNILTNR	2577	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	14-UNIMOD:267	ms_run[1]:scan=13248	77.806155	2	1552.847249	1551.849591	K	S	50	64
PSM	LVLLGESAVGK	2578	sp|P20339|RAB5A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=7728	44.04295333333333	2	1084.652676	1084.649211	K	S	23	34
PSM	TAMNVNEIFMAIAK	2579	sp|P51148|RAB5C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	3-UNIMOD:35	ms_run[1]:scan=11823	68.40077166666667	2	1567.7787	1567.7733	K	K	167	181
PSM	AFLASPEYVNLPINGNGKQ	2580	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=10775	61.86780166666667	3	2032.028447	2031.042541	K	-	192	211
PSM	IISNASCTTNCLAPLAK	2581	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	7-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=7588	43.247515	2	1833.8962	1832.9122	K	V	146	163
PSM	CQSLQEELDFRK	2582	sp|Q03252|LMNB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:385,1-UNIMOD:4,11-UNIMOD:267,12-UNIMOD:188	ms_run[1]:scan=9007	51.117745	2	1550.7361	1550.7365	R	S	212	224
PSM	YADALQEIIQER	2583	sp|Q9Y6N5|SQOR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=10597	60.760659999999994	2	1447.728396	1447.730708	K	N	242	254
PSM	QDVGKFVELPGAEMGK	2584	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:28	ms_run[1]:scan=10492	60.086715000000005	2	1687.8662	1686.8282	K	V	182	198
PSM	YGAAMALGICCAGTGNK	2585	sp|Q99460|PSMD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	10-UNIMOD:4,11-UNIMOD:4,17-UNIMOD:188	ms_run[1]:scan=7693	43.84370833333333	2	1719.781427	1719.783811	R	E	650	667
PSM	TSMNVNEIFMAIAK	2586	sp|P20339|RAB5A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	14-UNIMOD:188	ms_run[1]:scan=13522	79.58007666666667	2	1573.794185	1573.793965	K	K	166	180
PSM	CGDLLAASQVVNR	2587	sp|Q8N1F7|NUP93_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:4	ms_run[1]:scan=6977	39.766095	2	1401.718479	1401.703448	R	A	328	341
PSM	LEEGPPVTTVLTR	2588	sp|P08559|ODPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=7876	44.81437833333333	2	1411.768429	1410.771845	R	E	46	59
PSM	ELSDFISYLQR	2589	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	11-UNIMOD:267	ms_run[1]:scan=12309	71.669965	2	1379.693477	1379.696050	R	E	472	483
PSM	MNYSDAIVWLK	2590	sp|O43776|SYNC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	11-UNIMOD:188	ms_run[1]:scan=11651	67.33685666666666	2	1345.7182	1344.6842	R	E	391	402
PSM	LEVAPISDIIAIK	2591	sp|P13804|ETFA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=12419	72.37556500000001	2	1380.818864	1380.822818	K	S	127	140
PSM	ATENDIYNFFSPLNPVR	2592	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=12478	72.75044333333334	2	1996.963179	1995.969041	R	V	300	317
PSM	LVIVGDGACGK	2593	sp|P61586|RHOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	9-UNIMOD:4	ms_run[1]:scan=4395	26.215905	2	1087.568772	1087.569580	K	T	8	19
PSM	LLESEQFLTELTR	2594	sp|P37108|SRP14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0		ms_run[1]:scan=12369	72.05392166666667	2	1578.8292	1577.8292	V	L	3	16
PSM	TLQYLSQGNVVFK	2595	sp|P82663|RT25_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	13-UNIMOD:188	ms_run[1]:scan=9182	52.18082666666667	2	1502.8182	1501.8232	R	D	12	25
PSM	LCPSLIQESAAK	2596	sp|Q96G46|DUS3L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	2-UNIMOD:4,12-UNIMOD:188	ms_run[1]:scan=5642	32.731225	2	1321.703458	1321.700716	R	C	123	135
PSM	AINQGGLTSVAVR	2597	sp|P60900|PSA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=5495	32.02934666666667	2	1284.712086	1284.714999	K	G	31	44
PSM	SNDPVAIAFADMLK	2598	sp|Q9NZR1|TMOD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	14-UNIMOD:188	ms_run[1]:scan=13972	82.85943333333334	2	1496.763314	1496.764045	R	V	238	252
PSM	SILLATDVASR	2599	sp|Q9H0S4|DDX47_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=7082	40.293095	2	1145.644522	1144.645188	R	G	315	326
PSM	QLVHELDEAEYR	2600	sp|Q06323|PSME1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:28,12-UNIMOD:267	ms_run[1]:scan=8577	48.699495	2	1493.7052	1493.7021	R	D	199	211
PSM	ELYLEEALQNER	2601	sp|Q9NTX5|ECHD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=10286	58.74183000000001	2	1505.741084	1505.736188	R	D	272	284
PSM	TLIGYSAAELNR	2602	sp|Q06546|GABPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=7651	43.60089333333333	2	1307.682372	1306.688115	K	L	405	417
PSM	EDIQQFFEEFQSK	2603	sp|Q8N806|UBR7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	13-UNIMOD:188	ms_run[1]:scan=13664	80.52180666666666	2	1680.780618	1679.777446	R	K	400	413
PSM	AVVGVVAGGGR	2604	sp|P62917|RL8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=2619	17.20164	2	940.533772	940.545414	R	I	164	175
PSM	CATPVIIDEILPSKK	2605	sp|Q9ULW0|TPX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=12574	73.37842666666667	2	1665.8985	1665.9006	R	M	145	160
PSM	TAICNLILGNPPSK	2606	sp|Q9NRX1|PNO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	4-UNIMOD:4	ms_run[1]:scan=9422	53.54594833333333	2	1496.806089	1496.802099	R	V	223	237
PSM	ADGTATAPPPR	2607	sp|Q7Z6Z7-2|HUWE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:267	ms_run[2]:scan=755	7.8721	2	1062.5333	1062.5333	K	S	707	718
PSM	AFEVMDEFDGR	2608	sp|Q9UDY2-5|ZO2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:267	ms_run[2]:scan=9765	55.465	2	1324.5633	1324.5633	R	S	139	150
PSM	AGFAGDDAPR	2609	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=1968	13.971	2	975.44101	975.4410	K	A	19	29
PSM	AGIVQEDVQPPGLK	2610	sp|Q8N5G0|SIM20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6828	38.972	2	1449.7827	1449.7827	R	V	45	59
PSM	AGLPGFYDPCVGEEK	2611	sp|Q9NVH1-3|DJC11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=9167	52.093	2	1643.7597	1643.7597	K	N	457	472
PSM	AGNGQNSCGVEDVLQLLR	2612	sp|Q9ULT8|HECD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	8-UNIMOD:4,18-UNIMOD:267	ms_run[2]:scan=13194	77.459	2	1938.9457	1938.9457	K	I	1988	2006
PSM	AGNLGGGVVTIER	2613	sp|P35268|RL22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:267	ms_run[2]:scan=5744	33.25	2	1251.6811	1251.6811	K	S	53	66
PSM	AIVEYRDLDAPDDVDFF	2614	sp|Q9BXP5-5|SRRT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=12644	73.837	2	1998.9211	1998.9211	R	-	823	840
PSM	ALADENEFVR	2615	sp|Q92616|GCN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:267	ms_run[2]:scan=5719	33.121	2	1172.5701	1172.5701	K	D	1785	1795
PSM	ALDELFEAIEQK	2616	sp|Q27J81|INF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=12599	73.544	2	1404.7137	1404.7137	R	Q	878	890
PSM	ALDGAFTEENR	2617	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4949	29.279	2	1221.5626	1221.5626	K	A	1545	1556
PSM	ALGQNPTNAEVLK	2618	sp|P60660-2|MYL6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4874	28.812	2	1353.7252	1353.7252	R	V	38	51
PSM	ALLGYADNQCK	2619	sp|Q9HC38|GLOD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:4	ms_run[2]:scan=4980	29.448	2	1251.5918	1251.5918	R	L	188	199
PSM	ALTSELANAR	2620	sp|P26038|MOES_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4413	26.298	2	1044.5564	1044.5564	K	D	524	534
PSM	ALVEMQDVVAELLR	2621	sp|Q9C0H2-3|TTYH3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=14759	91.279	2	1584.8545	1584.8545	K	T	146	160
PSM	AMGTLLNTAISEVIGK	2622	sp|O43264-2|ZW10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:35	ms_run[2]:scan=13338	78.386	2	1632.8757	1632.8757	K	I	652	668
PSM	APSVPAAEPEYPK	2623	sp|P54819-3|KAD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:188	ms_run[2]:scan=4783	28.256	2	1360.697	1360.6970	M	G	2	15
PSM	AQIWDTAGQER	2624	sp|P62491-2|RB11A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:267	ms_run[2]:scan=5279	30.959	2	1283.6134	1283.6134	K	Y	62	73
PSM	AQSVGDSEVAAIGQLAFLR	2625	sp|Q96ME1-2|FXL18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	19-UNIMOD:267	ms_run[2]:scan=13292	78.088	2	1941.0195	1941.0195	R	H	516	535
PSM	ASAGPQPLLVQSCK	2626	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:4	ms_run[2]:scan=5082	29.971	2	1454.7551	1454.7551	K	A	944	958
PSM	ASFENNCEIGCFAK	2627	sp|P56537|IF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	7-UNIMOD:4,11-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=7118	40.47	2	1651.7066	1651.7066	R	L	5	19
PSM	ASGPPVSELITK	2628	sp|P10412|H14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:188	ms_run[2]:scan=6635	37.95	2	1203.6806	1203.6806	K	A	35	47
PSM	ASLTLFCPEEGDWK	2629	sp|P46821|MAP1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	7-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=11048	63.547	2	1657.7753	1657.7753	K	N	184	198
PSM	ATEALCWAEGQR	2630	sp|Q969X6-2|UTP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	6-UNIMOD:4	ms_run[2]:scan=6847	39.079	2	1390.6299	1390.6299	R	L	62	74
PSM	ATIGADFLTK	2631	sp|P51149|RAB7A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:188	ms_run[2]:scan=7835	44.602	2	1041.5802	1041.5802	K	E	39	49
PSM	AVAENQPFLIEAMTYR	2632	sp|P12694|ODBA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=12297	71.589	2	1851.9189	1851.9189	R	I	317	333
PSM	AVAQALEVIPR	2633	sp|P49368-2|TCPG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:267	ms_run[2]:scan=8033	45.657	2	1175.6902	1175.6902	R	T	401	412
PSM	AYGPGIEPTGNMVK	2634	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	14-UNIMOD:188	ms_run[2]:scan=5900	34.048	2	1438.7222	1438.7222	R	K	286	300
PSM	CAGNEDIITLR	2635	sp|P12004|PCNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:4	ms_run[2]:scan=6582	37.691	2	1260.6132	1260.6132	K	A	81	92
PSM	CDKEFMWALK	2636	sp|P58546|MTPN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:1,1-UNIMOD:4	ms_run[2]:scan=10853	62.345	2	1368.6206	1368.6206	M	N	2	12
PSM	CFIVGADNVGSK	2637	sp|P05388-2|RLA0_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:4	ms_run[2]:scan=5772	33.39	2	1265.6074	1265.6074	K	Q	27	39
PSM	CLATGPGIASTVK	2638	sp|O75369-6|FLNB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=5065	29.88	2	1279.6902	1279.6902	K	T	1617	1630
PSM	CLEEFELLGK	2639	sp|Q99613-2|EIF3C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:4,10-UNIMOD:188	ms_run[2]:scan=10013	56.855	2	1242.6262	1242.6262	K	A	79	89
PSM	CQNALQQVVAR	2640	sp|Q06210-2|GFPT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:4	ms_run[2]:scan=5406	31.579	2	1285.6561	1285.6561	K	Q	602	613
PSM	CQSLQEELDFR	2641	sp|Q03252|LMNB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:4,11-UNIMOD:267	ms_run[2]:scan=8587	48.754	2	1433.6484	1433.6484	R	K	212	223
PSM	CVVSSLGITDR	2642	sp|Q14690|RRP5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:4	ms_run[2]:scan=6425	36.835	2	1205.6074	1205.6074	R	G	151	162
PSM	DFYVAFQDLPTR	2643	sp|Q14566|MCM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11397	65.762	2	1470.7143	1470.7143	K	H	109	121
PSM	DLDDFQSWLSR	2644	sp|Q01082|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:267	ms_run[2]:scan=12408	72.306	2	1390.6393	1390.6393	R	T	1070	1081
PSM	DLDDFQSWLSR	2645	sp|Q01082|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=12419	72.376	2	1380.631	1380.6310	R	T	1070	1081
PSM	DSALEFLTQLSR	2646	sp|Q6PJG6|BRAT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:267	ms_run[2]:scan=13554	79.789	2	1388.7175	1388.7175	R	H	518	530
PSM	EAFQSVVLPAFEK	2647	sp|Q6P2E9|EDC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:188	ms_run[2]:scan=10960	62.995	2	1469.7862	1469.7862	R	S	1116	1129
PSM	EGMNIVEAMER	2648	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:267	ms_run[2]:scan=9209	52.326	2	1287.5827	1287.5827	K	F	134	145
PSM	EKLEATINELV	2649	sp|P10599-2|THIO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9825	55.78	2	1257.6816	1257.6816	K	-	75	86
PSM	ELDQWIEQLNECK	2650	sp|P67775-2|PP2AA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:4	ms_run[2]:scan=11330	65.341	2	1703.7825	1703.7825	K	Q	9	22
PSM	ELISFLSEPEILVK	2651	sp|A6NDU8|CE051_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=13765	81.229	2	1615.9073	1615.9073	K	E	98	112
PSM	ELQVGIPVADEAGQR	2652	sp|Q9BWM7|SFXN3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7872	44.793	2	1580.8158	1580.8158	R	L	199	214
PSM	ELSDFISYLQR	2653	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=12276	71.457	2	1369.6878	1369.6878	R	E	472	483
PSM	EQSILELGSLLAK	2654	sp|O00231|PSD11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:188	ms_run[2]:scan=12984	76.085	2	1405.8124	1405.8124	K	T	47	60
PSM	FAEVYFAQSQQK	2655	sp|Q14165|MLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:188	ms_run[2]:scan=6828	38.972	2	1450.7188	1450.7188	K	V	127	139
PSM	FDQPLEASTWLK	2656	sp|P51398-2|RT29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:188	ms_run[2]:scan=10596	60.755	2	1439.7392	1439.7392	R	N	137	149
PSM	FELSCYSLAPQIK	2657	sp|P00966|ASSY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=10118	57.57	2	1560.7953	1560.7953	R	V	128	141
PSM	FLEGTSCIAGVFVDATK	2658	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	7-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=12213	71.055	2	1819.9122	1819.9122	K	E	3896	3913
PSM	FMATNDLMTELQK	2659	sp|Q86VP6|CAND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9980	56.652	2	1540.7266	1540.7266	R	D	24	37
PSM	FSASGELGNGNIK	2660	sp|P12004|PCNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:188	ms_run[2]:scan=5215	30.648	2	1298.6562	1298.6562	K	L	169	182
PSM	FVALENISCK	2661	sp|Q8TAT6|NPL4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	9-UNIMOD:4	ms_run[2]:scan=6873	39.206	2	1179.5958	1179.5958	K	I	180	190
PSM	FVASCGFTPDVK	2662	sp|Q9Y4P3|TBL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:4,12-UNIMOD:188	ms_run[2]:scan=6623	37.888	2	1332.648	1332.6480	R	V	243	255
PSM	FVVQNVSAQK	2663	sp|Q92598-2|HS105_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:188	ms_run[2]:scan=3627	22.306	2	1124.6285	1124.6285	R	D	462	472
PSM	FVVQNVSAQK	2664	sp|Q92598-2|HS105_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3629	22.315	2	1118.6084	1118.6084	R	D	462	472
PSM	GAGNCPECGTPLR	2665	sp|P51948-2|MAT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=2323	15.799	2	1387.5973	1387.5973	R	K	42	55
PSM	GATQQILDEAER	2666	sp|P78371-2|TCPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:267	ms_run[2]:scan=6205	35.622	2	1339.6607	1339.6607	R	S	330	342
PSM	GCTATLGNFAK	2667	sp|P15880|RS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:4,11-UNIMOD:188	ms_run[2]:scan=5062	29.867	2	1144.5642	1144.5642	R	A	228	239
PSM	GEELGGGQDPVQLLSGFPR	2668	sp|Q04323|UBXN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=12316	71.71	3	1954.9749	1954.9749	R	R	248	267
PSM	GELVGGLDIVK	2669	sp|O76003|GLRX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8721	49.468	2	1098.6285	1098.6285	K	E	309	320
PSM	GFFDPNTEENLTYLQLK	2670	sp|P15924-2|DESP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=12432	72.455	2	2027.984	2027.9840	K	E	1815	1832
PSM	GFVLQDTVEQLR	2671	sp|P56192-2|SYMC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:267	ms_run[2]:scan=10148	57.762	2	1413.7491	1413.7491	R	C	377	389
PSM	GGAEGELQALR	2672	sp|Q15149-7|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5493	32.021	2	1099.5622	1099.5622	R	A	1437	1448
PSM	GGGVTNLLWSPDGSK	2673	sp|Q9NRG9-2|AAAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9674	54.954	2	1486.7416	1486.7416	R	I	254	269
PSM	GGLQEVAEQLELER	2674	sp|Q9UIV1-2|CNOT7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	14-UNIMOD:267	ms_run[2]:scan=11156	64.221	2	1579.8081	1579.8081	K	I	207	221
PSM	GIPGFGNTGNISGAPVTYPSAGAQGVNNTASGNNSR	2675	sp|Q86XP3-2|DDX42_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9382	53.315	3	3403.6141	3403.6141	K	E	643	679
PSM	GISDPLTVFEQTEAAAR	2676	sp|O00116|ADAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=12638	73.797	2	1803.9003	1803.9003	R	E	587	604
PSM	GLGLDESGLAK	2677	sp|Q9Y265|RUVB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6077	34.984	2	1058.5608	1058.5608	K	Q	23	34
PSM	GLGTDDNTLIR	2678	sp|P09525|ANXA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:267	ms_run[2]:scan=5582	32.44	2	1183.6072	1183.6072	K	V	260	271
PSM	GLGTDDNTLIR	2679	sp|P09525|ANXA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5591	32.483	2	1173.599	1173.5990	K	V	260	271
PSM	GLGTDEDSLIEIICSR	2680	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	14-UNIMOD:4	ms_run[2]:scan=12882	75.357	2	1776.8564	1776.8564	K	T	120	136
PSM	GLIQQFTTITGASESVGK	2681	sp|O94888|UBXN7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	18-UNIMOD:188	ms_run[2]:scan=11460	66.149	2	1841.983	1841.9830	K	H	15	33
PSM	GLPCTELFVAPVGVASK	2682	sp|O00515|LAD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	4-UNIMOD:4	ms_run[2]:scan=11085	63.776	2	1743.9229	1743.9229	R	R	425	442
PSM	GQSEDPGSLLSLFR	2683	sp|P08195-2|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	14-UNIMOD:267	ms_run[2]:scan=13185	77.403	2	1514.7604	1514.7604	K	R	410	424
PSM	GSGGGGGGGGQGSTNYGK	2684	sp|Q99729-3|ROAA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	18-UNIMOD:188	ms_run[2]:scan=546	6.7086	2	1459.6383	1459.6383	R	S	254	272
PSM	GTRDDEYDYLFK	2685	sp|P62491-2|RB11A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:1	ms_run[2]:scan=9569	54.388	2	1562.6889	1562.6889	M	V	2	14
PSM	GVVQELQQAISK	2686	sp|P29692|EF1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:188	ms_run[2]:scan=10788	61.941	2	1304.7395	1304.7395	R	L	96	108
PSM	GWEEALENVIK	2687	sp|Q9H583|HEAT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:188	ms_run[2]:scan=12640	73.815	2	1292.6708	1292.6708	R	S	639	650
PSM	GWEEALENVIK	2688	sp|Q9H583|HEAT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=12641	73.82	2	1286.6507	1286.6507	R	S	639	650
PSM	GYLGPEQLPDCLK	2689	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=8852	50.192	2	1494.7484	1494.7484	K	G	79	92
PSM	IANPVEGSSGR	2690	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=2108	14.703	2	1085.5465	1085.5465	K	Q	315	326
PSM	ICDDELILIK	2691	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:4	ms_run[2]:scan=9638	54.767	2	1230.653	1230.6530	R	N	356	366
PSM	ICSYCNNILGK	2692	sp|Q8WWI1|LMO7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:4,5-UNIMOD:4	ms_run[2]:scan=5827	33.681	2	1340.6217	1340.6217	R	G	1613	1624
PSM	IDFVGELNDK	2693	sp|P55786-2|PSA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:188	ms_run[2]:scan=8315	47.252	2	1154.5915	1154.5915	K	M	102	112
PSM	IDFVGELNDK	2694	sp|P55786-2|PSA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8321	47.283	2	1148.5714	1148.5714	K	M	102	112
PSM	IGGDLTAAVTK	2695	sp|Q7Z739|YTHD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:188	ms_run[2]:scan=5289	31.006	2	1050.6017	1050.6017	K	T	196	207
PSM	IIQLLDDYPK	2696	sp|P05388-2|RLA0_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:188	ms_run[2]:scan=9504	54.014	2	1222.6905	1222.6905	K	C	17	27
PSM	IIQLLDDYPK	2697	sp|P05388-2|RLA0_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9506	54.027	2	1216.6703	1216.6703	K	C	17	27
PSM	IITEGFEAAK	2698	sp|P40227-2|TCPZ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:188	ms_run[2]:scan=5277	30.951	2	1083.5908	1083.5908	R	E	73	83
PSM	ILDILGETCK	2699	sp|Q15424-2|SAFB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	9-UNIMOD:4	ms_run[2]:scan=8791	49.834	2	1160.6111	1160.6111	K	S	148	158
PSM	ILIENGVAER	2700	sp|Q9H0A0|NAT10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4981	29.453	2	1112.619	1112.6190	R	Q	12	22
PSM	ILIENGVAER	2701	sp|Q9H0A0|NAT10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4997	29.537	2	1112.619	1112.6190	R	Q	12	22
PSM	ILIENGVAER	2702	sp|Q9H0A0|NAT10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:267	ms_run[2]:scan=4988	29.493	2	1122.6272	1122.6272	R	Q	12	22
PSM	ILTATIENNR	2703	sp|P13646-3|K1C13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:267	ms_run[2]:scan=4119	24.834	2	1153.6331	1153.6331	K	V	166	176
PSM	ILTTNTWSSELSK	2704	sp|O60701-3|UGDH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8233	46.823	2	1478.7617	1478.7617	K	L	111	124
PSM	INEWLTLVEK	2705	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11252	64.844	2	1243.6812	1243.6812	K	E	1698	1708
PSM	IQLEQVQEWK	2706	sp|Q14203-5|DCTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7929	45.091	2	1299.6823	1299.6823	K	S	119	129
PSM	IQQLTEEIGR	2707	sp|P12270|TPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5418	31.635	2	1185.6354	1185.6354	R	L	1368	1378
PSM	IQQLTEEIGR	2708	sp|P12270|TPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:267	ms_run[2]:scan=5416	31.627	2	1195.6436	1195.6436	R	L	1368	1378
PSM	ISELSGCTPDPR	2709	sp|Q9H9P8-2|L2HDH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	7-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=3982	24.124	2	1340.627	1340.6270	R	I	266	278
PSM	ISGLIYEETR	2710	sp|P62805|H4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6223	35.713	2	1179.6136	1179.6136	R	G	47	57
PSM	ITPSYVAFTPEGER	2711	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	14-UNIMOD:267	ms_run[2]:scan=7889	44.886	2	1575.7808	1575.7808	R	L	61	75
PSM	ITQLTPFNGYAGAK	2712	sp|O14975-2|S27A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	14-UNIMOD:188	ms_run[2]:scan=7848	44.665	2	1485.7923	1485.7923	K	A	376	390
PSM	ITSEAEDLVANFFPK	2713	sp|P61289|PSME3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	15-UNIMOD:188	ms_run[2]:scan=13825	81.716	2	1685.8608	1685.8608	R	K	22	37
PSM	IVEANPLLEAFGNAK	2714	sp|Q9UM54-5|MYO6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	15-UNIMOD:188	ms_run[2]:scan=12000	69.621	2	1590.8713	1590.8713	R	T	182	197
PSM	LAATNALLNSLEFTK	2715	sp|Q14974|IMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=12244	71.252	2	1604.8774	1604.8774	K	A	192	207
PSM	LAPALATGNTVVMK	2716	sp|P30837|AL1B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	14-UNIMOD:188	ms_run[2]:scan=6783	38.719	2	1390.795	1390.7950	K	V	196	210
PSM	LAPEVMEDLVK	2717	sp|P62760|VISL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9660	54.882	2	1242.653	1242.6530	K	S	8	19
PSM	LCNEEQELLR	2718	sp|Q13042-4|CDC16_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:4,10-UNIMOD:267	ms_run[2]:scan=5847	33.779	2	1312.6321	1312.6321	K	F	99	109
PSM	LCPNSTGAEIR	2719	sp|P35998|PRS7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:4	ms_run[2]:scan=2564	16.947	2	1216.587	1216.5870	R	S	376	387
PSM	LDDIFEPVLIPEPK	2720	sp|Q14008-2|CKAP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	14-UNIMOD:188	ms_run[2]:scan=12757	74.57	2	1629.8961	1629.8961	K	I	1510	1524
PSM	LDIDSPPITAR	2721	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6725	38.401	2	1196.6401	1196.6401	R	N	33	44
PSM	LDQPMTEIVSR	2722	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:267	ms_run[2]:scan=6682	38.179	2	1297.6576	1297.6576	R	V	971	982
PSM	LEGLTDEINFLR	2723	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:267	ms_run[2]:scan=13195	77.465	2	1428.7488	1428.7488	R	Q	214	226
PSM	LEGLTDEINFLR	2724	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=12081	70.157	2	1418.7405	1418.7405	R	Q	214	226
PSM	LEGLTDEINFLR	2725	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=13015	76.289	2	1418.7405	1418.7405	R	Q	214	226
PSM	LELFLPEEYPMAAPK	2726	sp|P61088|UBE2N_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=12609	73.608	2	1746.8902	1746.8902	K	V	54	69
PSM	LENLGIPEEELLR	2727	sp|Q01658|NC2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:267	ms_run[2]:scan=10902	62.639	2	1533.8278	1533.8278	R	Q	108	121
PSM	LEPMIVPDLDLK	2728	sp|Q9Y6Y8-2|S23IP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11765	68.044	2	1381.7527	1381.7527	R	A	831	843
PSM	LEPMIVPDLDLK	2729	sp|Q9Y6Y8-2|S23IP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:188	ms_run[2]:scan=11767	68.053	2	1387.7728	1387.7728	R	A	831	843
PSM	LESALTELEQLR	2730	sp|P12270|TPR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:267	ms_run[2]:scan=11545	66.674	2	1410.7594	1410.7594	K	K	583	595
PSM	LFDSTIADEGTWTLEDR	2731	sp|Q8WVJ2|NUDC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	17-UNIMOD:267	ms_run[2]:scan=11325	65.308	2	1977.9195	1977.9195	K	K	66	83
PSM	LFSQGIGGEQAQAK	2732	sp|Q9H9E3-3|COG4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	14-UNIMOD:188	ms_run[2]:scan=4776	28.21	2	1438.7512	1438.7512	K	F	499	513
PSM	LGASNSPGQPNSVK	2733	sp|P49756|RBM25_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=1289	10.59	2	1354.6841	1354.6841	K	R	672	686
PSM	LGDASIAAPFTSK	2734	sp|Q9HD20|AT131_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7646	43.578	2	1276.6663	1276.6663	K	L	951	964
PSM	LGDLYEEEMR	2735	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:267	ms_run[2]:scan=6599	37.77	2	1263.5681	1263.5681	R	E	146	156
PSM	LGGDLGTYVINK	2736	sp|Q16595-2|FRDA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:188	ms_run[2]:scan=7657	43.634	2	1254.6915	1254.6915	K	Q	136	148
PSM	LIANNTTVER	2737	sp|O96019-2|ACL6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:267	ms_run[2]:scan=2191	15.086	2	1139.6174	1139.6174	K	R	338	348
PSM	LIANNTTVER	2738	sp|O96019-2|ACL6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=2194	15.098	2	1129.6091	1129.6091	K	R	338	348
PSM	LIEAVDNMLSNK	2739	sp|Q9H223|EHD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8881	50.349	2	1345.6912	1345.6912	K	I	381	393
PSM	LIEAVDNMLSNK	2740	sp|Q9H223|EHD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:188	ms_run[2]:scan=8888	50.394	2	1351.7113	1351.7113	K	I	381	393
PSM	LLAEALNQVTQR	2741	sp|Q05655|KPCD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:267	ms_run[2]:scan=8286	47.102	2	1364.7651	1364.7651	K	A	286	298
PSM	LLDEVFFSEK	2742	sp|P25789|PSA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:188	ms_run[2]:scan=10612	60.858	2	1231.6432	1231.6432	K	I	55	65
PSM	LLDEVFFSEK	2743	sp|P25789|PSA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10623	60.926	2	1225.6231	1225.6231	K	I	55	65
PSM	LLEAAAQSTK	2744	sp|Q15149-7|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=1952	13.899	2	1030.5659	1030.5659	R	G	4431	4441
PSM	LLVSASQDGK	2745	sp|P62873-2|GBB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:188	ms_run[2]:scan=2462	16.462	2	1022.5704	1022.5704	R	L	69	79
PSM	LLVSASQDGK	2746	sp|P62873-2|GBB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=2463	16.466	2	1016.5502	1016.5502	R	L	69	79
PSM	LMTDTINEPILLCR	2747	sp|O43776|SYNC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=10358	59.22	2	1697.872	1697.8720	R	F	426	440
PSM	LNEQQSVLQR	2748	sp|Q14683|SMC1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3120	19.791	2	1213.6415	1213.6415	K	I	1010	1020
PSM	LNIGDLQVTK	2749	sp|Q9UNM6|PSD13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:188	ms_run[2]:scan=8285	47.098	2	1105.6439	1105.6439	K	E	123	133
PSM	LNIGDLQVTK	2750	sp|Q9UNM6|PSD13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8287	47.106	2	1099.6237	1099.6237	K	E	123	133
PSM	LPSDVVTAVR	2751	sp|P04181|OAT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5738	33.217	2	1055.5975	1055.5975	K	G	363	373
PSM	LQAEISQAAR	2752	sp|O43395|PRPF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=2731	17.831	2	1085.5829	1085.5829	K	K	351	361
PSM	LQGPQTSAEVYR	2753	sp|Q8N335|GPD1L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:267	ms_run[2]:scan=3908	23.751	2	1357.6865	1357.6865	K	I	299	311
PSM	LQTSSVLVSGLR	2754	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7592	43.274	2	1258.7245	1258.7245	R	G	30	42
PSM	LSELEAALQR	2755	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7113	40.449	2	1128.6139	1128.6139	K	A	353	363
PSM	LSELEAALQR	2756	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7285	41.457	2	1128.6139	1128.6139	K	A	353	363
PSM	LSQLEGVNVER	2757	sp|Q96QK1|VPS35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:267	ms_run[2]:scan=5348	31.301	2	1252.6651	1252.6651	R	Y	227	238
PSM	LSQLEGVNVER	2758	sp|Q96QK1|VPS35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:267	ms_run[2]:scan=5376	31.44	2	1252.6651	1252.6651	R	Y	227	238
PSM	LSVEGFAVDK	2759	sp|P55786-2|PSA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:188	ms_run[2]:scan=7863	44.747	2	1069.5751	1069.5751	K	M	774	784
PSM	LSVISVEDPPQR	2760	sp|P38117|ETFB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:267	ms_run[2]:scan=6547	37.504	2	1348.7226	1348.7226	K	T	222	234
PSM	LTAEDLFEAR	2761	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:267	ms_run[2]:scan=9561	54.345	2	1173.5905	1173.5905	R	I	3615	3625
PSM	LTPITYPQGLAMAK	2762	sp|P63000|RAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	14-UNIMOD:188	ms_run[2]:scan=9184	52.19	2	1508.8368	1508.8368	K	E	134	148
PSM	LTTLELLEVR	2763	sp|Q01082|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11066	63.661	2	1185.6969	1185.6969	R	R	2079	2089
PSM	LTVSEDGPGVR	2764	sp|Q96CW6|S7A6O_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3697	22.685	2	1128.5775	1128.5775	R	R	176	187
PSM	LTVTDLDAPNSPAWR	2765	sp|P22223-2|CADH3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	15-UNIMOD:267	ms_run[2]:scan=9306	52.881	2	1664.8398	1664.8398	R	A	349	364
PSM	LVENCVCLLR	2766	sp|O60716|CTND1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:4,7-UNIMOD:4,10-UNIMOD:267	ms_run[2]:scan=7412	42.213	2	1284.6558	1284.6558	K	N	575	585
PSM	LVGDVDFEGVR	2767	sp|P13995-2|MTDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7836	44.605	2	1204.6088	1204.6088	K	Q	187	198
PSM	LWEEQLAAAK	2768	sp|P14314-2|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6882	39.248	2	1157.6081	1157.6081	K	A	197	207
PSM	LWEEQLAAAK	2769	sp|P14314-2|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:188	ms_run[2]:scan=6896	39.314	2	1163.6282	1163.6282	K	A	197	207
PSM	LYTQNIDGLER	2770	sp|Q9NTG7-2|SIR3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6320	36.245	2	1320.6674	1320.6674	R	V	83	94
PSM	MEPAVSEPMRDQVAR	2771	sp|Q15738|NSDHL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:1,10-UNIMOD:267,15-UNIMOD:267	ms_run[2]:scan=6807	38.849	2	1776.8402	1776.8402	-	T	1	16
PSM	MGESDDSILR	2772	sp|P63220|RS21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:35,10-UNIMOD:267	ms_run[2]:scan=3398	21.204	2	1147.5055	1147.5055	R	L	62	72
PSM	MGESDDSILR	2773	sp|P63220|RS21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:35	ms_run[2]:scan=3400	21.213	2	1137.4972	1137.4972	R	L	62	72
PSM	MGESDDSILR	2774	sp|P63220|RS21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4787	28.28	2	1121.5023	1121.5023	R	L	62	72
PSM	MGESDDSILR	2775	sp|P63220|RS21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:267	ms_run[2]:scan=4792	28.312	2	1131.5106	1131.5106	R	L	62	72
PSM	MISDAIPELK	2776	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:35	ms_run[2]:scan=7404	42.17	2	1131.5846	1131.5846	K	A	315	325
PSM	MISDAIPELK	2777	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:35,10-UNIMOD:188	ms_run[2]:scan=7405	42.174	2	1137.6047	1137.6047	K	A	315	325
PSM	MTISQQEFGR	2778	sp|P55036|PSMD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:267	ms_run[2]:scan=5425	31.667	2	1205.5738	1205.5738	K	T	263	273
PSM	MVSDINNAWGCLEQVEK	2779	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:35,11-UNIMOD:4	ms_run[2]:scan=10480	60.015	2	2007.903	2007.9030	R	G	360	377
PSM	NDSFIVDLFQGQYK	2780	sp|O94966-4|UBP19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	14-UNIMOD:188	ms_run[2]:scan=13697	80.729	2	1678.8298	1678.8298	R	S	625	639
PSM	NEPQNPGANSAR	2781	sp|P20339-2|RAB5A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=640	7.26	2	1253.5749	1253.5749	K	G	170	182
PSM	NFVDSPIIVDITK	2782	sp|P04062-4|GLCM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11685	67.554	2	1459.7922	1459.7922	R	D	348	361
PSM	NIEELQQQNQR	2783	sp|P12270|TPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:267	ms_run[2]:scan=2721	17.764	2	1408.6934	1408.6934	R	L	542	553
PSM	NIEELQQQNQR	2784	sp|P12270|TPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=2724	17.785	2	1398.6852	1398.6852	R	L	542	553
PSM	NLCDLGIVDPYPPLCDIK	2785	sp|P50579|MAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	3-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=12674	74.031	2	2101.0224	2101.0224	K	G	434	452
PSM	NLDQEQLSQVLDAMFER	2786	sp|P13861-2|KAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=14517	88.401	2	2034.9681	2034.9681	K	I	142	159
PSM	NLEPVSWSSLNPK	2787	sp|P98172|EFNB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:188	ms_run[2]:scan=9368	53.228	2	1475.7716	1475.7716	K	F	31	44
PSM	NLQEIQQAGER	2788	sp|Q8N1F7|NUP93_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3477	21.586	2	1284.6422	1284.6422	R	L	32	43
PSM	NLQYYDISAK	2789	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:188	ms_run[2]:scan=6099	35.085	2	1219.618	1219.6180	K	S	143	153
PSM	NMQDLVEDFK	2790	sp|P13647|K2C5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:188	ms_run[2]:scan=9862	55.966	2	1243.585	1243.5850	R	N	246	256
PSM	NQVEDLLATLEK	2791	sp|Q92542-2|NICA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:188	ms_run[2]:scan=13054	76.545	2	1377.7447	1377.7447	R	S	372	384
PSM	NSLESYAFNMK	2792	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:35	ms_run[2]:scan=6611	37.828	2	1318.5864	1318.5864	K	A	540	551
PSM	NSNILEDLETLR	2793	sp|P48444|COPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:267	ms_run[2]:scan=12866	75.258	2	1425.7339	1425.7339	K	L	73	85
PSM	NVDLSTFYQNR	2794	sp|O94826|TOM70_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8414	47.803	2	1355.647	1355.6470	K	A	149	160
PSM	PVSSAASVYAGAGGSGSR	2795	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	18-UNIMOD:267	ms_run[2]:scan=3584	22.076	3	1589.7673	1589.7673	R	I	28	46
PSM	PVSSAASVYAGAGGSGSR	2796	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3596	22.137	3	1579.759	1579.7590	R	I	28	46
PSM	QGCDCECLGGGR	2797	sp|Q9NRX4|PHP14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	3-UNIMOD:4,5-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=1305	10.669	2	1367.5017	1367.5017	K	I	67	79
PSM	QLAEGTAQQR	2798	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:267	ms_run[2]:scan=847	8.3535	2	1110.5657	1110.5657	R	L	1667	1677
PSM	QLGEANEEFALR	2799	sp|Q9Y679-3|AUP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:267	ms_run[2]:scan=7097	40.37	2	1385.6815	1385.6815	R	V	232	244
PSM	QNFIDPLQNLCEK	2800	sp|Q99961|SH3G1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=10649	61.09	2	1623.8022	1623.8022	K	D	137	150
PSM	QNGTVVGTDIAELLLR	2801	sp|O15027-2|SC16A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=14088	83.904	2	1697.9312	1697.9312	R	D	1547	1563
PSM	QSFLTEVEQLSR	2802	sp|P51617-4|IRAK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=12061	70.024	2	1435.7307	1435.7307	K	F	254	266
PSM	QWNNCAFLESSAK	2803	sp|P61224-2|RAP1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=7737	44.09	2	1559.7134	1559.7134	R	S	90	103
PSM	SCIAESPLWYSVIPMDR	2804	sp|Q14202-2|ZMYM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:4	ms_run[2]:scan=13504	79.46	2	2022.9543	2022.9543	R	S	1313	1330
PSM	SCYEDGWLIK	2805	sp|P23434|GCSH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:4	ms_run[2]:scan=8733	49.526	2	1269.57	1269.5700	K	M	137	147
PSM	SEGTYCCGPVPVR	2806	sp|P21980|TGM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	6-UNIMOD:4,7-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=4209	25.264	2	1490.6522	1490.6522	K	A	365	378
PSM	SEGVVAVLLTK	2807	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9786	55.583	2	1114.6598	1114.6598	R	K	225	236
PSM	SETSGSFEDALLAIVK	2808	sp|P09525|ANXA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=14062	83.685	2	1665.8461	1665.8461	K	C	226	242
PSM	SGNELPLAVASTADLIR	2809	sp|Q9Y4W2-4|LAS1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	17-UNIMOD:267	ms_run[2]:scan=11956	69.315	2	1735.9344	1735.9344	R	C	80	97
PSM	SIDGMQYPIVIK	2810	sp|Q9H9P8-2|L2HDH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9656	54.858	2	1362.7217	1362.7217	R	N	232	244
PSM	SLEDALAEAQR	2811	sp|O95347|SMC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:267	ms_run[2]:scan=7244	41.183	2	1211.6021	1211.6021	R	V	298	309
PSM	SLENAIEWSVK	2812	sp|Q9Y570-2|PPME1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:188	ms_run[2]:scan=9594	54.53	2	1280.6708	1280.6708	K	S	20	31
PSM	SLENAIEWSVK	2813	sp|Q9Y570-2|PPME1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9596	54.544	2	1274.6507	1274.6507	K	S	20	31
PSM	SLTANPELIDR	2814	sp|Q9Y2L1-2|RRP44_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6055	34.86	2	1227.6459	1227.6459	K	L	170	181
PSM	SLVEIADTVPK	2815	sp|O00410-2|IPO5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:188	ms_run[2]:scan=8237	46.84	2	1176.6697	1176.6697	K	Y	179	190
PSM	SLVEIADTVPK	2816	sp|O00410-2|IPO5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8242	46.867	2	1170.6496	1170.6496	K	Y	179	190
PSM	SMVPVQVQLDVPVVK	2817	sp|P18754|RCC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	15-UNIMOD:188	ms_run[2]:scan=10983	63.139	2	1642.9423	1642.9423	K	V	162	177
PSM	SPNTEEIFNMLTK	2818	sp|Q7KZ85|SPT6H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=12359	71.99	2	1522.7337	1522.7337	R	E	1143	1156
PSM	SQFEELCAELLQK	2819	sp|Q92598-2|HS105_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	7-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=11310	65.216	3	1599.791	1599.7910	R	I	304	317
PSM	SQVEEELFSVR	2820	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:267	ms_run[2]:scan=9021	51.205	2	1331.6597	1331.6597	R	V	2192	2203
PSM	SQVEEELFSVR	2821	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9068	51.507	2	1321.6514	1321.6514	R	V	2192	2203
PSM	SSSAGSGHQPSQSR	2822	sp|Q13542|4EBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:1	ms_run[2]:scan=442	6.072	2	1413.6233	1413.6233	M	A	2	16
PSM	SVDLAEYAPNLR	2823	sp|Q86W92-3|LIPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:267	ms_run[2]:scan=9273	52.694	2	1356.6913	1356.6913	R	G	665	677
PSM	SVLEGGDIPLQGLSGLK	2824	sp|Q9BX66-8|SRBS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	17-UNIMOD:188	ms_run[2]:scan=11416	65.879	2	1687.9452	1687.9452	K	R	461	478
PSM	SVLNEFDAIQK	2825	sp|Q14674-2|ESPL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:188	ms_run[2]:scan=9036	51.302	2	1268.6708	1268.6708	R	A	1427	1438
PSM	SVYGGEFIQQLK	2826	sp|Q9NQG5|RPR1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9215	52.353	2	1367.7085	1367.7085	R	L	115	127
PSM	SYELPDGQVITIGNER	2827	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	16-UNIMOD:267	ms_run[2]:scan=15225	95.902	2	1799.8929	1799.8929	K	F	239	255
PSM	SYELPDGQVITIGNER	2828	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	16-UNIMOD:267	ms_run[2]:scan=10348	59.158	3	1799.8929	1799.8929	K	F	239	255
PSM	SYELPDGQVITIGNER	2829	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10061	57.151	3	1789.8846	1789.8846	K	F	239	255
PSM	TAICNLILGNPPSK	2830	sp|Q9NRX1|PNO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	4-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=9455	53.724	2	1502.8222	1502.8222	R	V	223	237
PSM	TFESLVDFSK	2831	sp|Q16836|HCDH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:188	ms_run[2]:scan=9824	55.776	2	1177.5962	1177.5962	K	A	193	203
PSM	TFESLVDFSK	2832	sp|Q16836|HCDH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9828	55.794	2	1171.5761	1171.5761	K	A	193	203
PSM	TGNFQVTELGR	2833	sp|O75643|U520_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6301	36.138	2	1220.6149	1220.6149	K	I	976	987
PSM	TIAMDGTEGLVR	2834	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	4-UNIMOD:35	ms_run[2]:scan=4815	28.449	2	1277.6286	1277.6286	R	G	110	122
PSM	TIECISLIGLAVGK	2835	sp|O00410-2|IPO5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	4-UNIMOD:4	ms_run[2]:scan=12392	72.204	2	1472.8273	1472.8273	K	E	497	511
PSM	TNIIPVLEDAR	2836	sp|A6NHQ2|FBLL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8754	49.634	2	1239.6823	1239.6823	R	H	220	231
PSM	TQLYEYLQNR	2837	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:267	ms_run[2]:scan=7839	44.618	2	1336.6651	1336.6651	R	M	269	279
PSM	TQVAGGQLSFK	2838	sp|P46060|RAGP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:188	ms_run[2]:scan=5259	30.866	2	1140.6235	1140.6235	K	G	16	27
PSM	TTPSYVAFTDTER	2839	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:267	ms_run[2]:scan=6837	39.023	2	1496.7023	1496.7023	R	L	37	50
PSM	TVGALQVLGTEAQSSLLK	2840	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=12170	70.757	2	1814.0149	1814.0149	R	A	1275	1293
PSM	TVLSNVQEELDR	2841	sp|O43237-2|DC1L2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:267	ms_run[2]:scan=9441	53.646	2	1411.7182	1411.7182	K	M	386	398
PSM	TVSALGLDPSGAR	2842	sp|Q9NW82|WDR70_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6069	34.939	2	1242.6568	1242.6568	K	L	184	197
PSM	TWEQQQEVVSR	2843	sp|Q9UJU6|DBNL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:267	ms_run[2]:scan=3944	23.933	2	1398.6767	1398.6767	R	N	236	247
PSM	TWEQQQEVVSR	2844	sp|Q9UJU6|DBNL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3953	23.978	2	1388.6684	1388.6684	R	N	236	247
PSM	VAEITELILK	2845	sp|Q06265|EXOS9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:188	ms_run[2]:scan=10607	60.825	2	1133.7003	1133.7003	K	A	258	268
PSM	VAEITELILK	2846	sp|Q06265|EXOS9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10616	60.88	2	1127.6802	1127.6802	K	A	258	268
PSM	VAFGSLAANGPTTLVDK	2847	sp|Q9UKX7-2|NUP50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	17-UNIMOD:188	ms_run[2]:scan=9486	53.914	2	1665.9033	1665.9033	K	V	83	100
PSM	VAGQDGSVVQFK	2848	sp|P61956-2|SUMO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:188	ms_run[2]:scan=4695	27.743	2	1239.6555	1239.6555	K	I	22	34
PSM	VAGQDGSVVQFK	2849	sp|P61956-2|SUMO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4704	27.79	2	1233.6354	1233.6354	K	I	22	34
PSM	VAGYAALLEQYQK	2850	sp|P54920|SNAA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:188	ms_run[2]:scan=9706	55.137	2	1458.7814	1458.7814	K	A	168	181
PSM	VAGYAALLEQYQK	2851	sp|P54920|SNAA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9709	55.15	2	1452.7613	1452.7613	K	A	168	181
PSM	VAMFLTDSNNIK	2852	sp|Q15046|SYK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:188	ms_run[2]:scan=8243	46.871	2	1357.7007	1357.7007	R	E	554	566
PSM	VAQLCDFNPK	2853	sp|P09497-2|CLCB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:4	ms_run[2]:scan=5737	33.213	2	1190.5754	1190.5754	K	S	177	187
PSM	VDFPQDQLTALTGR	2854	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10186	58.022	2	1559.7944	1559.7944	K	I	216	230
PSM	VFEVNASNLEK	2855	sp|Q9P2J5|SYLC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:188	ms_run[2]:scan=6583	37.695	2	1254.6551	1254.6551	R	Q	29	40
PSM	VGDDPAVWQLK	2856	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:188	ms_run[2]:scan=7973	45.32	2	1232.6497	1232.6497	K	N	2105	2116
PSM	VIGLSSDLQQVGGASAR	2857	sp|O00303|EIF3F_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	17-UNIMOD:267	ms_run[2]:scan=8044	45.717	3	1666.8878	1666.8878	R	I	262	279
PSM	VISLEDFMEK	2858	sp|Q9H488-2|OFUT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:188	ms_run[2]:scan=11596	66.993	2	1215.6153	1215.6153	R	L	102	112
PSM	VIVDFSSPNIAK	2859	sp|P54136-2|SYRC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:188	ms_run[2]:scan=8007	45.501	2	1294.7228	1294.7228	K	E	122	134
PSM	VLIGGDETPEGQR	2860	sp|O60701-3|UGDH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4248	25.458	2	1369.6838	1369.6838	R	A	81	94
PSM	VLSVPESTPFTAVLK	2861	sp|P61960|UFM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11483	66.293	2	1586.892	1586.8920	K	F	20	35
PSM	VLTVINQTQK	2862	sp|P42766|RL35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3805	23.24	2	1142.6659	1142.6659	R	E	57	67
PSM	VLYPNDNFFEGK	2863	sp|P11216|PYGB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:188	ms_run[2]:scan=9310	52.905	2	1447.7079	1447.7079	R	E	279	291
PSM	VMDIPYLNLEGPDLQPK	2864	sp|O95453-4|PARN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	17-UNIMOD:188	ms_run[2]:scan=12791	74.788	2	1947.0119	1947.0119	R	R	252	269
PSM	VNNVDFTNIIR	2865	sp|Q07157-2|ZO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:267	ms_run[2]:scan=9225	52.405	2	1313.6967	1313.6967	R	E	470	481
PSM	VPTANVSVVDLTCR	2866	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:4	ms_run[2]:scan=8074	45.89	2	1529.7872	1529.7872	R	L	193	207
PSM	VQISPDSGGLPER	2867	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:267	ms_run[2]:scan=5175	30.443	2	1363.6971	1363.6971	K	S	178	191
PSM	VQISPDSGGLPER	2868	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5179	30.465	2	1353.6888	1353.6888	K	S	178	191
PSM	VQQTVQDLFGR	2869	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7980	45.356	2	1289.6728	1289.6728	K	A	395	406
PSM	VQTDPPSVPICDLYPNGVFPK	2870	sp|P50579|MAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:4,21-UNIMOD:188	ms_run[2]:scan=11807	68.3	2	2348.1818	2348.1818	K	G	111	132
PSM	VTLDPVQLESSLLR	2871	sp|Q9UPN3-4|MACF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=12762	74.6	2	1568.8774	1568.8774	R	S	2848	2862
PSM	VTLGTQPTVLR	2872	sp|Q16531|DDB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5911	34.099	2	1183.6925	1183.6925	K	T	629	640
PSM	VTLTSEEEAR	2873	sp|P00338-3|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=2520	16.743	2	1133.5564	1133.5564	K	L	335	345
PSM	VTTVVATLGQGPER	2874	sp|P49840|GSK3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	14-UNIMOD:267	ms_run[2]:scan=6107	35.124	2	1436.7863	1436.7863	K	S	100	114
PSM	YAQAGFEGFK	2875	sp|O75643|U520_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:188	ms_run[2]:scan=6135	35.26	2	1122.5441	1122.5441	K	T	470	480
PSM	YEELQSLAGK	2876	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5540	32.242	2	1136.5714	1136.5714	K	H	286	296
PSM	YGEPSEVFINR	2877	sp|Q8WXF1-2|PSPC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6777	38.684	2	1309.6303	1309.6303	R	D	105	116
PSM	YGEPSEVFINR	2878	sp|Q8WXF1-2|PSPC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6806	38.845	2	1309.6303	1309.6303	R	D	105	116
PSM	YGSDIVPFSK	2879	sp|P13010|XRCC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7032	40.034	2	1111.555	1111.5550	R	V	316	326
PSM	YLECSALTQR	2880	sp|P63000|RAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	4-UNIMOD:4,10-UNIMOD:267	ms_run[2]:scan=5044	29.777	2	1249.6	1249.6000	K	G	154	164
PSM	YLLQETWLEK	2881	sp|Q96HE7|ERO1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:188	ms_run[2]:scan=10432	59.705	2	1327.7119	1327.7119	R	K	266	276
PSM	YLQEEVNINR	2882	sp|Q9UHD8-7|SEPT9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5233	30.743	2	1276.6412	1276.6412	K	K	371	381
PSM	YNFPVEVEVPMER	2883	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10874	62.473	2	1607.7654	1607.7654	R	K	1988	2001
PSM	YNILGTNAIMDK	2884	sp|Q9BUJ2-3|HNRL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:188	ms_run[2]:scan=9110	51.764	2	1357.7007	1357.7007	K	M	336	348
PSM	YPVNSVNILK	2885	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:188	ms_run[2]:scan=7105	40.411	2	1151.6646	1151.6646	R	A	190	200
PSM	YQQGDFGYCPR	2886	sp|P67870|CSK2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	9-UNIMOD:4	ms_run[2]:scan=5026	29.687	2	1389.5772	1389.5772	K	V	101	112
PSM	YVASYLLAALGGNSSPSAK	2887	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	19-UNIMOD:188	ms_run[2]:scan=12562	73.303	3	1873.9881	1873.9881	R	D	3	22
PSM	QRELAEQELEK	2888	sp|Q15149|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28,2-UNIMOD:267,11-UNIMOD:188	ms_run[1]:scan=5385	31.48095	2	1370.6968	1370.7007	R	Q	1823	1834
PSM	CEFQDAYVLLSEKK	2889	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:385,1-UNIMOD:4,13-UNIMOD:188,14-UNIMOD:188	ms_run[1]:scan=12240	71.22859333333334	2	1723.8493	1723.8525	K	I	237	251
PSM	QVYVDKLAELK	2890	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28	ms_run[1]:scan=9447	53.679006666666666	2	1287.7063	1287.7069	K	N	669	680
PSM	QIILEKEETEELK	2891	sp|P12956|XRCC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28	ms_run[1]:scan=8640	49.041715	2	1583.8345	1583.8289	R	R	326	339
PSM	QATKDAGVIAGLNVLR	2892	sp|P0DMV8|HS71A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28	ms_run[1]:scan=10365	59.26385333333333	2	1607.9006	1607.8990	R	I	156	172
PSM	NALESYAFNMK	2893	sp|P0DMV8|HS71A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=8771	49.72174833333333	2	1286.596741	1286.596523	K	S	540	551
PSM	QYTGINAISKK	2894	sp|P61158|ARP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28,10-UNIMOD:188,11-UNIMOD:188	ms_run[1]:scan=5288	31.00191666666667	2	1216.6800	1216.6849	K	E	255	266
PSM	QYTGINAISKK	2895	sp|P61158|ARP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28	ms_run[1]:scan=5287	30.99785	2	1204.6432	1204.6447	K	E	255	266
PSM	IQELEDLLAK	2896	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	10-UNIMOD:188	ms_run[1]:scan=9735	55.296576666666674	2	1176.668829	1176.669733	R	E	321	331
PSM	CQSLQEELDFRK	2897	sp|Q03252|LMNB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=8998	51.05618666666666	2	1534.7102	1534.7081	R	S	212	224
PSM	FGEVVDCTIK	2898	sp|O14979|HNRDL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	7-UNIMOD:4,10-UNIMOD:188	ms_run[1]:scan=6241	35.79960833333333	2	1172.584760	1172.584290	R	T	171	181
PSM	QSSFALLGDLTK	2899	sp|Q92973|TNPO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28,12-UNIMOD:188	ms_run[1]:scan=13352	78.47994166666666	2	1267.6728	1267.6750	R	A	693	705
PSM	VLQLTSWDEDAWASK	2900	sp|P18206|VINC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	15-UNIMOD:188	ms_run[1]:scan=11359	65.52489166666666	2	1754.865121	1753.861844	R	D	247	262
PSM	QISDGEREELNLTANR	2901	sp|O95816|BAG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28	ms_run[1]:scan=7560	43.082951666666666	2	1826.8768	1826.8753	R	L	71	87
PSM	CIGKPGGSLDNSEQK	2902	sp|Q9Y5L4|TIM13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=5035	29.732298333333333	2	1571.7239	1571.7244	K	C	50	65
PSM	CGETGHVAINCSK	2903	sp|P62633|CNBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:385,1-UNIMOD:4,11-UNIMOD:4,13-UNIMOD:188	ms_run[1]:scan=3155	19.972925	2	1420.6106	1420.6165	R	T	140	153
PSM	SLESNPEQLQAMR	2904	sp|Q9HCE1|MOV10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	13-UNIMOD:267	ms_run[1]:scan=6063	34.904045	2	1512.7182	1511.7272	R	H	496	509
PSM	QPAIMPGQSYGLEDGSCSYKDFSESR	2905	sp|P14866|HNRPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28,17-UNIMOD:4,20-UNIMOD:188,26-UNIMOD:267	ms_run[1]:scan=10226	58.3092	2	2907.2674	2907.2657	K	N	456	482
PSM	QPAIMPGQSYGLEDGSCSYKDFSESR	2906	sp|P14866|HNRPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28,17-UNIMOD:4	ms_run[1]:scan=10214	58.22662166666667	2	2891.2381	2891.2373	K	N	456	482
PSM	QELIKEYLELEK	2907	sp|O94992|HEXI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28	ms_run[1]:scan=12717	74.30876333333333	2	1516.7988	1516.8020	K	C	285	297
PSM	QIGVEHVVVYVNK	2908	sp|P49411|EFTU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28,13-UNIMOD:188	ms_run[1]:scan=8713	49.42968166666667	2	1471.8122	1471.8125	R	A	170	183
PSM	QIGVEHVVVYVNK	2909	sp|P49411|EFTU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28	ms_run[1]:scan=8710	49.41508333333333	2	1465.7931	1465.7924	R	A	170	183
PSM	QQQQQQQHQQPNR	2910	sp|Q6Y7W6|GGYF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28	ms_run[1]:scan=411	5.846176666666667	2	1657.7655	1657.7664	K	A	1016	1029
PSM	ATENDIANFFSPLNPIR	2911	sp|P31942|HNRH3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	17-UNIMOD:267	ms_run[1]:scan=13618	80.219245	2	1928.951332	1927.966746	R	V	206	223
PSM	QLDDLKVELSQLR	2912	sp|P42766|RL35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28	ms_run[1]:scan=12509	72.959165	2	1538.8299	1538.8299	K	V	20	33
PSM	AMDSDWFAENYMGR	2913	sp|P55084|ECHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	14-UNIMOD:267	ms_run[1]:scan=10975	63.08898833333333	2	1701.682953	1701.679096	K	K	392	406
PSM	CAGGHDDATLAR	2914	sp|P49916|DNLI3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=2727	17.805371666666666	2	1225.5114	1225.5141	K	L	729	741
PSM	ALPTDWLIYDEMTR	2915	sp|Q9H6S0|YTDC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	14-UNIMOD:267	ms_run[1]:scan=13214	77.587445	2	1732.836746	1732.836977	K	A	1029	1043
PSM	CKDVLTGQEFDVR	2916	sp|P43304|GPDM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:188,13-UNIMOD:267	ms_run[1]:scan=9155	52.031285	2	1564.7563	1564.7521	R	A	270	283
PSM	VLSVPESTPFTAVLK	2917	sp|P61960|UFM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=11535	66.61511833333333	2	1586.897270	1586.891960	K	F	20	35
PSM	NALGPGLSPELGPLPALR	2918	sp|Q8N1G4|LRC47_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	18-UNIMOD:267	ms_run[1]:scan=12689	74.12786333333332	2	1781.992931	1781.007488	R	V	85	103
PSM	GGLQEVAEQLELER	2919	sp|Q9UIV1|CNOT7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=11178	64.36335333333334	2	1569.804488	1569.799851	K	I	207	221
PSM	VAQLCDFNPK	2920	sp|P09497|CLCB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	5-UNIMOD:4	ms_run[1]:scan=5746	33.258383333333335	2	1191.589956	1190.575394	K	S	195	205
PSM	QLVHELDEAEYR	2921	sp|Q06323|PSME1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28	ms_run[1]:scan=8578	48.703885	2	1483.6975	1483.6938	R	D	199	211
PSM	IQELENLPGSLAGDLR	2922	sp|P51532|SMCA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	16-UNIMOD:267	ms_run[1]:scan=11220	64.64224499999999	2	1733.920460	1733.918733	R	T	382	398
PSM	VYVGNLGNNGNK	2923	sp|P84103|SRSF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	12-UNIMOD:188	ms_run[1]:scan=3047	19.457395	2	1253.648701	1253.645978	K	T	12	24
PSM	LIQQVAQEIWVCEK	2924	sp|Q9UG63|ABCF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	12-UNIMOD:4,14-UNIMOD:188	ms_run[1]:scan=10850	62.32817666666667	2	1748.9286	1748.9221	R	Q	575	589
PSM	ALSNLESIPGGYNALR	2925	sp|Q9UMX0|UBQL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=9481	53.88386333333333	2	1673.866708	1673.873684	R	R	258	274
PSM	IPNQFQSDPPAPSDK	2926	sp|Q9NRV9|HEBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	15-UNIMOD:188	ms_run[1]:scan=4433	26.390571666666666	2	1646.790723	1645.804330	R	S	104	119
PSM	CATPVIIDEILPSKK	2927	sp|Q9ULW0|TPX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:385,1-UNIMOD:4,14-UNIMOD:188,15-UNIMOD:188	ms_run[1]:scan=12557	73.26860333333333	2	1679.9352	1677.9412	R	M	145	160
PSM	VAGLETISTATGR	2928	sp|O76062|ERG24_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	13-UNIMOD:267	ms_run[1]:scan=6253	35.864338333333336	2	1284.696333	1284.691299	R	K	323	336
PSM	FASCVDASGGLK	2929	sp|Q8IXT5|RB12B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:4	ms_run[1]:scan=4500	26.750453333333333	2	1210.564075	1210.565223	K	C	201	213
PSM	VLQSFTVDSSK	2930	sp|O75369|FLNB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	11-UNIMOD:188	ms_run[1]:scan=5288	31.00191666666667	2	1218.647260	1215.644247	R	A	1439	1450
PSM	CIELCCGSVK	2931	sp|P05023|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:4,5-UNIMOD:4,6-UNIMOD:4,10-UNIMOD:188	ms_run[1]:scan=4582	27.170551666666665	2	1232.549507	1230.550230	K	E	459	469
PSM	PGEEGTVMSLAGK	2932	sp|O96008|TOM40_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	13-UNIMOD:188	ms_run[1]:scan=6282	36.02735833333333	2	1282.658040	1280.637781	R	Y	241	254
PSM	FEEILQEAGSR	2933	sp|P04920|B3A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	11-UNIMOD:267	ms_run[1]:scan=6695	38.24005	2	1287.648309	1287.633450	R	G	47	58
PSM	GPVGTVSEAQLAR	2934	sp|Q9NZM1|MYOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	13-UNIMOD:267	ms_run[1]:scan=4946	29.266268333333336	2	1293.686798	1293.691633	K	R	168	181
PSM	IIAINSELTQPK	2935	sp|Q8WVX9|FACR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	12-UNIMOD:188	ms_run[1]:scan=7044	40.09325666666666	2	1331.774799	1331.775596	K	L	79	91
PSM	GALTVGITNTVGSSISR	2936	sp|Q06210|GFPT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	17-UNIMOD:267	ms_run[1]:scan=8634	49.00775333333333	2	1641.896399	1641.892518	R	E	458	475
PSM	LMTDTINEPILLCR	2937	sp|O43776|SYNC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	2-UNIMOD:35,13-UNIMOD:4	ms_run[1]:scan=9425	53.565128333333334	2	1703.852083	1703.858629	R	F	426	440
PSM	AAELIANSLATAGDGLIELR	2938	sp|P35232|PHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=13337	78.38	3	1997.0793	1997.0793	K	K	220	240
PSM	AAVATFLQSVQVPEFTPK	2939	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	18-UNIMOD:188	ms_run[2]:scan=12971	76.007	3	1938.0558	1938.0558	R	S	745	763
PSM	AAVATFLQSVQVPEFTPK	2940	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=12950	75.851	3	1932.0357	1932.0357	R	S	745	763
PSM	AEAGDNLGALVR	2941	sp|P49411|EFTU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:267	ms_run[2]:scan=6407	36.735	2	1194.6232	1194.6232	R	G	316	328
PSM	AEELSPAALSPLLEPIR	2942	sp|A5YM69|ARG35_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=12914	75.59	2	1804.9935	1804.9935	R	C	441	458
PSM	AERGELDLTGAK	2943	sp|P13984|T2FB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:1	ms_run[2]:scan=5595	32.499	2	1300.6623	1300.6623	M	Q	2	14
PSM	AFSDPFVEAEK	2944	sp|P34932|HSP74_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:188	ms_run[2]:scan=8449	47.998	2	1244.602	1244.6020	R	S	74	85
PSM	AGDLANELVR	2945	sp|Q68CZ2-2|TENS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6143	35.299	2	1056.5564	1056.5564	K	H	986	996
PSM	AGFAGDDAPR	2946	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:267	ms_run[2]:scan=1966	13.963	2	985.44928	985.4493	K	A	19	29
PSM	AGNLGGGVVTIER	2947	sp|P35268|RL22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5745	33.254	2	1241.6728	1241.6728	K	S	53	66
PSM	AGRLPACVVDCGTGYTK	2948	sp|P61158|ARP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:1,3-UNIMOD:267,7-UNIMOD:4,11-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=7747	44.141	2	1881.9048	1877.9167	M	L	2	19
PSM	AILVDLEPGTMDSVR	2949	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:35,15-UNIMOD:267	ms_run[2]:scan=8861	50.239	2	1640.8319	1640.8319	R	S	63	78
PSM	AINIGQLVDVK	2950	sp|Q14690|RRP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9932	56.358	2	1168.6816	1168.6816	K	V	632	643
PSM	AITGFDDPFSGK	2951	sp|P15924-2|DESP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:188	ms_run[2]:scan=9359	53.175	2	1259.6129	1259.6129	K	T	1493	1505
PSM	AITIAGIPQSIIECVK	2952	sp|Q15366-7|PCBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	14-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=12814	74.94	2	1717.9744	1717.9744	R	Q	145	161
PSM	AIVEYRDLDAPDDVDFF	2953	sp|Q9BXP5-5|SRRT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	6-UNIMOD:267	ms_run[2]:scan=12636	73.785	2	2008.9294	2008.9294	R	-	823	840
PSM	ALCIDQLDVFLQK	2954	sp|Q5T8P6-6|RBM26_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=13266	77.921	3	1567.8375	1567.8375	K	E	51	64
PSM	ALDQFVNFSEQK	2955	sp|Q9UQE7|SMC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:188	ms_run[2]:scan=9050	51.396	2	1430.7137	1430.7137	K	E	986	998
PSM	ALELDPNLYR	2956	sp|P35580|MYH10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8709	49.411	2	1202.6295	1202.6295	R	I	753	763
PSM	ALGTEVIQLFPEK	2957	sp|O95831-3|AIFM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:188	ms_run[2]:scan=11553	66.724	2	1449.8175	1449.8175	R	G	321	334
PSM	ALTDAGCNLNPLQYIK	2958	sp|Q8WVM8-2|SCFD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	7-UNIMOD:4	ms_run[2]:scan=11734	67.854	2	1789.9033	1789.9033	K	Q	387	403
PSM	ALTVPELTQQMFDAK	2959	sp|P68371|TBB4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	15-UNIMOD:188	ms_run[2]:scan=12147	70.608	2	1696.8801	1696.8801	R	N	283	298
PSM	ALTVPELTQQVFDAK	2960	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	15-UNIMOD:188	ms_run[2]:scan=12088	70.203	3	1664.9081	1664.9081	R	N	283	298
PSM	ANLNLENLLEATK	2961	sp|Q9NS87-4|KIF15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11948	69.26	2	1441.7777	1441.7777	K	A	626	639
PSM	AQPLSLEELLAK	2962	sp|Q9BUQ8|DDX23_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11783	68.152	2	1310.7446	1310.7446	K	K	139	151
PSM	AQSLTTGQEGFIPFNFVAK	2963	sp|P06239-2|LCK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=12755	74.552	3	2054.0473	2054.0473	K	A	100	119
PSM	ASVDELFAEIVR	2964	sp|P61225|RAP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:267	ms_run[2]:scan=13677	80.601	2	1357.7117	1357.7117	K	Q	151	163
PSM	ATENDIYNFFSPLNPVR	2965	sp|P52597|HNRPF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=13656	80.469	3	1995.969	1995.9690	K	V	300	317
PSM	AVENYLIQMAR	2966	sp|O14737|PDCD5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:267	ms_run[2]:scan=9650	54.83	2	1316.6786	1316.6786	K	Y	69	80
PSM	AVLIAGQPGTGK	2967	sp|Q9Y230|RUVB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:188	ms_run[2]:scan=3494	21.665	2	1116.6598	1116.6598	R	T	72	84
PSM	AVSVTPIRDTK	2968	sp|Q9NR56-3|MBNL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:1	ms_run[2]:scan=4877	28.831	2	1227.6823	1227.6823	M	W	2	13
PSM	CIENLEELQSLR	2969	sp|Q15435-2|PP1R7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=9404	53.445	2	1512.7482	1512.7482	K	E	69	81
PSM	CQSLQEELDFR	2970	sp|Q03252|LMNB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:4	ms_run[2]:scan=8586	48.748	2	1423.6402	1423.6402	R	K	212	223
PSM	CSPIGVYTSGK	2971	sp|P33992|MCM5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:4,11-UNIMOD:188	ms_run[2]:scan=4385	26.169	2	1173.5795	1173.5795	K	G	397	408
PSM	CSVLAAANPVYGR	2972	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:4	ms_run[2]:scan=6673	38.134	2	1376.6871	1376.6871	R	Y	446	459
PSM	CTGGEVGATSALAPK	2973	sp|P30050|RL12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=3926	23.848	2	1423.7073	1423.7073	R	I	17	32
PSM	DFYVAFQDLPTR	2974	sp|Q14566|MCM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:267	ms_run[2]:scan=11386	65.696	2	1480.7226	1480.7226	K	H	109	121
PSM	DGALTQLNVAFSR	2975	sp|P16435|NCPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:267	ms_run[2]:scan=9787	55.587	2	1400.7287	1400.7287	R	E	585	598
PSM	DICNDVLSLLEK	2976	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:4,12-UNIMOD:188	ms_run[2]:scan=14122	84.22	2	1423.7324	1423.7324	R	F	92	104
PSM	DICNDVLSLLEK	2977	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:4	ms_run[2]:scan=14124	84.238	2	1417.7123	1417.7123	R	F	92	104
PSM	DLPDVQELITQVR	2978	sp|Q9UHB9-4|SRP68_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=12742	74.471	2	1524.8148	1524.8148	K	S	471	484
PSM	DLPDVQELITQVR	2979	sp|Q9UHB9-4|SRP68_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:267	ms_run[2]:scan=12743	74.477	2	1534.823	1534.8230	K	S	471	484
PSM	DLYEDELVPLFEK	2980	sp|O43390-3|HNRPR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=13086	76.754	2	1608.7923	1608.7923	R	A	137	150
PSM	DSLIFLVDASK	2981	sp|P12956|XRCC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:188	ms_run[2]:scan=11467	66.193	2	1212.6697	1212.6697	R	A	36	47
PSM	DTPDEPWAFPAR	2982	sp|Q7KZF4|SND1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9234	52.458	2	1400.6361	1400.6361	K	E	72	84
PSM	EAINVEQAFQTIAR	2983	sp|P51149|RAB7A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11725	67.798	2	1588.8209	1588.8209	K	N	158	172
PSM	EALFNEFVAAAR	2984	sp|O14776-2|TCRG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:267	ms_run[2]:scan=11524	66.545	2	1346.6858	1346.6858	R	K	749	761
PSM	EFADSLGIPFLETSAK	2985	sp|P62820|RAB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=13331	78.344	2	1723.8669	1723.8669	K	N	141	157
PSM	EFADSLGIPFLETSAK	2986	sp|P62820|RAB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	16-UNIMOD:188	ms_run[2]:scan=13477	79.283	2	1729.887	1729.8870	K	N	141	157
PSM	EIVLADVIDNDSWR	2987	sp|P22234|PUR6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=12553	73.245	3	1643.8155	1643.8155	K	L	202	216
PSM	EKLEATINELV	2988	sp|P10599-2|THIO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:188	ms_run[2]:scan=9822	55.766	2	1263.7018	1263.7018	K	-	75	86
PSM	ELDSITPEVLPGWK	2989	sp|Q16891-3|MIC60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	14-UNIMOD:188	ms_run[2]:scan=11362	65.542	2	1588.8444	1588.8444	R	G	340	354
PSM	ENGLEVLQEAFSR	2990	sp|O75165|DJC13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:267	ms_run[2]:scan=12889	75.403	2	1500.7448	1500.7448	R	C	1443	1456
PSM	EVLDSFLDLAR	2991	sp|Q15758|AAAT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=12722	74.344	2	1276.6663	1276.6663	K	N	179	190
PSM	EYEIPSNLTPADVFFR	2992	sp|Q8WUM0|NU133_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	16-UNIMOD:267	ms_run[2]:scan=13374	78.62	2	1906.934	1906.9340	R	E	676	692
PSM	FASENDLPEWK	2993	sp|P43487-2|RANG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7936	45.127	2	1334.6143	1334.6143	R	E	58	69
PSM	FEEILQEAGSR	2994	sp|P04920-2|B3A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6703	38.282	2	1277.6252	1277.6252	R	G	33	44
PSM	FEELNADLFR	2995	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9997	56.759	2	1252.6088	1252.6088	R	G	302	312
PSM	FGEVVDCTLK	2996	sp|Q14103-4|HNRPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	7-UNIMOD:4	ms_run[2]:scan=6233	35.759	2	1166.5642	1166.5642	K	L	101	111
PSM	FIEDELQIPVK	2997	sp|P30520|PURA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9664	54.902	2	1329.718	1329.7180	R	W	431	442
PSM	FLDGNEMTLADCNLLPK	2998	sp|Q9Y696|CLIC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:4	ms_run[2]:scan=11655	67.36	2	1949.9227	1949.9227	K	L	178	195
PSM	FLEEYLSSTPQR	2999	sp|P61803|DAD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:267	ms_run[2]:scan=8312	47.238	2	1478.7281	1478.7281	R	L	12	24
PSM	FLESLPEEEQQR	3000	sp|P17480-2|UBF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:267	ms_run[2]:scan=6619	37.871	2	1513.7288	1513.7288	R	V	324	336
PSM	FLPAVSDENSK	3001	sp|P46087-2|NOP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4515	26.833	2	1205.5928	1205.5928	R	R	31	42
PSM	FLQDTIEEMALK	3002	sp|O95202|LETM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:188	ms_run[2]:scan=11069	63.678	2	1442.7422	1442.7422	K	N	263	275
PSM	FQTEIQTVNK	3003	sp|P14868|SYDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4039	24.412	2	1206.6245	1206.6245	R	Q	321	331
PSM	FTQLDLEDVQVR	3004	sp|Q9NTJ3-2|SMC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9448	53.683	2	1461.7464	1461.7464	K	E	390	402
PSM	FVQCPDGELQK	3005	sp|Q9Y230|RUVB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	4-UNIMOD:4,11-UNIMOD:188	ms_run[2]:scan=3734	22.884	2	1325.6381	1325.6381	K	R	224	235
PSM	FVQCPDGELQK	3006	sp|Q9Y230|RUVB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	4-UNIMOD:4	ms_run[2]:scan=3736	22.893	2	1319.618	1319.6180	K	R	224	235
PSM	GCTATLGNFAK	3007	sp|P15880|RS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:4	ms_run[2]:scan=5064	29.876	2	1138.5441	1138.5441	R	A	228	239
PSM	GELVGGLDIVK	3008	sp|O76003|GLRX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:188	ms_run[2]:scan=8715	49.438	2	1104.6486	1104.6486	K	E	309	320
PSM	GGAEQFMEETER	3009	sp|Q99832-3|TCPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5954	34.309	2	1382.5772	1382.5772	R	S	332	344
PSM	GGGALSAVAATK	3010	sp|P61011-2|SRP54_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3235	20.366	2	1001.5506	1001.5506	K	S	207	219
PSM	GGSGGGGEGIQDR	3011	sp|O43823|AKAP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:267	ms_run[2]:scan=814	8.1861	2	1155.5144	1155.5144	R	E	110	123
PSM	GISQEQMQEFR	3012	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	7-UNIMOD:35,11-UNIMOD:267	ms_run[2]:scan=3077	19.591	2	1377.6222	1377.6222	K	A	761	772
PSM	GISQEQMQEFR	3013	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:267	ms_run[2]:scan=5555	32.316	2	1361.6273	1361.6273	K	A	761	772
PSM	GMELLSPEDLVNACK	3014	sp|Q86VN1-2|VPS36_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	14-UNIMOD:4	ms_run[2]:scan=11441	66.031	2	1674.7957	1674.7957	R	M	220	235
PSM	GVQVETISPGDGR	3015	sp|P62942|FKB1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:267	ms_run[2]:scan=4290	25.654	2	1323.6658	1323.6658	M	T	2	15
PSM	GVVQELQQAISK	3016	sp|P29692|EF1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10789	61.946	2	1298.7194	1298.7194	R	L	96	108
PSM	GYLGPEQLPDCLK	3017	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=9108	51.748	2	1494.7484	1494.7484	K	G	79	92
PSM	IAIWTTECENR	3018	sp|P06730|IF4E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	8-UNIMOD:4,11-UNIMOD:267	ms_run[2]:scan=6997	39.858	2	1401.6586	1401.6586	K	E	163	174
PSM	IALYETPTGWK	3019	sp|P36871-2|PGM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:188	ms_run[2]:scan=8533	48.457	2	1283.6857	1283.6857	K	F	368	379
PSM	ICDDELILIK	3020	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:4,10-UNIMOD:188	ms_run[2]:scan=9637	54.763	2	1236.6731	1236.6731	R	N	356	366
PSM	IELLGSYDPQK	3021	sp|P24666|PPAC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:188	ms_run[2]:scan=8015	45.548	2	1267.6755	1267.6755	K	Q	114	125
PSM	IENVVLVVPVK	3022	sp|Q9NQW7-2|XPP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:188	ms_run[2]:scan=9177	52.148	2	1213.7741	1213.7741	R	T	512	523
PSM	IFVGGLNPEATEEK	3023	sp|Q99729-3|ROAA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	14-UNIMOD:188	ms_run[2]:scan=7619	43.424	2	1508.7818	1508.7818	K	I	156	170
PSM	IISNVPADSLIR	3024	sp|Q9UIG0-2|BAZ1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7812	44.474	2	1296.7402	1296.7402	K	T	232	244
PSM	IITEGFEAAK	3025	sp|P40227-2|TCPZ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5278	30.955	2	1077.5706	1077.5706	R	E	73	83
PSM	ILASTQFEPTAAR	3026	sp|Q9NZ08|ERAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:267	ms_run[2]:scan=6081	35.001	2	1413.7491	1413.7491	R	M	176	189
PSM	ILQDVADEEIAALPR	3027	sp|O60783|RT14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	15-UNIMOD:267	ms_run[2]:scan=10511	60.209	2	1661.8864	1661.8864	K	D	66	81
PSM	IMNVIGEPIDER	3028	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7921	45.051	2	1384.7021	1384.7021	R	G	144	156
PSM	IMNVIGEPIDER	3029	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:267	ms_run[2]:scan=7922	45.055	2	1394.7103	1394.7103	R	G	144	156
PSM	IMNVIGEPIDER	3030	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:35	ms_run[2]:scan=6344	36.384	2	1400.697	1400.6970	R	G	144	156
PSM	IMPEDIIINCSK	3031	sp|P11387|TOP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:4	ms_run[2]:scan=9256	52.589	2	1431.7102	1431.7102	R	D	377	389
PSM	INEWLTLVEK	3032	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:188	ms_run[2]:scan=11254	64.855	2	1249.7014	1249.7014	K	E	1698	1708
PSM	INPSSMFDVQVK	3033	sp|P06737-2|PYGL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9573	54.408	2	1363.6806	1363.6806	K	R	524	536
PSM	IPTEAPQLELK	3034	sp|Q5VW32-2|BROX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7067	40.223	2	1237.6918	1237.6918	K	A	303	314
PSM	IQELEDLLAK	3035	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9737	55.305	2	1170.6496	1170.6496	R	E	321	331
PSM	IQETQAELPR	3036	sp|Q14566|MCM6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3481	21.601	2	1183.6197	1183.6197	R	G	208	218
PSM	IQLVEEELDR	3037	sp|P06753-3|TPM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7678	43.754	2	1242.6456	1242.6456	R	A	56	66
PSM	ISLEDIQAFEK	3038	sp|Q8WXX5|DNJC9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10632	60.983	2	1291.666	1291.6660	K	T	108	119
PSM	ISTLPQLNSALVQDLAK	3039	sp|P14635-2|CCNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	17-UNIMOD:188	ms_run[2]:scan=12479	72.757	2	1816.0401	1816.0401	K	A	375	392
PSM	ITPSYVAFTPEGER	3040	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7898	44.937	2	1565.7726	1565.7726	R	L	61	75
PSM	ITSEAEDLVANFFPK	3041	sp|P61289|PSME3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	15-UNIMOD:188	ms_run[2]:scan=13944	82.659	2	1685.8608	1685.8608	R	K	22	37
PSM	IVEIPFNSTNK	3042	sp|P05023-3|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:188	ms_run[2]:scan=7121	40.49	2	1266.6915	1266.6915	K	Y	446	457
PSM	IYIGDDNPLTLIVK	3043	sp|P06756-3|ITAV_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=13298	78.129	2	1572.8763	1572.8763	K	A	601	615
PSM	IYVGNLPTDVR	3044	sp|Q13242|SRSF9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7356	41.892	2	1245.6717	1245.6717	R	E	16	27
PSM	LAMLEEDLLALK	3045	sp|Q6NVY1-2|HIBCH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:188	ms_run[2]:scan=13096	76.819	2	1363.7728	1363.7728	K	S	222	234
PSM	LAQNILSYLDLK	3046	sp|Q9UL15|BAG5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:188	ms_run[2]:scan=13306	78.18	2	1395.8069	1395.8069	R	S	430	442
PSM	LDIDSPPITAR	3047	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:267	ms_run[2]:scan=6698	38.259	2	1206.6484	1206.6484	R	N	33	44
PSM	LDQLIYIPLPDEK	3048	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:188	ms_run[2]:scan=12047	69.937	2	1561.8699	1561.8699	R	S	639	652
PSM	LEGLTDEINFLR	3049	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=12531	73.1	2	1418.7405	1418.7405	R	Q	214	226
PSM	LEGLTDEINFLR	3050	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=12692	74.146	2	1418.7405	1418.7405	R	Q	214	226
PSM	LEIEPEWAYGK	3051	sp|Q00688|FKBP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9270	52.674	2	1333.6554	1333.6554	R	K	190	201
PSM	LFQTNTELLELTTK	3052	sp|Q8NB49-2|AT11C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10957	62.978	2	1649.8876	1649.8876	R	T	693	707
PSM	LGDLYEEEMR	3053	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6594	37.744	2	1253.5598	1253.5598	R	E	146	156
PSM	LGSLVENNER	3054	sp|Q99613-2|EIF3C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2906	18.747	2	1129.5728	1129.5728	K	V	853	863
PSM	LITLEEEMTK	3055	sp|P07237|PDIA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7982	45.364	2	1205.6213	1205.6213	R	Y	317	327
PSM	LLAVTGEQAQQAR	3056	sp|Q5JTZ9|SYAM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:267	ms_run[2]:scan=3855	23.469	2	1393.7553	1393.7553	R	E	778	791
PSM	LNDYIFSFDK	3057	sp|P54136-2|SYRC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:188	ms_run[2]:scan=10777	61.879	2	1266.6228	1266.6228	R	M	441	451
PSM	LQEENLVITPR	3058	sp|P09327|VILI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6645	37.999	2	1310.7194	1310.7194	R	L	610	621
PSM	LQVAGEITTGPR	3059	sp|Q9UJS0|CMC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:267	ms_run[2]:scan=5376	31.44	2	1250.6858	1250.6858	R	V	456	468
PSM	LSDLLAPISEQIK	3060	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:188	ms_run[2]:scan=10799	62.006	2	1431.828	1431.8280	K	E	100	113
PSM	LSELEAALQR	3061	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=15128	94.829	2	1128.6139	1128.6139	K	A	353	363
PSM	LSLDGQNIYNACCTLR	3062	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:4,13-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=9074	51.545	3	1906.8905	1906.8905	K	I	239	255
PSM	LSSAYLLGVPGSEQPDR	3063	sp|Q96P48-7|ARAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9018	51.182	2	1787.9054	1787.9054	R	A	182	199
PSM	LSVEGFAVDK	3064	sp|P55786-2|PSA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7867	44.764	2	1063.555	1063.5550	K	M	774	784
PSM	LVLLGESAVGK	3065	sp|P20339-2|RAB5A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7665	43.678	2	1084.6492	1084.6492	K	S	23	34
PSM	LVMAGETTNSR	3066	sp|P26358-3|DNMT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2301	15.679	2	1177.5761	1177.5761	K	G	861	872
PSM	LVQEALEAVPR	3067	sp|Q15269|PWP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:267	ms_run[2]:scan=7545	42.988	2	1233.6957	1233.6957	K	G	774	785
PSM	LVSPGSANETSSILVESVTR	3068	sp|O75369-6|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	20-UNIMOD:267	ms_run[2]:scan=9772	55.505	3	2055.0723	2055.0723	R	S	2411	2431
PSM	LYYFQYPCYQEGLR	3069	sp|Q9NRW3|ABC3C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	8-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=10744	61.681	2	1908.8744	1908.8744	R	S	123	137
PSM	MEATTAGVGRLEEEALR	3070	sp|Q8WUD4|CCD12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:1	ms_run[2]:scan=11495	66.367	2	1873.9204	1873.9204	-	R	1	18
PSM	MEGISNFKTPSK	3071	sp|Q96KB5|TOPK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:1	ms_run[2]:scan=7589	43.254	2	1379.6755	1379.6755	-	L	1	13
PSM	MELIQDTSRPPLEYVK	3072	sp|P0DMM9-2|ST1A3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:1	ms_run[2]:scan=12600	73.549	2	1959.9976	1959.9976	-	G	1	17
PSM	MINLSVPDTIDER	3073	sp|P13797-3|PLST_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:35	ms_run[2]:scan=8567	48.646	2	1517.7396	1517.7396	K	A	124	137
PSM	MISDAIPELK	3074	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8314	47.248	2	1115.5896	1115.5896	K	A	315	325
PSM	MISDAIPELK	3075	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:188	ms_run[2]:scan=8318	47.264	2	1121.6098	1121.6098	K	A	315	325
PSM	MISDAIPELK	3076	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:35,10-UNIMOD:188	ms_run[2]:scan=7576	43.178	2	1137.6047	1137.6047	K	A	315	325
PSM	MQLLEIITTEK	3077	sp|P40939|ECHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:188	ms_run[2]:scan=11727	67.81	2	1323.7415	1323.7415	K	T	506	517
PSM	MSAEINEIIR	3078	sp|P18206|VINC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7917	45.034	2	1174.6016	1174.6016	K	V	237	247
PSM	NALANPLYCPDYR	3079	sp|P22695|QCR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	9-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=8060	45.811	2	1575.7379	1575.7379	R	I	184	197
PSM	NAQGIINPIEAK	3080	sp|Q9UBB9|TFP11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:188	ms_run[2]:scan=6129	35.229	2	1272.7133	1272.7133	K	Q	171	183
PSM	NDAPTPGTSTTPGLR	3081	sp|Q04726-2|TLE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	15-UNIMOD:267	ms_run[2]:scan=3422	21.327	2	1493.735	1493.7350	R	S	324	339
PSM	NDAPTPGTSTTPGLR	3082	sp|Q04726-2|TLE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3427	21.348	2	1483.7267	1483.7267	R	S	324	339
PSM	NDGAAILAAVSSIAQK	3083	sp|P28331-3|NDUS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	16-UNIMOD:188	ms_run[2]:scan=12512	72.977	3	1533.8458	1533.8458	R	I	373	389
PSM	NEGNIFPNPEATFVK	3084	sp|Q9Y5B9|SP16H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9858	55.949	2	1675.8206	1675.8206	R	E	582	597
PSM	NFQEEQINTR	3085	sp|Q8IXB1-2|DJC10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3318	20.805	2	1277.6	1277.6000	R	D	711	721
PSM	NFSDNQLQEGK	3086	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3110	19.747	2	1278.584	1278.5840	R	N	161	172
PSM	NLDCPELISEFMK	3087	sp|P45973|CBX5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	4-UNIMOD:4	ms_run[2]:scan=12579	73.414	2	1594.7371	1594.7371	K	K	56	69
PSM	NLVELAELELK	3088	sp|Q9UNH7-2|SNX6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:188	ms_run[2]:scan=12823	74.996	2	1275.7381	1275.7381	K	H	260	271
PSM	NSEGWEQNGLYEFFR	3089	sp|Q8IWX8|CHERP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	15-UNIMOD:267	ms_run[2]:scan=12993	76.148	2	1884.8306	1884.8306	R	A	704	719
PSM	NSLPDTVQIR	3090	sp|P56537|IF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:267	ms_run[2]:scan=5593	32.491	2	1151.6174	1151.6174	R	R	86	96
PSM	NSPGSQVASNPR	3091	sp|Q9H0D6-2|XRN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:267	ms_run[2]:scan=869	8.4597	2	1222.593	1222.5930	R	Q	371	383
PSM	NTAAVLEAAQELLR	3092	sp|Q9BVQ7|SPA5L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	14-UNIMOD:267	ms_run[2]:scan=13530	79.634	2	1507.8234	1507.8234	R	N	127	141
PSM	NTLEWCLPVIDAK	3093	sp|P48444|COPD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	6-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=12035	69.848	2	1563.8062	1563.8062	R	N	436	449
PSM	NVQQQLDATSR	3094	sp|Q9BVW5|TIPIN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:267	ms_run[2]:scan=2749	17.936	2	1268.6348	1268.6348	K	N	285	296
PSM	NVTAIQGPGGK	3095	sp|P50213|IDH3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:188	ms_run[2]:scan=1957	13.923	2	1046.5816	1046.5816	R	W	67	78
PSM	QAQIEVVPSASALIIK	3096	sp|P30050|RL12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10601	60.785	2	1665.9665	1665.9665	R	A	68	84
PSM	QIIVDPLSFSEER	3097	sp|P35221|CTNA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11014	63.334	2	1531.7882	1531.7882	K	F	288	301
PSM	QLAEGTAQQR	3098	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=851	8.3703	2	1100.5574	1100.5574	R	L	1667	1677
PSM	QLSSGVSEIR	3099	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3480	21.597	2	1074.5669	1074.5669	R	H	80	90
PSM	QQIQSIQQSIER	3100	sp|P55769|NH2L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:267	ms_run[2]:scan=5649	32.768	2	1466.7717	1466.7717	K	L	114	126
PSM	SDFQVNLNNASR	3101	sp|O60716|CTND1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5883	33.96	2	1363.648	1363.6480	K	S	847	859
PSM	SDGEMVLPGFPDADSFVK	3102	sp|Q01780-2|EXOSX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	18-UNIMOD:188	ms_run[2]:scan=12537	73.139	2	1915.8969	1915.8969	K	F	20	38
PSM	SDVSPIIQPVPSIK	3103	sp|P40818-2|UBP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8463	48.074	2	1478.8344	1478.8344	K	N	312	326
PSM	SELPLDPLPVPTEEGNPLLK	3104	sp|Q15758|AAAT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=13137	77.087	2	2157.1569	2157.1569	K	H	503	523
PSM	SEWSDLLSDLQK	3105	sp|P08237-2|PFKAM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:188	ms_run[2]:scan=13255	77.853	2	1425.7083	1425.7083	R	A	130	142
PSM	SGAAVCEFFLK	3106	sp|O95639-3|CPSF4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	6-UNIMOD:4,11-UNIMOD:188	ms_run[2]:scan=9872	56.017	2	1233.6159	1233.6159	K	A	36	47
PSM	SGEGEVSGLMR	3107	sp|Q13263-2|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5049	29.797	2	1120.5183	1120.5183	R	K	391	402
PSM	SGGAVEPLGTR	3108	sp|O75312|ZPR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:267	ms_run[2]:scan=2385	16.09	2	1052.549	1052.5490	K	I	300	311
PSM	SGGAVEPLGTR	3109	sp|O75312|ZPR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2387	16.098	2	1042.5407	1042.5407	K	I	300	311
PSM	SIDGMQYPIVIK	3110	sp|Q9H9P8-2|L2HDH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:188	ms_run[2]:scan=9657	54.863	2	1368.7419	1368.7419	R	N	232	244
PSM	SIMDNFTEIIK	3111	sp|Q15528-2|MED22_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=12131	70.503	2	1309.6588	1309.6588	K	T	28	39
PSM	SIQADGLVWGSSK	3112	sp|P24534|EF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:188	ms_run[2]:scan=8150	46.34	2	1352.7032	1352.7032	R	L	164	177
PSM	SLAEGYFDAAGR	3113	sp|O43813|LANC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:267	ms_run[2]:scan=7274	41.385	2	1265.5916	1265.5916	K	L	16	28
PSM	SLETEILESLK	3114	sp|P48681|NEST_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:188	ms_run[2]:scan=13122	76.989	2	1266.7014	1266.7014	K	S	820	831
PSM	SLGPPQGEEDSVPR	3115	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4657	27.55	2	1466.7001	1466.7001	R	D	2107	2121
PSM	SLIDNFALNPDILCSAK	3116	sp|Q5UIP0-2|RIF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	14-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=13229	77.684	2	1895.9758	1895.9758	K	R	299	316
PSM	SLLEIQQEEAR	3117	sp|Q6Y7W6-4|GGYF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:267	ms_run[2]:scan=6493	37.211	2	1324.6862	1324.6862	K	Q	995	1006
PSM	SLYYYIQQDTK	3118	sp|P07355|ANXA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:188	ms_run[2]:scan=8276	47.051	2	1426.7076	1426.7076	K	G	314	325
PSM	SPAITATLEGK	3119	sp|Q8TBC4-2|UBA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:188	ms_run[2]:scan=5395	31.527	2	1092.6122	1092.6122	K	N	385	396
PSM	SPEACCELTLQPLR	3120	sp|P06132|DCUP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	5-UNIMOD:4,6-UNIMOD:4	ms_run[2]:scan=8307	47.21	2	1672.7913	1672.7913	R	R	61	75
PSM	SPNELVDDLFK	3121	sp|Q9UNZ2-4|NSF1C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:188	ms_run[2]:scan=11686	67.56	2	1281.6548	1281.6548	K	G	114	125
PSM	SQYEVMAEQNR	3122	sp|P08727|K1C19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:267	ms_run[2]:scan=3420	21.311	2	1363.6066	1363.6066	R	K	254	265
PSM	SSANVEEAFFTLAR	3123	sp|Q92930|RAB8B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	14-UNIMOD:267	ms_run[2]:scan=12293	71.566	2	1550.7604	1550.7604	K	D	154	168
PSM	STGEAFVQFASK	3124	sp|P31942-3|HNRH3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7213	41.002	2	1270.6194	1270.6194	R	E	7	19
PSM	SVEPQDAGPLER	3125	sp|Q9NZT2-2|OGFR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3865	23.518	2	1296.631	1296.6310	R	S	349	361
PSM	SVPLAATSMLITQGLISK	3126	sp|Q9NX40-3|OCAD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=13383	78.678	2	1829.0332	1829.0332	R	G	47	65
PSM	SVPLATAPMAEQR	3127	sp|Q9Y678|COPG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:267	ms_run[2]:scan=5448	31.784	2	1379.7107	1379.7107	K	T	578	591
PSM	SYELPDGQVITIGNER	3128	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	16-UNIMOD:267	ms_run[2]:scan=10825	62.168	2	1799.8929	1799.8929	K	F	239	255
PSM	SYELPDGQVITIGNER	3129	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10651	61.101	2	1789.8846	1789.8846	K	F	239	255
PSM	TAVHAGNINFK	3130	sp|P35221|CTNA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:1,11-UNIMOD:188	ms_run[2]:scan=5803	33.553	2	1218.6452	1218.6452	M	W	2	13
PSM	TDGFGIDTCR	3131	sp|P04632|CPNS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	9-UNIMOD:4,10-UNIMOD:267	ms_run[2]:scan=5109	30.113	2	1150.4952	1150.4952	K	S	136	146
PSM	TDGFGIDTCR	3132	sp|P04632|CPNS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	9-UNIMOD:4	ms_run[2]:scan=5132	30.239	2	1140.487	1140.4870	K	S	136	146
PSM	TEALSVIELLLK	3133	sp|Q5VYK3|ECM29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:188	ms_run[2]:scan=14777	91.396	2	1333.8164	1333.8164	R	K	1785	1797
PSM	TEALSVIELLLK	3134	sp|Q5VYK3|ECM29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=14778	91.401	2	1327.7963	1327.7963	R	K	1785	1797
PSM	TFEMSDFIVDTR	3135	sp|O75369-6|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11491	66.343	2	1459.6653	1459.6653	R	D	1993	2005
PSM	TFTDCFNCLPIAAIVDEK	3136	sp|P36873|PP1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	5-UNIMOD:4,8-UNIMOD:4,18-UNIMOD:188	ms_run[2]:scan=13811	81.576	2	2119.0061	2119.0061	K	I	151	169
PSM	TGCNVLLIQK	3137	sp|P50991-2|TCPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:4,10-UNIMOD:188	ms_run[2]:scan=5871	33.902	2	1150.6476	1150.6476	K	S	263	273
PSM	TGSGLNSFYDQR	3138	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:267	ms_run[2]:scan=6018	34.654	2	1353.6189	1353.6189	K	E	585	597
PSM	TINLYPLTNYTFGTK	3139	sp|O43809|CPSF5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=12136	70.537	2	1744.9036	1744.9036	R	E	36	51
PSM	TLAESALQLLYTAK	3140	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	14-UNIMOD:188	ms_run[2]:scan=13532	79.646	3	1526.8651	1526.8651	K	E	1767	1781
PSM	TLDDDVFMPLYPK	3141	sp|Q9Y5B6-2|PAXB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11821	68.39	2	1552.7483	1552.7483	R	N	743	756
PSM	TLEVEIEPGVR	3142	sp|Q9UBS4|DJB11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7115	40.456	2	1240.6663	1240.6663	R	D	207	218
PSM	TLIQNCGASTIR	3143	sp|P49368-2|TCPG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	6-UNIMOD:4	ms_run[2]:scan=4448	26.469	2	1332.682	1332.6820	R	L	412	424
PSM	TLLENTAITIGR	3144	sp|Q92973-2|TNPO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8683	49.28	2	1300.7351	1300.7351	K	L	766	778
PSM	TLNEADCATVPPAIR	3145	sp|P31040-3|SDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	7-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=6028	34.708	2	1636.8118	1636.8118	K	S	503	518
PSM	TLNEADCATVPPAIR	3146	sp|P31040-3|SDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	7-UNIMOD:4	ms_run[2]:scan=6035	34.747	2	1626.8036	1626.8036	K	S	503	518
PSM	TLQLDNNFEVK	3147	sp|Q9UMS4|PRP19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7865	44.756	2	1319.6721	1319.6721	K	S	429	440
PSM	TNDPGVLQAAR	3148	sp|O76096|CYTF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3154	19.968	2	1140.5887	1140.5887	K	Y	44	55
PSM	TNDQDGLISGILR	3149	sp|Q8TC07-2|TBC15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:267	ms_run[2]:scan=9911	56.235	2	1410.7342	1410.7342	K	V	27	40
PSM	TNGKEPELLEPIPYEFMA	3150	sp|P46778|RL21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	17-UNIMOD:35	ms_run[2]:scan=12108	70.34	2	2093.0027	2093.0027	R	-	143	161
PSM	TPCNAGTFSQPEK	3151	sp|O43684-2|BUB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:4	ms_run[2]:scan=2361	15.975	2	1435.6402	1435.6402	R	V	127	140
PSM	TPCNAGTFSQPEK	3152	sp|O43684-2|BUB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=2367	16.006	2	1441.6603	1441.6603	R	V	127	140
PSM	TPVLFDIYEIK	3153	sp|P50995-2|ANX11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=12658	73.932	2	1336.7279	1336.7279	K	E	239	250
PSM	TPVSEDMLGR	3154	sp|P21281|VATB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5138	30.263	2	1103.5281	1103.5281	R	V	121	131
PSM	TQNDVDIADVAYYFEK	3155	sp|P16422|EPCAM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=12777	74.7	2	1889.8683	1889.8683	K	D	203	219
PSM	TSFTPVGDVFELNFMNVK	3156	sp|P04844-2|RPN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=14352	86.486	2	2043.9976	2043.9976	K	F	291	309
PSM	TSMNVNEIFMAIAK	3157	sp|P20339-2|RAB5A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11823	68.401	2	1567.7738	1567.7738	K	K	152	166
PSM	TTQIPQWCVEYMR	3158	sp|O43143|DHX15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	8-UNIMOD:4	ms_run[2]:scan=9763	55.454	2	1710.7858	1710.7858	K	S	167	180
PSM	TVDNFVALATGEK	3159	sp|P23284|PPIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9605	54.595	2	1363.6983	1363.6983	K	G	72	85
PSM	TVFGVEPDLTR	3160	sp|Q96KP4|CNDP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8250	46.909	2	1232.6401	1232.6401	K	E	403	414
PSM	TVQSLEIDLDSMR	3161	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10664	61.181	2	1505.7396	1505.7396	R	N	302	315
PSM	TWNDPSVQQDIK	3162	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5709	33.074	2	1429.6838	1429.6838	R	F	102	114
PSM	VAGAQIQGAK	3163	sp|Q13423|NNTM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=1057	9.3803	2	941.52943	941.5294	R	E	108	118
PSM	VEQLFQVMNGILAQDSACSQR	3164	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	18-UNIMOD:4,21-UNIMOD:267	ms_run[2]:scan=13917	82.475	3	2403.155	2403.1550	R	A	3764	3785
PSM	VFLLGEEVAQYDGAYK	3165	sp|P11177-3|ODPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11887	68.845	2	1800.8934	1800.8934	K	V	53	69
PSM	VGDYGSLSGR	3166	sp|Q9UBR2|CATZ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2968	19.061	2	1009.4829	1009.4829	R	E	190	200
PSM	VGINYQPPTVVPGGDLAK	3167	sp|P68366-2|TBA4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8960	50.817	3	1823.9781	1823.9781	K	V	338	356
PSM	VGQDASSAGSTR	3168	sp|P52799|EFNB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=507	6.4782	2	1134.5265	1134.5265	K	N	164	176
PSM	VGVDPLIIPTDYWK	3169	sp|Q9NQW7-2|XPP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	14-UNIMOD:188	ms_run[2]:scan=12989	76.119	2	1620.8859	1620.8859	R	K	117	131
PSM	VGVPTVDLDAQGR	3170	sp|O60306|AQR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:267	ms_run[2]:scan=6946	39.59	2	1335.7022	1335.7022	R	A	1126	1139
PSM	VINLNDNTFTEK	3171	sp|P46060|RAGP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6959	39.666	2	1406.7042	1406.7042	R	G	240	252
PSM	VISLEDFMEK	3172	sp|Q9H488-2|OFUT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11597	66.998	2	1209.5951	1209.5951	R	L	102	112
PSM	VLDMPTQELGLPAYR	3173	sp|Q9NP81|SYSM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10975	63.089	2	1701.876	1701.8760	R	K	388	403
PSM	VLGEAMTGISQNAK	3174	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5792	33.492	2	1417.7235	1417.7235	K	N	1402	1416
PSM	VLISDSLDPCCR	3175	sp|O43175|SERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:4,11-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=7622	43.438	2	1443.6726	1443.6726	K	K	9	21
PSM	VLQSEFCNAVR	3176	sp|Q9NUP9|LIN7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	7-UNIMOD:4	ms_run[2]:scan=5953	34.304	2	1321.6449	1321.6449	R	E	41	52
PSM	VLSECSPLMNDIFNK	3177	sp|P53618|COPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	5-UNIMOD:4	ms_run[2]:scan=11499	66.395	2	1765.8379	1765.8379	K	E	619	634
PSM	VLTLSDDLER	3178	sp|P55010|IF5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:267	ms_run[2]:scan=7326	41.716	2	1169.6167	1169.6167	K	T	225	235
PSM	VNSLPEVLPILNSDEPK	3179	sp|P23229-7|ITA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=12007	69.667	2	1862.9989	1862.9989	R	T	478	495
PSM	VSWLGEEPVAGVWSEK	3180	sp|Q9BQ67|GRWD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	16-UNIMOD:188	ms_run[2]:scan=11668	67.446	2	1777.8982	1777.8982	R	G	157	173
PSM	VTLTSEEEAR	3181	sp|P00338-3|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:267	ms_run[2]:scan=2519	16.738	2	1143.5647	1143.5647	K	L	335	345
PSM	VVDLLAPYAK	3182	sp|P06576|ATPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:188	ms_run[2]:scan=9013	51.157	2	1093.6479	1093.6479	K	G	189	199
PSM	VVEGTPLIDGR	3183	sp|Q14739|LBR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5379	31.452	2	1154.6295	1154.6295	K	R	280	291
PSM	VVLAEVIQAFSAPENAVR	3184	sp|Q99622|C10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	18-UNIMOD:267	ms_run[2]:scan=14271	85.703	2	1922.0501	1922.0501	K	M	18	36
PSM	VWDVESGSLK	3185	sp|Q9GZL7|WDR12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:188	ms_run[2]:scan=6596	37.752	2	1124.5809	1124.5809	R	S	282	292
PSM	VYQWDDPDPR	3186	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6015	34.64	2	1289.5677	1289.5677	K	L	958	968
PSM	VYTPSNADIGLR	3187	sp|Q6L8Q7-2|PDE12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:267	ms_run[2]:scan=6197	35.581	2	1314.6807	1314.6807	R	L	234	246
PSM	YAACNAVGQMATDFAPGFQK	3188	sp|O00410-2|IPO5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	4-UNIMOD:4,20-UNIMOD:188	ms_run[2]:scan=10986	63.156	2	2151.9813	2151.9813	R	K	357	377
PSM	YAVLYQPLFDK	3189	sp|P55209-3|NP1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:188	ms_run[2]:scan=10531	60.334	2	1361.7327	1361.7327	K	E	65	76
PSM	YGQGAGEGSTR	3190	sp|Q9C0C2-2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=625	7.173	2	1081.4789	1081.4789	K	E	229	240
PSM	YIQPWESEFIDSQR	3191	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10759	61.773	2	1796.837	1796.8370	R	V	1371	1385
PSM	YLAEFATGNDR	3192	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5845	33.771	2	1255.5833	1255.5833	R	K	131	142
PSM	YLGQDYEQLR	3193	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6433	36.882	2	1283.6146	1283.6146	K	V	37	47
PSM	YLLGDAPVSPSSQK	3194	sp|Q9NYB0|TE2IP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6450	36.977	2	1460.7511	1460.7511	K	L	195	209
PSM	YLLQETWLEK	3195	sp|Q96HE7|ERO1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10413	59.579	2	1321.6918	1321.6918	R	K	266	276
PSM	YNILGTNTIMDK	3196	sp|Q00839-2|HNRPU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8996	51.045	2	1381.6912	1381.6912	K	M	506	518
PSM	YQQGDFGYCPR	3197	sp|P67870|CSK2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	9-UNIMOD:4,11-UNIMOD:267	ms_run[2]:scan=5025	29.682	2	1399.5855	1399.5855	K	V	101	112
PSM	YTQGGLENLELSR	3198	sp|Q15006|EMC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:267	ms_run[2]:scan=7594	43.283	2	1488.7448	1488.7448	K	K	200	213
PSM	YVVVTGITPTPLGEGK	3199	sp|P11586|C1TC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8800	49.884	2	1629.8978	1629.8978	K	S	371	387
PSM	YYLAPKIEDEEGS	3200	sp|P12004|PCNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	6-UNIMOD:188	ms_run[2]:scan=6710	38.318	2	1518.7185	1518.7185	K	-	249	262
PSM	LSDFNDITNMLLLK	3201	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	10-UNIMOD:35,14-UNIMOD:188	ms_run[1]:scan=12465	72.66867333333333	2	1658.893187	1657.869238	K	M	3656	3670
PSM	QSVENDIHGLR	3202	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28,11-UNIMOD:267	ms_run[1]:scan=6171	35.44969833333333	2	1259.6128	1259.6129	R	K	176	187
PSM	QSVENDIHGLR	3203	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28,11-UNIMOD:267	ms_run[1]:scan=6138	35.27258	2	1259.6128	1259.6129	R	K	176	187
PSM	CEFQDAYVLLSEKK	3204	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:385,1-UNIMOD:4,13-UNIMOD:188,14-UNIMOD:188	ms_run[1]:scan=12304	71.635215	2	1723.8493	1723.8525	K	I	237	251
PSM	QKVEGTEPTTAFNLFVGNLNFNK	3205	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28,2-UNIMOD:188,23-UNIMOD:188	ms_run[1]:scan=14127	84.26093833333333	3	2562.3187	2562.3152	K	S	296	319
PSM	TIAMDGTEGLVR	3206	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:35	ms_run[1]:scan=4870	28.78629	2	1277.625673	1277.628552	R	G	110	122
PSM	ALEAANGELEVK	3207	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	12-UNIMOD:188	ms_run[1]:scan=5268	30.90646	2	1248.664505	1248.665711	R	I	100	112
PSM	ALEAANGELEVK	3208	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=5269	30.910988333333336	2	1242.652760	1242.645582	R	I	100	112
PSM	QIWQNLGLDDTK	3209	sp|P49588|SYAC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0		ms_run[1]:scan=9461	53.761995	2	1430.7282	1429.7192	K	I	154	166
PSM	ACARPLISVYSEK	3210	sp|P36578|RL4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1,2-UNIMOD:4	ms_run[1]:scan=7907	44.984943333333334	2	1534.7835	1534.7808	M	G	2	15
PSM	GPCIIYNEDNGIIK	3211	sp|P36578|RL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:4,14-UNIMOD:188	ms_run[1]:scan=8278	47.059128333333334	2	1611.791325	1610.806972	R	A	206	220
PSM	TGCNVLLIQK	3212	sp|P50991|TCPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:4	ms_run[1]:scan=5879	33.942625	2	1145.627349	1144.627429	K	S	293	303
PSM	CQSLTEDLEFRK	3213	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:385,1-UNIMOD:4,11-UNIMOD:267,12-UNIMOD:188	ms_run[1]:scan=9443	53.66082166666667	2	1523.7308	1523.7256	R	S	198	210
PSM	FGEVVDCTIK	3214	sp|O14979|HNRDL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	7-UNIMOD:4,10-UNIMOD:188	ms_run[1]:scan=5915	34.12295	2	1172.582413	1172.584290	R	T	171	181
PSM	QSSFALLGDLTK	3215	sp|Q92973|TNPO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28	ms_run[1]:scan=13334	78.36244	2	1261.6534	1261.6549	R	A	693	705
PSM	VSFTGSVPTGMK	3216	sp|P49189|AL9A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	12-UNIMOD:188	ms_run[1]:scan=6532	37.423251666666665	2	1215.628046	1215.626488	K	I	228	240
PSM	NDKSEEEQSSSSVK	3217	sp|P07910|HNRPC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=606	7.0617616666666665	2	1553.667927	1552.685274	K	K	230	244
PSM	NDKSEEEQSSSSVK	3218	sp|P07910|HNRPC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	3-UNIMOD:188,14-UNIMOD:188	ms_run[1]:scan=609	7.077798333333334	2	1565.7082	1564.7252	K	K	230	244
PSM	QAEMLDDLMEKR	3219	sp|P54819|KAD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28,11-UNIMOD:188,12-UNIMOD:267	ms_run[1]:scan=11673	67.47644	2	1476.6955	1476.6918	R	K	107	119
PSM	QNFIDPLQNLCEKDLK	3220	sp|Q99961|SH3G1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28,11-UNIMOD:4,13-UNIMOD:188,16-UNIMOD:188	ms_run[1]:scan=12314	71.69787666666667	2	1968.9945	1969.0012	K	E	137	153
PSM	QADNPHVALYQAR	3221	sp|Q9Y4L1|HYOU1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28	ms_run[1]:scan=5400	31.547576666666668	2	1464.7055	1464.7105	K	F	107	120
PSM	DLAGAPPGEVVGCFTPQSR	3222	sp|Q9Y446|PKP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	13-UNIMOD:4	ms_run[1]:scan=8914	50.546058333333335	2	1956.937388	1956.936361	R	R	557	576
PSM	GIDYDFPSLILQK	3223	sp|Q9BYG3|MK67I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	13-UNIMOD:188	ms_run[1]:scan=12667	73.98981166666667	2	1513.803647	1513.812375	K	T	180	193
PSM	ATENDIYNFFSPLNPVR	3224	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=13828	81.73927833333333	2	1995.970549	1995.969041	R	V	300	317
PSM	ATENDIYNFFSPLNPVR	3225	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	17-UNIMOD:267	ms_run[1]:scan=13827	81.73322166666667	2	2006.961222	2005.977310	R	V	300	317
PSM	QHTFVETESVR	3226	sp|P48444|COPD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28	ms_run[1]:scan=4930	29.162746666666667	2	1314.6159	1314.6199	K	Y	45	56
PSM	ISAFGYLECSAK	3227	sp|P08134|RHOC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	9-UNIMOD:4,12-UNIMOD:188	ms_run[1]:scan=9112	51.77554166666667	2	1350.657298	1350.658517	R	T	151	163
PSM	MQELALSEGALPR	3228	sp|O75165|DJC13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:35	ms_run[1]:scan=7551	43.024726666666666	2	1430.752449	1429.723515	K	H	600	613
PSM	QYDAGRDGFIDLMELK	3229	sp|Q96C19|EFHD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28,6-UNIMOD:267,16-UNIMOD:188	ms_run[1]:scan=13343	78.421145	2	1868.8933	1868.8944	K	L	103	119
PSM	LSQLQVEAAR	3230	sp|Q9P2N5|RBM27_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	10-UNIMOD:267	ms_run[1]:scan=3987	24.150401666666667	2	1123.625088	1123.622491	K	L	926	936
PSM	GFAFVTFESPADAK	3231	sp|P38159|RBMX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	14-UNIMOD:188	ms_run[1]:scan=10956	62.97283	2	1491.746590	1491.734125	R	D	50	64
PSM	QAALQVAEGFISR	3232	sp|P40121|CAPG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28	ms_run[1]:scan=13469	79.23147166666666	2	1371.7123	1371.7141	R	M	307	320
PSM	QAALQVAEGFISR	3233	sp|P40121|CAPG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	13-UNIMOD:267	ms_run[1]:scan=10243	58.42672333333333	2	1398.748598	1398.749482	R	M	307	320
PSM	QLEEEQAVRPK	3234	sp|P14635|CCNB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28,9-UNIMOD:267,11-UNIMOD:188	ms_run[1]:scan=4471	26.596451666666667	2	1324.7030	1324.6953	R	Y	180	191
PSM	QLDDLKVELSQLR	3235	sp|P42766|RL35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28	ms_run[1]:scan=12548	73.21021166666667	3	1538.8299	1538.8299	K	V	20	33
PSM	IVNGWQVEEADDWLR	3236	sp|P11216|PYGB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=11992	69.56405666666666	2	1829.862614	1828.874413	K	Y	171	186
PSM	LAAIAESGVER	3237	sp|P28072|PSB6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	11-UNIMOD:267	ms_run[1]:scan=4085	24.65002	2	1124.604489	1124.606507	R	Q	210	221
PSM	TDLEELSLGPR	3238	sp|P53365|ARFP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=8345	47.411613333333335	2	1229.635923	1228.629932	R	D	240	251
PSM	NLNEDDTFLVFSK	3239	sp|Q9BYT8|NEUL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=11013	63.32875	2	1540.748202	1540.740939	K	A	205	218
PSM	CPEDVELCHK	3240	sp|Q96I59|SYNM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:385,1-UNIMOD:4,8-UNIMOD:4,10-UNIMOD:188	ms_run[1]:scan=5120	30.168816666666668	2	1274.5335	1274.5362	K	F	291	301
PSM	NCYPSPLNYYNFPK	3241	sp|P53582|MAP11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	2-UNIMOD:4	ms_run[1]:scan=10491	60.08076833333333	2	1776.806331	1775.797742	R	S	178	192
PSM	VAQLCDFNPK	3242	sp|P09497|CLCB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	5-UNIMOD:4,10-UNIMOD:188	ms_run[1]:scan=5753	33.293643333333335	2	1197.608312	1196.595523	K	S	195	205
PSM	TNIIPVLEDAR	3243	sp|A6NHQ2|FBLL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	11-UNIMOD:267	ms_run[1]:scan=8753	49.62981666666667	2	1249.688910	1249.690571	R	H	220	231
PSM	SLELNPNNSTAMLR	3244	sp|Q9Y2Z0|SGT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	14-UNIMOD:267	ms_run[1]:scan=8124	46.182111666666664	2	1569.806783	1568.785610	K	K	71	85
PSM	LQGLEQDVLQAIDR	3245	sp|Q9NZQ3|SPN90_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=12805	74.88139	2	1598.834875	1596.847135	R	A	56	70
PSM	SECLNNIGDSSPLIR	3246	sp|Q92973|TNPO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:4	ms_run[1]:scan=7938	45.13463333333333	2	1673.806090	1673.804284	K	A	101	116
PSM	TLSSVQNEVQEALQR	3247	sp|P12270|TPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=9832	55.81692333333333	2	1702.854885	1700.869327	K	A	1039	1054
PSM	CAEALVPLLSNVNVSDR	3248	sp|O15084|ANR28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:4	ms_run[1]:scan=11669	67.45232333333333	2	1855.954118	1855.946198	K	A	122	139
PSM	PAMETAAEENTEQSQERK	3249	sp|Q13491|GPM6B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	17-UNIMOD:267	ms_run[1]:scan=13657	80.47476833333333	2	2058.889176	2057.919931	K	G	3	21
PSM	AAAFEQLQK	3250	sp|O94826|TOM70_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3824	23.324	2	1004.5291	1004.5291	R	W	160	169
PSM	AAGPLLTDECR	3251	sp|Q9BQ69|MACD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:4,11-UNIMOD:267	ms_run[2]:scan=4224	25.334	2	1211.5844	1211.5844	R	T	190	201
PSM	AALQELLSK	3252	sp|P62851|RS25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:188	ms_run[2]:scan=7845	44.653	2	977.58528	977.5853	R	G	86	95
PSM	AASFLKDDGDPPLLYDE	3253	sp|O14730-2|RIOK3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	6-UNIMOD:188	ms_run[2]:scan=10694	61.372	2	1870.8932	1870.8932	K	-	500	517
PSM	AAVQMDPELAKR	3254	sp|Q9Y312|AAR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:1	ms_run[2]:scan=6412	36.759	2	1369.7024	1369.7024	M	L	2	14
PSM	AEGILDVFQTVK	3255	sp|P18433-6|PTPRA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=12103	70.308	2	1318.7133	1318.7133	K	S	745	757
PSM	AEPMQWASLELPAAK	3256	sp|Q9UHD1|CHRD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	15-UNIMOD:188	ms_run[2]:scan=11279	65.017	2	1646.8434	1646.8434	K	K	307	322
PSM	AGLELLSDQGYRVDGR	3257	sp|Q9NPD3|EXOS4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:1	ms_run[2]:scan=11098	63.852	2	1789.8959	1789.8959	M	R	2	18
PSM	AINIGQLVDVK	3258	sp|Q14690|RRP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:188	ms_run[2]:scan=9934	56.369	2	1174.7017	1174.7017	K	V	632	643
PSM	ALAAGGYDVEK	3259	sp|P16401|H15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3705	22.73	2	1092.5451	1092.5451	K	N	68	79
PSM	ALDGAFTEENR	3260	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:267	ms_run[2]:scan=4972	29.405	2	1231.5708	1231.5708	K	A	1545	1556
PSM	ALELDSNLYR	3261	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7754	44.177	2	1192.6088	1192.6088	K	I	746	756
PSM	ALELDSNLYR	3262	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:267	ms_run[2]:scan=7763	44.222	2	1202.6171	1202.6171	K	I	746	756
PSM	ALQAQEIECR	3263	sp|Q8NBJ5|GT251_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:4	ms_run[2]:scan=3416	21.294	2	1216.587	1216.5870	R	L	361	371
PSM	ALTVPELTQQMFDAK	3264	sp|P68371|TBB4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	15-UNIMOD:188	ms_run[2]:scan=12434	72.472	3	1696.8801	1696.8801	R	N	283	298
PSM	AMADALLER	3265	sp|P34897-3|GLYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267	ms_run[2]:scan=6651	38.024	2	998.50943	998.5094	R	G	339	348
PSM	AMADALLER	3266	sp|P34897-3|GLYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6660	38.068	2	988.50117	988.5012	R	G	339	348
PSM	AMGTLLNTAISEVIGK	3267	sp|O43264-2|ZW10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	16-UNIMOD:188	ms_run[2]:scan=14291	85.895	2	1622.9009	1622.9009	K	I	652	668
PSM	AMNGESLDGR	3268	sp|P98179|RBM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=1922	13.753	2	1048.4608	1048.4608	R	Q	66	76
PSM	ANDQFLESQR	3269	sp|Q15276|RABE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3726	22.841	2	1206.5629	1206.5629	K	L	283	293
PSM	APTLASLENCMK	3270	sp|Q9UGP8|SEC63_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:4	ms_run[2]:scan=8838	50.107	2	1333.637	1333.6370	R	L	357	369
PSM	ASLEAAIADAEQR	3271	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	13-UNIMOD:267	ms_run[2]:scan=8603	48.846	2	1353.6764	1353.6764	R	G	329	342
PSM	ASNTAEVFFDGVR	3272	sp|P49748-2|ACADV_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	13-UNIMOD:267	ms_run[2]:scan=9211	52.335	2	1421.6815	1421.6815	K	V	282	295
PSM	ATQLLEGLVQELQK	3273	sp|P51692|STA5B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=13410	78.851	2	1568.8774	1568.8774	K	K	57	71
PSM	AVANQTSATFLR	3274	sp|P62191-2|PRS4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:267	ms_run[2]:scan=5341	31.264	2	1287.6811	1287.6811	K	V	165	177
PSM	AYGPGIEPTGNMVK	3275	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:35,14-UNIMOD:188	ms_run[2]:scan=4305	25.732	2	1454.7171	1454.7171	R	K	286	300
PSM	CSPIGVYTSGK	3276	sp|P33992|MCM5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:4	ms_run[2]:scan=4398	26.227	2	1167.5594	1167.5594	K	G	397	408
PSM	DAEAWFTSR	3277	sp|P08727|K1C19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8269	47.013	2	1081.4829	1081.4829	K	T	266	275
PSM	DDGLFSGDPNWFPK	3278	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=12426	72.42	2	1593.71	1593.7100	R	K	140	154
PSM	DFSPGLFEDPSVAFATPDPK	3279	sp|Q7Z5J4-4|RAI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=12602	73.562	2	2136.0052	2136.0052	K	K	681	701
PSM	DIDPQNDLTFLR	3280	sp|Q8TF09|DLRB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10742	61.67	2	1445.7151	1445.7151	R	I	59	71
PSM	DILYVFQGIDGK	3281	sp|Q96CW5-3|GCP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=12458	72.624	2	1366.7133	1366.7133	R	N	253	265
PSM	DSSQGPCEPLPGPLTQPR	3282	sp|O15027-2|SC16A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	7-UNIMOD:4	ms_run[2]:scan=7494	42.678	2	1934.9156	1934.9156	R	A	101	119
PSM	DSTLIMQLLR	3283	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	6-UNIMOD:35	ms_run[2]:scan=12268	71.406	2	1204.6486	1204.6486	K	D	213	223
PSM	DVFLGETVPFIK	3284	sp|Q8NEN9|PDZD8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=12652	73.891	2	1363.7388	1363.7388	R	T	147	159
PSM	DYSLLPLLAAAPQVGEK	3285	sp|P38432|COIL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	17-UNIMOD:188	ms_run[2]:scan=13778	81.33	2	1789.9921	1789.9921	K	I	460	477
PSM	EFNEDGALAVLQQFK	3286	sp|O60506-4|HNRPQ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	15-UNIMOD:188	ms_run[2]:scan=13129	77.035	2	1713.8669	1713.8669	K	D	67	82
PSM	EGDLITLLVPEAR	3287	sp|Q9UQB8-3|BAIP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	13-UNIMOD:267	ms_run[2]:scan=13276	77.984	2	1434.7958	1434.7958	K	D	398	411
PSM	EGMNIVEAMER	3288	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9210	52.33	2	1277.5744	1277.5744	K	F	134	145
PSM	EGPTLSVPMVQGECLLK	3289	sp|Q9BQ52-4|RNZ2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	14-UNIMOD:4	ms_run[2]:scan=11301	65.159	2	1856.9376	1856.9376	K	Y	368	385
PSM	EKFTTPIEETGGEGCPAVALIQ	3290	sp|Q9NP84-2|TNR12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	15-UNIMOD:4	ms_run[2]:scan=10568	60.576	2	2346.1413	2346.1413	R	-	73	95
PSM	ENDFDRLVLQYAPSA	3291	sp|O14579|COPE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	6-UNIMOD:267	ms_run[2]:scan=12279	71.474	2	1746.8452	1746.8452	K	-	294	309
PSM	EQFLDGDGWTSR	3292	sp|P27797|CALR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8277	47.055	2	1409.6212	1409.6212	K	W	25	37
PSM	EQLAIAEFAR	3293	sp|P17987|TCPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:267	ms_run[2]:scan=8745	49.59	2	1156.6116	1156.6116	R	S	434	444
PSM	EQSILELGSLLAK	3294	sp|O00231|PSD11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=12985	76.09	2	1399.7922	1399.7922	K	T	47	60
PSM	ESGVFEGIPTYR	3295	sp|Q8WTV0-3|SCRB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:267	ms_run[2]:scan=8630	48.99	2	1363.6647	1363.6647	K	F	189	201
PSM	EVCGFAPYER	3296	sp|Q9Y3U8|RL36_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:4,10-UNIMOD:267	ms_run[2]:scan=5726	33.159	2	1236.5473	1236.5473	R	R	46	56
PSM	EYGGLDVLVNNAGIAFK	3297	sp|P16152-2|CBR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=12798	74.835	2	1778.9203	1778.9203	K	V	80	97
PSM	FDSDAASQR	3298	sp|P04439|HLAA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=919	8.7033	2	995.43084	995.4308	R	M	60	69
PSM	FDSDAASQR	3299	sp|P04439|HLAA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267	ms_run[2]:scan=923	8.7203	2	1005.4391	1005.4391	R	M	60	69
PSM	FFTEEVDSR	3300	sp|Q9H845|ACAD9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5550	32.288	2	1128.5088	1128.5088	K	K	77	86
PSM	FGEVVDCTLK	3301	sp|Q14103-4|HNRPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	7-UNIMOD:4	ms_run[2]:scan=5849	33.788	2	1166.5642	1166.5642	K	L	101	111
PSM	FGQVYTEAK	3302	sp|P46977-2|STT3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:188	ms_run[2]:scan=3166	20.03	2	1047.5332	1047.5332	R	R	555	564
PSM	FIEDELQIPVK	3303	sp|P30520|PURA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:188	ms_run[2]:scan=9668	54.925	2	1335.7381	1335.7381	R	W	431	442
PSM	FLDGNEMTLADCNLLPK	3304	sp|Q9Y696|CLIC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=11637	67.247	2	1955.9428	1955.9428	K	L	178	195
PSM	FLEQLQELDAK	3305	sp|Q8N1B4-2|VPS52_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:188	ms_run[2]:scan=9536	54.199	2	1338.7127	1338.7127	R	A	70	81
PSM	FSMVVQDGIVK	3306	sp|P30044-4|PRDX5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:188	ms_run[2]:scan=8375	47.583	2	1227.6629	1227.6629	R	A	92	103
PSM	GAGTNEDALIEILTTR	3307	sp|P12429|ANXA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	16-UNIMOD:267	ms_run[2]:scan=13226	77.666	2	1682.8714	1682.8714	K	T	105	121
PSM	GDLGIEIPAEK	3308	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7664	43.674	2	1140.6027	1140.6027	R	V	295	306
PSM	GFSEGLWEIENNPTVK	3309	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10792	61.968	3	1818.8788	1818.8788	K	A	81	97
PSM	GGIVDEGALLR	3310	sp|O43175|SERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:267	ms_run[2]:scan=7818	44.509	2	1108.6116	1108.6116	R	A	237	248
PSM	GGIVDEGALLR	3311	sp|O43175|SERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7827	44.558	2	1098.6033	1098.6033	R	A	237	248
PSM	GGPTVDPEELFR	3312	sp|Q96EY1-2|DNJA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:267	ms_run[2]:scan=9887	56.098	2	1325.6491	1325.6491	K	K	176	188
PSM	GGVAEACPNIR	3313	sp|Q15813|TBCE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	7-UNIMOD:4	ms_run[2]:scan=2938	18.916	2	1142.5502	1142.5502	K	K	146	157
PSM	GGVSYRPAEVAETGA	3314	sp|Q16790|CAH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5009	29.596	2	1462.7052	1462.7052	K	-	445	460
PSM	GISQEQMQEFR	3315	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5557	32.324	2	1351.619	1351.6190	K	A	761	772
PSM	GISQEQMQEFR	3316	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5578	32.419	2	1351.619	1351.6190	K	A	761	772
PSM	GLGTDEDTLIEILASR	3317	sp|P04083|ANXA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	16-UNIMOD:267	ms_run[2]:scan=13921	82.504	2	1711.8868	1711.8868	K	T	129	145
PSM	GLGTDEESILTLLTSR	3318	sp|P08758|ANXA5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=14262	85.621	2	1703.8941	1703.8941	K	S	30	46
PSM	GNSLTVLDVLEGR	3319	sp|A3KMH1-3|VWA8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	13-UNIMOD:267	ms_run[2]:scan=12778	74.706	2	1381.7441	1381.7441	K	T	1214	1227
PSM	GQSEDPGSLLSLFR	3320	sp|P08195-2|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=13176	77.346	2	1504.7522	1504.7522	K	R	410	424
PSM	GSLTFEPLTLVPIQTK	3321	sp|Q9NQW7-2|XPP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=13154	77.206	2	1742.9818	1742.9818	R	M	531	547
PSM	GTMVTIEGPR	3322	sp|Q13126-7|MTAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5027	29.691	2	1059.5383	1059.5383	K	F	167	177
PSM	GTPEQPQCGFSNAVVQILR	3323	sp|Q86SX6|GLRX5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	8-UNIMOD:4	ms_run[2]:scan=11915	69.031	2	2100.0422	2100.0422	K	L	60	79
PSM	GVTIKPTVDDD	3324	sp|P41091|IF2G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3759	23.014	2	1158.5768	1158.5768	R	-	462	473
PSM	GYSFTTTAER	3325	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:267	ms_run[2]:scan=4267	25.549	2	1141.5279	1141.5279	R	E	197	207
PSM	IAEGAQQGDPLSR	3326	sp|Q9UJ70|NAGK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	13-UNIMOD:267	ms_run[2]:scan=3366	21.056	2	1350.6767	1350.6767	K	Y	220	233
PSM	IAIWTTECENR	3327	sp|P06730|IF4E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	8-UNIMOD:4	ms_run[2]:scan=6998	39.863	2	1391.6503	1391.6503	K	E	163	174
PSM	IATEAIENFR	3328	sp|P08183-2|MDR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:267	ms_run[2]:scan=6656	38.05	2	1172.6065	1172.6065	K	T	832	842
PSM	IAVAAQNCYK	3329	sp|P60174|TPIS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	8-UNIMOD:4,10-UNIMOD:188	ms_run[2]:scan=2468	16.486	2	1142.585	1142.5850	K	V	97	107
PSM	ICPVETLVEEAIQCAEK	3330	sp|P30084|ECHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=14765	91.319	3	1987.9595	1987.9595	K	I	212	229
PSM	IDPALLTVTSGK	3331	sp|Q68D85|NR3L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:188	ms_run[2]:scan=7912	45.007	2	1219.7119	1219.7119	R	S	385	397
PSM	IESLSSQLSNLQK	3332	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	13-UNIMOD:188	ms_run[2]:scan=8224	46.777	2	1451.7927	1451.7927	R	E	300	313
PSM	IGIIGGTGLDDPEILEGR	3333	sp|Q13126-7|MTAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	18-UNIMOD:267	ms_run[2]:scan=11698	67.634	3	1833.9712	1833.9712	K	T	12	30
PSM	IISNASCTTNCLAPLAK	3334	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	7-UNIMOD:4,11-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=6716	38.352	3	1838.9326	1838.9326	K	V	104	121
PSM	IISVNEDVTLR	3335	sp|Q96BW9-2|TAM41_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:267	ms_run[2]:scan=7229	41.096	2	1267.7011	1267.7011	K	S	140	151
PSM	ILDNTSEPQPGEAR	3336	sp|P50416-2|CPT1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	14-UNIMOD:267	ms_run[2]:scan=3177	20.083	2	1535.7455	1535.7455	R	L	366	380
PSM	ILDVLEEIPK	3337	sp|Q16718-2|NDUA5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11542	66.653	2	1167.6751	1167.6751	K	N	31	41
PSM	ILEQQNSSR	3338	sp|Q16181-2|SEPT7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267	ms_run[2]:scan=920	8.7075	2	1083.5548	1083.5548	R	T	416	425
PSM	ILEQQNSSR	3339	sp|Q16181-2|SEPT7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=926	8.7335	2	1073.5465	1073.5465	R	T	416	425
PSM	IMLNTPEDVQALVSGK	3340	sp|O00231|PSD11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:35	ms_run[2]:scan=10722	61.548	2	1729.892	1729.8920	K	L	259	275
PSM	ISGLGLTPEQK	3341	sp|O95831-3|AIFM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5486	31.983	2	1141.6343	1141.6343	R	Q	95	106
PSM	ISLADIAQK	3342	sp|O43242-2|PSMD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:188	ms_run[2]:scan=7069	40.231	2	963.56963	963.5696	R	L	279	288
PSM	ISLADIAQK	3343	sp|O43242-2|PSMD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7073	40.248	2	957.5495	957.5495	R	L	279	288
PSM	ITSGPFEPDLYK	3344	sp|Q9UQ80-2|PA2G4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:188	ms_run[2]:scan=8273	47.032	2	1371.7018	1371.7018	R	S	279	291
PSM	IVFEDGNINVNK	3345	sp|Q14194|DPYL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7190	40.869	2	1360.6987	1360.6987	K	G	452	464
PSM	IVSLPECFNSPYGAK	3346	sp|Q9NQR4|NIT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	7-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=9195	52.249	2	1686.8383	1686.8383	K	Y	38	53
PSM	IYLSCLEELMK	3347	sp|Q15645|PCH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	5-UNIMOD:4,11-UNIMOD:188	ms_run[2]:scan=12952	75.863	2	1403.7136	1403.7136	K	C	330	341
PSM	LAAEQELIR	3348	sp|Q15149-7|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267	ms_run[2]:scan=5424	31.664	2	1051.5901	1051.5901	R	L	1677	1686
PSM	LAAIGEATR	3349	sp|Q15149-7|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267	ms_run[2]:scan=2607	17.149	2	910.51115	910.5111	K	L	1807	1816
PSM	LAATNALLNSLEFTK	3350	sp|Q14974|IMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	15-UNIMOD:188	ms_run[2]:scan=12269	71.411	3	1610.8975	1610.8975	K	A	192	207
PSM	LADALQELR	3351	sp|P02545-2|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7009	39.917	2	1027.5662	1027.5662	R	A	241	250
PSM	LADIQIEQLNR	3352	sp|O60925|PFD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:267	ms_run[2]:scan=7727	44.039	2	1321.7229	1321.7229	K	T	29	40
PSM	LADIQIEQLNR	3353	sp|O60925|PFD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7736	44.086	2	1311.7147	1311.7147	K	T	29	40
PSM	LAGNEQVTR	3354	sp|P56182|RRP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267	ms_run[2]:scan=1002	9.1107	2	996.52278	996.5228	R	D	17	26
PSM	LAPEVMEDLVK	3355	sp|P62760|VISL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:188	ms_run[2]:scan=9662	54.892	2	1248.6731	1248.6731	K	S	8	19
PSM	LDQLIYIPLPDEK	3356	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=12055	69.986	2	1555.8498	1555.8498	R	S	639	652
PSM	LEAEIATYR	3357	sp|P05783|K1C18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267	ms_run[2]:scan=5134	30.247	2	1074.5585	1074.5585	K	R	373	382
PSM	LEAQEQAFLAR	3358	sp|Q5T3I0|GPTC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6340	36.357	2	1274.6619	1274.6619	R	L	174	185
PSM	LEGLTDEINFLR	3359	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=13169	77.3	2	1418.7405	1418.7405	R	Q	214	226
PSM	LEQEIATYR	3360	sp|P08727|K1C19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267	ms_run[2]:scan=4089	24.675	2	1131.58	1131.5800	R	S	373	382
PSM	LGNQNVETK	3361	sp|Q8WWC4|MAIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=842	8.3256	2	1001.5142	1001.5142	K	Q	250	259
PSM	LGQEATVGK	3362	sp|P53396|ACLY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:188	ms_run[2]:scan=1038	9.2915	2	907.50702	907.5070	R	A	89	98
PSM	LGQEATVGK	3363	sp|P53396|ACLY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=1045	9.3256	2	901.4869	901.4869	R	A	89	98
PSM	LGQSQSQADER	3364	sp|Q5T0Z8|CF132_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:267	ms_run[2]:scan=664	7.3881	2	1227.5719	1227.5719	R	A	376	387
PSM	LGVTANDVK	3365	sp|P40925-2|MDHC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:188	ms_run[2]:scan=2552	16.896	2	921.52268	921.5227	K	N	82	91
PSM	LGVTANDVK	3366	sp|P40925-2|MDHC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2553	16.899	2	915.50255	915.5025	K	N	82	91
PSM	LIVENLSSR	3367	sp|Q13247-3|SRSF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5511	32.108	2	1029.5819	1029.5819	R	C	112	121
PSM	LLNDEDQVVVNK	3368	sp|P35222|CTNB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:188	ms_run[2]:scan=5093	30.029	2	1390.7399	1390.7399	K	A	159	171
PSM	LLSESAQPLK	3369	sp|Q9H3N1|TMX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4214	25.289	2	1084.6128	1084.6128	K	K	224	234
PSM	LLSSGFDIDTPDDFGR	3370	sp|O15084-2|ANR28_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	16-UNIMOD:267	ms_run[2]:scan=10837	62.249	2	1763.8242	1763.8242	K	T	237	253
PSM	LLSVVPVPEGYSVK	3371	sp|Q9GZN8|CT027_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	14-UNIMOD:188	ms_run[2]:scan=9768	55.485	2	1491.8644	1491.8644	K	C	92	106
PSM	LNILDTLSK	3372	sp|Q13200-2|PSMD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:188	ms_run[2]:scan=9843	55.872	2	1021.6115	1021.6115	R	F	545	554
PSM	LNLNNTVLSK	3373	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:188	ms_run[2]:scan=6228	35.733	2	1120.6548	1120.6548	R	R	426	436
PSM	LNQPQPDFTK	3374	sp|O94832|MYO1D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:188	ms_run[2]:scan=3789	23.16	2	1192.6184	1192.6184	R	N	985	995
PSM	LQEENLVITPR	3375	sp|P09327|VILI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:267	ms_run[2]:scan=6668	38.108	2	1320.7277	1320.7277	R	L	610	621
PSM	LQIEDFEAR	3376	sp|Q9P0J0|NDUAD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7799	44.41	2	1119.556	1119.5560	R	I	60	69
PSM	LQSPEFQSLFTEGLK	3377	sp|Q96Q11-3|TRNT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=12402	72.266	2	1722.8829	1722.8829	K	S	32	47
PSM	LSAAVTEAFVR	3378	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:267	ms_run[2]:scan=7917	45.034	2	1172.6429	1172.6429	K	L	451	462
PSM	LSDDTLLDIMR	3379	sp|Q2TB90-3|HKDC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11804	68.279	2	1290.649	1290.6490	R	R	31	42
PSM	LSDGVAVLK	3380	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:188	ms_run[2]:scan=4927	29.15	2	906.54816	906.5482	K	V	397	406
PSM	LSDGVAVLK	3381	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4762	28.125	2	900.52803	900.5280	K	V	397	406
PSM	LSDGVAVLK	3382	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4928	29.154	2	900.52803	900.5280	K	V	397	406
PSM	LSELEAALQR	3383	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=15387	97.86	2	1128.6139	1128.6139	K	A	353	363
PSM	LTDAQILTR	3384	sp|P35250-2|RFC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5263	30.882	2	1029.5819	1029.5819	K	L	159	168
PSM	MEPAVSEPMRDQVAR	3385	sp|Q15738|NSDHL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:1	ms_run[2]:scan=6804	38.83	2	1756.8236	1756.8236	-	T	1	16
PSM	MIEEAGAIISTR	3386	sp|O00154-2|BACH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:35,12-UNIMOD:267	ms_run[2]:scan=5819	33.639	2	1315.6681	1315.6681	K	H	37	49
PSM	MLIQENQELGR	3387	sp|Q15007|FL2D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:267	ms_run[2]:scan=5827	33.681	2	1339.6794	1339.6794	R	Q	163	174
PSM	MSNYDTDLFVPYFEAIQK	3388	sp|P49588|SYAC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:35	ms_run[2]:scan=13699	80.747	2	2196.0085	2196.0085	K	G	255	273
PSM	NALESYAFNMK	3389	sp|P0DMV8-2|HS71A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8732	49.521	2	1286.5965	1286.5965	K	S	485	496
PSM	NANFEALPEDWR	3390	sp|Q8N3X1|FNBP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:267	ms_run[2]:scan=9609	54.616	2	1470.6767	1470.6767	R	A	994	1006
PSM	NCIVLIDSTPYR	3391	sp|P62241|RS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:4	ms_run[2]:scan=8560	48.611	2	1449.7286	1449.7286	K	Q	99	111
PSM	NDLAVVDVR	3392	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5681	32.935	2	999.53491	999.5349	K	I	334	343
PSM	NELSGALTGLTR	3393	sp|P26639|SYTC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:267	ms_run[2]:scan=8638	49.032	2	1240.6651	1240.6651	R	V	443	455
PSM	NIEDVIAQGIGK	3394	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9921	56.294	2	1255.6772	1255.6772	K	L	50	62
PSM	NILLTNEQLESAR	3395	sp|Q9H9B4|SFXN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7701	43.891	2	1499.7944	1499.7944	R	K	36	49
PSM	NIVEAAAVR	3396	sp|Q5JNZ5|RS26L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267	ms_run[2]:scan=3753	22.983	2	951.5377	951.5377	R	D	43	52
PSM	NLQSVVLSK	3397	sp|P43246-2|MSH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:188	ms_run[2]:scan=5566	32.367	2	992.59617	992.5962	K	M	8	17
PSM	NLSSDEATNPISR	3398	sp|Q7Z417|NUFP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4182	25.135	2	1402.6688	1402.6688	K	V	110	123
PSM	NQVEDLLATLEK	3399	sp|Q92542-2|NICA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=13053	76.539	2	1371.7246	1371.7246	R	S	372	384
PSM	NSTPSEPGSGR	3400	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:267	ms_run[2]:scan=658	7.3584	2	1097.4977	1097.4977	K	G	198	209
PSM	NTVVLFVPQQEAWVVER	3401	sp|Q9UJZ1-2|STML2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=12336	71.842	2	2013.0684	2013.0684	R	M	35	52
PSM	NVLIEVNPQTR	3402	sp|Q92979|NEP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6158	35.379	2	1281.7041	1281.7041	K	I	115	126
PSM	NVPPGLDEYNPFSDSR	3403	sp|O15126-2|SCAM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10442	59.768	2	1805.822	1805.8220	R	T	29	45
PSM	NVQLTENEIR	3404	sp|P62136-2|PP1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:267	ms_run[2]:scan=4765	28.144	2	1224.6338	1224.6338	K	G	38	48
PSM	PALELLEPIEQK	3405	sp|P50395|GDIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10314	58.943	2	1378.7708	1378.7708	R	F	368	380
PSM	PSANCDPFSVTEALIR	3406	sp|P15104|GLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	5-UNIMOD:4	ms_run[2]:scan=12176	70.797	2	1775.8512	1775.8512	R	T	342	358
PSM	QEIFQEQLAAVPEFR	3407	sp|Q9Y678|COPG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11477	66.255	2	1803.9155	1803.9155	R	G	610	625
PSM	QLLPCEMACNEK	3408	sp|Q9NR45|SIAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	5-UNIMOD:4,9-UNIMOD:4,12-UNIMOD:188	ms_run[2]:scan=6009	34.607	2	1497.6721	1497.6721	K	L	279	291
PSM	QVENAGAIGPSR	3409	sp|Q9UHD8-7|SEPT9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:267	ms_run[2]:scan=1863	13.471	2	1207.6185	1207.6185	K	F	99	111
PSM	SAVENCQDSWR	3410	sp|P52209-2|6PGD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	6-UNIMOD:4	ms_run[2]:scan=3004	19.243	2	1350.5623	1350.5623	K	R	384	395
PSM	SAVENCQDSWR	3411	sp|P52209-2|6PGD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	6-UNIMOD:4,11-UNIMOD:267	ms_run[2]:scan=3006	19.252	2	1360.5705	1360.5705	K	R	384	395
PSM	SDVSPIIQPVPSIK	3412	sp|P40818-2|UBP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	14-UNIMOD:188	ms_run[2]:scan=8454	48.024	2	1484.8546	1484.8546	K	N	312	326
PSM	SEIDLLDIR	3413	sp|P12429|ANXA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10166	57.887	2	1072.5764	1072.5764	R	T	280	289
PSM	SELDMLDIR	3414	sp|P08133-2|ANXA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267	ms_run[2]:scan=9665	54.907	2	1100.5411	1100.5411	R	E	250	259
PSM	SFDDPIVQTER	3415	sp|O95757|HS74L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6408	36.739	2	1305.6201	1305.6201	R	I	74	85
PSM	SGEGEVSGLMR	3416	sp|Q13263-2|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:267	ms_run[2]:scan=5034	29.728	2	1130.5265	1130.5265	R	K	391	402
PSM	SGGSAGEITFLEALAR	3417	sp|Q9GZR1-2|SENP6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=12953	75.868	2	1577.8049	1577.8049	K	S	6	22
PSM	SGLDSVSSWLPLAK	3418	sp|Q6PD74|AAGAB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=12793	74.806	2	1458.7718	1458.7718	K	A	90	104
PSM	SICEVLDLER	3419	sp|P35659|DEK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:4,10-UNIMOD:267	ms_run[2]:scan=9324	52.98	2	1242.6154	1242.6154	K	S	159	169
PSM	SICEVLDLER	3420	sp|P35659|DEK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:4,10-UNIMOD:267	ms_run[2]:scan=9326	52.994	2	1242.6154	1242.6154	K	S	159	169
PSM	SIQLDGLVWGASK	3421	sp|P29692|EF1D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	13-UNIMOD:188	ms_run[2]:scan=11113	63.948	2	1378.7552	1378.7552	R	L	220	233
PSM	SLAAEEEAAR	3422	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:267	ms_run[2]:scan=2134	14.83	2	1055.5123	1055.5123	K	Q	1961	1971
PSM	SLAAEEEAAR	3423	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2136	14.837	2	1045.504	1045.5040	K	Q	1961	1971
PSM	SLCSDDTPMVR	3424	sp|P30154-4|2AAB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:4	ms_run[2]:scan=4346	25.977	2	1279.5537	1279.5537	R	R	184	195
PSM	SLEDQVEMLR	3425	sp|P14314-2|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8520	48.387	2	1218.5914	1218.5914	K	T	168	178
PSM	SLEDQVEMLR	3426	sp|P14314-2|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:267	ms_run[2]:scan=8521	48.391	2	1228.5997	1228.5997	K	T	168	178
PSM	SLPEYLENMVIK	3427	sp|Q96FV9|THOC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=12459	72.63	2	1434.7429	1434.7429	K	L	517	529
PSM	SLSLCNMFLDEMAK	3428	sp|Q9Y2A7|NCKP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	5-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=13563	79.846	2	1663.7715	1663.7715	R	Q	595	609
PSM	SMENYYQESGR	3429	sp|P46063|RECQ1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3673	22.551	2	1362.551	1362.5510	K	A	394	405
PSM	SMVEEGTGLR	3430	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3575	22.031	2	1077.5125	1077.5125	R	L	4421	4431
PSM	SNILTLMYQCMQDK	3431	sp|Q92973-2|TNPO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:4	ms_run[2]:scan=13861	81.982	2	1743.7994	1743.7994	R	M	666	680
PSM	SNLGSVVLQLK	3432	sp|O43143|DHX15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9339	53.064	2	1156.6816	1156.6816	R	K	505	516
PSM	SPNTEEIFNMLTK	3433	sp|Q7KZ85|SPT6H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	13-UNIMOD:188	ms_run[2]:scan=12266	71.394	2	1528.7539	1528.7539	R	E	1143	1156
PSM	SPQEEALQR	3434	sp|Q92974-3|ARHG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267	ms_run[2]:scan=1525	11.813	2	1066.5283	1066.5283	R	L	705	714
PSM	SQAFIEMETR	3435	sp|P43243|MATR3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:267	ms_run[2]:scan=6167	35.432	2	1220.5735	1220.5735	K	E	533	543
PSM	SSAVVVDAIPVFLEK	3436	sp|Q14669-4|TRIPC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=12622	73.696	2	1572.8763	1572.8763	R	L	218	233
PSM	SSLLDDLLTESEDMAQR	3437	sp|O00429-3|DNM1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	14-UNIMOD:35	ms_run[2]:scan=13307	78.186	2	1937.8888	1937.8888	K	R	667	684
PSM	STIIGESISR	3438	sp|P54136-2|SYRC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5151	30.331	2	1061.5717	1061.5717	R	L	142	152
PSM	SVPLAATSMLITQGLISK	3439	sp|Q9NX40-3|OCAD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	18-UNIMOD:188	ms_run[2]:scan=13421	78.925	2	1835.0533	1835.0534	R	G	47	65
PSM	SVVGTPAYLAPEVLLNQGYNR	3440	sp|Q9BZL6-2|KPCD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	21-UNIMOD:267	ms_run[2]:scan=12495	72.864	2	2270.1935	2270.1935	R	S	553	574
PSM	SYELPDGQVITIGNER	3441	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=13559	79.817	2	1789.8846	1789.8846	K	F	239	255
PSM	SYELPDGQVITIGNER	3442	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=13840	81.833	2	1789.8846	1789.8846	K	F	239	255
PSM	TAICNLILGNPPSK	3443	sp|Q9NRX1|PNO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	4-UNIMOD:4	ms_run[2]:scan=9449	53.688	2	1496.8021	1496.8021	R	V	223	237
PSM	TAVCDIPPR	3444	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	4-UNIMOD:4,9-UNIMOD:267	ms_run[2]:scan=2671	17.449	2	1037.5203	1037.5203	K	G	351	360
PSM	TAVCDIPPR	3445	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	4-UNIMOD:4,9-UNIMOD:267	ms_run[2]:scan=3272	20.558	2	1037.5203	1037.5203	K	G	351	360
PSM	TAVCDIPPR	3446	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	4-UNIMOD:4,9-UNIMOD:267	ms_run[2]:scan=3609	22.211	2	1037.5203	1037.5203	K	G	351	360
PSM	TAVCDIPPR	3447	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	4-UNIMOD:4,9-UNIMOD:267	ms_run[2]:scan=3829	23.344	2	1037.5203	1037.5203	K	G	351	360
PSM	TAVCDIPPR	3448	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	4-UNIMOD:4,9-UNIMOD:267	ms_run[2]:scan=4006	24.24	2	1037.5203	1037.5203	K	G	351	360
PSM	TAVCDIPPR	3449	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	4-UNIMOD:4,9-UNIMOD:267	ms_run[2]:scan=4029	24.36	2	1037.5203	1037.5203	K	G	351	360
PSM	TDLEELSLGPR	3450	sp|P53365-2|ARFP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:267	ms_run[2]:scan=8340	47.387	2	1238.6382	1238.6382	R	D	155	166
PSM	TEMQNMIELSR	3451	sp|Q9NTZ6|RBM12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:267	ms_run[2]:scan=8090	45.984	2	1360.6354	1360.6354	K	R	77	88
PSM	TFTDCFNCLPIAAIVDEK	3452	sp|P36873|PP1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	5-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=13810	81.57	2	2112.986	2112.9860	K	I	151	169
PSM	TGNFISTSTSLPR	3453	sp|Q9Y5J1|UTP18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	13-UNIMOD:267	ms_run[2]:scan=6979	39.774	2	1389.7128	1389.7128	R	G	221	234
PSM	TGNFISTSTSLPR	3454	sp|Q9Y5J1|UTP18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6983	39.791	2	1379.7045	1379.7045	R	G	221	234
PSM	TGSQGQCTQVR	3455	sp|P62857|RS28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	7-UNIMOD:4,11-UNIMOD:267	ms_run[2]:scan=627	7.1834	2	1230.5651	1230.5651	R	V	21	32
PSM	TGYGVEELISALQR	3456	sp|Q8NC60|NOA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=13591	80.035	2	1534.7991	1534.7991	K	S	320	334
PSM	THSLVCPETVSR	3457	sp|Q86WQ0|NR2CA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:1,6-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=5211	30.624	2	1436.6957	1436.6957	M	V	2	14
PSM	TIAEQLAEK	3458	sp|Q7L014|DDX46_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:188	ms_run[2]:scan=3921	23.827	2	1007.5595	1007.5595	K	I	895	904
PSM	TIGGGDDSFNTFFSETGAGK	3459	sp|Q9BQE3|TBA1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	20-UNIMOD:188	ms_run[2]:scan=10885	62.537	3	2012.9059	2012.9059	K	H	41	61
PSM	TIISYIDEQFER	3460	sp|Q15019|SEPT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=12667	73.99	2	1512.746	1512.7460	K	Y	117	129
PSM	TIPIDGDFFSYTR	3461	sp|P05091-2|ALDH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11436	66.003	2	1530.7355	1530.7355	K	H	113	126
PSM	TLDQISDADNIPGLLVLK	3462	sp|Q6PGP7|TTC37_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	18-UNIMOD:188	ms_run[2]:scan=12841	75.102	2	1930.0718	1930.0718	R	S	375	393
PSM	TLLENTAITIGR	3463	sp|Q92973-2|TNPO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:267	ms_run[2]:scan=8682	49.276	2	1310.7433	1310.7433	K	L	766	778
PSM	TLQLDNNFEVK	3464	sp|Q9UMS4|PRP19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:188	ms_run[2]:scan=7871	44.788	2	1325.6923	1325.6923	K	S	429	440
PSM	TLQQNAESR	3465	sp|O95816|BAG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267	ms_run[2]:scan=815	8.1914	2	1055.5235	1055.5235	K	F	201	210
PSM	TMGFCYQILTEPNADPR	3466	sp|O95373|IPO7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	5-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=10757	61.762	2	2021.9215	2021.9215	K	K	411	428
PSM	TNEGVIEFR	3467	sp|Q13247-3|SRSF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267	ms_run[2]:scan=5780	33.434	2	1073.5381	1073.5381	R	S	146	155
PSM	TNEGVIEFR	3468	sp|Q13247-3|SRSF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5783	33.446	2	1063.5298	1063.5298	R	S	146	155
PSM	TQILSPNTQDVLIFK	3469	sp|Q01415-2|GALK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11185	64.409	2	1715.9458	1715.9458	R	L	302	317
PSM	TSAALSTVGSAISR	3470	sp|O43399-2|TPD54_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	14-UNIMOD:267	ms_run[2]:scan=6388	36.632	2	1329.7128	1329.7128	K	K	120	134
PSM	TSTSAVPNLFVPLNTNPK	3471	sp|P35611-2|ADDA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10839	62.26	2	1899.0102	1899.0102	R	E	480	498
PSM	TTDFSDFLSIVGCTK	3472	sp|Q9UHD1|CHRD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	13-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=13416	78.891	2	1695.8121	1695.8121	R	G	47	62
PSM	TTEPGVTGLLLAVEGPAAK	3473	sp|Q14690|RRP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=12773	74.671	3	1823.004	1823.0040	K	R	982	1001
PSM	TTQVPQFILDDFIQNDR	3474	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=13639	80.355	2	2049.0167	2049.0167	K	A	418	435
PSM	TWTLCGTPEYLAPEIILSK	3475	sp|P17612|KAPCA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	5-UNIMOD:4,19-UNIMOD:188	ms_run[2]:scan=13763	81.217	2	2197.1436	2197.1436	R	G	196	215
PSM	TYEQMEFPLLK	3476	sp|Q9H2P0|ADNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11278	65.011	2	1397.6901	1397.6901	R	K	718	729
PSM	TYNQLQVIFQGIEGK	3477	sp|Q8WUQ7|CATIN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	15-UNIMOD:188	ms_run[2]:scan=13437	79.023	2	1742.9299	1742.9299	K	I	410	425
PSM	VAAALPGMESTQDR	3478	sp|P20340-3|RAB6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	8-UNIMOD:35	ms_run[2]:scan=3301	20.712	2	1460.6929	1460.6929	R	S	66	80
PSM	VAEQTPLTALYVANLIK	3479	sp|P05091-2|ALDH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=13717	80.871	2	1843.0455	1843.0455	K	E	163	180
PSM	VDLLGEFQSALPK	3480	sp|Q9H9L3|I20L2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=13327	78.315	2	1415.766	1415.7660	K	I	116	129
PSM	VGEFSGANK	3481	sp|P10599-2|THIO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:188	ms_run[2]:scan=1301	10.653	2	913.46007	913.4601	K	E	66	75
PSM	VGGSGVNVNAK	3482	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=1125	9.7165	2	1000.5302	1000.5302	K	G	253	264
PSM	VGQASEIAR	3483	sp|Q99459|CDC5L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=1189	10.023	2	929.49304	929.4930	K	Q	313	322
PSM	VIDDTNITR	3484	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267	ms_run[2]:scan=2790	18.177	2	1055.5487	1055.5487	K	L	188	197
PSM	VLCPIIQTADYPINLAAIK	3485	sp|Q7Z460-4|CLAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:4	ms_run[2]:scan=13105	76.877	3	2112.1653	2112.1653	K	M	1365	1384
PSM	VLEGMEVVR	3486	sp|P23284|PPIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6088	35.036	2	1030.5481	1030.5481	K	K	172	181
PSM	VLIANNGIAAVK	3487	sp|O00763-3|ACACB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:188	ms_run[2]:scan=6141	35.291	2	1187.7333	1187.7333	K	C	61	73
PSM	VLLQEEGTR	3488	sp|P15924-2|DESP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3055	19.495	2	1043.5611	1043.5611	R	K	1176	1185
PSM	VLLQEEGTR	3489	sp|P15924-2|DESP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267	ms_run[2]:scan=3056	19.499	2	1053.5694	1053.5694	R	K	1176	1185
PSM	VLNVTNLEFSDTR	3490	sp|O75151|PHF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	13-UNIMOD:267	ms_run[2]:scan=9369	53.233	2	1516.7761	1516.7761	R	M	189	202
PSM	VLTEIIASR	3491	sp|P08758|ANXA5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267	ms_run[2]:scan=6203	35.614	2	1010.6	1010.6000	K	T	109	118
PSM	VLTSGIFETK	3492	sp|Q5JWF2-2|GNAS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:188	ms_run[2]:scan=7148	40.623	2	1099.6221	1099.6221	R	F	831	841
PSM	VMLESFIDTQK	3493	sp|P49736|MCM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9603	54.58	2	1309.6588	1309.6588	R	F	797	808
PSM	VQLVVGDGR	3494	sp|P22061|PIMT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267	ms_run[2]:scan=4095	24.711	2	951.5377	951.5377	R	M	136	145
PSM	VSFTGSVPTGMK	3495	sp|P49189-2|AL9A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:188	ms_run[2]:scan=6546	37.499	2	1215.6265	1215.6265	K	I	158	170
PSM	VTDALNATR	3496	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267	ms_run[2]:scan=1805	13.196	2	969.51188	969.5119	R	A	421	430
PSM	VTDALNATR	3497	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=1814	13.237	2	959.50361	959.5036	R	A	421	430
PSM	VVLLGEGCVGK	3498	sp|Q9UL25|RAB21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	8-UNIMOD:4	ms_run[2]:scan=6169	35.44	2	1129.6165	1129.6165	K	T	22	33
PSM	VYVGNLGTGAGK	3499	sp|Q16629-3|SRSF7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4025	24.336	2	1134.6033	1134.6033	K	G	13	25
PSM	YAICSALAASALPALVMSK	3500	sp|P36578|RL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	4-UNIMOD:4,19-UNIMOD:188	ms_run[2]:scan=13529	79.628	2	1942.0363	1942.0363	R	G	122	141
PSM	YAQAGFEGFK	3501	sp|O75643|U520_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6133	35.252	2	1116.524	1116.5240	K	T	470	480
PSM	YGEPGEVFINK	3502	sp|P23246-2|SFPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:188	ms_run[2]:scan=6500	37.25	2	1257.6337	1257.6337	K	G	320	331
PSM	YGEPGEVFINK	3503	sp|P23246-2|SFPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6501	37.254	2	1251.6136	1251.6136	K	G	320	331
PSM	YITQNGDYQLR	3504	sp|Q9BXS5|AP1M1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5116	30.15	2	1369.6626	1369.6626	R	T	411	422
PSM	YIVPMLTVDGK	3505	sp|P14550|AK1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9927	56.326	2	1234.6631	1234.6631	R	R	298	309
PSM	YLLADCNEAFIK	3506	sp|O60216|RAD21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	6-UNIMOD:4,12-UNIMOD:188	ms_run[2]:scan=9304	52.871	2	1461.7269	1461.7269	K	I	73	85
PSM	YLLCELVSDDPR	3507	sp|Q969H6-2|POP5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	4-UNIMOD:4	ms_run[2]:scan=10247	58.456	2	1478.7075	1478.7075	R	C	8	20
PSM	YNEAQVDFR	3508	sp|Q13277-2|STX3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267	ms_run[2]:scan=4699	27.76	2	1150.5283	1150.5283	K	E	134	143
PSM	YPVNSVNILK	3509	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7103	40.403	2	1145.6445	1145.6445	R	A	190	200
PSM	TFEMSDFIVDTR	3510	sp|O75369|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=11518	66.51273	2	1459.668332	1459.665331	R	D	2017	2029
PSM	QKGADFLVTEVENGGSLGSK	3511	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28,2-UNIMOD:188,20-UNIMOD:188	ms_run[1]:scan=10973	63.077176666666674	3	2030.0354	2030.0354	K	K	187	207
PSM	LADALQELR	3512	sp|P02545|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	9-UNIMOD:267	ms_run[1]:scan=7004	39.896609999999995	2	1037.575478	1037.574478	R	A	241	250
PSM	QNGDDPLLTYRFPPK	3513	sp|P02545|LMNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28,11-UNIMOD:267,15-UNIMOD:188	ms_run[1]:scan=11550	66.70166333333333	2	1758.8782	1758.8902	R	F	472	487
PSM	QVYVDKLAELK	3514	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28,6-UNIMOD:188,11-UNIMOD:188	ms_run[1]:scan=9444	53.665130000000005	2	1299.7464	1299.7472	K	N	669	680
PSM	CIKDEETGLCLLPLK	3515	sp|P15924|DESP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:385,1-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=12290	71.54254666666667	2	1772.8962	1770.8892	R	E	2433	2448
PSM	SYELPDGQVITIGNER	3516	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=11098	63.852265	2	1789.897002	1789.884643	K	F	241	257
PSM	QEYDESGPSIVHR	3517	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28,13-UNIMOD:267	ms_run[1]:scan=5308	31.101803333333333	2	1508.6780	1508.6766	K	K	360	373
PSM	CLEKEVAALCR	3518	sp|P12956|XRCC6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:385,1-UNIMOD:4,4-UNIMOD:188,10-UNIMOD:4,11-UNIMOD:267	ms_run[1]:scan=9949	56.45881333333333	2	1346.6622	1346.6652	K	Y	389	400
PSM	TNQELQEINR	3519	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	10-UNIMOD:267	ms_run[1]:scan=3047	19.457395	2	1253.620058	1253.623948	R	V	136	146
PSM	INISEGNCPER	3520	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	8-UNIMOD:4,11-UNIMOD:267	ms_run[1]:scan=2990	19.173605	2	1298.620803	1297.596019	R	I	47	58
PSM	TAVCDIPPR	3521	sp|P68371|TBB4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	4-UNIMOD:4	ms_run[1]:scan=3136	19.87708	2	1027.5146	1027.5115	K	G	351	360
PSM	TAVCDIPPR	3522	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:4	ms_run[1]:scan=2694	17.569966666666666	2	1027.515146	1027.512065	K	G	351	360
PSM	TAVCDIPPR	3523	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:4	ms_run[1]:scan=2929	18.871411666666667	2	1027.515146	1027.512065	K	G	351	360
PSM	TAVCDIPPR	3524	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:4,9-UNIMOD:267	ms_run[1]:scan=3986	24.14653	2	1037.519732	1037.520334	K	G	351	360
PSM	TAVCDIPPR	3525	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:4	ms_run[1]:scan=3833	23.365601666666667	2	1027.513936	1027.512065	K	G	351	360
PSM	TLTIVDTGIGMTK	3526	sp|Q58FG1|HS904_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	11-UNIMOD:35,13-UNIMOD:188	ms_run[1]:scan=7418	42.24077	2	1370.743487	1370.742247	R	A	28	41
PSM	FDVSGYPTIK	3527	sp|P13667|PDIA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	10-UNIMOD:188	ms_run[1]:scan=7575	43.173991666666666	2	1131.588200	1131.590755	R	I	132	142
PSM	VPTANVSVVDLTCR	3528	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	13-UNIMOD:4	ms_run[1]:scan=8061	45.817209999999996	2	1530.769218	1529.787178	R	L	235	249
PSM	LISWYDNEFGYSNR	3529	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=10837	62.24937166666667	2	1763.770384	1762.795100	K	V	310	324
PSM	TGCNVLLIQK	3530	sp|P50991|TCPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:4,10-UNIMOD:188	ms_run[1]:scan=5866	33.872225	2	1150.645792	1150.647558	K	S	293	303
PSM	QAVEQQIQSHR	3531	sp|P33176|KINH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28,11-UNIMOD:267	ms_run[1]:scan=3693	22.660283333333336	2	1315.6469	1315.6503	K	E	699	710
PSM	DDGLFSGDPNWFPK	3532	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	14-UNIMOD:188	ms_run[1]:scan=12588	73.471915	2	1600.756165	1599.730102	R	K	140	154
PSM	STSGEGFQFGK	3533	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=4641	27.475485	2	1144.522191	1143.519653	K	K	1953	1964
PSM	GFGFVCFSSPEEATK	3534	sp|P11940|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	6-UNIMOD:4	ms_run[1]:scan=10511	60.2091	2	1661.742240	1661.739559	K	A	334	349
PSM	AITQETINGR	3535	sp|Q9C075|K1C23_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	10-UNIMOD:267	ms_run[1]:scan=2318	15.770091666666666	2	1111.585959	1111.586105	K	L	400	410
PSM	LGDLYEEEMR	3536	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	9-UNIMOD:35	ms_run[1]:scan=4922	29.118245	2	1270.555305	1269.554718	R	E	146	156
PSM	TPAQFDADELR	3537	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	11-UNIMOD:267	ms_run[1]:scan=5987	34.489473333333336	2	1271.599693	1271.602150	K	A	114	125
PSM	NGDLDEVKDYVAK	3538	sp|P58546|MTPN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=7185	40.83645166666667	2	1465.693031	1464.709639	K	G	12	25
PSM	QAEMLDDLMEKR	3539	sp|P54819|KAD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28	ms_run[1]:scan=11685	67.55426333333332	2	1460.6713	1460.6634	R	K	107	119
PSM	LDDIFEPVLIPEPK	3540	sp|Q14008|CKAP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=12803	74.86955166666667	2	1623.873823	1623.875976	K	I	1510	1524
PSM	ILDSAEFIK	3541	sp|P78347|GTF2I_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	9-UNIMOD:188	ms_run[1]:scan=7809	44.46177333333333	2	1041.582642	1040.584941	R	F	929	938
PSM	VIGAGEFGEVYK	3542	sp|P29317|EPHA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	12-UNIMOD:188	ms_run[1]:scan=7794	44.38127	2	1274.649576	1273.664982	K	G	618	630
PSM	CYSCGEFGHIQK	3543	sp|P62633|CNBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:385,1-UNIMOD:4,4-UNIMOD:4,12-UNIMOD:188	ms_run[1]:scan=6816	38.901606666666666	2	1473.6125	1473.6107	K	D	119	131
PSM	EIAQDFKTDLR	3544	sp|Q16695|H31T_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:27,7-UNIMOD:188,11-UNIMOD:267	ms_run[1]:scan=8222	46.768765	2	1332.7000	1332.7003	R	F	74	85
PSM	SLIDNFALNPDILCSAK	3545	sp|Q5UIP0|RIF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	14-UNIMOD:4	ms_run[1]:scan=13249	77.8118	2	1889.942463	1889.955700	K	R	299	316
PSM	VGADPALLDR	3546	sp|Q00653|NFKB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	10-UNIMOD:267	ms_run[1]:scan=5300	31.060259999999996	2	1035.561871	1035.558828	R	H	549	559
PSM	SPSAQLMEQVAQLK	3547	sp|Q14203|DCTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=9813	55.72013666666667	2	1528.790441	1528.791928	K	S	1180	1194
PSM	SAPLDAALHALQEEQAR	3548	sp|P80217|IN35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1	ms_run[1]:scan=13488	79.35346833333334	2	1861.9332	1860.9322	M	L	2	19
PSM	LLTIGDANGEIQR	3549	sp|Q86X55|CARM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=7146	40.60788	2	1399.729068	1398.746693	R	H	37	50
PSM	YQQGDFGYCPR	3550	sp|P67870|CSK2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	9-UNIMOD:4,11-UNIMOD:267	ms_run[1]:scan=5069	29.904076666666665	2	1399.582356	1399.585454	K	V	101	112
PSM	TLLADQGEIR	3551	sp|O94776|MTA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	10-UNIMOD:267	ms_run[1]:scan=5309	31.107345000000002	2	1125.599163	1124.606507	K	V	139	149
PSM	LVINSGNGAVEDR	3552	sp|P16070|CD44_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	13-UNIMOD:267	ms_run[1]:scan=4723	27.898906666666665	2	1352.669977	1352.692362	K	K	682	695
PSM	QSSSSTTSQGGVKR	3553	sp|P18615|NELFE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28	ms_run[1]:scan=589	6.962913333333333	2	1391.6607	1391.6636	K	S	35	49
PSM	QFEDELHPDLK	3554	sp|Q9Y3C6|PPIL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28,11-UNIMOD:188	ms_run[1]:scan=8688	49.301759999999994	2	1358.6439	1358.6445	K	F	81	92
PSM	ENVLIGDGAGFK	3555	sp|P11310|ACADM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=7422	42.266126666666665	2	1218.630843	1218.624452	K	V	260	272
PSM	QVQDLEREFLIK	3556	sp|Q9HAU5|RENT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28,7-UNIMOD:267,12-UNIMOD:188	ms_run[1]:scan=12527	73.076435	2	1515.8275	1515.8263	R	L	999	1011
PSM	QATVVLNCVGPYR	3557	sp|Q8NBX0|SCPDL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	8-UNIMOD:4	ms_run[1]:scan=6929	39.490945	2	1476.760412	1475.755484	K	F	91	104
PSM	LEALDANSR	3558	sp|P09496|CLCA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	9-UNIMOD:267	ms_run[1]:scan=2554	16.902623333333334	2	997.512210	997.506792	R	K	121	130
PSM	AANNGALPPDLSYIVR	3559	sp|P08574|CY1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	16-UNIMOD:267	ms_run[1]:scan=10419	59.619168333333334	2	1679.891460	1679.887039	R	A	187	203
PSM	EGDLITLLVPEAR	3560	sp|Q9UQB8|BAIP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=13304	78.16879833333333	2	1424.786560	1424.787495	K	D	398	411
PSM	LLLSSSEWVQSEK	3561	sp|O95822|DCMC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	13-UNIMOD:188	ms_run[1]:scan=8964	50.83918333333333	2	1510.788957	1510.797453	K	L	377	390
PSM	IEGNLIFDPNNYLPK	3562	sp|P04114|APOB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=12733	74.41274333333334	2	1745.906133	1745.898836	K	E	655	670
PSM	IGIEEADSFFK	3563	sp|Q969F9|HPS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=10589	60.70926166666667	2	1255.632630	1254.613219	K	V	754	765
PSM	NLALDEAGQR	3564	sp|Q53TN4|CYBR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	10-UNIMOD:267	ms_run[1]:scan=3689	22.640198333333334	2	1096.5812	1095.5542	R	S	274	284
PSM	CVVLSDPLKDSSR	3565	sp|P48553|TPC10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:385,1-UNIMOD:4,9-UNIMOD:188,13-UNIMOD:267	ms_run[1]:scan=9545	54.25121	2	1474.7522	1473.7462	R	T	162	175
PSM	ALYLSDNDFEILPPDIGK	3566	sp|Q15404|RSU1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=13006	76.23069833333332	2	2019.022715	2019.020074	R	L	138	156
PSM	FGTTAVPTYQVGR	3567	sp|Q96PZ0|PUS7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=6416	36.783455	2	1395.723702	1395.714664	R	A	380	393
PSM	LGTDEISPR	3568	sp|O00159|MYO1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=3165	20.026591666666665	2	987.500622	986.503275	R	V	901	910
PSM	ALDVIQAGK	3569	sp|O75937|DNJC8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=4003	24.22867	2	914.519465	913.523282	R	E	119	128
PSM	NLDLDSIIAEVK	3570	sp|P35908|K22E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	12-UNIMOD:188	ms_run[1]:scan=13368	78.58199166666667	2	1335.718586	1334.738876	R	A	342	354
PSM	GVVNAALGQEMGSR	3571	sp|A0AVF1|IFT56_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	14-UNIMOD:267	ms_run[1]:scan=6570	37.62224333333334	2	1397.710325	1397.696067	K	D	323	337
PSM	FMATNDLMTELQK	3572	sp|Q86VP6|CAND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	13-UNIMOD:188	ms_run[1]:scan=9987	56.69368166666666	2	1546.744862	1546.746680	R	D	24	37
PSM	ALTVPELTQQVFDAK	3573	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	15-UNIMOD:188	ms_run[1]:scan=12574	73.37842666666667	2	1665.899039	1664.908066	R	N	283	298
PSM	MESEELADRVLDVVER	3574	sp|P49961-4|ENTP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:1,9-UNIMOD:267	ms_run[1]:scan=10606	60.81887833333333	2	1941.963939	1940.938876	-	S	1	17
PSM	MLERGAESAAGATDPSPTGK	3575	sp|Q86XF7|ZN575_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:267	ms_run[1]:scan=11267	64.941615	2	2013.910841	2012.934854	-	E	1	21
PSM	AAAFEQLQK	3576	sp|O94826|TOM70_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:188	ms_run[2]:scan=3820	23.304	2	1010.5492	1010.5492	R	W	160	169
PSM	AALQELLSK	3577	sp|P62851|RS25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7849	44.671	2	971.56515	971.5651	R	G	86	95
PSM	AAPVDLELKK	3578	sp|O60925|PFD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:1	ms_run[2]:scan=6647	38.007	2	1124.6441	1124.6441	M	A	2	12
PSM	AASAAAASAAAASAASGSPGPGEGSAGGEKR	3579	sp|Q13263-2|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:1,30-UNIMOD:188,31-UNIMOD:267	ms_run[2]:scan=7078	40.273	2	2600.2397	2596.2516	M	S	2	33
PSM	AASTDMAGLEESFRK	3580	sp|Q9BW30|TPPP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:1	ms_run[2]:scan=9683	55.001	2	1653.7668	1653.7668	M	F	2	17
PSM	ADFPAGIPECGTDALR	3581	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=8659	49.15	2	1698.7911	1698.7911	K	F	908	924
PSM	AELNEFLTR	3582	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:267	ms_run[2]:scan=7943	45.162	2	1101.5694	1101.5694	K	E	19	28
PSM	AELNEFLTR	3583	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7944	45.166	2	1091.5611	1091.5611	K	E	19	28
PSM	AELNTHVNVK	3584	sp|Q9NUQ6-2|SPS2L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:1	ms_run[2]:scan=4702	27.775	2	1165.6091	1165.6091	M	E	2	12
PSM	AENPSLENHR	3585	sp|O00505|IMA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:1,10-UNIMOD:267	ms_run[2]:scan=1781	13.087	2	1217.5664	1217.5664	M	I	2	12
PSM	AFVDVVNGEYVPR	3586	sp|O94763-2|RMP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9044	51.357	2	1463.7409	1463.7409	R	K	318	331
PSM	AGEIELELQR	3587	sp|Q8TD30|ALAT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6992	39.833	2	1156.6088	1156.6088	K	G	72	82
PSM	ALALLEDEER	3588	sp|A0FGR8-2|ESYT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7296	41.526	2	1157.5928	1157.5928	R	V	135	145
PSM	ALLQEFDNAVLSK	3589	sp|Q02241-3|KIF23_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11626	67.181	2	1446.7718	1446.7718	K	E	341	354
PSM	ALNALCDGLIDELNQALK	3590	sp|P30084|ECHM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	6-UNIMOD:4	ms_run[2]:scan=14423	87.218	2	1970.0143	1970.0143	K	T	57	75
PSM	ALPAVQQNNLDEDLIR	3591	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	16-UNIMOD:267	ms_run[2]:scan=9227	52.42	3	1817.9511	1817.9511	R	K	329	345
PSM	ALQAQEIECR	3592	sp|Q8NBJ5|GT251_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:4,10-UNIMOD:267	ms_run[2]:scan=3424	21.336	2	1226.5953	1226.5953	R	L	361	371
PSM	ALTVPELTQQMFDAK	3593	sp|P68371|TBB4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=12164	70.717	2	1690.86	1690.8600	R	N	283	298
PSM	ALTVPELTQQVFDAK	3594	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=12071	70.09	3	1658.8879	1658.8879	R	N	283	298
PSM	ALVEEALAQR	3595	sp|Q9HB07|MYG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=6275	35.993	2	1108.6116	1108.6116	R	F	244	254
PSM	AMQGAGTQER	3596	sp|P20073-2|ANXA7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=659	7.3628	2	1047.4767	1047.4767	K	V	247	257
PSM	ANDQFLESQR	3597	sp|Q15276|RABE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=3727	22.846	2	1216.5712	1216.5712	K	L	283	293
PSM	ANEFLEVGK	3598	sp|Q14152|EIF3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:188	ms_run[2]:scan=5891	34.004	2	1011.5332	1011.5332	R	K	15	24
PSM	ANTFVAELK	3599	sp|P40926|MDHM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:188	ms_run[2]:scan=6113	35.154	2	997.55398	997.5540	R	G	177	186
PSM	ANTTAFLTPLEIK	3600	sp|Q9Y5K6|CD2AP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	13-UNIMOD:188	ms_run[2]:scan=10897	62.607	2	1423.8018	1423.8018	K	A	558	571
PSM	ASGEHSPGSGAAR	3601	sp|Q9H4A4|AMPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:1	ms_run[2]:scan=692	7.5389	2	1224.5483	1224.5483	M	R	2	15
PSM	ASLLDDYQLPEILR	3602	sp|Q9H2U1-3|DHX36_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	14-UNIMOD:267	ms_run[2]:scan=13342	78.415	2	1654.8806	1654.8806	R	T	620	634
PSM	ASVDELFAEIVR	3603	sp|P61225|RAP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=13667	80.54	2	1347.7034	1347.7034	K	Q	151	163
PSM	ATDTSQGELVHPK	3604	sp|Q5SSJ5|HP1B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:1	ms_run[2]:scan=3341	20.934	2	1423.6943	1423.6943	M	A	2	15
PSM	ATHGQTCAR	3605	sp|P45880|VDAC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:1,7-UNIMOD:4,9-UNIMOD:267	ms_run[2]:scan=497	6.4196	2	1052.4697	1052.4697	M	P	2	11
PSM	ATNFLAHEK	3606	sp|P29692|EF1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:1,9-UNIMOD:188	ms_run[2]:scan=6095	35.07	2	1077.555	1077.5550	M	I	2	11
PSM	ATNFLAHEK	3607	sp|P29692|EF1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:1	ms_run[2]:scan=6096	35.074	2	1071.5349	1071.5349	M	I	2	11
PSM	AVAEQIPLLVQGVR	3608	sp|Q9Y490|TLN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=10349	59.163	2	1491.8773	1491.8773	K	G	958	972
PSM	AVENSSTAIGIR	3609	sp|P25788-2|PSA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	12-UNIMOD:267	ms_run[2]:scan=3757	22.999	2	1226.6494	1226.6494	K	C	30	42
PSM	AVENYLIQMAR	3610	sp|O14737|PDCD5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9669	54.93	2	1306.6704	1306.6704	K	Y	69	80
PSM	AVETPPLSSVNLLEGLSR	3611	sp|Q14C86-3|GAPD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	18-UNIMOD:267	ms_run[2]:scan=12822	74.99	3	1891.029	1891.0290	R	T	387	405
PSM	AYTSPLIDMFNNPATAAPNSQR	3612	sp|Q9UHR4|BI2L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=12179	70.82	2	2378.1325	2378.1325	R	V	292	314
PSM	CADLSLSPIYPAAR	3613	sp|P18858|DNLI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=9017	51.177	2	1542.774	1542.7740	K	G	846	860
PSM	CDAVLCTLPLGVLK	3614	sp|O60341|KDM1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:4,6-UNIMOD:4	ms_run[2]:scan=12205	70.997	2	1557.8259	1557.8259	K	Q	618	632
PSM	CIELCCGSVK	3615	sp|P05023-3|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:4,5-UNIMOD:4,6-UNIMOD:4	ms_run[2]:scan=4600	27.26	2	1224.5301	1224.5301	K	E	428	438
PSM	CLEEFELLGK	3616	sp|Q99613-2|EIF3C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:4	ms_run[2]:scan=10014	56.859	2	1236.606	1236.6060	K	A	79	89
PSM	CVNTTLQIK	3617	sp|Q01518-2|CAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:4	ms_run[2]:scan=4196	25.204	2	1075.5696	1075.5696	K	G	355	364
PSM	DANLYISGLPR	3618	sp|Q15717|ELAV1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8686	49.293	2	1217.6404	1217.6404	K	T	105	116
PSM	DLQNVNITLR	3619	sp|P35232|PHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=7691	43.834	2	1194.6596	1194.6596	K	I	84	94
PSM	DSALEFLTQLSR	3620	sp|Q6PJG6|BRAT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=13552	79.778	2	1378.7092	1378.7092	R	H	518	530
PSM	DSTLIMQLLR	3621	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	6-UNIMOD:35,10-UNIMOD:267	ms_run[2]:scan=12257	71.337	2	1214.6568	1214.6568	K	D	213	223
PSM	DVEDFLSPLLGK	3622	sp|Q13405|RM49_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=13756	81.17	2	1331.6973	1331.6973	K	T	123	135
PSM	EADGSLQPLPQR	3623	sp|Q5JTZ9|SYAM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=4084	24.645	2	1309.6626	1309.6626	R	H	251	263
PSM	EDVLTLLLPVMGDSK	3624	sp|Q13200-2|PSMD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=14735	91.085	2	1628.8695	1628.8695	R	S	336	351
PSM	EEGWWVVIGDAK	3625	sp|O75643|U520_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	12-UNIMOD:188	ms_run[2]:scan=12200	70.963	2	1393.6973	1393.6973	R	S	2061	2073
PSM	EEPSNPFLAFVEK	3626	sp|Q7LBC6-2|KDM3B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=13046	76.493	2	1505.7402	1505.7402	R	V	287	300
PSM	EGPAVVGQFIQDVK	3627	sp|Q86VP6|CAND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=10703	61.428	2	1485.7827	1485.7827	K	N	813	827
PSM	EIVLADVIDNDSWR	3628	sp|P22234|PUR6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	14-UNIMOD:267	ms_run[2]:scan=12554	73.251	3	1653.8238	1653.8238	K	L	202	216
PSM	ELAEAVAGGR	3629	sp|Q9UBT2|SAE2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=2597	17.104	2	981.51188	981.5119	R	V	10	20
PSM	ELDDLEQWIQER	3630	sp|O15020-2|SPTN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=12105	70.319	2	1572.742	1572.7420	R	E	1702	1714
PSM	ELDSITPEVLPGWK	3631	sp|Q16891-3|MIC60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11361	65.537	2	1582.8243	1582.8243	R	G	340	354
PSM	ELLEQISAFDNVPR	3632	sp|Q9NX58|LYAR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11339	65.399	2	1629.8362	1629.8362	R	K	96	110
PSM	ELPPDQAEYCIAR	3633	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=6273	35.977	2	1570.7325	1570.7325	R	M	870	883
PSM	ETQALILAPTR	3634	sp|P38919|IF4A3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:267	ms_run[2]:scan=6257	35.89	2	1221.6957	1221.6957	R	E	106	117
PSM	FASENDLPEWK	3635	sp|P43487-2|RANG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:188	ms_run[2]:scan=7935	45.123	2	1340.6344	1340.6344	R	E	58	69
PSM	FEDENFILK	3636	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:188	ms_run[2]:scan=8610	48.888	2	1159.5857	1159.5857	K	H	83	92
PSM	FEDENFILK	3637	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8611	48.892	2	1153.5655	1153.5655	K	H	83	92
PSM	FLPAVSDENSK	3638	sp|P46087-2|NOP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:188	ms_run[2]:scan=4500	26.75	2	1211.6129	1211.6129	R	R	31	42
PSM	FLQDTIEEMALK	3639	sp|O95202|LETM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11074	63.711	2	1436.7221	1436.7221	K	N	263	275
PSM	FSEGEATLR	3640	sp|P47897-2|SYQ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3453	21.471	2	1008.4876	1008.4876	K	M	384	393
PSM	FSGDLDDQTCR	3641	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:4	ms_run[2]:scan=3307	20.747	2	1312.5354	1312.5354	K	E	236	247
PSM	FSLDCPSCDMMELR	3642	sp|Q8IX12-2|CCAR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	5-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=10999	63.24	2	1759.7038	1759.7038	K	R	354	368
PSM	FVSTTSSSR	3643	sp|P13647|K2C5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:267	ms_run[2]:scan=913	8.6708	2	980.48024	980.4802	K	K	577	586
PSM	GALPLDTVTFYK	3644	sp|P30040|ERP29_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	12-UNIMOD:188	ms_run[2]:scan=10135	57.68	2	1329.7276	1329.7276	K	V	37	49
PSM	GASQAGMTGYGMPR	3645	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=4884	28.878	2	1382.6071	1382.6071	R	Q	183	197
PSM	GCDVVVIPAGVPR	3646	sp|P40926|MDHM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	2-UNIMOD:4	ms_run[2]:scan=8043	45.713	2	1337.7126	1337.7126	K	K	92	105
PSM	GEGGILINSQGER	3647	sp|P31040-3|SDHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	13-UNIMOD:267	ms_run[2]:scan=4534	26.935	2	1338.6767	1338.6767	R	F	168	181
PSM	GGGALSAVAATK	3648	sp|P61011-2|SRP54_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	12-UNIMOD:188	ms_run[2]:scan=3228	20.329	2	1007.5707	1007.5707	K	S	207	219
PSM	GGSDGYGSGR	3649	sp|P22626|ROA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=605	7.0567	2	911.37332	911.3733	R	G	229	239
PSM	GGSGGGGEGIQDR	3650	sp|O43823|AKAP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=817	8.201	2	1145.5061	1145.5061	R	E	110	123
PSM	GGSWIQEINVAEK	3651	sp|P78527|PRKDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9602	54.576	2	1429.7201	1429.7201	K	N	4024	4037
PSM	GLESDVAELR	3652	sp|Q03252|LMNB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=7127	40.512	2	1097.5592	1097.5592	R	A	172	182
PSM	GLPITITESDIR	3653	sp|P52756-4|RBM5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	12-UNIMOD:267	ms_run[2]:scan=9144	51.964	2	1323.7273	1323.7273	R	E	104	116
PSM	GLQSGVDIGVK	3654	sp|Q99439|CNN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:188	ms_run[2]:scan=5483	31.971	2	1077.6126	1077.6126	K	Y	135	146
PSM	GSFSDTGLGDGK	3655	sp|Q9Y2W1|TR150_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3717	22.794	2	1139.5095	1139.5095	K	M	376	388
PSM	GSIFVVFDSIESAK	3656	sp|P05455|LA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	14-UNIMOD:188	ms_run[2]:scan=13574	79.921	2	1503.7916	1503.7916	K	K	152	166
PSM	GSPLVVISQGK	3657	sp|Q16555-2|DPYL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:188	ms_run[2]:scan=6023	34.685	2	1089.6489	1089.6489	R	I	405	416
PSM	GTVLDQVPVNPSLYLIK	3658	sp|Q5JUX0|SPIN3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=12647	73.855	2	1855.0455	1855.0455	K	Y	70	87
PSM	GVGTDEACLIEILASR	3659	sp|P50995-2|ANX11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	8-UNIMOD:4	ms_run[2]:scan=13268	77.933	3	1702.856	1702.8560	K	S	254	270
PSM	GVSAVVVGADR	3660	sp|Q9BV20-2|MTNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3723	22.829	2	1028.5615	1028.5615	R	V	192	203
PSM	IAENPANPPVGGK	3661	sp|Q9Y4E1-5|WAC2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=2294	15.641	2	1262.6619	1262.6619	K	A	1058	1071
PSM	IAGQVAAANK	3662	sp|P39019|RS19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=904	8.6289	2	941.52943	941.5294	R	K	134	144
PSM	IDPALLTVTSGK	3663	sp|Q68D85|NR3L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7904	44.966	2	1213.6918	1213.6918	R	S	385	397
PSM	IIEVGDTPK	3664	sp|Q9H9S3-2|S61A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:188	ms_run[2]:scan=3487	21.63	2	976.55364	976.5536	K	D	99	108
PSM	ILDAAGANLK	3665	sp|Q9UBQ7|GRHPR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=4399	26.232	2	984.5604	984.5604	R	V	67	77
PSM	IMFEVQDLK	3666	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:188	ms_run[2]:scan=9390	53.366	2	1127.5992	1127.5992	R	Y	2341	2350
PSM	INSVEVYDGTWYR	3667	sp|Q13308-4|PTK7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9040	51.329	2	1600.7522	1600.7522	R	C	468	481
PSM	IPTEAPQLELK	3668	sp|Q5VW32-2|BROX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:188	ms_run[2]:scan=7070	40.235	2	1243.7119	1243.7119	K	A	303	314
PSM	IQDPVLQAVTSQTSLPGH	3669	sp|Q9UBP6|TRMB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=10256	58.531	2	1889.9847	1889.9847	R	-	259	277
PSM	IQEENVIPR	3670	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:267	ms_run[2]:scan=4489	26.693	2	1106.5959	1106.5959	K	E	981	990
PSM	IQQQQPPPGEK	3671	sp|P26640|SYVC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=743	7.809	2	1248.6463	1248.6463	K	K	253	264
PSM	IQTQPGYANTLR	3672	sp|Q00325-2|MPCP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=4145	24.963	2	1360.7099	1360.7099	R	D	189	201
PSM	ITGCASPGK	3673	sp|P50991-2|TCPD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	4-UNIMOD:4,9-UNIMOD:188	ms_run[2]:scan=661	7.3731	2	895.45288	895.4529	K	T	346	355
PSM	ITLDNAYMEK	3674	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:188	ms_run[2]:scan=6371	36.534	2	1202.5949	1202.5949	K	C	142	152
PSM	ITQDIFQQLLK	3675	sp|P56192-2|SYMC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=12385	72.159	2	1345.7606	1345.7606	K	R	365	376
PSM	ITQDIFQQLLK	3676	sp|P56192-2|SYMC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:188	ms_run[2]:scan=12394	72.215	2	1351.7807	1351.7807	K	R	365	376
PSM	IVLQIDNAR	3677	sp|P08727|K1C19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5861	33.852	2	1040.5978	1040.5978	R	L	151	160
PSM	IYIGDDNPLTLIVK	3678	sp|P06756-3|ITAV_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	14-UNIMOD:188	ms_run[2]:scan=13291	78.083	2	1578.8964	1578.8964	K	A	601	615
PSM	IYLSCLEELMK	3679	sp|Q15645|PCH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	5-UNIMOD:4	ms_run[2]:scan=12961	75.924	2	1397.6935	1397.6935	K	C	330	341
PSM	LAAGDQLLSVDGR	3680	sp|P55196-2|AFAD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7336	41.773	2	1313.6939	1313.6939	R	S	1036	1049
PSM	LANELPDWFQTAK	3681	sp|Q9UDY2-5|ZO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11393	65.741	2	1531.7671	1531.7671	K	T	747	760
PSM	LAQQQAALLMQQEER	3682	sp|Q13435|SF3B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	15-UNIMOD:267	ms_run[2]:scan=7171	40.751	3	1765.902	1765.9020	K	A	149	164
PSM	LCPNSTGAEIR	3683	sp|P35998|PRS7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	2-UNIMOD:4,11-UNIMOD:267	ms_run[2]:scan=2563	16.943	2	1226.5953	1226.5953	R	S	376	387
PSM	LDSIVIQQGR	3684	sp|O60264|SMCA5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5154	30.343	2	1127.6299	1127.6299	R	L	627	637
PSM	LECVEPNCR	3685	sp|Q969Q0|RL36L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	3-UNIMOD:4,8-UNIMOD:4,9-UNIMOD:267	ms_run[2]:scan=1976	14.006	2	1185.5146	1185.5146	R	S	70	79
PSM	LEICNLTPDALK	3686	sp|P07384|CAN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	4-UNIMOD:4,12-UNIMOD:188	ms_run[2]:scan=9677	54.973	2	1391.7426	1391.7426	R	S	348	360
PSM	LGALTAEEIALK	3687	sp|Q13601-2|KRR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8704	49.384	2	1227.7075	1227.7075	K	M	301	313
PSM	LGAMSAAPSQPNSQIR	3688	sp|Q9BTC0-1|DIDO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	16-UNIMOD:267	ms_run[2]:scan=4630	27.417	2	1636.8231	1636.8231	R	Q	656	672
PSM	LGDAILSVNGTDLR	3689	sp|Q13425-2|SNTB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8990	51.007	2	1442.7729	1442.7729	R	Q	159	173
PSM	LGDLEEAPER	3690	sp|Q8WUM9|S20A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=3779	23.113	2	1137.5541	1137.5541	K	E	321	331
PSM	LGESQTLQQFSR	3691	sp|Q13813-3|SPTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	12-UNIMOD:267	ms_run[2]:scan=6146	35.312	2	1402.708	1402.7080	K	D	1527	1539
PSM	LGGTCVNVGCVPK	3692	sp|P00390-5|GSHR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	5-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=5319	31.153	2	1359.6639	1359.6639	K	K	98	111
PSM	LGLDDFESLK	3693	sp|Q9Y2H1|ST38L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=10223	58.288	2	1135.5761	1135.5761	R	V	85	95
PSM	LGNQNVETK	3694	sp|Q8WWC4|MAIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:188	ms_run[2]:scan=841	8.3211	2	1007.5343	1007.5343	K	Q	250	259
PSM	LGNTTVICGVK	3695	sp|Q96B26|EXOS8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	8-UNIMOD:4	ms_run[2]:scan=4561	27.072	2	1160.6223	1160.6223	K	A	53	64
PSM	LIALDAAEEFFK	3696	sp|Q8N565|MREG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	12-UNIMOD:188	ms_run[2]:scan=13933	82.587	2	1371.7381	1371.7381	R	L	173	185
PSM	LISWYDNEFGYSNR	3697	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=10670	61.221	2	1762.7951	1762.7951	K	V	268	282
PSM	LIVENLSSR	3698	sp|Q13247-3|SRSF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:267	ms_run[2]:scan=5510	32.104	2	1039.5901	1039.5901	R	C	112	121
PSM	LLADQAEAR	3699	sp|P84098|RL19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:267	ms_run[2]:scan=1970	13.978	2	995.52753	995.5275	K	R	154	163
PSM	LLQTDDEEEAGLLELLK	3700	sp|P55060|XPO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=13678	80.607	2	1927.999	1927.9990	K	S	252	269
PSM	LPEVQQATK	3701	sp|Q13428-2|TCOF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:188	ms_run[2]:scan=2350	15.926	2	1018.5754	1018.5754	K	A	1053	1062
PSM	LPSDVVTAVR	3702	sp|P04181|OAT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=5741	33.232	2	1065.6058	1065.6058	K	G	363	373
PSM	LQAEIEGLK	3703	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5568	32.375	2	999.56006	999.5601	R	G	317	326
PSM	LQLEACETR	3704	sp|Q15149-7|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	6-UNIMOD:4,9-UNIMOD:267	ms_run[2]:scan=3541	21.874	2	1128.5473	1128.5473	R	T	962	971
PSM	LQPFATEADVEEALR	3705	sp|P33992|MCM5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11128	64.047	3	1687.8417	1687.8417	K	L	628	643
PSM	LSEFGLIQEK	3706	sp|Q9H845|ACAD9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8327	47.311	2	1162.6234	1162.6234	R	F	336	346
PSM	LSELEAALQR	3707	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=7112	40.445	2	1138.6222	1138.6222	K	A	353	363
PSM	LSELEAALQR	3708	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=7284	41.453	2	1138.6222	1138.6222	K	A	353	363
PSM	LSELEAALQR	3709	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=15346	97.317	2	1138.6222	1138.6222	K	A	353	363
PSM	LSELEAALQR	3710	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=15220	95.835	2	1128.6139	1128.6139	K	A	353	363
PSM	LSEQELQFR	3711	sp|Q16891-3|MIC60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:267	ms_run[2]:scan=6455	37.007	2	1158.5909	1158.5909	K	R	485	494
PSM	LSEQELQFR	3712	sp|Q16891-3|MIC60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6456	37.011	2	1148.5826	1148.5826	K	R	485	494
PSM	LSGTGSAGATIR	3713	sp|P36871-2|PGM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	12-UNIMOD:267	ms_run[2]:scan=1826	13.29	2	1099.5861	1099.5861	R	L	522	534
PSM	LSSEKGMGCS	3714	sp|Q15365|PCBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:4	ms_run[2]:scan=955	8.8804	2	1054.4423	1054.4423	R	-	347	357
PSM	LTDAQILTR	3715	sp|P35250-2|RFC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:267	ms_run[2]:scan=5261	30.874	2	1039.5901	1039.5901	K	L	159	168
PSM	LTDQVMQNPR	3716	sp|Q99733|NP1L4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3106	19.724	2	1200.5921	1200.5921	K	V	27	37
PSM	LTTDPDLILEVLR	3717	sp|Q71RC2-7|LARP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=13972	82.859	2	1496.845	1496.8450	K	S	166	179
PSM	LTVPGLSENVPYK	3718	sp|P16144-4|ITB4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	13-UNIMOD:188	ms_run[2]:scan=9106	51.737	2	1421.7862	1421.7862	R	F	1624	1637
PSM	LTVSSVNNPR	3719	sp|Q86TB9-2|PATL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=2549	16.878	2	1095.5912	1095.5912	K	K	342	352
PSM	LVEIAQVPK	3720	sp|Q16851-2|UGPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:188	ms_run[2]:scan=5664	32.847	2	1001.6217	1001.6217	R	A	293	302
PSM	LVPLNQESVEER	3721	sp|Q8N1F7|NUP93_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	12-UNIMOD:267	ms_run[2]:scan=5361	31.363	2	1421.739	1421.7390	K	V	719	731
PSM	MEKTELIQK	3722	sp|P27348|1433T_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:1,3-UNIMOD:188,9-UNIMOD:188	ms_run[2]:scan=5101	30.072	2	1172.6514	1172.6514	-	A	1	10
PSM	MELLGEYVGQEGKPQK	3723	sp|Q9BXV9|GON7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:1	ms_run[2]:scan=12584	73.443	2	1846.9135	1846.9135	-	L	1	17
PSM	MLLCEAVAAVMAK	3724	sp|P54136-2|SYRC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	4-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=13520	79.569	2	1411.7333	1411.7333	R	G	563	576
PSM	MNYSDAIVWLK	3725	sp|O43776|SYNC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:35,11-UNIMOD:188	ms_run[2]:scan=10292	58.781	2	1360.6793	1360.6793	R	E	391	402
PSM	MNYSDAIVWLK	3726	sp|O43776|SYNC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11654	67.354	2	1338.6642	1338.6642	R	E	391	402
PSM	MSTEEIIQR	3727	sp|P17980|PRS6A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:35,9-UNIMOD:267	ms_run[2]:scan=2819	18.327	2	1131.5469	1131.5469	K	T	36	45
PSM	MTDQEAIQDLWQWR	3728	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:35	ms_run[2]:scan=12634	73.773	3	1834.8308	1834.8308	R	K	278	292
PSM	MTDQEAIQDLWQWR	3729	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	14-UNIMOD:267	ms_run[2]:scan=13441	79.05	3	1828.8442	1828.8442	R	K	278	292
PSM	NADGLIVASR	3730	sp|Q9UJA5-4|TRM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3981	24.12	2	1014.5458	1014.5458	R	F	198	208
PSM	NAQGIINPIEAK	3731	sp|Q9UBB9|TFP11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6118	35.174	2	1266.6932	1266.6932	K	Q	171	183
PSM	NGQDLGVAFK	3732	sp|Q00839-2|HNRPU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:188	ms_run[2]:scan=5465	31.872	2	1053.555	1053.5550	K	I	405	415
PSM	NILEESLCELVAK	3733	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	8-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=13448	79.096	2	1522.8008	1522.8008	K	Q	2335	2348
PSM	NIVEAAAVR	3734	sp|Q5JNZ5|RS26L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3754	22.987	2	941.52943	941.5294	R	D	43	52
PSM	NLAMGVNLTSMSK	3735	sp|P12004|PCNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8692	49.324	2	1364.6792	1364.6792	R	I	65	78
PSM	NLCSDDTPMVR	3736	sp|P30153|2AAA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	3-UNIMOD:4	ms_run[2]:scan=4436	26.404	2	1306.5646	1306.5646	R	R	172	183
PSM	NLDDLTLLK	3737	sp|Q4VC31|CCD58_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:188	ms_run[2]:scan=9747	55.364	2	1049.6064	1049.6064	K	Q	92	101
PSM	NLQEAEEWYK	3738	sp|P08670|VIME_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7234	41.127	2	1308.5986	1308.5986	K	S	283	293
PSM	NLQYYDISAK	3739	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6098	35.081	2	1213.5979	1213.5979	K	S	143	153
PSM	NLVTEDVMR	3740	sp|P06744|G6PI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6186	35.527	2	1075.5332	1075.5332	K	M	58	67
PSM	NNTQVLINCR	3741	sp|P62316-2|SMD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:4	ms_run[2]:scan=3489	21.638	2	1230.6139	1230.6139	K	N	28	38
PSM	NQDNLQGWNK	3742	sp|P30085-2|KCY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3535	21.845	2	1215.5632	1215.5632	R	T	48	58
PSM	NQSPVLEPVGR	3743	sp|P51812|KS6A3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:267	ms_run[2]:scan=4125	24.865	2	1204.644	1204.6440	R	S	713	724
PSM	NSNILEDLETLR	3744	sp|P48444|COPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=12867	75.264	2	1415.7256	1415.7256	K	L	73	85
PSM	NSTWSGESK	3745	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=1046	9.3294	2	994.43559	994.4356	K	T	478	487
PSM	NVLCSACSGQGGK	3746	sp|O60884|DNJA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	4-UNIMOD:4,7-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=1817	13.248	2	1342.6065	1342.6065	K	S	140	153
PSM	NVLIEVNPQTR	3747	sp|Q92979|NEP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:267	ms_run[2]:scan=6170	35.444	2	1291.7124	1291.7124	K	I	115	126
PSM	NVMILTNPVAAK	3748	sp|Q9UGI8|TES_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	12-UNIMOD:188	ms_run[2]:scan=7974	45.324	2	1275.7316	1275.7316	R	K	90	102
PSM	NVPQVVNVQELK	3749	sp|P35658-2|NU214_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7658	43.638	2	1365.7616	1365.7616	K	N	1107	1119
PSM	NVQLQENEIR	3750	sp|P36873|PP1G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=4152	24.998	2	1251.6447	1251.6447	K	G	27	37
PSM	NVVACESIGR	3751	sp|Q9H0U6|RM18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	5-UNIMOD:4	ms_run[2]:scan=3105	19.719	2	1103.5393	1103.5393	R	V	121	131
PSM	PELEDSTLR	3752	sp|Q15149-7|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3761	23.022	2	1058.5244	1058.5244	R	Y	483	492
PSM	PSANCDPFSVTEALIR	3753	sp|P15104|GLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	5-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=12115	70.39	2	1785.8595	1785.8595	R	T	342	358
PSM	QAAPCVLFFDELDSIAK	3754	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	5-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=14749	91.203	3	1928.9649	1928.9649	R	A	568	585
PSM	QAGVFEPTIVK	3755	sp|P17987|TCPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6878	39.232	2	1187.655	1187.6550	K	V	500	511
PSM	QASPNIVIALSGNK	3756	sp|P20339-2|RAB5A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	14-UNIMOD:188	ms_run[2]:scan=8505	48.302	2	1416.8032	1416.8032	R	A	107	121
PSM	QEAKPEAFVLSPLEMSST	3757	sp|Q14676-3|MDC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	4-UNIMOD:188	ms_run[2]:scan=11640	67.269	2	1968.981	1968.9810	K	-	1785	1803
PSM	QEIFQEQLAAVPEFR	3758	sp|Q9Y678|COPG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	15-UNIMOD:267	ms_run[2]:scan=11485	66.304	2	1813.9238	1813.9238	R	G	610	625
PSM	QLLPCEMACNEK	3759	sp|Q9NR45|SIAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	5-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=6016	34.644	2	1491.652	1491.6520	K	L	279	291
PSM	QLSSGVSEIR	3760	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=3485	21.623	2	1084.5752	1084.5752	R	H	80	90
PSM	QNGTVVGTDIAELLLR	3761	sp|O15027-2|SC16A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	16-UNIMOD:267	ms_run[2]:scan=14093	83.94	2	1707.9395	1707.9395	R	D	1547	1563
PSM	QVLLGDQIPK	3762	sp|P28072|PSB6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:188	ms_run[2]:scan=6654	38.042	2	1115.6646	1115.6646	R	F	221	231
PSM	SACGNCYLGDAFR	3763	sp|Q6FI81-2|CPIN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	3-UNIMOD:4,6-UNIMOD:4	ms_run[2]:scan=7339	41.789	2	1489.6078	1489.6078	K	C	68	81
PSM	SFDFEIETK	3764	sp|Q08945|SSRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8558	48.603	2	1114.5183	1114.5183	R	Q	388	397
PSM	SFDFEIETK	3765	sp|Q08945|SSRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:188	ms_run[2]:scan=8559	48.607	2	1120.5384	1120.5384	R	Q	388	397
PSM	SIQEELQQLR	3766	sp|Q15149-7|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=8641	49.047	2	1252.6651	1252.6651	R	Q	1385	1395
PSM	SLDIQVPNFPADETK	3767	sp|P47897-2|SYQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=10391	59.437	2	1672.8308	1672.8308	K	G	576	591
PSM	SLEDALAEAQR	3768	sp|O95347|SMC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7258	41.278	2	1201.5939	1201.5939	R	V	298	309
PSM	SLETENAGLR	3769	sp|P02545-2|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=2950	18.976	2	1098.5545	1098.5545	R	L	51	61
PSM	SLETENAGLR	3770	sp|P02545-2|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=2953	18.987	2	1088.5462	1088.5462	R	L	51	61
PSM	SLNWEEMEK	3771	sp|Q969U7-2|PSMG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:188	ms_run[2]:scan=7095	40.362	2	1170.5323	1170.5323	K	S	126	135
PSM	SLPYNQPGTCYTLVALPK	3772	sp|Q9Y678|COPG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:4	ms_run[2]:scan=10457	59.864	2	2021.0292	2021.0292	R	E	697	715
PSM	SLTLDTWEPELLK	3773	sp|Q15057|ACAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	13-UNIMOD:188	ms_run[2]:scan=12555	73.257	2	1549.8335	1549.8335	R	L	453	466
PSM	SMVEEGTGLR	3774	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=3559	21.956	2	1087.5207	1087.5207	R	L	4421	4431
PSM	SNDPVATAFAEMLK	3775	sp|Q9NYL9|TMOD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=13461	79.179	2	1492.7232	1492.7232	R	V	239	253
PSM	SNNIINETTTR	3776	sp|Q9NTJ3-2|SMC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:267	ms_run[2]:scan=3474	21.568	2	1271.6345	1271.6345	K	N	435	446
PSM	SPAQYQVVLSER	3777	sp|Q6XQN6|PNCB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6440	36.922	2	1375.7096	1375.7096	R	L	513	525
PSM	SQDFGNLFSFPSYSQK	3778	sp|Q02880-2|TOP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=12418	72.369	2	1850.8475	1850.8475	K	S	1436	1452
PSM	SSENPNEVFR	3779	sp|P45974-2|UBP5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3517	21.764	2	1177.5364	1177.5364	R	F	453	463
PSM	STLNEIYFGK	3780	sp|P47756-2|CAPZB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7952	45.208	2	1170.5921	1170.5921	R	T	226	236
PSM	SVENAVCVLR	3781	sp|Q9Y446|PKP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	7-UNIMOD:4,10-UNIMOD:267	ms_run[2]:scan=6048	34.82	2	1155.5946	1155.5946	K	N	523	533
PSM	TAVCDIPPR	3782	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	4-UNIMOD:4,9-UNIMOD:267	ms_run[2]:scan=3067	19.548	2	1037.5203	1037.5203	K	G	351	360
PSM	TAVCDIPPR	3783	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	4-UNIMOD:4	ms_run[2]:scan=2480	16.548	2	1027.5121	1027.5121	K	G	351	360
PSM	TFDSIVMDPK	3784	sp|P13667|PDIA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7406	42.178	2	1151.5533	1151.5533	K	K	534	544
PSM	TGEAIVDAALSALR	3785	sp|Q15084-3|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=13210	77.564	3	1385.7514	1385.7514	R	Q	116	130
PSM	TGEGFLCVFAINNTK	3786	sp|P01116|RASK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	7-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=12324	71.759	2	1675.8335	1675.8335	R	S	74	89
PSM	TGISDVFAK	3787	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6888	39.278	2	936.49165	936.4916	K	N	325	334
PSM	TIAECLADELINAAK	3788	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	5-UNIMOD:4	ms_run[2]:scan=13932	82.582	3	1630.8236	1630.8236	K	G	168	183
PSM	TIAEQLAEK	3789	sp|Q7L014|DDX46_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3922	23.831	2	1001.5393	1001.5393	K	I	895	904
PSM	TIEYLQPNPASR	3790	sp|Q99961|SH3G1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5701	33.033	2	1387.7096	1387.7096	R	A	54	66
PSM	TIIPWDVDTICK	3791	sp|P21953|ODBB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:4	ms_run[2]:scan=11019	63.369	2	1459.7381	1459.7381	R	S	306	318
PSM	TLEDPDLNVR	3792	sp|Q86VP6|CAND1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=5647	32.76	2	1180.5963	1180.5963	K	R	1014	1024
PSM	TLETVPLER	3793	sp|P22626|ROA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5394	31.523	2	1056.5815	1056.5815	K	K	4	13
PSM	TLPQAEALDR	3794	sp|Q9UIJ7|KAD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=4588	27.203	2	1122.5909	1122.5909	R	A	95	105
PSM	TNLLDELPQSVLK	3795	sp|Q86Y07-4|VRK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	13-UNIMOD:188	ms_run[2]:scan=11994	69.581	2	1474.8338	1474.8338	K	W	147	160
PSM	TNQELQEINR	3796	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3069	19.555	2	1243.6157	1243.6157	R	V	136	146
PSM	TPCEEILVK	3797	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	3-UNIMOD:4	ms_run[2]:scan=5153	30.339	2	1087.5583	1087.5583	R	H	2591	2600
PSM	TPTEALASFDYIVR	3798	sp|Q9H7Z7|PGES2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11679	67.516	2	1581.8039	1581.8039	R	E	253	267
PSM	TPVEVPVGGFK	3799	sp|Q15149-7|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:188	ms_run[2]:scan=6906	39.365	2	1134.638	1134.6380	K	G	3205	3216
PSM	TPVSEDMLGR	3800	sp|P21281|VATB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=5135	30.251	2	1113.5364	1113.5364	R	V	121	131
PSM	TPYTDVNIVTIR	3801	sp|P50213|IDH3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8513	48.348	2	1390.7456	1390.7456	K	E	135	147
PSM	TQLYEYLQNR	3802	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7840	44.622	2	1326.6568	1326.6568	R	M	269	279
PSM	TSLALDESLFR	3803	sp|Q86U42-2|PABP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=10182	57.994	2	1250.6507	1250.6507	R	G	228	239
PSM	TSLGPNGLDK	3804	sp|P48643|TCPE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:188	ms_run[2]:scan=3374	21.094	2	1006.5391	1006.5391	R	M	50	60
PSM	TSMTQSLREVIK	3805	sp|Q9NPJ3|ACO13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:1	ms_run[2]:scan=9707	55.141	2	1433.7548	1433.7548	M	A	2	14
PSM	TSQLGDSPFYPGK	3806	sp|P49790-2|NU153_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6856	39.125	2	1395.667	1395.6670	K	T	251	264
PSM	TSSTDLSDIPALPANPIPVIK	3807	sp|P51003|PAPOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	21-UNIMOD:188	ms_run[2]:scan=12015	69.72	2	2154.1879	2154.1879	K	N	716	737
PSM	TTDFSDFLSIVGCTK	3808	sp|Q9UHD1|CHRD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	13-UNIMOD:4	ms_run[2]:scan=13394	78.747	2	1689.792	1689.7920	R	G	47	62
PSM	TTQIPQFLLDDCFK	3809	sp|Q9H6S0|YTDC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	12-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=12322	71.748	2	1730.8645	1730.8645	K	N	223	237
PSM	TTQVPQFILDDFIQNDR	3810	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	17-UNIMOD:267	ms_run[2]:scan=13645	80.398	3	2059.025	2059.0250	K	A	418	435
PSM	TVINFTMPNTIK	3811	sp|Q96GQ7|DDX27_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	12-UNIMOD:188	ms_run[2]:scan=9782	55.56	2	1383.7528	1383.7528	K	H	534	546
PSM	TYEQMEFPLLK	3812	sp|Q9H2P0|ADNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:188	ms_run[2]:scan=11287	65.07	2	1403.7102	1403.7102	R	K	718	729
PSM	TYNFLPEFLVSTQK	3813	sp|P30740|ILEU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=13326	78.309	2	1685.8665	1685.8665	K	T	97	111
PSM	VADLADFVK	3814	sp|Q99797|MIPEP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:188	ms_run[2]:scan=8767	49.697	2	982.54308	982.5431	R	I	118	127
PSM	VAQLEQVYIR	3815	sp|P62318-2|SMD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=6833	39.004	2	1227.6851	1227.6851	R	G	55	65
PSM	VCDIAAELAR	3816	sp|O00410-2|IPO5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	2-UNIMOD:4,10-UNIMOD:267	ms_run[2]:scan=6980	39.778	2	1126.568	1126.5680	K	N	49	59
PSM	VDREQLVQK	3817	sp|P61981|1433G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:1	ms_run[2]:scan=3619	22.264	2	1155.6248	1155.6248	M	A	2	11
PSM	VEFMDDTSR	3818	sp|P62857|RS28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:267	ms_run[2]:scan=4644	27.489	2	1108.4734	1108.4734	R	S	32	41
PSM	VGGEAAAAVEELVSGVR	3819	sp|Q96HQ2-2|C2AIL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	17-UNIMOD:267	ms_run[2]:scan=12740	74.46	3	1622.8503	1622.8503	M	Q	2	19
PSM	VGINYQPPTVVPGGDLAK	3820	sp|P68366-2|TBA4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	18-UNIMOD:188	ms_run[2]:scan=8953	50.774	3	1829.9983	1829.9983	K	V	338	356
PSM	VIDDTNITR	3821	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=2774	18.09	2	1045.5404	1045.5404	K	L	188	197
PSM	VLEGMEVVR	3822	sp|P23284|PPIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:267	ms_run[2]:scan=6087	35.032	2	1040.5564	1040.5564	K	K	172	181
PSM	VLENAEGAR	3823	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=1064	9.4145	2	957.48796	957.4880	K	T	77	86
PSM	VLTVINQTQK	3824	sp|P42766|RL35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:188	ms_run[2]:scan=3804	23.236	2	1148.6861	1148.6861	R	E	57	67
PSM	VQENCIDLVGR	3825	sp|O75533|SF3B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	5-UNIMOD:4,11-UNIMOD:267	ms_run[2]:scan=5763	33.345	2	1311.6481	1311.6481	K	I	1031	1042
PSM	VSASPLLYTLIEK	3826	sp|P02786|TFR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	13-UNIMOD:188	ms_run[2]:scan=12204	70.991	2	1438.8379	1438.8379	K	T	496	509
PSM	VSEQGLIEILK	3827	sp|O14737|PDCD5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:188	ms_run[2]:scan=10572	60.601	2	1233.7276	1233.7276	K	K	87	98
PSM	VSGGLEVLAEK	3828	sp|P39687|AN32A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6376	36.56	2	1100.6077	1100.6077	R	C	76	87
PSM	VTYTPMAPGSYLISIK	3829	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	16-UNIMOD:188	ms_run[2]:scan=11484	66.298	2	1745.9369	1745.9369	R	Y	2477	2493
PSM	VVGSEFVQK	3830	sp|P43686-2|PRS6B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3742	22.928	2	991.53385	991.5338	R	Y	199	208
PSM	WTLLQEQGTK	3831	sp|P13647|K2C5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:188	ms_run[2]:scan=7140	40.58	2	1208.6497	1208.6497	K	T	200	210
PSM	YAVLYQPLFDK	3832	sp|P55209-3|NP1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=10537	60.375	2	1355.7125	1355.7125	K	E	65	76
PSM	YGEPSEVFINR	3833	sp|Q8WXF1-2|PSPC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:267	ms_run[2]:scan=6773	38.663	2	1319.6385	1319.6385	R	D	105	116
PSM	YIANTVELR	3834	sp|P04844-2|RPN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:267	ms_run[2]:scan=5321	31.167	2	1087.5901	1087.5901	R	V	326	335
PSM	YLVLDEADR	3835	sp|O00571-2|DDX3X_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6415	36.779	2	1092.5451	1092.5451	K	M	327	336
PSM	YYLAPKIEDEEGS	3836	sp|P12004|PCNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6711	38.323	2	1512.6984	1512.6984	K	-	249	262
PSM	QTLSIYQALKK	3837	sp|Q15149|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28,10-UNIMOD:188,11-UNIMOD:188	ms_run[1]:scan=9377	53.28279666666667	2	1286.7632	1286.7632	R	G	3839	3850
PSM	QCLPSLDLSCK	3838	sp|P78527|PRKDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	2-UNIMOD:4,10-UNIMOD:4,11-UNIMOD:188	ms_run[1]:scan=7792	44.371315	2	1326.653567	1325.641487	R	Q	1498	1509
PSM	FDQLLAEEK	3839	sp|P35580|MYH10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	9-UNIMOD:188	ms_run[1]:scan=5614	32.59405666666667	2	1097.558446	1097.570019	K	S	1453	1462
PSM	VCDIAAELAR	3840	sp|O00410|IPO5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	2-UNIMOD:4	ms_run[1]:scan=6972	39.73596	2	1117.574956	1116.559744	K	N	109	119
PSM	GYSFTTTAER	3841	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	10-UNIMOD:267	ms_run[1]:scan=4227	25.3467	2	1141.526761	1141.527922	R	E	197	207
PSM	SYELPDGQVITIGNER	3842	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	16-UNIMOD:267	ms_run[1]:scan=12148	70.61421166666668	2	1800.899168	1799.892912	K	F	241	257
PSM	SYELPDGQVITIGNER	3843	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=13277	77.99008666666667	2	1789.878533	1789.884643	K	F	241	257
PSM	IDHTSRTLSFGSDLNYATR	3844	sp|Q14152|EIF3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:267	ms_run[1]:scan=8633	49.002995	3	2164.040978	2163.058414	R	E	484	503
PSM	GVDEVTIVNILTNR	3845	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	14-UNIMOD:267	ms_run[1]:scan=13370	78.59308666666666	2	1551.849488	1551.849591	K	S	50	64
PSM	QSLGELIGTLNAAK	3846	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28	ms_run[1]:scan=13896	82.27197333333332	2	1396.7541	1396.7557	K	V	57	71
PSM	TAVCDIPPR	3847	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:4,9-UNIMOD:267	ms_run[1]:scan=3548	21.907366666666665	2	1037.519732	1037.520334	K	G	351	360
PSM	TAVCDIPPR	3848	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:4	ms_run[1]:scan=2888	18.655708333333333	2	1027.515146	1027.512065	K	G	351	360
PSM	TAVCDIPPR	3849	sp|P68371|TBB4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	4-UNIMOD:4	ms_run[1]:scan=3550	21.914920000000002	2	1027.5096	1027.5115	K	G	351	360
PSM	QIWQNLGLDDTK	3850	sp|P49588|SYAC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	12-UNIMOD:188	ms_run[1]:scan=9462	53.766481666666664	2	1436.749402	1435.740273	K	I	154	166
PSM	ACANPAAGSVILLENLR	3851	sp|P00558|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	2-UNIMOD:4,17-UNIMOD:267	ms_run[1]:scan=12539	73.15121333333333	2	1778.973321	1777.938423	K	F	107	124
PSM	ASCLYGQLPK	3852	sp|P09211|GSTP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:4,10-UNIMOD:188	ms_run[1]:scan=5699	33.02488333333333	2	1141.578329	1141.589709	K	F	46	56
PSM	LQSSSASYGGGFGGGSCQLGGGR	3853	sp|P13646|K1C13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	17-UNIMOD:4,23-UNIMOD:267	ms_run[1]:scan=5900	34.04815333333333	3	2155.954623	2155.958048	R	G	5	28
PSM	ALYETELADAR	3854	sp|P20700|LMNB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=6401	36.701775	2	1250.623801	1250.614282	K	R	80	91
PSM	QLICDPSYVKDR	3855	sp|P50395|GDIB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28,4-UNIMOD:4	ms_run[1]:scan=7166	40.71989833333333	2	1475.7044	1475.7073	K	V	279	291
PSM	QVDQLTNDKAR	3856	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28	ms_run[1]:scan=3688	22.635883333333336	2	1269.6283	1269.6308	R	V	160	171
PSM	QVDQLTNDKAR	3857	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28,9-UNIMOD:188,11-UNIMOD:267	ms_run[1]:scan=3696	22.68057166666667	2	1285.6562	1285.6592	R	V	160	171
PSM	IQEENVIPR	3858	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=4507	26.788956666666664	2	1096.588775	1096.587673	K	E	981	990
PSM	GSPLVVISQGK	3859	sp|Q16555|DPYL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	11-UNIMOD:188	ms_run[1]:scan=6014	34.63645	2	1089.648248	1089.648938	R	I	441	452
PSM	AISSTEAVLNNR	3860	sp|Q5T8P6|RBM26_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	12-UNIMOD:267	ms_run[1]:scan=4468	26.575788333333335	2	1284.677630	1283.670898	K	F	586	598
PSM	ATENDIANFFSPLNPIR	3861	sp|P31942|HNRH3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=13848	81.89147	2	1918.943864	1917.958477	R	V	206	223
PSM	QAWQKADINTK	3862	sp|P50914|RL14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28	ms_run[1]:scan=4991	29.505378333333333	2	1284.6447	1284.6457	R	W	75	86
PSM	VGSGDTNNFPYLEK	3863	sp|Q9NR45|SIAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	14-UNIMOD:188	ms_run[1]:scan=7567	43.126846666666665	2	1545.733538	1545.740667	K	T	132	146
PSM	YCTDTGVLFR	3864	sp|P12955|PEPD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	2-UNIMOD:4,10-UNIMOD:267	ms_run[1]:scan=7416	42.23068166666666	2	1240.585210	1240.578578	R	Q	57	67
PSM	QSSSSRDDNMFQIGK	3865	sp|P53999|TCP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28,10-UNIMOD:35	ms_run[1]:scan=4449	26.47378333333333	2	1697.7300	1697.7310	K	M	54	69
PSM	QLDDLKVELSQLR	3866	sp|P42766|RL35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28,6-UNIMOD:188,13-UNIMOD:267	ms_run[1]:scan=12511	72.97086999999999	2	1554.8583	1554.8583	K	V	20	33
PSM	ISGLIYEETR	3867	sp|P62805|H4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	10-UNIMOD:267	ms_run[1]:scan=6563	37.591163333333334	2	1189.620113	1189.621822	R	G	47	57
PSM	TEFLSFMNTELAAFTK	3868	sp|P31949|S10AB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	16-UNIMOD:188	ms_run[1]:scan=14756	91.25482666666667	2	1855.922581	1854.916917	K	N	37	53
PSM	QFEDELHPDLK	3869	sp|Q9Y3C6|PPIL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28	ms_run[1]:scan=8684	49.2843	2	1352.6236	1352.6243	K	F	81	92
PSM	QSGGTTALPLYFVGLYCDKK	3870	sp|Q9H9J2|RM44_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28,17-UNIMOD:4,19-UNIMOD:188,20-UNIMOD:188	ms_run[1]:scan=13793	81.43525166666667	2	2212.1277	2212.1272	R	L	260	280
PSM	YITQNGDYQLR	3871	sp|Q9BXS5|AP1M1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=5103	30.08090333333333	2	1371.650529	1369.662629	R	T	411	422
PSM	CLEKVDAFEER	3872	sp|P51580|TPMT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:385,1-UNIMOD:4,4-UNIMOD:188,11-UNIMOD:267	ms_run[1]:scan=9378	53.28819833333333	2	1393.6534	1393.6513	R	H	216	227
PSM	LEALDANSR	3873	sp|P09496|CLCA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=2547	16.870398333333334	2	987.504099	987.498523	R	K	121	130
PSM	NQDEQEIPFR	3874	sp|Q6PK04|CC137_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=5524	32.165295	2	1275.609443	1274.589129	K	L	57	67
PSM	VLIEGSINSVR	3875	sp|P59998|ARPC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	11-UNIMOD:267	ms_run[1]:scan=6407	36.73471333333334	2	1195.674809	1195.680006	K	V	61	72
PSM	SSVPLYLIYPSVENVR	3876	sp|Q9NUW8|TYDP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=12227	71.14232333333332	2	1834.984110	1834.982900	K	T	433	449
PSM	ADANNQTTEPQLKK	3877	sp|P19878|NCF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0		ms_run[1]:scan=8267	47.003615	2	1558.7662	1556.7792	K	G	445	459
PSM	LGTDEISPR	3878	sp|O00159|MYO1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=3151	19.948883333333335	2	987.500622	986.503275	R	V	901	910
PSM	TAVCDIPPR	3879	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:4	ms_run[1]:scan=2464	16.47012	2	1030.542166	1027.512065	K	G	351	360
PSM	LGDDIDLIVR	3880	sp|O15371|EIF3D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=9318	52.950916666666664	2	1127.620209	1127.618639	K	C	365	375
PSM	ALALLEDEER	3881	sp|A0FGR8|ESYT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=7320	41.679273333333335	2	1159.608414	1157.592818	R	V	163	173
PSM	LGTPELSTAER	3882	sp|Q13085|ACACA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	11-UNIMOD:267	ms_run[1]:scan=4555	27.03987	2	1182.611528	1182.611986	R	K	2151	2162
PSM	QDLLFLDMLK	3883	sp|Q13315|ATM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	8-UNIMOD:35	ms_run[1]:scan=10762	61.78941	2	1250.656794	1250.658061	K	F	893	903
PSM	LGDASIAAPFTSK	3884	sp|Q9HD20|AT131_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=7685	43.79537666666667	2	1276.669916	1276.666317	K	L	951	964
PSM	EILNLTSELLQK	3885	sp|Q86TU7|SETD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=11565	66.79727166666667	2	1400.768044	1399.792246	K	C	24	36
PSM	EGDPLVFATVGSNR	3886	sp|O75530|EED_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=8819	49.99561833333333	2	1460.725877	1460.725957	K	V	107	121
PSM	MRQIASNSPGSSPK	3887	sp|Q9C0D5|TANC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:35	ms_run[1]:scan=9192	52.23509666666667	2	1474.712905	1474.719826	R	T	437	451
PSM	TVQSLEIDLDSMR	3888	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	13-UNIMOD:267	ms_run[1]:scan=10346	59.147040000000004	2	1515.747060	1515.747828	R	N	302	315
PSM	TLQVSPLDNGDLIR	3889	sp|P29350|PTN6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=9329	53.007490000000004	2	1539.828053	1539.825671	R	E	394	408
PSM	KYNCIGHYLQDLK	3890	sp|Q8IWY8-3|ZSC29_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:188,4-UNIMOD:4	ms_run[1]:scan=9807	55.68806333333333	2	1656.815529	1656.838941	R	G	512	525
PSM	GIYQSLEGAVQAGQLK	3891	sp|Q15149|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=10770	61.83555666666666	2	1663.884699	1660.878435	K	V	478	494
PSM	FQVIATDDYGKGLSGK	3892	sp|Q96QU1|PCD15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	11-UNIMOD:188	ms_run[1]:scan=12575	73.38424666666667	2	1704.875717	1703.882580	K	A	1220	1236
PSM	RMALENYLAALQSDPPR	3893	sp|Q06481|APLP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=10579	60.64502333333333	2	1943.967382	1943.988731	R	P	469	486
PSM	MQASADQVERDILETQK	3894	sp|A8MZ36|EVPLL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=10192	58.06596166666667	2	1960.990838	1960.952405	-	R	1	18
PSM	EFERLIHCYDEEVVK	3895	sp|Q9UPT6|JIP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:267,8-UNIMOD:4	ms_run[1]:scan=12767	74.63548666666667	2	1974.941195	1974.938482	R	E	39	54