MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000208 -- new
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220618\20220618002634800212^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\111222_HL03.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220618\20220618002634800212^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\111222_HL03.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Acetyl (Protein N-term),Label:13C(6) (K),Label:13C(6)15N(4) (R),Oxidation (M)
MTD	software[1]-setting	maxMissedCleavages=1
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=40
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Label:13C(6) (K),Label:13C(6)15N(4) (R),Acetyl (Protein N-term)
MTD	software[2]-setting	TOL(-)=20
MTD	software[2]-setting	TOL(+)=20
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=1000
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=1
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Acetyl (Protein N-term),Label:13C(6) (K),Label:13C(6)15N(4) (R),Oxidation (M)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=1
MTD	software[3]-setting	peptide_mass_tolerance=20
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:1, Acetyl,]
MTD	variable_mod[1]-site	N-term
MTD	variable_mod[1]-position	Protein N-term
MTD	variable_mod[2]	[UNIMOD, UNIMOD:188, Label:13C(6),]
MTD	variable_mod[2]-site	K
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:267, Label:13C(6)15N(4),]
MTD	variable_mod[3]-site	R
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[4]-site	M
MTD	variable_mod[4]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q12962|TAF10_HUMAN	Transcription initiation factor TFIID subunit 10 OS=Homo sapiens OX=9606 GN=TAF10 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	56.0	null	67-UNIMOD:267	0.12	56.0	2	1	0
PRT	sp|Q96K37|S35E1_HUMAN	Solute carrier family 35 member E1 OS=Homo sapiens OX=9606 GN=SLC35E1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	null	2-UNIMOD:1	0.06	51.0	1	1	1
PRT	sp|O14579-3|COPE_HUMAN	Isoform 3 of Coatomer subunit epsilon OS=Homo sapiens OX=9606 GN=COPE	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	null	23-UNIMOD:188	0.09	51.0	2	1	0
PRT	sp|Q15056-2|IF4H_HUMAN	Isoform Short of Eukaryotic translation initiation factor 4H OS=Homo sapiens OX=9606 GN=EIF4H	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	null	217-UNIMOD:267	0.10	50.0	3	1	0
PRT	sp|Q969Y2-3|GTPB3_HUMAN	Isoform 3 of tRNA modification GTPase GTPBP3, mitochondrial OS=Homo sapiens OX=9606 GN=GTPBP3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null	45-UNIMOD:267	0.05	49.0	2	1	0
PRT	sp|Q9UHB9-4|SRP68_HUMAN	Isoform 4 of Signal recognition particle subunit SRP68 OS=Homo sapiens OX=9606 GN=SRP68	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	31-UNIMOD:267	0.05	47.0	1	1	0
PRT	sp|P62829|RL23_HUMAN	60S ribosomal protein L23 OS=Homo sapiens OX=9606 GN=RPL23 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	28-UNIMOD:4,35-UNIMOD:188	0.15	46.0	3	1	0
PRT	sp|P68363-2|TBA1B_HUMAN	Isoform 2 of Tubulin alpha-1B chain OS=Homo sapiens OX=9606 GN=TUBA1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	60-UNIMOD:188,254-UNIMOD:188,231-UNIMOD:4,236-UNIMOD:188,79-UNIMOD:267,199-UNIMOD:4,200-UNIMOD:4,204-UNIMOD:267	0.24	46.0	12	5	1
PRT	sp|Q96C90|PP14B_HUMAN	Protein phosphatase 1 regulatory subunit 14B OS=Homo sapiens OX=9606 GN=PPP1R14B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.17	46.0	1	1	1
PRT	sp|P16403|H12_HUMAN	Histone H1.2 OS=Homo sapiens OX=9606 GN=H1-2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	2-UNIMOD:1,17-UNIMOD:188,21-UNIMOD:188	0.10	45.0	2	1	0
PRT	sp|P09382|LEG1_HUMAN	Galectin-1 OS=Homo sapiens OX=9606 GN=LGALS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	2-UNIMOD:1,3-UNIMOD:4,17-UNIMOD:4	0.14	44.0	2	1	0
PRT	sp|Q6EEV4-2|GL1AD_HUMAN	Isoform 5 of DNA-directed RNA polymerase II subunit GRINL1A, isoforms 4/5 OS=Homo sapiens OX=9606 GN=POLR2M	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.29	44.0	1	1	1
PRT	sp|P31937|3HIDH_HUMAN	3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=HIBADH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	150-UNIMOD:35,167-UNIMOD:267	0.06	43.0	2	1	0
PRT	sp|Q9Y6M9|NDUB9_HUMAN	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 OS=Homo sapiens OX=9606 GN=NDUFB9 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	null	75-UNIMOD:28,93-UNIMOD:267	0.11	43.0	2	1	0
PRT	sp|Q9H0B6-2|KLC2_HUMAN	Isoform 2 of Kinesin light chain 2 OS=Homo sapiens OX=9606 GN=KLC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.04	42.0	1	1	1
PRT	sp|P52209-2|6PGD_HUMAN	Isoform 2 of 6-phosphogluconate dehydrogenase, decarboxylating OS=Homo sapiens OX=9606 GN=PGD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	123-UNIMOD:267	0.04	42.0	2	1	0
PRT	sp|O75083|WDR1_HUMAN	WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=WDR1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	170-UNIMOD:4,180-UNIMOD:188	0.03	42.0	6	1	0
PRT	sp|Q9UK76-3|JUPI1_HUMAN	Isoform 3 of Jupiter microtubule associated homolog 1 OS=Homo sapiens OX=9606 GN=JPT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	1-UNIMOD:35,18-UNIMOD:188	0.18	42.0	2	1	0
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	42.0	null	1423-UNIMOD:267,1828-UNIMOD:385,1828-UNIMOD:4,1841-UNIMOD:267,310-UNIMOD:267,384-UNIMOD:267,2220-UNIMOD:267,212-UNIMOD:4,835-UNIMOD:188,205-UNIMOD:35,213-UNIMOD:188	0.04	42.0	14	7	3
PRT	sp|P09211|GSTP1_HUMAN	Glutathione S-transferase P OS=Homo sapiens OX=9606 GN=GSTP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null	71-UNIMOD:267,209-UNIMOD:188	0.23	41.0	8	4	2
PRT	sp|P62701|RS4X_HUMAN	40S ribosomal protein S4, X isoform OS=Homo sapiens OX=9606 GN=RPS4X PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	181-UNIMOD:4,191-UNIMOD:267,182-UNIMOD:35,230-UNIMOD:188	0.11	41.0	7	2	0
PRT	sp|P63244|RACK1_HUMAN	Receptor of activated protein C kinase 1 OS=Homo sapiens OX=9606 GN=RACK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null	168-UNIMOD:4,172-UNIMOD:188,249-UNIMOD:4,99-UNIMOD:267,257-UNIMOD:188	0.14	41.0	9	3	0
PRT	sp|Q9ULC4-2|MCTS1_HUMAN	Isoform 2 of Malignant T-cell-amplified sequence 1 OS=Homo sapiens OX=9606 GN=MCTS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	101-UNIMOD:4,100-UNIMOD:35,110-UNIMOD:188	0.12	41.0	2	1	0
PRT	sp|P14618|KPYM_HUMAN	Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	41.0	null	206-UNIMOD:188,224-UNIMOD:188,49-UNIMOD:4,423-UNIMOD:4,424-UNIMOD:4,433-UNIMOD:188,43-UNIMOD:267,152-UNIMOD:4,56-UNIMOD:267,162-UNIMOD:188,305-UNIMOD:188,498-UNIMOD:188	0.22	41.0	21	9	2
PRT	sp|Q13085|ACACA_HUMAN	Acetyl-CoA carboxylase 1 OS=Homo sapiens OX=9606 GN=ACACA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	1-UNIMOD:1,18-UNIMOD:267,335-UNIMOD:267	0.01	41.0	3	2	1
PRT	sp|Q9Y5U9|IR3IP_HUMAN	Immediate early response 3-interacting protein 1 OS=Homo sapiens OX=9606 GN=IER3IP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.26	41.0	1	1	1
PRT	sp|Q32MZ4-4|LRRF1_HUMAN	Isoform 4 of Leucine-rich repeat flightless-interacting protein 1 OS=Homo sapiens OX=9606 GN=LRRFIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	245-UNIMOD:267	0.03	41.0	2	1	0
PRT	sp|Q96IJ6|GMPPA_HUMAN	Mannose-1-phosphate guanyltransferase alpha OS=Homo sapiens OX=9606 GN=GMPPA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	309-UNIMOD:188	0.09	41.0	3	2	1
PRT	sp|P60602-2|ROMO1_HUMAN	Isoform 2 of Reactive oxygen species modulator 1 OS=Homo sapiens OX=9606 GN=ROMO1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	15-UNIMOD:4,18-UNIMOD:267	0.31	41.0	2	1	0
PRT	sp|O75369-6|FLNB_HUMAN	Isoform 6 of Filamin-B OS=Homo sapiens OX=9606 GN=FLNB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	450-UNIMOD:4,455-UNIMOD:4,456-UNIMOD:267,551-UNIMOD:188,2154-UNIMOD:267,549-UNIMOD:35,894-UNIMOD:188,49-UNIMOD:267,691-UNIMOD:267,2004-UNIMOD:267,991-UNIMOD:4,999-UNIMOD:267	0.05	41.0	14	8	4
PRT	sp|P51991-2|ROA3_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.06	41.0	1	1	1
PRT	sp|P40925-2|MDHC_HUMAN	Isoform 2 of Malate dehydrogenase, cytoplasmic OS=Homo sapiens OX=9606 GN=MDH1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	48-UNIMOD:4,53-UNIMOD:188,221-UNIMOD:267	0.13	41.0	4	2	0
PRT	sp|Q8IZ83-3|A16A1_HUMAN	Isoform 3 of Aldehyde dehydrogenase family 16 member A1 OS=Homo sapiens OX=9606 GN=ALDH16A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	738-UNIMOD:267	0.02	40.0	2	1	0
PRT	sp|P29401|TKT_HUMAN	Transketolase OS=Homo sapiens OX=9606 GN=TKT PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	302-UNIMOD:267	0.03	40.0	1	1	1
PRT	sp|O43707|ACTN4_HUMAN	Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	40.0	null	883-UNIMOD:35,899-UNIMOD:188,668-UNIMOD:188,757-UNIMOD:267,653-UNIMOD:28,879-UNIMOD:4,882-UNIMOD:267,771-UNIMOD:267	0.08	40.0	12	5	0
PRT	sp|Q07021|C1QBP_HUMAN	Complement component 1 Q subcomponent-binding protein, mitochondrial OS=Homo sapiens OX=9606 GN=C1QBP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	105-UNIMOD:35,119-UNIMOD:188	0.06	40.0	2	1	0
PRT	sp|P55072|TERA_HUMAN	Transitional endoplasmic reticulum ATPase OS=Homo sapiens OX=9606 GN=VCP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	678-UNIMOD:35,691-UNIMOD:4,693-UNIMOD:267,105-UNIMOD:4,109-UNIMOD:188,651-UNIMOD:188	0.06	40.0	5	3	1
PRT	sp|Q96GD0|PLPP_HUMAN	Pyridoxal phosphate phosphatase OS=Homo sapiens OX=9606 GN=PDXP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	206-UNIMOD:267	0.06	40.0	3	1	0
PRT	sp|Q96PD2|DCBD2_HUMAN	Discoidin, CUB and LCCL domain-containing protein 2 OS=Homo sapiens OX=9606 GN=DCBLD2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	721-UNIMOD:267	0.03	39.0	2	1	0
PRT	sp|P46781|RS9_HUMAN	40S ribosomal protein S9 OS=Homo sapiens OX=9606 GN=RPS9 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null	180-UNIMOD:188	0.08	39.0	3	1	0
PRT	sp|P54578-2|UBP14_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 14 OS=Homo sapiens OX=9606 GN=USP14	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	189-UNIMOD:188,203-UNIMOD:188,43-UNIMOD:267	0.08	39.0	3	2	1
PRT	sp|Q8TEX9|IPO4_HUMAN	Importin-4 OS=Homo sapiens OX=9606 GN=IPO4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	916-UNIMOD:267	0.02	39.0	2	1	0
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	284-UNIMOD:267,360-UNIMOD:267,99-UNIMOD:267,405-UNIMOD:267	0.11	39.0	9	5	1
PRT	sp|P07108|ACBP_HUMAN	Acyl-CoA-binding protein OS=Homo sapiens OX=9606 GN=DBI PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	39.0	null	34-UNIMOD:28,2-UNIMOD:1	0.40	39.0	2	2	2
PRT	sp|P05388-2|RLA0_HUMAN	Isoform 2 of 60S acidic ribosomal protein P0 OS=Homo sapiens OX=9606 GN=RPLP0	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	119-UNIMOD:4,134-UNIMOD:188,27-UNIMOD:4,146-UNIMOD:188,38-UNIMOD:188	0.19	38.0	7	3	0
PRT	sp|P40939|ECHA_HUMAN	Trifunctional enzyme subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=HADHA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	625-UNIMOD:188,622-UNIMOD:35	0.02	38.0	4	1	0
PRT	sp|Q9UJU6-5|DBNL_HUMAN	Isoform 5 of Drebrin-like protein OS=Homo sapiens OX=9606 GN=DBNL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.05	38.0	1	1	1
PRT	sp|P00505-2|AATM_HUMAN	Isoform 2 of Aspartate aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=GOT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	96-UNIMOD:267	0.04	38.0	2	1	0
PRT	sp|Q96EP0-3|RNF31_HUMAN	Isoform 3 of E3 ubiquitin-protein ligase RNF31 OS=Homo sapiens OX=9606 GN=RNF31	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.02	38.0	1	1	1
PRT	sp|Q9UJS0|CMC2_HUMAN	Calcium-binding mitochondrial carrier protein Aralar2 OS=Homo sapiens OX=9606 GN=SLC25A13 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null	310-UNIMOD:267,56-UNIMOD:188,467-UNIMOD:267	0.07	38.0	7	3	0
PRT	sp|O15347|HMGB3_HUMAN	High mobility group protein B3 OS=Homo sapiens OX=9606 GN=HMGB3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.12	38.0	1	1	1
PRT	sp|Q3LXA3|TKFC_HUMAN	Triokinase/FMN cyclase OS=Homo sapiens OX=9606 GN=TKFC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	567-UNIMOD:267	0.05	38.0	4	2	1
PRT	sp|P07195|LDHB_HUMAN	L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	38.0	null	23-UNIMOD:188,164-UNIMOD:4,100-UNIMOD:267	0.12	38.0	4	3	1
PRT	sp|Q15149|PLEC_HUMAN	Plectin OS=Homo sapiens OX=9606 GN=PLEC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	38.0	null	2808-UNIMOD:267,2359-UNIMOD:28,2360-UNIMOD:267,2371-UNIMOD:267,4245-UNIMOD:4,4254-UNIMOD:4,4259-UNIMOD:188,3804-UNIMOD:267,3127-UNIMOD:267,2172-UNIMOD:28,2182-UNIMOD:188,2183-UNIMOD:267,4245-UNIMOD:385,1984-UNIMOD:267,1563-UNIMOD:267,410-UNIMOD:267,316-UNIMOD:267,2348-UNIMOD:267,3384-UNIMOD:188,3295-UNIMOD:4,3297-UNIMOD:267	0.04	38.0	23	15	8
PRT	sp|P30520|PURA2_HUMAN	Adenylosuccinate synthetase isozyme 2 OS=Homo sapiens OX=9606 GN=ADSS2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	181-UNIMOD:35,182-UNIMOD:4,194-UNIMOD:267,2-UNIMOD:1,18-UNIMOD:4	0.08	38.0	3	2	1
PRT	sp|Q99961|SH3G1_HUMAN	Endophilin-A2 OS=Homo sapiens OX=9606 GN=SH3GL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	96-UNIMOD:4,99-UNIMOD:267,147-UNIMOD:4	0.09	38.0	2	2	2
PRT	sp|P16402|H13_HUMAN	Histone H1.3 OS=Homo sapiens OX=9606 GN=H1-3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	2-UNIMOD:1,17-UNIMOD:188,21-UNIMOD:188	0.10	38.0	1	1	1
PRT	sp|Q92804-2|RBP56_HUMAN	Isoform Short of TATA-binding protein-associated factor 2N OS=Homo sapiens OX=9606 GN=TAF15	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	357-UNIMOD:4,362-UNIMOD:4,369-UNIMOD:267	0.03	38.0	2	1	0
PRT	sp|Q15393|SF3B3_HUMAN	Splicing factor 3B subunit 3 OS=Homo sapiens OX=9606 GN=SF3B3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	958-UNIMOD:267,690-UNIMOD:267,268-UNIMOD:267	0.03	38.0	5	3	1
PRT	sp|P61604|CH10_HUMAN	10 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPE1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	54-UNIMOD:188,80-UNIMOD:188	0.25	38.0	3	2	1
PRT	sp|Q9UBT2|SAE2_HUMAN	SUMO-activating enzyme subunit 2 OS=Homo sapiens OX=9606 GN=UBA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	30-UNIMOD:4,34-UNIMOD:188	0.03	38.0	2	1	0
PRT	sp|P07339|CATD_HUMAN	Cathepsin D OS=Homo sapiens OX=9606 GN=CTSD PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	null	177-UNIMOD:28,184-UNIMOD:188,194-UNIMOD:188	0.05	38.0	2	1	0
PRT	sp|P00558|PGK1_HUMAN	Phosphoglycerate kinase 1 OS=Homo sapiens OX=9606 GN=PGK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	108-UNIMOD:4,367-UNIMOD:4,379-UNIMOD:4,380-UNIMOD:4,382-UNIMOD:188,123-UNIMOD:267	0.09	37.0	5	2	0
PRT	sp|P10253|LYAG_HUMAN	Lysosomal alpha-glucosidase OS=Homo sapiens OX=9606 GN=GAA PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.02	37.0	1	1	1
PRT	sp|P43243-2|MATR3_HUMAN	Isoform 2 of Matrin-3 OS=Homo sapiens OX=9606 GN=MATR3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	510-UNIMOD:188	0.03	37.0	3	1	0
PRT	sp|P04406-2|G3P_HUMAN	Isoform 2 of Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	110-UNIMOD:4,114-UNIMOD:4,120-UNIMOD:188,281-UNIMOD:267,173-UNIMOD:188,205-UNIMOD:4,206-UNIMOD:267	0.22	37.0	9	4	0
PRT	sp|Q9Y6G9|DC1L1_HUMAN	Cytoplasmic dynein 1 light intermediate chain 1 OS=Homo sapiens OX=9606 GN=DYNC1LI1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	505-UNIMOD:188	0.04	37.0	2	1	0
PRT	sp|Q9UI10-3|EI2BD_HUMAN	Isoform 3 of Translation initiation factor eIF-2B subunit delta OS=Homo sapiens OX=9606 GN=EIF2B4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	224-UNIMOD:267,353-UNIMOD:267	0.05	37.0	4	2	0
PRT	sp|Q1KMD3|HNRL2_HUMAN	Heterogeneous nuclear ribonucleoprotein U-like protein 2 OS=Homo sapiens OX=9606 GN=HNRNPUL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	538-UNIMOD:4,546-UNIMOD:267	0.02	37.0	2	1	0
PRT	sp|Q00839-2|HNRPU_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	246-UNIMOD:188,414-UNIMOD:188	0.05	37.0	3	3	2
PRT	sp|P31939-2|PUR9_HUMAN	Isoform 2 of Bifunctional purine biosynthesis protein PURH OS=Homo sapiens OX=9606 GN=ATIC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	38-UNIMOD:188,450-UNIMOD:267	0.06	37.0	4	2	0
PRT	sp|P51610-2|HCFC1_HUMAN	Isoform 2 of Host cell factor 1 OS=Homo sapiens OX=9606 GN=HCFC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	613-UNIMOD:188	0.01	37.0	2	1	0
PRT	sp|P02545|LMNA_HUMAN	Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	37.0	null	644-UNIMOD:267,472-UNIMOD:28,482-UNIMOD:267,486-UNIMOD:188,541-UNIMOD:267,249-UNIMOD:267	0.09	37.0	21	4	1
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	254-UNIMOD:267,28-UNIMOD:267,206-UNIMOD:267	0.10	37.0	5	3	1
PRT	sp|O00410-2|IPO5_HUMAN	Isoform 2 of Importin-5 OS=Homo sapiens OX=9606 GN=IPO5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	397-UNIMOD:267,673-UNIMOD:4	0.03	37.0	5	2	1
PRT	sp|Q8TD30-2|ALAT2_HUMAN	Isoform 2 of Alanine aminotransferase 2 OS=Homo sapiens OX=9606 GN=GPT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	165-UNIMOD:4,179-UNIMOD:267	0.04	37.0	2	1	0
PRT	sp|P84098|RL19_HUMAN	60S ribosomal protein L19 OS=Homo sapiens OX=9606 GN=RPL19 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	38-UNIMOD:267	0.09	37.0	2	1	0
PRT	sp|P78406|RAE1L_HUMAN	mRNA export factor OS=Homo sapiens OX=9606 GN=RAE1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	37.0	null	225-UNIMOD:28,205-UNIMOD:267,227-UNIMOD:188,239-UNIMOD:267,68-UNIMOD:4,80-UNIMOD:188,172-UNIMOD:267	0.16	37.0	6	4	2
PRT	sp|P13647|K2C5_HUMAN	Keratin, type II cytoskeletal 5 OS=Homo sapiens OX=9606 GN=KRT5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	576-UNIMOD:188,55-UNIMOD:4,63-UNIMOD:267,84-UNIMOD:267,255-UNIMOD:188,209-UNIMOD:188	0.12	36.0	6	5	4
PRT	sp|P09651-3|ROA1_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	140-UNIMOD:267	0.10	36.0	3	2	1
PRT	sp|P46087-3|NOP2_HUMAN	Isoform 3 of Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase OS=Homo sapiens OX=9606 GN=NOP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	549-UNIMOD:267,388-UNIMOD:4,389-UNIMOD:4,394-UNIMOD:188	0.04	36.0	4	2	0
PRT	sp|Q13418-3|ILK_HUMAN	Isoform 3 of Integrin-linked protein kinase OS=Homo sapiens OX=9606 GN=ILK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.05	36.0	1	1	1
PRT	sp|P05023-3|AT1A1_HUMAN	Isoform 3 of Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	218-UNIMOD:4,224-UNIMOD:267,209-UNIMOD:267,456-UNIMOD:188,60-UNIMOD:188,627-UNIMOD:267	0.08	36.0	12	6	2
PRT	sp|P55060-4|XPO2_HUMAN	Isoform 4 of Exportin-2 OS=Homo sapiens OX=9606 GN=CSE1L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	288-UNIMOD:4,290-UNIMOD:188	0.02	36.0	2	1	0
PRT	sp|Q02218-3|ODO1_HUMAN	Isoform 3 of 2-oxoglutarate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=OGDH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	101-UNIMOD:267	0.05	36.0	1	1	1
PRT	sp|O95071-2|UBR5_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase UBR5 OS=Homo sapiens OX=9606 GN=UBR5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	813-UNIMOD:267	0.01	36.0	2	1	0
PRT	sp|O75886-2|STAM2_HUMAN	Isoform 2 of Signal transducing adapter molecule 2 OS=Homo sapiens OX=9606 GN=STAM2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	15-UNIMOD:188	0.04	36.0	2	1	0
PRT	sp|Q99627-2|CSN8_HUMAN	Isoform 2 of COP9 signalosome complex subunit 8 OS=Homo sapiens OX=9606 GN=COPS8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	31-UNIMOD:267,111-UNIMOD:267	0.19	36.0	4	2	0
PRT	sp|P24534|EF1B_HUMAN	Elongation factor 1-beta OS=Homo sapiens OX=9606 GN=EEF1B2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	22-UNIMOD:188,176-UNIMOD:188	0.13	36.0	3	2	1
PRT	sp|Q9NPF4|OSGEP_HUMAN	Probable tRNA N6-adenosine threonylcarbamoyltransferase OS=Homo sapiens OX=9606 GN=OSGEP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	47-UNIMOD:267,13-UNIMOD:188	0.09	36.0	4	2	0
PRT	sp|P40926|MDHM_HUMAN	Malate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=MDH2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	36.0	null	229-UNIMOD:267,93-UNIMOD:4,104-UNIMOD:267,285-UNIMOD:4,212-UNIMOD:4,215-UNIMOD:188,315-UNIMOD:35,324-UNIMOD:188	0.21	36.0	14	5	1
PRT	sp|Q13011|ECH1_HUMAN	Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial OS=Homo sapiens OX=9606 GN=ECH1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	230-UNIMOD:267	0.05	36.0	2	1	0
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	357-UNIMOD:4,358-UNIMOD:188,281-UNIMOD:188	0.07	36.0	4	2	0
PRT	sp|P08727|K1C19_HUMAN	Keratin, type I cytoskeletal 19 OS=Homo sapiens OX=9606 GN=KRT19 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	24-UNIMOD:267,150-UNIMOD:267,111-UNIMOD:188	0.14	36.0	7	4	1
PRT	sp|P17301|ITA2_HUMAN	Integrin alpha-2 OS=Homo sapiens OX=9606 GN=ITGA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	null	805-UNIMOD:28	0.02	36.0	1	1	1
PRT	sp|P54577|SYYC_HUMAN	Tyrosine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=YARS1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	null	451-UNIMOD:28,470-UNIMOD:188	0.04	36.0	2	1	0
PRT	sp|P12236|ADT3_HUMAN	ADP/ATP translocase 3 OS=Homo sapiens OX=9606 GN=SLC25A6 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	23-UNIMOD:188	0.05	35.0	3	1	0
PRT	sp|Q15233-2|NONO_HUMAN	Isoform 2 of Non-POU domain-containing octamer-binding protein OS=Homo sapiens OX=9606 GN=NONO	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	180-UNIMOD:35,181-UNIMOD:267	0.04	35.0	4	1	0
PRT	sp|Q00610-2|CLH1_HUMAN	Isoform 2 of Clathrin heavy chain 1 OS=Homo sapiens OX=9606 GN=CLTC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	382-UNIMOD:188,1226-UNIMOD:267,366-UNIMOD:267,96-UNIMOD:188,95-UNIMOD:35	0.03	35.0	9	4	0
PRT	sp|P48059-3|LIMS1_HUMAN	Isoform 3 of LIM and senescent cell antigen-like-containing domain protein 1 OS=Homo sapiens OX=9606 GN=LIMS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	35.0	null	72-UNIMOD:4,74-UNIMOD:267,200-UNIMOD:385,200-UNIMOD:4,212-UNIMOD:188	0.07	35.0	3	2	1
PRT	sp|P11940-2|PABP1_HUMAN	Isoform 2 of Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	339-UNIMOD:4,348-UNIMOD:188,104-UNIMOD:188	0.07	35.0	5	3	1
PRT	sp|Q9Y3E1|HDGR3_HUMAN	Hepatoma-derived growth factor-related protein 3 OS=Homo sapiens OX=9606 GN=HDGFL3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.08	35.0	1	1	1
PRT	sp|Q5RKV6|EXOS6_HUMAN	Exosome complex component MTR3 OS=Homo sapiens OX=9606 GN=EXOSC6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	93-UNIMOD:267	0.06	35.0	2	1	0
PRT	sp|Q9Y5B9|SP16H_HUMAN	FACT complex subunit SPT16 OS=Homo sapiens OX=9606 GN=SUPT16H PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	108-UNIMOD:267,596-UNIMOD:188	0.03	35.0	3	2	1
PRT	sp|P62942|FKB1A_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Homo sapiens OX=9606 GN=FKBP1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	72-UNIMOD:267	0.14	35.0	2	1	0
PRT	sp|Q99729-3|ROAA_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein A/B OS=Homo sapiens OX=9606 GN=HNRNPAB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	169-UNIMOD:188	0.05	35.0	2	1	0
PRT	sp|Q9NP72|RAB18_HUMAN	Ras-related protein Rab-18 OS=Homo sapiens OX=9606 GN=RAB18 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	183-UNIMOD:188	0.14	35.0	3	2	1
PRT	sp|Q07020-2|RL18_HUMAN	Isoform 2 of 60S ribosomal protein L18 OS=Homo sapiens OX=9606 GN=RPL18	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	103-UNIMOD:188,105-UNIMOD:4,114-UNIMOD:267	0.16	35.0	6	2	0
PRT	sp|Q14204|DYHC1_HUMAN	Cytoplasmic dynein 1 heavy chain 1 OS=Homo sapiens OX=9606 GN=DYNC1H1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	35.0	null	2712-UNIMOD:4,2720-UNIMOD:267,4231-UNIMOD:28,3757-UNIMOD:188,3620-UNIMOD:267,4237-UNIMOD:188,4244-UNIMOD:188	0.01	35.0	8	4	1
PRT	sp|Q14974|IMB1_HUMAN	Importin subunit beta-1 OS=Homo sapiens OX=9606 GN=KPNB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	206-UNIMOD:188,54-UNIMOD:267	0.03	35.0	6	2	0
PRT	sp|P22314-2|UBA1_HUMAN	Isoform 2 of Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	344-UNIMOD:267,653-UNIMOD:267	0.05	35.0	6	3	1
PRT	sp|Q9Y5P6|GMPPB_HUMAN	Mannose-1-phosphate guanyltransferase beta OS=Homo sapiens OX=9606 GN=GMPPB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	245-UNIMOD:4,261-UNIMOD:267	0.05	35.0	2	1	0
PRT	sp|O00159-2|MYO1C_HUMAN	Isoform 2 of Unconventional myosin-Ic OS=Homo sapiens OX=9606 GN=MYO1C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	153-UNIMOD:188	0.02	35.0	4	1	0
PRT	sp|Q99832-2|TCPH_HUMAN	Isoform 2 of T-complex protein 1 subunit eta OS=Homo sapiens OX=9606 GN=CCT7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	102-UNIMOD:267	0.04	35.0	2	1	0
PRT	sp|Q9H8H3|MET7A_HUMAN	Methyltransferase-like protein 7A OS=Homo sapiens OX=9606 GN=METTL7A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	79-UNIMOD:4	0.13	35.0	2	2	2
PRT	sp|Q9Y4E1-5|WAC2C_HUMAN	Isoform 5 of WASH complex subunit 2C OS=Homo sapiens OX=9606 GN=WASHC2C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	341-UNIMOD:188	0.02	35.0	2	1	0
PRT	sp|Q15365|PCBP1_HUMAN	Poly(rC)-binding protein 1 OS=Homo sapiens OX=9606 GN=PCBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	109-UNIMOD:4,115-UNIMOD:188,54-UNIMOD:4,57-UNIMOD:267	0.08	35.0	4	2	0
PRT	sp|Q5TBC7|B2L15_HUMAN	Bcl-2-like protein 15 OS=Homo sapiens OX=9606 GN=BCL2L15 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	59-UNIMOD:35,73-UNIMOD:188	0.10	35.0	1	1	1
PRT	sp|P18206|VINC_HUMAN	Vinculin OS=Homo sapiens OX=9606 GN=VCL PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	327-UNIMOD:35,339-UNIMOD:267	0.01	35.0	2	1	0
PRT	sp|O75694-2|NU155_HUMAN	Isoform 2 of Nuclear pore complex protein Nup155 OS=Homo sapiens OX=9606 GN=NUP155	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.01	35.0	1	1	1
PRT	sp|P10412|H14_HUMAN	Histone H1.4 OS=Homo sapiens OX=9606 GN=H1-4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	2-UNIMOD:1,17-UNIMOD:188,21-UNIMOD:188	0.15	35.0	3	2	1
PRT	sp|P62195-2|PRS8_HUMAN	Isoform 2 of 26S proteasome regulatory subunit 8 OS=Homo sapiens OX=9606 GN=PSMC5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	265-UNIMOD:35,279-UNIMOD:188	0.04	35.0	2	1	0
PRT	sp|Q14676-2|MDC1_HUMAN	Isoform 2 of Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	1320-UNIMOD:267	0.01	35.0	2	1	0
PRT	sp|P25205|MCM3_HUMAN	DNA replication licensing factor MCM3 OS=Homo sapiens OX=9606 GN=MCM3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	478-UNIMOD:267,466-UNIMOD:35	0.02	35.0	4	1	0
PRT	sp|Q9Y230|RUVB2_HUMAN	RuvB-like 2 OS=Homo sapiens OX=9606 GN=RUVBL2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	269-UNIMOD:188,40-UNIMOD:267,83-UNIMOD:188	0.09	35.0	4	3	2
PRT	sp|P78344-2|IF4G2_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 4 gamma 2 OS=Homo sapiens OX=9606 GN=EIF4G2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	482-UNIMOD:188,23-UNIMOD:267	0.03	35.0	3	2	1
PRT	sp|P06576|ATPB_HUMAN	ATP synthase subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	279-UNIMOD:267,324-UNIMOD:267,155-UNIMOD:267	0.08	35.0	8	3	0
PRT	sp|P49588|SYAC_HUMAN	Alanine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=AARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	35.0	null	165-UNIMOD:188,154-UNIMOD:28	0.03	35.0	4	2	1
PRT	sp|Q9NV31|IMP3_HUMAN	U3 small nucleolar ribonucleoprotein protein IMP3 OS=Homo sapiens OX=9606 GN=IMP3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	152-UNIMOD:267	0.09	35.0	2	1	0
PRT	sp|Q9UK22|FBX2_HUMAN	F-box only protein 2 OS=Homo sapiens OX=9606 GN=FBXO2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	71-UNIMOD:4,72-UNIMOD:267	0.05	35.0	4	1	0
PRT	sp|P34932|HSP74_HUMAN	Heat shock 70 kDa protein 4 OS=Homo sapiens OX=9606 GN=HSPA4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	234-UNIMOD:267,310-UNIMOD:4,34-UNIMOD:4,38-UNIMOD:4,44-UNIMOD:188	0.05	35.0	5	3	1
PRT	sp|P33992|MCM5_HUMAN	DNA replication licensing factor MCM5 OS=Homo sapiens OX=9606 GN=MCM5 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	35.0	null	308-UNIMOD:267,482-UNIMOD:4,494-UNIMOD:267,91-UNIMOD:28,104-UNIMOD:188	0.06	35.0	5	3	1
PRT	sp|Q9UL25|RAB21_HUMAN	Ras-related protein Rab-21 OS=Homo sapiens OX=9606 GN=RAB21 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	80-UNIMOD:267	0.06	35.0	2	1	0
PRT	sp|O75369|FLNB_HUMAN	Filamin-B OS=Homo sapiens OX=9606 GN=FLNB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	894-UNIMOD:188	0.01	35.0	1	1	0
PRT	sp|Q9BZZ5|API5_HUMAN	Apoptosis inhibitor 5 OS=Homo sapiens OX=9606 GN=API5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	null	81-UNIMOD:28,84-UNIMOD:188,97-UNIMOD:267	0.03	35.0	2	1	0
PRT	sp|Q9H3U1|UN45A_HUMAN	Protein unc-45 homolog A OS=Homo sapiens OX=9606 GN=UNC45A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	707-UNIMOD:188	0.02	35.0	2	1	0
PRT	sp|Q15691|MARE1_HUMAN	Microtubule-associated protein RP/EB family member 1 OS=Homo sapiens OX=9606 GN=MAPRE1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	null	131-UNIMOD:28,148-UNIMOD:188,150-UNIMOD:188	0.08	35.0	2	1	0
PRT	sp|P08240|SRPRA_HUMAN	Signal recognition particle receptor subunit alpha OS=Homo sapiens OX=9606 GN=SRPRA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	null	416-UNIMOD:28,417-UNIMOD:267,424-UNIMOD:4,431-UNIMOD:188	0.03	35.0	1	1	1
PRT	sp|Q9UBP6|TRMB_HUMAN	tRNA (guanine-N(7)-)-methyltransferase OS=Homo sapiens OX=9606 GN=METTL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	136-UNIMOD:4,138-UNIMOD:267	0.05	34.0	2	1	0
PRT	sp|P41091|IF2G_HUMAN	Eukaryotic translation initiation factor 2 subunit 3 OS=Homo sapiens OX=9606 GN=EIF2S3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	2-UNIMOD:1,17-UNIMOD:267,434-UNIMOD:4,440-UNIMOD:188	0.07	34.0	4	2	0
PRT	sp|Q9UJZ1-2|STML2_HUMAN	Isoform 2 of Stomatin-like protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=STOML2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	292-UNIMOD:267	0.05	34.0	1	1	1
PRT	sp|P41250|GARS_HUMAN	Glycine--tRNA ligase OS=Homo sapiens OX=9606 GN=GARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	616-UNIMOD:4,628-UNIMOD:35,632-UNIMOD:188	0.02	34.0	3	1	0
PRT	sp|Q96I25|SPF45_HUMAN	Splicing factor 45 OS=Homo sapiens OX=9606 GN=RBM17 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	339-UNIMOD:4,354-UNIMOD:267	0.04	34.0	2	1	0
PRT	sp|P51149|RAB7A_HUMAN	Ras-related protein Rab-7a OS=Homo sapiens OX=9606 GN=RAB7A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	126-UNIMOD:188	0.14	34.0	6	2	1
PRT	sp|P08865|RSSA_HUMAN	40S ribosomal protein SA OS=Homo sapiens OX=9606 GN=RPSA PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	102-UNIMOD:267,163-UNIMOD:4	0.09	34.0	4	2	1
PRT	sp|A0FGR8-5|ESYT2_HUMAN	Isoform 5 of Extended synaptotagmin-2 OS=Homo sapiens OX=9606 GN=ESYT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	54-UNIMOD:188	0.04	34.0	2	1	0
PRT	sp|P29692-3|EF1D_HUMAN	Isoform 3 of Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	38-UNIMOD:267,83-UNIMOD:188,2-UNIMOD:1,10-UNIMOD:188	0.20	34.0	7	4	0
PRT	sp|Q96JY6|PDLI2_HUMAN	PDZ and LIM domain protein 2 OS=Homo sapiens OX=9606 GN=PDLIM2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	275-UNIMOD:267	0.06	34.0	1	1	1
PRT	sp|Q16822|PCKGM_HUMAN	Phosphoenolpyruvate carboxykinase [GTP], mitochondrial OS=Homo sapiens OX=9606 GN=PCK2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	45-UNIMOD:267,209-UNIMOD:188	0.05	34.0	4	2	0
PRT	sp|Q13572|ITPK1_HUMAN	Inositol-tetrakisphosphate 1-kinase OS=Homo sapiens OX=9606 GN=ITPK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	353-UNIMOD:267	0.03	34.0	1	1	1
PRT	sp|P49411|EFTU_HUMAN	Elongation factor Tu, mitochondrial OS=Homo sapiens OX=9606 GN=TUFM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	252-UNIMOD:267	0.03	34.0	2	1	0
PRT	sp|Q9H3P2|NELFA_HUMAN	Negative elongation factor A OS=Homo sapiens OX=9606 GN=NELFA PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	269-UNIMOD:267	0.03	34.0	1	1	1
PRT	sp|P07910-4|HNRPC_HUMAN	Isoform 4 of Heterogeneous nuclear ribonucleoproteins C1/C2 OS=Homo sapiens OX=9606 GN=HNRNPC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	74-UNIMOD:35,29-UNIMOD:188,89-UNIMOD:188	0.12	34.0	4	2	0
PRT	sp|P61970|NTF2_HUMAN	Nuclear transport factor 2 OS=Homo sapiens OX=9606 GN=NUTF2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	114-UNIMOD:4,120-UNIMOD:267	0.12	34.0	2	1	0
PRT	sp|P12956|XRCC6_HUMAN	X-ray repair cross-complementing protein 6 OS=Homo sapiens OX=9606 GN=XRCC6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	34.0	null	114-UNIMOD:188,389-UNIMOD:385,389-UNIMOD:4,392-UNIMOD:188,398-UNIMOD:4,399-UNIMOD:267	0.04	34.0	3	2	1
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	96-UNIMOD:188,74-UNIMOD:267,336-UNIMOD:267,60-UNIMOD:267,152-UNIMOD:188	0.10	34.0	7	5	3
PRT	sp|O14737|PDCD5_HUMAN	Programmed cell death protein 5 OS=Homo sapiens OX=9606 GN=PDCD5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	53-UNIMOD:267	0.11	34.0	2	1	0
PRT	sp|Q96CS3|FAF2_HUMAN	FAS-associated factor 2 OS=Homo sapiens OX=9606 GN=FAF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	194-UNIMOD:4,205-UNIMOD:267	0.04	34.0	2	1	0
PRT	sp|Q01581|HMCS1_HUMAN	Hydroxymethylglutaryl-CoA synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=HMGCS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	12-UNIMOD:4,15-UNIMOD:188	0.03	34.0	2	1	0
PRT	sp|Q6P2E9|EDC4_HUMAN	Enhancer of mRNA-decapping protein 4 OS=Homo sapiens OX=9606 GN=EDC4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	1130-UNIMOD:4	0.01	34.0	1	1	1
PRT	sp|Q9P0I2-2|EMC3_HUMAN	Isoform 2 of ER membrane protein complex subunit 3 OS=Homo sapiens OX=9606 GN=EMC3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	197-UNIMOD:267	0.08	34.0	2	1	0
PRT	sp|Q15717|ELAV1_HUMAN	ELAV-like protein 1 OS=Homo sapiens OX=9606 GN=ELAVL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	50-UNIMOD:188	0.04	34.0	2	1	0
PRT	sp|P32322-2|P5CR1_HUMAN	Isoform 2 of Pyrroline-5-carboxylate reductase 1, mitochondrial OS=Homo sapiens OX=9606 GN=PYCR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	262-UNIMOD:4,264-UNIMOD:267,120-UNIMOD:4	0.08	34.0	3	2	1
PRT	sp|P22695|QCR2_HUMAN	Cytochrome b-c1 complex subunit 2, mitochondrial OS=Homo sapiens OX=9606 GN=UQCRC2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.04	34.0	1	1	1
PRT	sp|Q9UNE7-2|CHIP_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase CHIP OS=Homo sapiens OX=9606 GN=STUB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	215-UNIMOD:188	0.07	34.0	2	1	0
PRT	sp|P26640|SYVC_HUMAN	Valine--tRNA ligase OS=Homo sapiens OX=9606 GN=VARS1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.01	34.0	1	1	1
PRT	sp|Q9BY77-2|PDIP3_HUMAN	Isoform 2 of Polymerase delta-interacting protein 3 OS=Homo sapiens OX=9606 GN=POLDIP3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	144-UNIMOD:188	0.05	34.0	2	1	0
PRT	sp|P04637-8|P53_HUMAN	Isoform 8 of Cellular tumor antigen p53 OS=Homo sapiens OX=9606 GN=TP53	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	9-UNIMOD:4,24-UNIMOD:267	0.09	34.0	2	1	0
PRT	sp|Q96GK7|FAH2A_HUMAN	Fumarylacetoacetate hydrolase domain-containing protein 2A OS=Homo sapiens OX=9606 GN=FAHD2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	215-UNIMOD:4,224-UNIMOD:188	0.05	34.0	2	1	0
PRT	sp|P01116-2|RASK_HUMAN	Isoform 2B of GTPase KRas OS=Homo sapiens OX=9606 GN=KRAS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	80-UNIMOD:4,88-UNIMOD:188	0.09	34.0	2	1	0
PRT	sp|P32519-2|ELF1_HUMAN	Isoform 2 of ETS-related transcription factor Elf-1 OS=Homo sapiens OX=9606 GN=ELF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	410-UNIMOD:267	0.03	34.0	2	1	0
PRT	sp|P54764-2|EPHA4_HUMAN	Isoform 2 of Ephrin type-A receptor 4 OS=Homo sapiens OX=9606 GN=EPHA4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	585-UNIMOD:4,588-UNIMOD:267	0.02	34.0	2	1	0
PRT	sp|Q12906-4|ILF3_HUMAN	Isoform 4 of Interleukin enhancer-binding factor 3 OS=Homo sapiens OX=9606 GN=ILF3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	342-UNIMOD:188	0.04	34.0	2	2	2
PRT	sp|P11142|HSP7C_HUMAN	Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	34.0	null	156-UNIMOD:28,159-UNIMOD:188,171-UNIMOD:267,49-UNIMOD:267,187-UNIMOD:188,311-UNIMOD:267	0.09	34.0	8	5	2
PRT	sp|Q14409|GLPK3_HUMAN	Glycerol kinase 3 OS=Homo sapiens OX=9606 GN=GK3P PE=2 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null		0.03	34.0	1	1	1
PRT	sp|P63313|TYB10_HUMAN	Thymosin beta-10 OS=Homo sapiens OX=9606 GN=TMSB10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	2-UNIMOD:1,4-UNIMOD:188,15-UNIMOD:188	0.34	33.0	2	1	0
PRT	sp|P21333-2|FLNA_HUMAN	Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	76-UNIMOD:267,973-UNIMOD:188,299-UNIMOD:188,1246-UNIMOD:188,1018-UNIMOD:4,1019-UNIMOD:188	0.04	33.0	11	7	3
PRT	sp|Q9NRF9|DPOE3_HUMAN	DNA polymerase epsilon subunit 3 OS=Homo sapiens OX=9606 GN=POLE3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	2-UNIMOD:1,4-UNIMOD:267,17-UNIMOD:267	0.12	33.0	1	1	1
PRT	sp|Q14684-2|RRP1B_HUMAN	Isoform 2 of Ribosomal RNA processing protein 1 homolog B OS=Homo sapiens OX=9606 GN=RRP1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	565-UNIMOD:4,571-UNIMOD:188,15-UNIMOD:267	0.04	33.0	4	2	0
PRT	sp|P22570-7|ADRO_HUMAN	Isoform 7 of NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Homo sapiens OX=9606 GN=FDXR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	183-UNIMOD:4,186-UNIMOD:267	0.03	33.0	1	1	1
PRT	sp|Q9BX68|HINT2_HUMAN	Histidine triad nucleotide-binding protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=HINT2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	58-UNIMOD:267	0.10	33.0	2	1	0
PRT	sp|Q86XP3-2|DDX42_HUMAN	Isoform 2 of ATP-dependent RNA helicase DDX42 OS=Homo sapiens OX=9606 GN=DDX42	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	214-UNIMOD:4,217-UNIMOD:267	0.02	33.0	2	1	0
PRT	sp|P12004|PCNA_HUMAN	Proliferating cell nuclear antigen OS=Homo sapiens OX=9606 GN=PCNA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	181-UNIMOD:188,81-UNIMOD:4,91-UNIMOD:267,254-UNIMOD:188	0.15	33.0	6	3	1
PRT	sp|Q99447|PCY2_HUMAN	Ethanolamine-phosphate cytidylyltransferase OS=Homo sapiens OX=9606 GN=PCYT2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	20-UNIMOD:267	0.04	33.0	2	1	0
PRT	sp|P19338|NUCL_HUMAN	Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	624-UNIMOD:188	0.02	33.0	2	1	0
PRT	sp|Q9H3S7|PTN23_HUMAN	Tyrosine-protein phosphatase non-receptor type 23 OS=Homo sapiens OX=9606 GN=PTPN23 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	1196-UNIMOD:267	0.01	33.0	1	1	1
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	448-UNIMOD:267	0.02	33.0	2	1	0
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	107-UNIMOD:188	0.08	33.0	6	5	3
PRT	sp|Q14139|UBE4A_HUMAN	Ubiquitin conjugation factor E4 A OS=Homo sapiens OX=9606 GN=UBE4A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.01	33.0	1	1	1
PRT	sp|Q13126-7|MTAP_HUMAN	Isoform 7 of S-methyl-5'-thioadenosine phosphorylase OS=Homo sapiens OX=9606 GN=MTAP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.08	33.0	1	1	1
PRT	sp|P53396-3|ACLY_HUMAN	Isoform 3 of ATP-citrate synthase OS=Homo sapiens OX=9606 GN=ACLY	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	371-UNIMOD:35,379-UNIMOD:188,405-UNIMOD:267,691-UNIMOD:188,336-UNIMOD:267,20-UNIMOD:4,28-UNIMOD:267	0.09	33.0	13	5	1
PRT	sp|Q96KG9-5|SCYL1_HUMAN	Isoform 5 of N-terminal kinase-like protein OS=Homo sapiens OX=9606 GN=SCYL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	512-UNIMOD:4,520-UNIMOD:188	0.02	33.0	2	1	0
PRT	sp|Q96PZ0|PUS7_HUMAN	Pseudouridylate synthase 7 homolog OS=Homo sapiens OX=9606 GN=PUS7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	609-UNIMOD:188	0.02	33.0	1	1	1
PRT	sp|Q5RIA9-3|CBWD5_HUMAN	Isoform 3 of COBW domain-containing protein 5 OS=Homo sapiens OX=9606 GN=CBWD5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	55-UNIMOD:188,205-UNIMOD:267	0.08	33.0	2	2	1
PRT	sp|Q96K76-2|UBP47_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 47 OS=Homo sapiens OX=9606 GN=USP47	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	750-UNIMOD:188	0.01	33.0	1	1	1
PRT	sp|Q9H2P0|ADNP_HUMAN	Activity-dependent neuroprotector homeobox protein OS=Homo sapiens OX=9606 GN=ADNP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	367-UNIMOD:188	0.02	33.0	2	1	0
PRT	sp|Q9UHX1-4|PUF60_HUMAN	Isoform 4 of Poly(U)-binding-splicing factor PUF60 OS=Homo sapiens OX=9606 GN=PUF60	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	26-UNIMOD:188	0.03	33.0	3	1	0
PRT	sp|P35270|SPRE_HUMAN	Sepiapterin reductase OS=Homo sapiens OX=9606 GN=SPR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	109-UNIMOD:188,10-UNIMOD:4	0.10	33.0	3	2	1
PRT	sp|Q13263-2|TIF1B_HUMAN	Isoform 2 of Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	685-UNIMOD:267	0.02	33.0	3	1	0
PRT	sp|P13796|PLSL_HUMAN	Plastin-2 OS=Homo sapiens OX=9606 GN=LCP1 PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	166-UNIMOD:35,178-UNIMOD:267	0.02	33.0	2	1	0
PRT	sp|Q01813-2|PFKAP_HUMAN	Isoform 2 of ATP-dependent 6-phosphofructokinase, platelet type OS=Homo sapiens OX=9606 GN=PFKP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	435-UNIMOD:35	0.02	33.0	2	1	0
PRT	sp|Q96G03|PGM2_HUMAN	Phosphoglucomutase-2 OS=Homo sapiens OX=9606 GN=PGM2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	73-UNIMOD:35,86-UNIMOD:4	0.03	33.0	1	1	1
PRT	sp|P09327|VILI_HUMAN	Villin-1 OS=Homo sapiens OX=9606 GN=VIL1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	392-UNIMOD:35,529-UNIMOD:188,549-UNIMOD:188	0.05	33.0	5	3	1
PRT	sp|P61106|RAB14_HUMAN	Ras-related protein Rab-14 OS=Homo sapiens OX=9606 GN=RAB14 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	125-UNIMOD:188,24-UNIMOD:188	0.13	33.0	4	2	0
PRT	sp|Q9BQA1-2|MEP50_HUMAN	Isoform 2 of Methylosome protein 50 OS=Homo sapiens OX=9606 GN=WDR77	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	52-UNIMOD:267	0.06	33.0	2	1	0
PRT	sp|O43242|PSMD3_HUMAN	26S proteasome non-ATPase regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PSMD3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	287-UNIMOD:267,385-UNIMOD:188	0.08	33.0	4	3	2
PRT	sp|P46821|MAP1B_HUMAN	Microtubule-associated protein 1B OS=Homo sapiens OX=9606 GN=MAP1B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	414-UNIMOD:188	0.01	33.0	2	1	0
PRT	sp|Q9BRA2|TXD17_HUMAN	Thioredoxin domain-containing protein 17 OS=Homo sapiens OX=9606 GN=TXNDC17 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	43-UNIMOD:4,46-UNIMOD:4,54-UNIMOD:267,35-UNIMOD:188	0.21	33.0	4	2	0
PRT	sp|Q9Y265|RUVB1_HUMAN	RuvB-like 1 OS=Homo sapiens OX=9606 GN=RUVBL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	90-UNIMOD:188	0.06	33.0	3	2	1
PRT	sp|P11388|TOP2A_HUMAN	DNA topoisomerase 2-alpha OS=Homo sapiens OX=9606 GN=TOP2A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	478-UNIMOD:267	0.01	33.0	2	1	0
PRT	sp|P05783|K1C18_HUMAN	Keratin, type I cytoskeletal 18 OS=Homo sapiens OX=9606 GN=KRT18 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	33.0	null	370-UNIMOD:188,27-UNIMOD:267,359-UNIMOD:28,313-UNIMOD:35,314-UNIMOD:267,158-UNIMOD:267,176-UNIMOD:28,186-UNIMOD:267,196-UNIMOD:267	0.17	33.0	15	6	1
PRT	sp|Q9NZL9-5|MAT2B_HUMAN	Isoform 5 of Methionine adenosyltransferase 2 subunit beta OS=Homo sapiens OX=9606 GN=MAT2B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	32-UNIMOD:267	0.16	33.0	1	1	1
PRT	sp|Q9NQ84|GPC5C_HUMAN	G-protein coupled receptor family C group 5 member C OS=Homo sapiens OX=9606 GN=GPRC5C PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	393-UNIMOD:267	0.03	33.0	2	1	0
PRT	sp|P51659|DHB4_HUMAN	Peroxisomal multifunctional enzyme type 2 OS=Homo sapiens OX=9606 GN=HSD17B4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|Q00839|HNRPU_HUMAN	Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	33.0	null	590-UNIMOD:267,545-UNIMOD:28,546-UNIMOD:35,551-UNIMOD:188,558-UNIMOD:267	0.04	33.0	7	2	0
PRT	sp|Q99798|ACON_HUMAN	Aconitate hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=ACO2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	33.0	null	592-UNIMOD:385,592-UNIMOD:4,605-UNIMOD:188,424-UNIMOD:267	0.04	33.0	4	2	0
PRT	sp|P62241|RS8_HUMAN	40S ribosomal protein S8 OS=Homo sapiens OX=9606 GN=RPS8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	33.0	null	71-UNIMOD:4,72-UNIMOD:4,74-UNIMOD:267,170-UNIMOD:188	0.14	33.0	4	2	0
PRT	sp|Q9Y4W6|AFG32_HUMAN	AFG3-like protein 2 OS=Homo sapiens OX=9606 GN=AFG3L2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	33.0	null	240-UNIMOD:267,641-UNIMOD:267	0.03	33.0	3	2	1
PRT	sp|Q12905|ILF2_HUMAN	Interleukin enhancer-binding factor 2 OS=Homo sapiens OX=9606 GN=ILF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	33.0	null	141-UNIMOD:188,206-UNIMOD:267	0.07	33.0	5	2	0
PRT	sp|P11387|TOP1_HUMAN	DNA topoisomerase 1 OS=Homo sapiens OX=9606 GN=TOP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	33.0	null	239-UNIMOD:188	0.02	33.0	2	1	0
PRT	sp|Q8IWS0|PHF6_HUMAN	PHD finger protein 6 OS=Homo sapiens OX=9606 GN=PHF6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	33.0	null	212-UNIMOD:385,212-UNIMOD:4,215-UNIMOD:4,225-UNIMOD:267	0.09	33.0	3	2	0
PRT	sp|Q6ZRV2|FA83H_HUMAN	Protein FAM83H OS=Homo sapiens OX=9606 GN=FAM83H PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	496-UNIMOD:267	0.01	33.0	1	1	1
PRT	sp|O14497-2|ARI1A_HUMAN	Isoform 2 of AT-rich interactive domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ARID1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.01	32.0	1	1	1
PRT	sp|Q9H074-3|PAIP1_HUMAN	Isoform 3 of Polyadenylate-binding protein-interacting protein 1 OS=Homo sapiens OX=9606 GN=PAIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	2-UNIMOD:1,3-UNIMOD:188,15-UNIMOD:188	0.04	32.0	2	1	0
PRT	sp|P50991-2|TCPD_HUMAN	Isoform 2 of T-complex protein 1 subunit delta OS=Homo sapiens OX=9606 GN=CCT4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	405-UNIMOD:267	0.03	32.0	2	1	0
PRT	sp|P61006|RAB8A_HUMAN	Ras-related protein Rab-8A OS=Homo sapiens OX=9606 GN=RAB8A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	167-UNIMOD:267	0.07	32.0	2	1	0
PRT	sp|P17844-2|DDX5_HUMAN	Isoform 2 of Probable ATP-dependent RNA helicase DDX5 OS=Homo sapiens OX=9606 GN=DDX5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	324-UNIMOD:267,142-UNIMOD:4,148-UNIMOD:267,205-UNIMOD:188,382-UNIMOD:267,155-UNIMOD:4,157-UNIMOD:188	0.11	32.0	8	5	1
PRT	sp|Q9BY44-4|EIF2A_HUMAN	Isoform 4 of Eukaryotic translation initiation factor 2A OS=Homo sapiens OX=9606 GN=EIF2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	245-UNIMOD:4,256-UNIMOD:267,122-UNIMOD:188	0.05	32.0	3	2	1
PRT	sp|P40429|RL13A_HUMAN	60S ribosomal protein L13a OS=Homo sapiens OX=9606 GN=RPL13A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	38-UNIMOD:4,49-UNIMOD:267	0.06	32.0	2	1	0
PRT	sp|Q16543|CDC37_HUMAN	Hsp90 co-chaperone Cdc37 OS=Homo sapiens OX=9606 GN=CDC37 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	336-UNIMOD:4,347-UNIMOD:188	0.03	32.0	2	1	0
PRT	sp|P78527-2|PRKDC_HUMAN	Isoform 2 of DNA-dependent protein kinase catalytic subunit OS=Homo sapiens OX=9606 GN=PRKDC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	4075-UNIMOD:4,4088-UNIMOD:267,3859-UNIMOD:35,3870-UNIMOD:267,2120-UNIMOD:267,2549-UNIMOD:188,321-UNIMOD:188	0.02	32.0	8	5	2
PRT	sp|Q68CZ2-2|TENS3_HUMAN	Isoform 2 of Tensin-3 OS=Homo sapiens OX=9606 GN=TNS3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	375-UNIMOD:4	0.01	32.0	1	1	1
PRT	sp|Q6NYC1-2|JMJD6_HUMAN	Isoform 2 of Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6 OS=Homo sapiens OX=9606 GN=JMJD6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	167-UNIMOD:188	0.04	32.0	2	1	0
PRT	sp|P48426-2|PI42A_HUMAN	Isoform 2 of Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha OS=Homo sapiens OX=9606 GN=PIP4K2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	59-UNIMOD:267	0.04	32.0	2	1	0
PRT	sp|Q92890-3|UFD1_HUMAN	Isoform 3 of Ubiquitin recognition factor in ER-associated degradation protein 1 OS=Homo sapiens OX=9606 GN=UFD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	139-UNIMOD:188	0.06	32.0	2	1	0
PRT	sp|Q9NXG2|THUM1_HUMAN	THUMP domain-containing protein 1 OS=Homo sapiens OX=9606 GN=THUMPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	131-UNIMOD:267,2-UNIMOD:1	0.09	32.0	3	2	1
PRT	sp|P51858|HDGF_HUMAN	Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.07	32.0	1	1	1
PRT	sp|Q13895|BYST_HUMAN	Bystin OS=Homo sapiens OX=9606 GN=BYSL PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	295-UNIMOD:4,300-UNIMOD:4,303-UNIMOD:267	0.04	32.0	2	1	0
PRT	sp|Q8IWS0-5|PHF6_HUMAN	Isoform 5 of PHD finger protein 6 OS=Homo sapiens OX=9606 GN=PHF6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	315-UNIMOD:188	0.06	32.0	2	1	0
PRT	sp|Q14103-4|HNRPD_HUMAN	Isoform 4 of Heterogeneous nuclear ribonucleoprotein D0 OS=Homo sapiens OX=9606 GN=HNRNPD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	178-UNIMOD:188	0.05	32.0	2	1	0
PRT	sp|P16615-5|AT2A2_HUMAN	Isoform 5 of Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Homo sapiens OX=9606 GN=ATP2A2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	650-UNIMOD:188	0.01	32.0	1	1	1
PRT	sp|Q9Y295|DRG1_HUMAN	Developmentally-regulated GTP-binding protein 1 OS=Homo sapiens OX=9606 GN=DRG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	61-UNIMOD:188	0.08	32.0	3	2	1
PRT	sp|P35579-2|MYH9_HUMAN	Isoform 2 of Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	193-UNIMOD:35,201-UNIMOD:35,491-UNIMOD:35,205-UNIMOD:267,501-UNIMOD:188	0.03	32.0	5	2	0
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	174-UNIMOD:188,58-UNIMOD:188,103-UNIMOD:188,77-UNIMOD:267,297-UNIMOD:188,350-UNIMOD:188,354-UNIMOD:4,359-UNIMOD:267	0.25	32.0	17	8	3
PRT	sp|O75396|SC22B_HUMAN	Vesicle-trafficking protein SEC22b OS=Homo sapiens OX=9606 GN=SEC22B PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	159-UNIMOD:267,149-UNIMOD:35	0.06	32.0	3	1	0
PRT	sp|P50990|TCPQ_HUMAN	T-complex protein 1 subunit theta OS=Homo sapiens OX=9606 GN=CCT8 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	74-UNIMOD:267,450-UNIMOD:267	0.04	32.0	5	2	0
PRT	sp|Q8IY17-5|PLPL6_HUMAN	Isoform 5 of Neuropathy target esterase OS=Homo sapiens OX=9606 GN=PNPLA6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	762-UNIMOD:267	0.01	32.0	1	1	1
PRT	sp|O75122-2|CLAP2_HUMAN	Isoform 2 of CLIP-associating protein 2 OS=Homo sapiens OX=9606 GN=CLASP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	227-UNIMOD:4	0.03	32.0	1	1	1
PRT	sp|Q7L2H7-2|EIF3M_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit M OS=Homo sapiens OX=9606 GN=EIF3M	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	158-UNIMOD:188	0.05	32.0	2	1	0
PRT	sp|Q86X55-2|CARM1_HUMAN	Isoform 2 of Histone-arginine methyltransferase CARM1 OS=Homo sapiens OX=9606 GN=CARM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	49-UNIMOD:267	0.04	32.0	2	1	0
PRT	sp|Q15046|SYK_HUMAN	Lysine--tRNA ligase OS=Homo sapiens OX=9606 GN=KARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|Q92600-3|CNOT9_HUMAN	Isoform 3 of CCR4-NOT transcription complex subunit 9 OS=Homo sapiens OX=9606 GN=CNOT9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	148-UNIMOD:188	0.05	32.0	2	1	0
PRT	sp|P50914|RL14_HUMAN	60S ribosomal protein L14 OS=Homo sapiens OX=9606 GN=RPL14 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	35-UNIMOD:267,42-UNIMOD:4,46-UNIMOD:267,54-UNIMOD:4,55-UNIMOD:35	0.16	32.0	6	3	1
PRT	sp|O60568|PLOD3_HUMAN	Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3 OS=Homo sapiens OX=9606 GN=PLOD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	372-UNIMOD:267,232-UNIMOD:188	0.04	32.0	2	2	2
PRT	sp|Q15366-7|PCBP2_HUMAN	Isoform 7 of Poly(rC)-binding protein 2 OS=Homo sapiens OX=9606 GN=PCBP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	109-UNIMOD:4,115-UNIMOD:188	0.05	32.0	2	1	0
PRT	sp|O00231|PSD11_HUMAN	26S proteasome non-ATPase regulatory subunit 11 OS=Homo sapiens OX=9606 GN=PSMD11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	337-UNIMOD:267	0.03	32.0	2	1	0
PRT	sp|P50454|SERPH_HUMAN	Serpin H1 OS=Homo sapiens OX=9606 GN=SERPINH1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	148-UNIMOD:267,60-UNIMOD:188	0.07	32.0	2	2	2
PRT	sp|P26599|PTBP1_HUMAN	Polypyrimidine tract-binding protein 1 OS=Homo sapiens OX=9606 GN=PTBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	1-UNIMOD:1,1-UNIMOD:35,250-UNIMOD:4,251-UNIMOD:4,482-UNIMOD:188	0.08	32.0	5	3	1
PRT	sp|Q96I24|FUBP3_HUMAN	Far upstream element-binding protein 3 OS=Homo sapiens OX=9606 GN=FUBP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	251-UNIMOD:35,262-UNIMOD:267	0.02	32.0	2	1	0
PRT	sp|P38919|IF4A3_HUMAN	Eukaryotic initiation factor 4A-III OS=Homo sapiens OX=9606 GN=EIF4A3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	183-UNIMOD:35,195-UNIMOD:188	0.03	32.0	2	1	0
PRT	sp|Q01082-3|SPTB2_HUMAN	Isoform 2 of Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	1348-UNIMOD:35,1359-UNIMOD:188	0.01	32.0	1	1	1
PRT	sp|Q8IVT2|MISP_HUMAN	Mitotic interactor and substrate of PLK1 OS=Homo sapiens OX=9606 GN=MISP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	587-UNIMOD:267	0.03	32.0	2	1	0
PRT	sp|P26639|SYTC_HUMAN	Threonine--tRNA ligase 1, cytoplasmic OS=Homo sapiens OX=9606 GN=TARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	381-UNIMOD:267,517-UNIMOD:188	0.06	32.0	4	3	2
PRT	sp|P05387|RLA2_HUMAN	60S acidic ribosomal protein P2 OS=Homo sapiens OX=9606 GN=RPLP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	61-UNIMOD:188	0.11	32.0	2	1	0
PRT	sp|Q8WVX9|FACR1_HUMAN	Fatty acyl-CoA reductase 1 OS=Homo sapiens OX=9606 GN=FAR1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	24-UNIMOD:188	0.03	32.0	2	1	0
PRT	sp|P52789|HXK2_HUMAN	Hexokinase-2 OS=Homo sapiens OX=9606 GN=HK2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	386-UNIMOD:4,396-UNIMOD:267	0.02	32.0	1	1	1
PRT	sp|O75643|U520_HUMAN	U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens OX=9606 GN=SNRNP200 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	557-UNIMOD:188,986-UNIMOD:267,270-UNIMOD:267	0.02	32.0	5	3	2
PRT	sp|Q8N6H7-3|ARFG2_HUMAN	Isoform 3 of ADP-ribosylation factor GTPase-activating protein 2 OS=Homo sapiens OX=9606 GN=ARFGAP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	88-UNIMOD:188,170-UNIMOD:267	0.12	32.0	3	2	1
PRT	sp|Q8IZP2|ST134_HUMAN	Putative protein FAM10A4 OS=Homo sapiens OX=9606 GN=ST13P4 PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	128-UNIMOD:188	0.06	32.0	1	1	1
PRT	sp|P62913-2|RL11_HUMAN	Isoform 2 of 60S ribosomal protein L11 OS=Homo sapiens OX=9606 GN=RPL11	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	51-UNIMOD:188	0.08	32.0	2	1	0
PRT	sp|P23526|SAHH_HUMAN	Adenosylhomocysteinase OS=Homo sapiens OX=9606 GN=AHCY PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	186-UNIMOD:188	0.03	32.0	2	1	0
PRT	sp|P80188-2|NGAL_HUMAN	Isoform 2 of Neutrophil gelatinase-associated lipocalin OS=Homo sapiens OX=9606 GN=LCN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	50-UNIMOD:188	0.08	32.0	1	1	1
PRT	sp|Q14690|RRP5_HUMAN	Protein RRP5 homolog OS=Homo sapiens OX=9606 GN=PDCD11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	1254-UNIMOD:188	0.01	32.0	3	1	0
PRT	sp|Q9ULV4|COR1C_HUMAN	Coronin-1C OS=Homo sapiens OX=9606 GN=CORO1C PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	39-UNIMOD:4,44-UNIMOD:267	0.03	32.0	2	1	0
PRT	sp|P21980|TGM2_HUMAN	Protein-glutamine gamma-glutamyltransferase 2 OS=Homo sapiens OX=9606 GN=TGM2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	230-UNIMOD:4,240-UNIMOD:267,370-UNIMOD:4,371-UNIMOD:4,377-UNIMOD:267	0.05	32.0	2	2	2
PRT	sp|P55265-5|DSRAD_HUMAN	Isoform 5 of Double-stranded RNA-specific adenosine deaminase OS=Homo sapiens OX=9606 GN=ADAR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	441-UNIMOD:267	0.02	32.0	2	1	0
PRT	sp|P05787|K2C8_HUMAN	Keratin, type II cytoskeletal 8 OS=Homo sapiens OX=9606 GN=KRT8 PE=1 SV=7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	225-UNIMOD:267,264-UNIMOD:188,341-UNIMOD:267,256-UNIMOD:35,370-UNIMOD:28,372-UNIMOD:267,381-UNIMOD:188,378-UNIMOD:35,362-UNIMOD:267	0.21	32.0	14	8	5
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	400-UNIMOD:267	0.02	32.0	1	1	0
PRT	sp|P30101|PDIA3_HUMAN	Protein disulfide-isomerase A3 OS=Homo sapiens OX=9606 GN=PDIA3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	32.0	null	131-UNIMOD:28,140-UNIMOD:267,146-UNIMOD:188,362-UNIMOD:188,338-UNIMOD:35,344-UNIMOD:267,482-UNIMOD:267	0.10	32.0	7	4	1
PRT	sp|O60812|HNRC1_HUMAN	Heterogeneous nuclear ribonucleoprotein C-like 1 OS=Homo sapiens OX=9606 GN=HNRNPCL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	29-UNIMOD:188	0.04	32.0	1	1	0
PRT	sp|P33778|H2B1B_HUMAN	Histone H2B type 1-B OS=Homo sapiens OX=9606 GN=HIST1H2BB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	60-UNIMOD:35,73-UNIMOD:267,63-UNIMOD:35,48-UNIMOD:28,58-UNIMOD:188	0.21	32.0	7	2	0
PRT	sp|Q9NVZ3|NECP2_HUMAN	Adaptin ear-binding coat-associated protein 2 OS=Homo sapiens OX=9606 GN=NECAP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	null	138-UNIMOD:28,147-UNIMOD:188,153-UNIMOD:188	0.06	32.0	2	1	0
PRT	sp|Q9NWB1|RFOX1_HUMAN	RNA binding protein fox-1 homolog 1 OS=Homo sapiens OX=9606 GN=RBFOX1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|O14744-3|ANM5_HUMAN	Isoform 3 of Protein arginine N-methyltransferase 5 OS=Homo sapiens OX=9606 GN=PRMT5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	179-UNIMOD:188	0.02	31.0	2	1	0
PRT	sp|Q9HCC0-2|MCCB_HUMAN	Isoform 2 of Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Homo sapiens OX=9606 GN=MCCC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|P18583-6|SON_HUMAN	Isoform E of Protein SON OS=Homo sapiens OX=9606 GN=SON	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	1763-UNIMOD:267,2096-UNIMOD:188	0.01	31.0	2	2	2
PRT	sp|P37837|TALDO_HUMAN	Transaldolase OS=Homo sapiens OX=9606 GN=TALDO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	250-UNIMOD:4,258-UNIMOD:188,269-UNIMOD:188,9-UNIMOD:28,10-UNIMOD:267,19-UNIMOD:188	0.11	31.0	5	3	1
PRT	sp|Q7Z4H3-3|HDDC2_HUMAN	Isoform 3 of HD domain-containing protein 2 OS=Homo sapiens OX=9606 GN=HDDC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	2-UNIMOD:1,15-UNIMOD:267	0.21	31.0	2	1	0
PRT	sp|O75592-2|MYCB2_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase MYCBP2 OS=Homo sapiens OX=9606 GN=MYCBP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	1169-UNIMOD:4,1183-UNIMOD:267	0.00	31.0	2	1	0
PRT	sp|Q13362-2|2A5G_HUMAN	Isoform Gamma-1 of Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform OS=Homo sapiens OX=9606 GN=PPP2R5C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	156-UNIMOD:188	0.03	31.0	2	1	0
PRT	sp|P36639-4|8ODP_HUMAN	Isoform p18 of 7,8-dihydro-8-oxoguanine triphosphatase OS=Homo sapiens OX=9606 GN=NUDT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	151-UNIMOD:267	0.09	31.0	2	1	0
PRT	sp|P27797|CALR_HUMAN	Calreticulin OS=Homo sapiens OX=9606 GN=CALR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.04	31.0	1	1	1
PRT	sp|Q96DH6-2|MSI2H_HUMAN	Isoform 2 of RNA-binding protein Musashi homolog 2 OS=Homo sapiens OX=9606 GN=MSI2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.06	31.0	1	1	1
PRT	sp|O43542|XRCC3_HUMAN	DNA repair protein XRCC3 OS=Homo sapiens OX=9606 GN=XRCC3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	108-UNIMOD:267	0.04	31.0	2	1	0
PRT	sp|A5YKK6-3|CNOT1_HUMAN	Isoform 3 of CCR4-NOT transcription complex subunit 1 OS=Homo sapiens OX=9606 GN=CNOT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	1809-UNIMOD:267	0.01	31.0	1	1	1
PRT	sp|P07355|ANXA2_HUMAN	Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	63-UNIMOD:267,133-UNIMOD:4,145-UNIMOD:267	0.12	31.0	6	3	2
PRT	sp|P61586|RHOA_HUMAN	Transforming protein RhoA OS=Homo sapiens OX=9606 GN=RHOA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	159-UNIMOD:4,162-UNIMOD:188	0.07	31.0	2	1	0
PRT	sp|Q9Y315|DEOC_HUMAN	Deoxyribose-phosphate aldolase OS=Homo sapiens OX=9606 GN=DERA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	299-UNIMOD:267	0.04	31.0	3	1	0
PRT	sp|Q9BVA1|TBB2B_HUMAN	Tubulin beta-2B chain OS=Homo sapiens OX=9606 GN=TUBB2B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	174-UNIMOD:188	0.03	31.0	2	1	0
PRT	sp|O60701|UGDH_HUMAN	UDP-glucose 6-dehydrogenase OS=Homo sapiens OX=9606 GN=UGDH PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	58-UNIMOD:188	0.04	31.0	2	1	0
PRT	sp|Q92616|GCN1_HUMAN	eIF-2-alpha kinase activator GCN1 OS=Homo sapiens OX=9606 GN=GCN1 PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	2654-UNIMOD:188,246-UNIMOD:4,2558-UNIMOD:4,323-UNIMOD:267	0.02	31.0	5	4	3
PRT	sp|P04792|HSPB1_HUMAN	Heat shock protein beta-1 OS=Homo sapiens OX=9606 GN=HSPB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	188-UNIMOD:267	0.09	31.0	2	1	0
PRT	sp|Q00796|DHSO_HUMAN	Sorbitol dehydrogenase OS=Homo sapiens OX=9606 GN=SORD PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	38-UNIMOD:267	0.05	31.0	2	1	0
PRT	sp|P16144-4|ITB4_HUMAN	Isoform Beta-4D of Integrin beta-4 OS=Homo sapiens OX=9606 GN=ITGB4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	1072-UNIMOD:267	0.01	31.0	2	1	0
PRT	sp|P61421|VA0D1_HUMAN	V-type proton ATPase subunit d 1 OS=Homo sapiens OX=9606 GN=ATP6V0D1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	288-UNIMOD:188	0.04	31.0	2	1	0
PRT	sp|A0AV96|RBM47_HUMAN	RNA-binding protein 47 OS=Homo sapiens OX=9606 GN=RBM47 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	145-UNIMOD:4,146-UNIMOD:4,151-UNIMOD:4	0.02	31.0	1	1	1
PRT	sp|P61019-2|RAB2A_HUMAN	Isoform 2 of Ras-related protein Rab-2A OS=Homo sapiens OX=9606 GN=RAB2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	45-UNIMOD:267	0.07	31.0	2	1	0
PRT	sp|Q8WWM7-6|ATX2L_HUMAN	Isoform 6 of Ataxin-2-like protein OS=Homo sapiens OX=9606 GN=ATXN2L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	570-UNIMOD:267	0.02	31.0	3	1	0
PRT	sp|P23458|JAK1_HUMAN	Tyrosine-protein kinase JAK1 OS=Homo sapiens OX=9606 GN=JAK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	749-UNIMOD:267	0.01	31.0	1	1	1
PRT	sp|P26885|FKBP2_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP2 OS=Homo sapiens OX=9606 GN=FKBP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	115-UNIMOD:267	0.09	31.0	2	1	0
PRT	sp|Q14651|PLSI_HUMAN	Plastin-1 OS=Homo sapiens OX=9606 GN=PLS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	168-UNIMOD:35,180-UNIMOD:267,166-UNIMOD:4,167-UNIMOD:188	0.04	31.0	4	2	0
PRT	sp|Q9BXS4|TMM59_HUMAN	Transmembrane protein 59 OS=Homo sapiens OX=9606 GN=TMEM59 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	232-UNIMOD:267	0.04	31.0	2	1	0
PRT	sp|O60506-4|HNRPQ_HUMAN	Isoform 4 of Heterogeneous nuclear ribonucleoprotein Q OS=Homo sapiens OX=9606 GN=SYNCRIP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	321-UNIMOD:188	0.03	31.0	2	1	0
PRT	sp|Q5TDH0-2|DDI2_HUMAN	Isoform 2 of Protein DDI1 homolog 2 OS=Homo sapiens OX=9606 GN=DDI2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	108-UNIMOD:267	0.15	31.0	2	2	1
PRT	sp|P60174|TPIS_HUMAN	Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	70-UNIMOD:188,255-UNIMOD:4,212-UNIMOD:188	0.16	31.0	3	3	3
PRT	sp|O76031|CLPX_HUMAN	ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial OS=Homo sapiens OX=9606 GN=CLPX PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	299-UNIMOD:188,522-UNIMOD:267	0.04	31.0	4	2	0
PRT	sp|Q14166|TTL12_HUMAN	Tubulin--tyrosine ligase-like protein 12 OS=Homo sapiens OX=9606 GN=TTLL12 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	407-UNIMOD:267	0.02	31.0	2	1	0
PRT	sp|P46926|GNPI1_HUMAN	Glucosamine-6-phosphate isomerase 1 OS=Homo sapiens OX=9606 GN=GNPDA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	79-UNIMOD:267,172-UNIMOD:267	0.09	31.0	4	2	0
PRT	sp|O95831-3|AIFM1_HUMAN	Isoform 3 of Apoptosis-inducing factor 1, mitochondrial OS=Homo sapiens OX=9606 GN=AIFM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	418-UNIMOD:267,252-UNIMOD:4,261-UNIMOD:267	0.04	31.0	4	2	0
PRT	sp|P13645|K1C10_HUMAN	Keratin, type I cytoskeletal 10 OS=Homo sapiens OX=9606 GN=KRT10 PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.05	31.0	1	1	1
PRT	sp|O43399-6|TPD54_HUMAN	Isoform 6 of Tumor protein D54 OS=Homo sapiens OX=9606 GN=TPD52L2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	110-UNIMOD:267,67-UNIMOD:188	0.16	31.0	2	2	2
PRT	sp|P14222|PERF_HUMAN	Perforin-1 OS=Homo sapiens OX=9606 GN=PRF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	464-UNIMOD:267	0.03	31.0	1	1	1
PRT	sp|Q15052-2|ARHG6_HUMAN	Isoform 2 of Rho guanine nucleotide exchange factor 6 OS=Homo sapiens OX=9606 GN=ARHGEF6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|Q9C0C2|TB182_HUMAN	182 kDa tankyrase-1-binding protein OS=Homo sapiens OX=9606 GN=TNKS1BP1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	823-UNIMOD:267	0.01	31.0	2	1	0
PRT	sp|P49247|RPIA_HUMAN	Ribose-5-phosphate isomerase OS=Homo sapiens OX=9606 GN=RPIA PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	306-UNIMOD:267	0.05	31.0	2	1	0
PRT	sp|Q92769-3|HDAC2_HUMAN	Isoform 2 of Histone deacetylase 2 OS=Homo sapiens OX=9606 GN=HDAC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	183-UNIMOD:267	0.03	31.0	2	1	0
PRT	sp|Q13868-3|EXOS2_HUMAN	Isoform 3 of Exosome complex component RRP4 OS=Homo sapiens OX=9606 GN=EXOSC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	87-UNIMOD:267,210-UNIMOD:4,218-UNIMOD:267	0.09	31.0	3	2	1
PRT	sp|P78527|PRKDC_HUMAN	DNA-dependent protein kinase catalytic subunit OS=Homo sapiens OX=9606 GN=PRKDC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	3890-UNIMOD:35,3148-UNIMOD:28,3158-UNIMOD:188,3159-UNIMOD:267	0.01	31.0	2	2	1
PRT	sp|Q58FG1|HS904_HUMAN	Putative heat shock protein HSP 90-alpha A4 OS=Homo sapiens OX=9606 GN=HSP90AA4P PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	40-UNIMOD:188	0.03	31.0	2	1	0
PRT	sp|P60709|ACTB_HUMAN	Actin, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=ACTB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	null	360-UNIMOD:28,372-UNIMOD:267	0.04	31.0	2	1	0
PRT	sp|P29692|EF1D_HUMAN	Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	232-UNIMOD:188	0.05	31.0	2	1	0
PRT	sp|P35579|MYH9_HUMAN	Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	337-UNIMOD:35,341-UNIMOD:267,719-UNIMOD:28,720-UNIMOD:267,731-UNIMOD:188	0.01	31.0	4	2	1
PRT	sp|Q14980|NUMA1_HUMAN	Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	null	870-UNIMOD:28,883-UNIMOD:267	0.01	31.0	2	1	0
PRT	sp|P54578|UBP14_HUMAN	Ubiquitin carboxyl-terminal hydrolase 14 OS=Homo sapiens OX=9606 GN=USP14 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	43-UNIMOD:267	0.03	31.0	3	1	0
PRT	sp|Q92905|CSN5_HUMAN	COP9 signalosome complex subunit 5 OS=Homo sapiens OX=9606 GN=COPS5 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	31.0	null	35-UNIMOD:28,43-UNIMOD:188,47-UNIMOD:188	0.09	31.0	4	2	1
PRT	sp|P25440|BRD2_HUMAN	Bromodomain-containing protein 2 OS=Homo sapiens OX=9606 GN=BRD2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	null	649-UNIMOD:28,656-UNIMOD:188,661-UNIMOD:188	0.02	31.0	2	1	0
PRT	sp|P00734|THRB_HUMAN	Prothrombin OS=Homo sapiens OX=9606 GN=F2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	391-UNIMOD:4	0.03	31.0	1	1	1
PRT	sp|Q92598-2|HS105_HUMAN	Isoform Beta of Heat shock protein 105 kDa OS=Homo sapiens OX=9606 GN=HSPH1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	33-UNIMOD:267	0.02	30.0	2	1	0
PRT	sp|Q9Y3Q8|T22D4_HUMAN	TSC22 domain family protein 4 OS=Homo sapiens OX=9606 GN=TSC22D4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	384-UNIMOD:267	0.08	30.0	2	2	2
PRT	sp|Q13098-5|CSN1_HUMAN	Isoform 4 of COP9 signalosome complex subunit 1 OS=Homo sapiens OX=9606 GN=GPS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	247-UNIMOD:4,257-UNIMOD:267	0.02	30.0	1	1	1
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	447-UNIMOD:4,233-UNIMOD:188,462-UNIMOD:188,405-UNIMOD:188,493-UNIMOD:188	0.09	30.0	6	4	2
PRT	sp|P46940|IQGA1_HUMAN	Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens OX=9606 GN=IQGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	751-UNIMOD:267,870-UNIMOD:267	0.02	30.0	4	2	0
PRT	sp|Q96FX7|TRM61_HUMAN	tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRMT61A OS=Homo sapiens OX=9606 GN=TRMT61A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	204-UNIMOD:4,209-UNIMOD:4,215-UNIMOD:267	0.05	30.0	2	1	0
PRT	sp|P98171|RHG04_HUMAN	Rho GTPase-activating protein 4 OS=Homo sapiens OX=9606 GN=ARHGAP4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	527-UNIMOD:4	0.04	30.0	2	2	2
PRT	sp|Q13283|G3BP1_HUMAN	Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens OX=9606 GN=G3BP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	123-UNIMOD:188	0.04	30.0	2	1	0
PRT	sp|Q14152-2|EIF3A_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens OX=9606 GN=EIF3A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|Q15942-2|ZYX_HUMAN	Isoform 2 of Zyxin OS=Homo sapiens OX=9606 GN=ZYX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	27-UNIMOD:188,138-UNIMOD:188	0.08	30.0	3	2	1
PRT	sp|Q9UHV9|PFD2_HUMAN	Prefoldin subunit 2 OS=Homo sapiens OX=9606 GN=PFDN2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	73-UNIMOD:35	0.16	30.0	2	2	2
PRT	sp|P98172|EFNB1_HUMAN	Ephrin-B1 OS=Homo sapiens OX=9606 GN=EFNB1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	307-UNIMOD:267	0.05	30.0	1	1	1
PRT	sp|P33121-2|ACSL1_HUMAN	Isoform 2 of Long-chain-fatty-acid--CoA ligase 1 OS=Homo sapiens OX=9606 GN=ACSL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	108-UNIMOD:4,112-UNIMOD:267,615-UNIMOD:4,616-UNIMOD:267	0.04	30.0	4	2	0
PRT	sp|Q9P265|DIP2B_HUMAN	Disco-interacting protein 2 homolog B OS=Homo sapiens OX=9606 GN=DIP2B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|P55795|HNRH2_HUMAN	Heterogeneous nuclear ribonucleoprotein H2 OS=Homo sapiens OX=9606 GN=HNRNPH2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	22-UNIMOD:4,28-UNIMOD:35,29-UNIMOD:267	0.03	30.0	4	1	0
PRT	sp|P31943|HNRH1_HUMAN	Heterogeneous nuclear ribonucleoprotein H OS=Homo sapiens OX=9606 GN=HNRNPH1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	22-UNIMOD:4,29-UNIMOD:267	0.03	30.0	2	1	0
PRT	sp|Q96M27-4|PRRC1_HUMAN	Isoform 4 of Protein PRRC1 OS=Homo sapiens OX=9606 GN=PRRC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	218-UNIMOD:188	0.05	30.0	1	1	1
PRT	sp|P09960-4|LKHA4_HUMAN	Isoform 4 of Leukotriene A-4 hydrolase OS=Homo sapiens OX=9606 GN=LTA4H	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	63-UNIMOD:35,73-UNIMOD:188	0.04	30.0	5	2	1
PRT	sp|P18124|RL7_HUMAN	60S ribosomal protein L7 OS=Homo sapiens OX=9606 GN=RPL7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	177-UNIMOD:267,148-UNIMOD:188	0.11	30.0	4	2	0
PRT	sp|Q96C36|P5CR2_HUMAN	Pyrroline-5-carboxylate reductase 2 OS=Homo sapiens OX=9606 GN=PYCR2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	46-UNIMOD:267	0.06	30.0	1	1	1
PRT	sp|Q5T4S7-3|UBR4_HUMAN	Isoform 3 of E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	2	2	2
PRT	sp|O60282-2|KIF5C_HUMAN	Isoform 2 of Kinesin heavy chain isoform 5C OS=Homo sapiens OX=9606 GN=KIF5C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	64-UNIMOD:4,65-UNIMOD:267,614-UNIMOD:188	0.04	30.0	3	2	1
PRT	sp|Q96AE4|FUBP1_HUMAN	Far upstream element-binding protein 1 OS=Homo sapiens OX=9606 GN=FUBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	146-UNIMOD:267,331-UNIMOD:267	0.04	30.0	3	2	1
PRT	sp|Q9UMS4|PRP19_HUMAN	Pre-mRNA-processing factor 19 OS=Homo sapiens OX=9606 GN=PRPF19 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	298-UNIMOD:4,303-UNIMOD:267	0.03	30.0	2	1	0
PRT	sp|Q9H583|HEAT1_HUMAN	HEAT repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=HEATR1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	23-UNIMOD:267,1698-UNIMOD:188	0.02	30.0	2	2	2
PRT	sp|P38159-3|RBMX_HUMAN	Isoform 3 of RNA-binding motif protein, X chromosome OS=Homo sapiens OX=9606 GN=RBMX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	22-UNIMOD:188	0.15	30.0	3	2	1
PRT	sp|P14406|CX7A2_HUMAN	Cytochrome c oxidase subunit 7A2, mitochondrial OS=Homo sapiens OX=9606 GN=COX7A2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	46-UNIMOD:188	0.17	30.0	2	1	0
PRT	sp|P62873-2|GBB1_HUMAN	Isoform 2 of Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homo sapiens OX=9606 GN=GNB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	204-UNIMOD:4	0.04	30.0	1	1	1
PRT	sp|Q86UU0-3|BCL9L_HUMAN	Isoform 3 of B-cell CLL/lymphoma 9-like protein OS=Homo sapiens OX=9606 GN=BCL9L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	521-UNIMOD:267	0.01	30.0	2	1	0
PRT	sp|Q9UHN6-2|CEIP2_HUMAN	Isoform 2 of Cell surface hyaluronidase OS=Homo sapiens OX=9606 GN=CEMIP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	345-UNIMOD:267	0.01	30.0	2	1	0
PRT	sp|P30041|PRDX6_HUMAN	Peroxiredoxin-6 OS=Homo sapiens OX=9606 GN=PRDX6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	155-UNIMOD:267	0.05	30.0	2	1	0
PRT	sp|Q15185-3|TEBP_HUMAN	Isoform 3 of Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	40-UNIMOD:4,48-UNIMOD:188	0.11	30.0	2	1	0
PRT	sp|P62888|RL30_HUMAN	60S ribosomal protein L30 OS=Homo sapiens OX=9606 GN=RPL30 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	52-UNIMOD:4,92-UNIMOD:4,106-UNIMOD:267,56-UNIMOD:267	0.26	30.0	6	2	0
PRT	sp|P61224-2|RAP1B_HUMAN	Isoform 2 of Ras-related protein Rap-1b OS=Homo sapiens OX=9606 GN=RAP1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	16-UNIMOD:188,94-UNIMOD:4,102-UNIMOD:188	0.19	30.0	4	2	0
PRT	sp|P01111|RASN_HUMAN	GTPase NRas OS=Homo sapiens OX=9606 GN=NRAS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	16-UNIMOD:188,80-UNIMOD:4	0.15	30.0	3	2	1
PRT	sp|Q8N122|RPTOR_HUMAN	Regulatory-associated protein of mTOR OS=Homo sapiens OX=9606 GN=RPTOR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	616-UNIMOD:267	0.01	30.0	2	1	0
PRT	sp|Q9BWJ5|SF3B5_HUMAN	Splicing factor 3B subunit 5 OS=Homo sapiens OX=9606 GN=SF3B5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	72-UNIMOD:35,76-UNIMOD:4,82-UNIMOD:188	0.19	30.0	2	1	0
PRT	sp|P46459-2|NSF_HUMAN	Isoform 2 of Vesicle-fusing ATPase OS=Homo sapiens OX=9606 GN=NSF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	352-UNIMOD:267	0.04	30.0	3	2	1
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	223-UNIMOD:35,227-UNIMOD:267	0.11	30.0	3	2	1
PRT	sp|Q14677|EPN4_HUMAN	Clathrin interactor 1 OS=Homo sapiens OX=9606 GN=CLINT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	625-UNIMOD:188	0.02	30.0	2	1	0
PRT	sp|P35580|MYH10_HUMAN	Myosin-10 OS=Homo sapiens OX=9606 GN=MYH10 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|Q9BRF8-3|CPPED_HUMAN	Isoform 3 of Serine/threonine-protein phosphatase CPPED1 OS=Homo sapiens OX=9606 GN=CPPED1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:1,12-UNIMOD:267	0.10	30.0	1	1	1
PRT	sp|Q9C0B5-2|ZDHC5_HUMAN	Isoform 2 of Palmitoyltransferase ZDHHC5 OS=Homo sapiens OX=9606 GN=ZDHHC5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	394-UNIMOD:267	0.05	30.0	2	2	2
PRT	sp|Q9UIG0-2|BAZ1B_HUMAN	Isoform 2 of Tyrosine-protein kinase BAZ1B OS=Homo sapiens OX=9606 GN=BAZ1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	1041-UNIMOD:4,1052-UNIMOD:267	0.01	30.0	2	1	0
PRT	sp|P62136-3|PP1A_HUMAN	Isoform 3 of Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Homo sapiens OX=9606 GN=PPP1CA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:1	0.05	30.0	1	1	1
PRT	sp|Q8ND56-3|LS14A_HUMAN	Isoform 3 of Protein LSM14 homolog A OS=Homo sapiens OX=9606 GN=LSM14A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	334-UNIMOD:4	0.03	30.0	1	1	1
PRT	sp|Q13200-2|PSMD2_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PSMD2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	289-UNIMOD:4,553-UNIMOD:188	0.03	30.0	3	2	1
PRT	sp|P57737-2|CORO7_HUMAN	Isoform 2 of Coronin-7 OS=Homo sapiens OX=9606 GN=CORO7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	595-UNIMOD:188	0.02	30.0	2	1	0
PRT	sp|P02786|TFR1_HUMAN	Transferrin receptor protein 1 OS=Homo sapiens OX=9606 GN=TFRC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	339-UNIMOD:267	0.03	30.0	3	2	1
PRT	sp|P46776|RL27A_HUMAN	60S ribosomal protein L27a OS=Homo sapiens OX=9606 GN=RPL27A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	105-UNIMOD:267	0.08	30.0	2	1	0
PRT	sp|Q9ULR0|ISY1_HUMAN	Pre-mRNA-splicing factor ISY1 homolog OS=Homo sapiens OX=9606 GN=ISY1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	69-UNIMOD:267	0.05	30.0	2	1	0
PRT	sp|P48147|PPCE_HUMAN	Prolyl endopeptidase OS=Homo sapiens OX=9606 GN=PREP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	128-UNIMOD:267	0.03	30.0	2	1	0
PRT	sp|P17174-2|AATC_HUMAN	Isoform 2 of Aspartate aminotransferase, cytoplasmic OS=Homo sapiens OX=9606 GN=GOT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	93-UNIMOD:267	0.04	30.0	1	1	1
PRT	sp|Q99735-2|MGST2_HUMAN	Isoform 2 of Microsomal glutathione S-transferase 2 OS=Homo sapiens OX=9606 GN=MGST2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	48-UNIMOD:267	0.19	30.0	1	1	1
PRT	sp|Q13596-2|SNX1_HUMAN	Isoform 1A of Sorting nexin-1 OS=Homo sapiens OX=9606 GN=SNX1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	112-UNIMOD:267	0.05	30.0	3	2	1
PRT	sp|Q6P2Q9|PRP8_HUMAN	Pre-mRNA-processing-splicing factor 8 OS=Homo sapiens OX=9606 GN=PRPF8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	1384-UNIMOD:267	0.01	30.0	2	1	0
PRT	sp|Q9NQA3|WASH6_HUMAN	WAS protein family homolog 6 OS=Homo sapiens OX=9606 GN=WASH6P PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	180-UNIMOD:188	0.03	30.0	2	1	0
PRT	sp|Q08211|DHX9_HUMAN	ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	1130-UNIMOD:267,323-UNIMOD:267,1117-UNIMOD:28	0.03	30.0	4	3	2
PRT	sp|P42166|LAP2A_HUMAN	Lamina-associated polypeptide 2, isoform alpha OS=Homo sapiens OX=9606 GN=TMPO PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	30.0	null	512-UNIMOD:28,518-UNIMOD:4,519-UNIMOD:188,525-UNIMOD:267,139-UNIMOD:267	0.04	30.0	4	2	0
PRT	sp|Q15233|NONO_HUMAN	Non-POU domain-containing octamer-binding protein OS=Homo sapiens OX=9606 GN=NONO PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	null	366-UNIMOD:28,371-UNIMOD:188,378-UNIMOD:267	0.03	30.0	2	1	0
PRT	sp|P43243|MATR3_HUMAN	Matrin-3 OS=Homo sapiens OX=9606 GN=MATR3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	387-UNIMOD:267	0.02	30.0	4	1	0
PRT	sp|A5YKK6|CNOT1_HUMAN	CCR4-NOT transcription complex subunit 1 OS=Homo sapiens OX=9606 GN=CNOT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	null	624-UNIMOD:385,624-UNIMOD:4,635-UNIMOD:188,639-UNIMOD:188	0.01	30.0	2	1	0
PRT	sp|P62333|PRS10_HUMAN	26S proteasome regulatory subunit 10B OS=Homo sapiens OX=9606 GN=PSMC6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	30.0	null	347-UNIMOD:4,356-UNIMOD:267,344-UNIMOD:267	0.06	30.0	6	2	0
PRT	sp|Q5TDH0|DDI2_HUMAN	Protein DDI1 homolog 2 OS=Homo sapiens OX=9606 GN=DDI2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	170-UNIMOD:188	0.04	30.0	3	1	0
PRT	sp|P11166|GTR1_HUMAN	Solute carrier family 2, facilitated glucose transporter member 1 OS=Homo sapiens OX=9606 GN=SLC2A1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	30.0	null	469-UNIMOD:28,477-UNIMOD:188,468-UNIMOD:267	0.07	30.0	3	2	1
PRT	sp|P62917|RL8_HUMAN	60S ribosomal protein L8 OS=Homo sapiens OX=9606 GN=RPL8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	174-UNIMOD:267	0.05	30.0	3	1	0
PRT	sp|Q15154|PCM1_HUMAN	Pericentriolar material 1 protein OS=Homo sapiens OX=9606 GN=PCM1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	1432-UNIMOD:267	0.01	30.0	1	1	1
PRT	sp|P19404|NDUV2_HUMAN	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFV2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	88-UNIMOD:267	0.06	29.0	3	1	0
PRT	sp|P46060|RAGP1_HUMAN	Ran GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RANGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	152-UNIMOD:4,160-UNIMOD:188,515-UNIMOD:267	0.05	29.0	3	2	1
PRT	sp|Q14160-2|SCRIB_HUMAN	Isoform 2 of Protein scribble homolog OS=Homo sapiens OX=9606 GN=SCRIB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	38-UNIMOD:267	0.01	29.0	2	1	0
PRT	sp|Q96GM8|TOE1_HUMAN	Target of EGR1 protein 1 OS=Homo sapiens OX=9606 GN=TOE1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	362-UNIMOD:188,80-UNIMOD:4,84-UNIMOD:267	0.05	29.0	3	2	1
PRT	sp|Q9H270|VPS11_HUMAN	Vacuolar protein sorting-associated protein 11 homolog OS=Homo sapiens OX=9606 GN=VPS11 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	602-UNIMOD:267	0.02	29.0	2	1	0
PRT	sp|P22234|PUR6_HUMAN	Multifunctional protein ADE2 OS=Homo sapiens OX=9606 GN=PAICS PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1,11-UNIMOD:188,12-UNIMOD:188	0.03	29.0	2	1	0
PRT	sp|Q9P0M9|RM27_HUMAN	39S ribosomal protein L27, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL27 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	88-UNIMOD:4,98-UNIMOD:267	0.08	29.0	2	1	0
PRT	sp|Q9UHJ6|SHPK_HUMAN	Sedoheptulokinase OS=Homo sapiens OX=9606 GN=SHPK PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	132-UNIMOD:4	0.03	29.0	1	1	1
PRT	sp|P10321-2|HLAC_HUMAN	Isoform 2 of HLA class I histocompatibility antigen, C alpha chain OS=Homo sapiens OX=9606 GN=HLA-C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.12	29.0	2	2	2
PRT	sp|P45974-2|UBP5_HUMAN	Isoform Short of Ubiquitin carboxyl-terminal hydrolase 5 OS=Homo sapiens OX=9606 GN=USP5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	144-UNIMOD:267	0.01	29.0	1	1	1
PRT	sp|Q13310-2|PABP4_HUMAN	Isoform 2 of Polyadenylate-binding protein 4 OS=Homo sapiens OX=9606 GN=PABPC4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	324-UNIMOD:188	0.02	29.0	2	1	0
PRT	sp|P13489|RINI_HUMAN	Ribonuclease inhibitor OS=Homo sapiens OX=9606 GN=RNH1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	362-UNIMOD:4,373-UNIMOD:267	0.03	29.0	2	1	0
PRT	sp|P59998|ARPC4_HUMAN	Actin-related protein 2/3 complex subunit 4 OS=Homo sapiens OX=9606 GN=ARPC4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	55-UNIMOD:267	0.07	29.0	2	1	0
PRT	sp|Q9NRG9|AAAS_HUMAN	Aladin OS=Homo sapiens OX=9606 GN=AAAS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	176-UNIMOD:267	0.02	29.0	1	1	1
PRT	sp|Q08945|SSRP1_HUMAN	FACT complex subunit SSRP1 OS=Homo sapiens OX=9606 GN=SSRP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	381-UNIMOD:267	0.02	29.0	2	1	0
PRT	sp|Q15029-2|U5S1_HUMAN	Isoform 2 of 116 kDa U5 small nuclear ribonucleoprotein component OS=Homo sapiens OX=9606 GN=EFTUD2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	922-UNIMOD:35,928-UNIMOD:188,695-UNIMOD:267	0.04	29.0	6	3	1
PRT	sp|P51571|SSRD_HUMAN	Translocon-associated protein subunit delta OS=Homo sapiens OX=9606 GN=SSR4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	116-UNIMOD:267	0.07	29.0	2	1	0
PRT	sp|O94804|STK10_HUMAN	Serine/threonine-protein kinase 10 OS=Homo sapiens OX=9606 GN=STK10 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	618-UNIMOD:267	0.01	29.0	1	1	1
PRT	sp|P18031|PTN1_HUMAN	Tyrosine-protein phosphatase non-receptor type 1 OS=Homo sapiens OX=9606 GN=PTPN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	279-UNIMOD:188	0.03	29.0	2	1	0
PRT	sp|P56192-2|SYMC_HUMAN	Isoform 2 of Methionine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=MARS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	388-UNIMOD:267	0.05	29.0	2	2	1
PRT	sp|P23396|RS3_HUMAN	40S ribosomal protein S3 OS=Homo sapiens OX=9606 GN=RPS3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	97-UNIMOD:4,106-UNIMOD:267	0.09	29.0	2	2	2
PRT	sp|Q6NXG1-2|ESRP1_HUMAN	Isoform 2 of Epithelial splicing regulatory protein 1 OS=Homo sapiens OX=9606 GN=ESRP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	243-UNIMOD:267	0.02	29.0	2	1	0
PRT	sp|Q9Y3I0|RTCB_HUMAN	RNA-splicing ligase RtcB homolog OS=Homo sapiens OX=9606 GN=RTCB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	321-UNIMOD:267	0.03	29.0	2	1	0
PRT	sp|Q9ULX9-2|MAFF_HUMAN	Isoform 2 of Transcription factor MafF OS=Homo sapiens OX=9606 GN=MAFF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	112-UNIMOD:188	0.13	29.0	2	1	0
PRT	sp|P08195-2|4F2_HUMAN	Isoform 2 of 4F2 cell-surface antigen heavy chain OS=Homo sapiens OX=9606 GN=SLC3A2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	212-UNIMOD:267	0.05	29.0	2	2	2
PRT	sp|Q03252|LMNB2_HUMAN	Lamin-B2 OS=Homo sapiens OX=9606 GN=LMNB2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	561-UNIMOD:267	0.02	29.0	2	1	0
PRT	sp|Q9P0M6|H2AW_HUMAN	Core histone macro-H2A.2 OS=Homo sapiens OX=9606 GN=H2AFY2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	108-UNIMOD:267	0.03	29.0	2	1	0
PRT	sp|O00567|NOP56_HUMAN	Nucleolar protein 56 OS=Homo sapiens OX=9606 GN=NOP56 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	384-UNIMOD:4,396-UNIMOD:188	0.04	29.0	3	2	1
PRT	sp|P48449-2|ERG7_HUMAN	Isoform 2 of Lanosterol synthase OS=Homo sapiens OX=9606 GN=LSS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	95-UNIMOD:267	0.02	29.0	2	1	0
PRT	sp|P18085|ARF4_HUMAN	ADP-ribosylation factor 4 OS=Homo sapiens OX=9606 GN=ARF4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	22-UNIMOD:35,30-UNIMOD:188,62-UNIMOD:4,73-UNIMOD:267	0.15	29.0	6	2	0
PRT	sp|P68371|TBB4B_HUMAN	Tubulin beta-4B chain OS=Homo sapiens OX=9606 GN=TUBB4B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	58-UNIMOD:188,293-UNIMOD:35,297-UNIMOD:188	0.07	29.0	2	2	2
PRT	sp|P49755|TMEDA_HUMAN	Transmembrane emp24 domain-containing protein 10 OS=Homo sapiens OX=9606 GN=TMED10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	126-UNIMOD:35,127-UNIMOD:188	0.05	29.0	6	1	0
PRT	sp|P21281|VATB2_HUMAN	V-type proton ATPase subunit B, brain isoform OS=Homo sapiens OX=9606 GN=ATP6V1B2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	471-UNIMOD:267,412-UNIMOD:267	0.07	29.0	3	3	3
PRT	sp|Q9NWS0|PIHD1_HUMAN	PIH1 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PIH1D1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	200-UNIMOD:267	0.05	29.0	2	1	0
PRT	sp|P27824-2|CALX_HUMAN	Isoform 2 of Calnexin OS=Homo sapiens OX=9606 GN=CANX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	493-UNIMOD:188,122-UNIMOD:188	0.04	29.0	2	2	2
PRT	sp|P98175-4|RBM10_HUMAN	Isoform 4 of RNA-binding protein 10 OS=Homo sapiens OX=9606 GN=RBM10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	186-UNIMOD:267	0.01	29.0	1	1	1
PRT	sp|P05091-2|ALDH2_HUMAN	Isoform 2 of Aldehyde dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ALDH2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	1	1	0
PRT	sp|P62820-2|RAB1A_HUMAN	Isoform 2 of Ras-related protein Rab-1A OS=Homo sapiens OX=9606 GN=RAB1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	112-UNIMOD:35,123-UNIMOD:188	0.18	29.0	6	2	0
PRT	sp|Q5JWF2|GNAS1_HUMAN	Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas OS=Homo sapiens OX=9606 GN=GNAS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|Q5T440|CAF17_HUMAN	Putative transferase CAF17, mitochondrial OS=Homo sapiens OX=9606 GN=IBA57 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	212-UNIMOD:267	0.04	29.0	2	1	0
PRT	sp|O00203-3|AP3B1_HUMAN	Isoform 2 of AP-3 complex subunit beta-1 OS=Homo sapiens OX=9606 GN=AP3B1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	514-UNIMOD:188	0.01	29.0	2	1	0
PRT	sp|Q8IYB5-3|SMAP1_HUMAN	Isoform 3 of Stromal membrane-associated protein 1 OS=Homo sapiens OX=9606 GN=SMAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	107-UNIMOD:267	0.03	29.0	2	1	0
PRT	sp|Q15386|UBE3C_HUMAN	Ubiquitin-protein ligase E3C OS=Homo sapiens OX=9606 GN=UBE3C PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|Q6UB35|C1TM_HUMAN	Monofunctional C1-tetrahydrofolate synthase, mitochondrial OS=Homo sapiens OX=9606 GN=MTHFD1L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|P20340-2|RAB6A_HUMAN	Isoform 2 of Ras-related protein Rab-6A OS=Homo sapiens OX=9606 GN=RAB6A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	26-UNIMOD:188	0.12	29.0	4	2	0
PRT	sp|P61020-2|RAB5B_HUMAN	Isoform 2 of Ras-related protein Rab-5B OS=Homo sapiens OX=9606 GN=RAB5B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	33-UNIMOD:188	0.07	29.0	2	1	0
PRT	sp|Q8NBJ7-2|SUMF2_HUMAN	Isoform 2 of Inactive C-alpha-formylglycine-generating enzyme 2 OS=Homo sapiens OX=9606 GN=SUMF2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	187-UNIMOD:35,201-UNIMOD:267	0.08	29.0	2	1	0
PRT	sp|Q7L014|DDX46_HUMAN	Probable ATP-dependent RNA helicase DDX46 OS=Homo sapiens OX=9606 GN=DDX46 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	506-UNIMOD:35,516-UNIMOD:267,455-UNIMOD:267,451-UNIMOD:35	0.03	29.0	6	2	0
PRT	sp|Q12974-2|TP4A2_HUMAN	Isoform 2 of Protein tyrosine phosphatase type IVA 2 OS=Homo sapiens OX=9606 GN=PTP4A2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	1-UNIMOD:1	0.20	29.0	1	1	1
PRT	sp|P55735-2|SEC13_HUMAN	Isoform 2 of Protein SEC13 homolog OS=Homo sapiens OX=9606 GN=SEC13	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	40-UNIMOD:267,173-UNIMOD:4,178-UNIMOD:188	0.08	29.0	4	2	0
PRT	sp|Q70UQ0-2|IKIP_HUMAN	Isoform 2 of Inhibitor of nuclear factor kappa-B kinase-interacting protein OS=Homo sapiens OX=9606 GN=IKBIP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	118-UNIMOD:267	0.05	29.0	2	1	0
PRT	sp|P35237|SPB6_HUMAN	Serpin B6 OS=Homo sapiens OX=9606 GN=SERPINB6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	299-UNIMOD:188,160-UNIMOD:267	0.08	29.0	3	2	1
PRT	sp|P33897|ABCD1_HUMAN	ATP-binding cassette sub-family D member 1 OS=Homo sapiens OX=9606 GN=ABCD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	401-UNIMOD:267	0.02	29.0	2	1	0
PRT	sp|Q9NQP4|PFD4_HUMAN	Prefoldin subunit 4 OS=Homo sapiens OX=9606 GN=PFDN4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	104-UNIMOD:267	0.10	29.0	2	1	0
PRT	sp|Q8IXB1|DJC10_HUMAN	DnaJ homolog subfamily C member 10 OS=Homo sapiens OX=9606 GN=DNAJC10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	337-UNIMOD:188	0.02	29.0	2	1	0
PRT	sp|Q92783-2|STAM1_HUMAN	Isoform 2 of Signal transducing adapter molecule 1 OS=Homo sapiens OX=9606 GN=STAM	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	15-UNIMOD:188	0.04	29.0	2	1	0
PRT	sp|P49458-2|SRP09_HUMAN	Isoform 2 of Signal recognition particle 9 kDa protein OS=Homo sapiens OX=9606 GN=SRP9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	12-UNIMOD:267	0.15	29.0	2	1	0
PRT	sp|Q99805|TM9S2_HUMAN	Transmembrane 9 superfamily member 2 OS=Homo sapiens OX=9606 GN=TM9SF2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	104-UNIMOD:267	0.02	29.0	2	1	0
PRT	sp|Q96IR7|HPDL_HUMAN	4-hydroxyphenylpyruvate dioxygenase-like protein OS=Homo sapiens OX=9606 GN=HPDL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	355-UNIMOD:267	0.07	29.0	3	2	1
PRT	sp|P35221-2|CTNA1_HUMAN	Isoform 2 of Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	300-UNIMOD:267,2-UNIMOD:1,12-UNIMOD:188	0.03	29.0	4	2	0
PRT	sp|Q9Y679-3|AUP1_HUMAN	Isoform 2 of Ancient ubiquitous protein 1 OS=Homo sapiens OX=9606 GN=AUP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	243-UNIMOD:267	0.03	29.0	1	1	1
PRT	sp|P15311|EZRI_HUMAN	Ezrin OS=Homo sapiens OX=9606 GN=EZR PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	542-UNIMOD:267	0.02	29.0	1	1	1
PRT	sp|P37802|TAGL2_HUMAN	Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	102-UNIMOD:267	0.14	29.0	3	2	1
PRT	sp|Q9H9B4|SFXN1_HUMAN	Sideroflexin-1 OS=Homo sapiens OX=9606 GN=SFXN1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	2-UNIMOD:1	0.05	29.0	3	1	0
PRT	sp|P42704|LPPRC_HUMAN	Leucine-rich PPR motif-containing protein, mitochondrial OS=Homo sapiens OX=9606 GN=LRPPRC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	541-UNIMOD:267,1109-UNIMOD:267,463-UNIMOD:188	0.03	29.0	6	3	0
PRT	sp|O75534|CSDE1_HUMAN	Cold shock domain-containing protein E1 OS=Homo sapiens OX=9606 GN=CSDE1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	129-UNIMOD:4,132-UNIMOD:267	0.02	29.0	1	1	1
PRT	sp|P50851-2|LRBA_HUMAN	Isoform 2 of Lipopolysaccharide-responsive and beige-like anchor protein OS=Homo sapiens OX=9606 GN=LRBA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|Q71U36-2|TBA1A_HUMAN	Isoform 2 of Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	312-UNIMOD:4,317-UNIMOD:188	0.03	29.0	2	1	0
PRT	sp|Q9BVJ6-3|UT14A_HUMAN	Isoform 3 of U3 small nucleolar RNA-associated protein 14 homolog A OS=Homo sapiens OX=9606 GN=UTP14A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	659-UNIMOD:267	0.02	29.0	2	1	0
PRT	sp|P49368-2|TCPG_HUMAN	Isoform 2 of T-complex protein 1 subunit gamma OS=Homo sapiens OX=9606 GN=CCT3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	417-UNIMOD:4,423-UNIMOD:267,360-UNIMOD:4,480-UNIMOD:267,361-UNIMOD:267	0.07	29.0	5	3	1
PRT	sp|Q7L2E3-3|DHX30_HUMAN	Isoform 3 of ATP-dependent RNA helicase DHX30 OS=Homo sapiens OX=9606 GN=DHX30	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	785-UNIMOD:188,912-UNIMOD:267	0.02	29.0	3	2	1
PRT	sp|O00411|RPOM_HUMAN	DNA-directed RNA polymerase, mitochondrial OS=Homo sapiens OX=9606 GN=POLRMT PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	987-UNIMOD:267	0.01	29.0	1	1	1
PRT	sp|Q12965|MYO1E_HUMAN	Unconventional myosin-Ie OS=Homo sapiens OX=9606 GN=MYO1E PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	373-UNIMOD:188	0.01	29.0	2	1	0
PRT	sp|Q8TEM1|PO210_HUMAN	Nuclear pore membrane glycoprotein 210 OS=Homo sapiens OX=9606 GN=NUP210 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|Q15750-2|TAB1_HUMAN	Isoform 2 of TGF-beta-activated kinase 1 and MAP3K7-binding protein 1 OS=Homo sapiens OX=9606 GN=TAB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|Q99536-2|VAT1_HUMAN	Isoform 2 of Synaptic vesicle membrane protein VAT-1 homolog OS=Homo sapiens OX=9606 GN=VAT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	161-UNIMOD:188	0.06	29.0	2	1	0
PRT	sp|Q9BYC2|SCOT2_HUMAN	Succinyl-CoA:3-ketoacid coenzyme A transferase 2, mitochondrial OS=Homo sapiens OX=9606 GN=OXCT2 PE=2 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	415-UNIMOD:188	0.03	29.0	2	1	0
PRT	sp|O00116|ADAS_HUMAN	Alkyldihydroxyacetonephosphate synthase, peroxisomal OS=Homo sapiens OX=9606 GN=AGPS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	404-UNIMOD:4,406-UNIMOD:267	0.03	29.0	1	1	1
PRT	sp|P62258|1433E_HUMAN	14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	141-UNIMOD:267,97-UNIMOD:4,98-UNIMOD:4	0.10	29.0	3	2	1
PRT	sp|P11586|C1TC_HUMAN	C-1-tetrahydrofolate synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=MTHFD1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|Q6ZMR3|LDH6A_HUMAN	L-lactate dehydrogenase A-like 6A OS=Homo sapiens OX=9606 GN=LDHAL6A PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	163-UNIMOD:4	0.04	29.0	2	1	0
PRT	sp|P61026|RAB10_HUMAN	Ras-related protein Rab-10 OS=Homo sapiens OX=9606 GN=RAB10 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	22-UNIMOD:188,70-UNIMOD:267	0.12	29.0	3	2	1
PRT	sp|P12270|TPR_HUMAN	Nucleoprotein TPR OS=Homo sapiens OX=9606 GN=TPR PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	1592-UNIMOD:188,1598-UNIMOD:267,511-UNIMOD:267	0.01	29.0	3	2	0
PRT	sp|O96008|TOM40_HUMAN	Mitochondrial import receptor subunit TOM40 homolog OS=Homo sapiens OX=9606 GN=TOMM40 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	null	90-UNIMOD:385,90-UNIMOD:4,91-UNIMOD:188,102-UNIMOD:188	0.04	29.0	2	1	0
PRT	sp|P52597|HNRPF_HUMAN	Heterogeneous nuclear ribonucleoprotein F OS=Homo sapiens OX=9606 GN=HNRNPF PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	null	14-UNIMOD:188	0.03	29.0	1	1	1
PRT	sp|Q5JTV8|TOIP1_HUMAN	Torsin-1A-interacting protein 1 OS=Homo sapiens OX=9606 GN=TOR1AIP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	null	322-UNIMOD:28,334-UNIMOD:188,335-UNIMOD:267	0.03	29.0	1	1	1
PRT	sp|Q13177|PAK2_HUMAN	Serine/threonine-protein kinase PAK 2 OS=Homo sapiens OX=9606 GN=PAK2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1	0.03	29.0	2	1	0
PRT	sp|Q6KC79|NIPBL_HUMAN	Nipped-B-like protein OS=Homo sapiens OX=9606 GN=NIPBL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	2247-UNIMOD:267	0.00	29.0	1	1	0
PRT	sp|P62877|RBX1_HUMAN	E3 ubiquitin-protein ligase RBX1 OS=Homo sapiens OX=9606 GN=RBX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	null	92-UNIMOD:28,94-UNIMOD:4,99-UNIMOD:267,105-UNIMOD:188	0.14	29.0	2	1	0
PRT	sp|Q07817|B2CL1_HUMAN	Bcl-2-like protein 1 OS=Homo sapiens OX=9606 GN=BCL2L1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	null	88-UNIMOD:28,91-UNIMOD:267,100-UNIMOD:267	0.06	29.0	1	1	1
PRT	sp|Q13404-8|UB2V1_HUMAN	Isoform 6 of Ubiquitin-conjugating enzyme E2 variant 1 OS=Homo sapiens OX=9606 GN=UBE2V1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1	0.12	28.0	1	1	0
PRT	sp|Q9H3U1-2|UN45A_HUMAN	Isoform 2 of Protein unc-45 homolog A OS=Homo sapiens OX=9606 GN=UNC45A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	0
PRT	sp|Q15906|VPS72_HUMAN	Vacuolar protein sorting-associated protein 72 homolog OS=Homo sapiens OX=9606 GN=VPS72 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	130-UNIMOD:267	0.04	28.0	1	1	1
PRT	sp|P56537-2|IF6_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 6 OS=Homo sapiens OX=9606 GN=EIF6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	11-UNIMOD:4,15-UNIMOD:4,18-UNIMOD:188	0.07	28.0	1	1	1
PRT	sp|Q14151|SAFB2_HUMAN	Scaffold attachment factor B2 OS=Homo sapiens OX=9606 GN=SAFB2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|P82675|RT05_HUMAN	28S ribosomal protein S5, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	377-UNIMOD:4	0.03	28.0	1	1	1
PRT	sp|O75436|VP26A_HUMAN	Vacuolar protein sorting-associated protein 26A OS=Homo sapiens OX=9606 GN=VPS26A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	1	1	1
PRT	sp|Q99496-2|RING2_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase RING2 OS=Homo sapiens OX=9606 GN=RNF2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	72-UNIMOD:4,75-UNIMOD:4,81-UNIMOD:267	0.05	28.0	2	1	0
PRT	sp|P62826|RAN_HUMAN	GTP-binding nuclear protein Ran OS=Homo sapiens OX=9606 GN=RAN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null	71-UNIMOD:188,23-UNIMOD:188	0.11	28.0	4	2	0
PRT	sp|Q9H773|DCTP1_HUMAN	dCTP pyrophosphatase 1 OS=Homo sapiens OX=9606 GN=DCTPP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	35-UNIMOD:267,121-UNIMOD:188	0.23	28.0	4	3	2
PRT	sp|Q5UIP0-2|RIF1_HUMAN	Isoform 2 of Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	217-UNIMOD:188	0.01	28.0	1	1	1
PRT	sp|P40227-2|TCPZ_HUMAN	Isoform 2 of T-complex protein 1 subunit zeta OS=Homo sapiens OX=9606 GN=CCT6A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	262-UNIMOD:188	0.05	28.0	4	2	1
PRT	sp|Q96S94-3|CCNL2_HUMAN	Isoform 3 of Cyclin-L2 OS=Homo sapiens OX=9606 GN=CCNL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.07	28.0	1	1	1
PRT	sp|Q08209-4|PP2BA_HUMAN	Isoform 4 of Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform OS=Homo sapiens OX=9606 GN=PPP3CA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	209-UNIMOD:188	0.06	28.0	1	1	1
PRT	sp|P36578|RL4_HUMAN	60S ribosomal protein L4 OS=Homo sapiens OX=9606 GN=RPL4 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	208-UNIMOD:4,2-UNIMOD:1,3-UNIMOD:4	0.07	28.0	2	2	2
PRT	sp|Q14558|KPRA_HUMAN	Phosphoribosyl pyrophosphate synthase-associated protein 1 OS=Homo sapiens OX=9606 GN=PRPSAP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	68-UNIMOD:267	0.04	28.0	2	1	0
PRT	sp|Q15084-3|PDIA6_HUMAN	Isoform 3 of Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	383-UNIMOD:267,406-UNIMOD:267,129-UNIMOD:267	0.11	28.0	4	3	2
PRT	sp|Q9Y446|PKP3_HUMAN	Plakophilin-3 OS=Homo sapiens OX=9606 GN=PKP3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null	277-UNIMOD:267	0.02	28.0	2	1	0
PRT	sp|Q6ZSZ5-2|ARHGI_HUMAN	Isoform 4 of Rho guanine nucleotide exchange factor 18 OS=Homo sapiens OX=9606 GN=ARHGEF18	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	199-UNIMOD:267	0.02	28.0	1	1	1
PRT	sp|Q9UBS0|KS6B2_HUMAN	Ribosomal protein S6 kinase beta-2 OS=Homo sapiens OX=9606 GN=RPS6KB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|Q08J23|NSUN2_HUMAN	RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	184-UNIMOD:4,190-UNIMOD:188,701-UNIMOD:35,710-UNIMOD:188	0.03	28.0	4	2	0
PRT	sp|O00161-2|SNP23_HUMAN	Isoform SNAP-23b of Synaptosomal-associated protein 23 OS=Homo sapiens OX=9606 GN=SNAP23	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	40-UNIMOD:188	0.09	28.0	1	1	1
PRT	sp|P61160|ARP2_HUMAN	Actin-related protein 2 OS=Homo sapiens OX=9606 GN=ACTR2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	118-UNIMOD:188	0.03	28.0	2	1	0
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	5524-UNIMOD:188,5366-UNIMOD:267	0.01	28.0	3	3	3
PRT	sp|Q9UM54-5|MYO6_HUMAN	Isoform 5 of Unconventional myosin-VI OS=Homo sapiens OX=9606 GN=MYO6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|Q6PIU2-2|NCEH1_HUMAN	Isoform 2 of Neutral cholesterol ester hydrolase 1 OS=Homo sapiens OX=9606 GN=NCEH1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|Q13242|SRSF9_HUMAN	Serine/arginine-rich splicing factor 9 OS=Homo sapiens OX=9606 GN=SRSF9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	26-UNIMOD:267	0.05	28.0	2	1	0
PRT	sp|P30405|PPIF_HUMAN	Peptidyl-prolyl cis-trans isomerase F, mitochondrial OS=Homo sapiens OX=9606 GN=PPIF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	197-UNIMOD:188,203-UNIMOD:4	0.06	28.0	1	1	1
PRT	sp|P07686|HEXB_HUMAN	Beta-hexosaminidase subunit beta OS=Homo sapiens OX=9606 GN=HEXB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	425-UNIMOD:188	0.02	28.0	1	1	1
PRT	sp|P16422|EPCAM_HUMAN	Epithelial cell adhesion molecule OS=Homo sapiens OX=9606 GN=EPCAM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	38-UNIMOD:4,44-UNIMOD:267	0.04	28.0	2	1	0
PRT	sp|Q9BTW9-5|TBCD_HUMAN	Isoform 5 of Tubulin-specific chaperone D OS=Homo sapiens OX=9606 GN=TBCD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	165-UNIMOD:267	0.02	28.0	2	1	0
PRT	sp|Q9H223|EHD4_HUMAN	EH domain-containing protein 4 OS=Homo sapiens OX=9606 GN=EHD4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|P48444|COPD_HUMAN	Coatomer subunit delta OS=Homo sapiens OX=9606 GN=ARCN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	347-UNIMOD:188	0.05	28.0	3	2	1
PRT	sp|P30740|ILEU_HUMAN	Leukocyte elastase inhibitor OS=Homo sapiens OX=9606 GN=SERPINB1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	301-UNIMOD:188	0.03	28.0	2	1	0
PRT	sp|P39748|FEN1_HUMAN	Flap endonuclease 1 OS=Homo sapiens OX=9606 GN=FEN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	19-UNIMOD:267	0.03	28.0	2	1	0
PRT	sp|P30044-2|PRDX5_HUMAN	Isoform Cytoplasmic+peroxisomal of Peroxiredoxin-5, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	107-UNIMOD:188	0.07	28.0	2	1	0
PRT	sp|Q9UFC0|LRWD1_HUMAN	Leucine-rich repeat and WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=LRWD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	463-UNIMOD:4,467-UNIMOD:4,468-UNIMOD:4,469-UNIMOD:4,473-UNIMOD:267	0.02	28.0	1	1	1
PRT	sp|Q6ZMZ3-3|SYNE3_HUMAN	Isoform 3 of Nesprin-3 OS=Homo sapiens OX=9606 GN=SYNE3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	183-UNIMOD:267	0.02	28.0	1	1	1
PRT	sp|Q9BVP2-2|GNL3_HUMAN	Isoform 2 of Guanine nucleotide-binding protein-like 3 OS=Homo sapiens OX=9606 GN=GNL3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	239-UNIMOD:4,241-UNIMOD:188	0.02	28.0	2	1	0
PRT	sp|O95573|ACSL3_HUMAN	Long-chain-fatty-acid--CoA ligase 3 OS=Homo sapiens OX=9606 GN=ACSL3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null	450-UNIMOD:4,461-UNIMOD:267	0.02	28.0	2	1	0
PRT	sp|O43815-2|STRN_HUMAN	Isoform 2 of Striatin OS=Homo sapiens OX=9606 GN=STRN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	538-UNIMOD:4,545-UNIMOD:267	0.02	28.0	2	1	0
PRT	sp|Q16513-5|PKN2_HUMAN	Isoform 5 of Serine/threonine-protein kinase N2 OS=Homo sapiens OX=9606 GN=PKN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	12-UNIMOD:4,22-UNIMOD:267	0.02	28.0	1	1	1
PRT	sp|O43290|SNUT1_HUMAN	U4/U6.U5 tri-snRNP-associated protein 1 OS=Homo sapiens OX=9606 GN=SART1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	385-UNIMOD:267	0.02	28.0	2	1	0
PRT	sp|P22307-6|NLTP_HUMAN	Isoform 6 of Non-specific lipid-transfer protein OS=Homo sapiens OX=9606 GN=SCP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	139-UNIMOD:188	0.10	28.0	2	1	0
PRT	sp|Q9NRF8|PYRG2_HUMAN	CTP synthase 2 OS=Homo sapiens OX=9606 GN=CTPS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null	477-UNIMOD:267	0.02	28.0	2	1	0
PRT	sp|P60842|IF4A1_HUMAN	Eukaryotic initiation factor 4A-I OS=Homo sapiens OX=9606 GN=EIF4A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	190-UNIMOD:267,334-UNIMOD:267	0.06	28.0	4	2	0
PRT	sp|Q96D46|NMD3_HUMAN	60S ribosomal export protein NMD3 OS=Homo sapiens OX=9606 GN=NMD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	208-UNIMOD:35,214-UNIMOD:4,218-UNIMOD:4,219-UNIMOD:267	0.03	28.0	2	1	0
PRT	sp|Q9NR30-2|DDX21_HUMAN	Isoform 2 of Nucleolar RNA helicase 2 OS=Homo sapiens OX=9606 GN=DDX21	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	2	2	2
PRT	sp|Q6ZW49-2|PAXI1_HUMAN	Isoform 3 of PAX-interacting protein 1 OS=Homo sapiens OX=9606 GN=PAXIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|Q6KC79-2|NIPBL_HUMAN	Isoform 2 of Nipped-B-like protein OS=Homo sapiens OX=9606 GN=NIPBL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.00	28.0	1	1	0
PRT	sp|Q53GS9-2|SNUT2_HUMAN	Isoform 2 of U4/U6.U5 tri-snRNP-associated protein 2 OS=Homo sapiens OX=9606 GN=USP39	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	378-UNIMOD:267	0.03	28.0	1	1	1
PRT	sp|P09001|RM03_HUMAN	39S ribosomal protein L3, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|Q13162|PRDX4_HUMAN	Peroxiredoxin-4 OS=Homo sapiens OX=9606 GN=PRDX4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	1	1	1
PRT	sp|P09661|RU2A_HUMAN	U2 small nuclear ribonucleoprotein A' OS=Homo sapiens OX=9606 GN=SNRPA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.14	28.0	2	2	2
PRT	sp|Q7Z7F0-4|KHDC4_HUMAN	Isoform 4 of KH homology domain-containing protein 4 OS=Homo sapiens OX=9606 GN=KHDC4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1	0.06	28.0	1	1	1
PRT	sp|Q86TN4-2|TRPT1_HUMAN	Isoform 2 of tRNA 2'-phosphotransferase 1 OS=Homo sapiens OX=9606 GN=TRPT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	163-UNIMOD:188	0.10	28.0	2	1	0
PRT	sp|Q9UNZ2-4|NSF1C_HUMAN	Isoform 2 of NSFL1 cofactor p47 OS=Homo sapiens OX=9606 GN=NSFL1C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.07	28.0	3	2	1
PRT	sp|P55290-3|CAD13_HUMAN	Isoform 3 of Cadherin-13 OS=Homo sapiens OX=9606 GN=CDH13	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	152-UNIMOD:267	0.09	28.0	2	1	0
PRT	sp|P50148|GNAQ_HUMAN	Guanine nucleotide-binding protein G(q) subunit alpha OS=Homo sapiens OX=9606 GN=GNAQ PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	144-UNIMOD:4,147-UNIMOD:267	0.04	28.0	1	1	1
PRT	sp|Q92786|PROX1_HUMAN	Prospero homeobox protein 1 OS=Homo sapiens OX=9606 GN=PROX1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	730-UNIMOD:4	0.02	28.0	1	1	1
PRT	sp|Q96EP5-2|DAZP1_HUMAN	Isoform 2 of DAZ-associated protein 1 OS=Homo sapiens OX=9606 GN=DAZAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	209-UNIMOD:267	0.04	28.0	2	1	0
PRT	sp|P30038|AL4A1_HUMAN	Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ALDH4A1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	524-UNIMOD:267	0.03	28.0	2	1	0
PRT	sp|Q9NYJ1|COA4_HUMAN	Cytochrome c oxidase assembly factor 4 homolog, mitochondrial OS=Homo sapiens OX=9606 GN=COA4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1	0.16	28.0	1	1	1
PRT	sp|P07737|PROF1_HUMAN	Profilin-1 OS=Homo sapiens OX=9606 GN=PFN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.12	28.0	1	1	1
PRT	sp|Q9H089|LSG1_HUMAN	Large subunit GTPase 1 homolog OS=Homo sapiens OX=9606 GN=LSG1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	99-UNIMOD:267	0.02	28.0	1	1	1
PRT	sp|Q16401-2|PSMD5_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 5 OS=Homo sapiens OX=9606 GN=PSMD5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|P27708|PYR1_HUMAN	CAD protein OS=Homo sapiens OX=9606 GN=CAD PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	1240-UNIMOD:267,770-UNIMOD:267	0.01	28.0	3	2	1
PRT	sp|Q8NFH3|NUP43_HUMAN	Nucleoporin Nup43 OS=Homo sapiens OX=9606 GN=NUP43 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	196-UNIMOD:188	0.04	28.0	2	1	0
PRT	sp|Q9ULW0|TPX2_HUMAN	Targeting protein for Xklp2 OS=Homo sapiens OX=9606 GN=TPX2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	536-UNIMOD:4,543-UNIMOD:267	0.02	28.0	2	1	0
PRT	sp|P62805|H4_HUMAN	Histone H4 OS=Homo sapiens OX=9606 GN=H4C1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	92-UNIMOD:188,56-UNIMOD:267	0.23	28.0	4	2	0
PRT	sp|Q8NCJ5|SPRY3_HUMAN	SPRY domain-containing protein 3 OS=Homo sapiens OX=9606 GN=SPRYD3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	229-UNIMOD:4	0.03	28.0	2	1	0
PRT	sp|Q8N8A6|DDX51_HUMAN	ATP-dependent RNA helicase DDX51 OS=Homo sapiens OX=9606 GN=DDX51 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	311-UNIMOD:267	0.02	28.0	2	1	0
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null	426-UNIMOD:188,726-UNIMOD:267,10-UNIMOD:267	0.05	28.0	6	4	2
PRT	sp|P49748-2|ACADV_HUMAN	Isoform 2 of Very long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADVL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|Q8TDD1|DDX54_HUMAN	ATP-dependent RNA helicase DDX54 OS=Homo sapiens OX=9606 GN=DDX54 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	868-UNIMOD:267	0.01	28.0	2	1	0
PRT	sp|Q8NFQ8|TOIP2_HUMAN	Torsin-1A-interacting protein 2 OS=Homo sapiens OX=9606 GN=TOR1AIP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	335-UNIMOD:267	0.03	28.0	1	1	1
PRT	sp|O43615|TIM44_HUMAN	Mitochondrial import inner membrane translocase subunit TIM44 OS=Homo sapiens OX=9606 GN=TIMM44 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	293-UNIMOD:188	0.03	28.0	2	1	0
PRT	sp|P62491-2|RB11A_HUMAN	Isoform 2 of Ras-related protein Rab-11A OS=Homo sapiens OX=9606 GN=RAB11A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1,24-UNIMOD:188	0.15	28.0	3	2	1
PRT	sp|P40227|TCPZ_HUMAN	T-complex protein 1 subunit zeta OS=Homo sapiens OX=9606 GN=CCT6A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	null	105-UNIMOD:28,117-UNIMOD:267	0.03	28.0	2	1	0
PRT	sp|P84077|ARF1_HUMAN	ADP-ribosylation factor 1 OS=Homo sapiens OX=9606 GN=ARF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	22-UNIMOD:35,30-UNIMOD:188	0.07	28.0	1	1	0
PRT	sp|O94979|SC31A_HUMAN	Protein transport protein Sec31A OS=Homo sapiens OX=9606 GN=SEC31A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	null	179-UNIMOD:28,192-UNIMOD:267	0.01	28.0	1	1	1
PRT	sp|P01023|A2MG_HUMAN	Alpha-2-macroglobulin OS=Homo sapiens OX=9606 GN=A2M PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|Q13144|EI2BE_HUMAN	Translation initiation factor eIF-2B subunit epsilon OS=Homo sapiens OX=9606 GN=EIF2B5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	563-UNIMOD:267	0.02	28.0	1	1	1
PRT	sp|O60343|TBCD4_HUMAN	TBC1 domain family member 4 OS=Homo sapiens OX=9606 GN=TBC1D4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	374-UNIMOD:188	0.01	28.0	1	1	0
PRT	sp|P36543|VATE1_HUMAN	V-type proton ATPase subunit E 1 OS=Homo sapiens OX=9606 GN=ATP6V1E1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	212-UNIMOD:267	0.06	28.0	1	1	0
PRT	sp|Q9NZN8|CNOT2_HUMAN	CCR4-NOT transcription complex subunit 2 OS=Homo sapiens OX=9606 GN=CNOT2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	255-UNIMOD:267	0.03	28.0	1	1	1
PRT	sp|Q01085|TIAR_HUMAN	Nucleolysin TIAR OS=Homo sapiens OX=9606 GN=TIAL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	null	190-UNIMOD:28,192-UNIMOD:267,203-UNIMOD:188	0.04	28.0	1	1	1
PRT	sp|Q14257|RCN2_HUMAN	Reticulocalbin-2 OS=Homo sapiens OX=9606 GN=RCN2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	null	306-UNIMOD:28	0.04	28.0	1	1	1
PRT	sp|P13674|P4HA1_HUMAN	Prolyl 4-hydroxylase subunit alpha-1 OS=Homo sapiens OX=9606 GN=P4HA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|Q9NQT8|KI13B_HUMAN	Kinesin-like protein KIF13B OS=Homo sapiens OX=9606 GN=KIF13B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	259-UNIMOD:267	0.01	28.0	1	1	1
PRT	sp|P15586|GNS_HUMAN	N-acetylglucosamine-6-sulfatase OS=Homo sapiens OX=9606 GN=GNS PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	140-UNIMOD:4,149-UNIMOD:188	0.02	28.0	1	1	1
PRT	sp|Q9NVZ3-3|NECP2_HUMAN	Isoform 3 of Adaptin ear-binding coat-associated protein 2 OS=Homo sapiens OX=9606 GN=NECAP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	45-UNIMOD:267	0.09	27.0	2	1	0
PRT	sp|P52565-2|GDIR1_HUMAN	Isoform 2 of Rho GDP-dissociation inhibitor 1 OS=Homo sapiens OX=9606 GN=ARHGDIA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1	0.21	27.0	1	1	1
PRT	sp|Q9H0A0-2|NAT10_HUMAN	Isoform 2 of RNA cytidine acetyltransferase OS=Homo sapiens OX=9606 GN=NAT10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	917-UNIMOD:188	0.01	27.0	2	1	0
PRT	sp|P49916-4|DNLI3_HUMAN	Isoform 4 of DNA ligase 3 OS=Homo sapiens OX=9606 GN=LIG3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	561-UNIMOD:267	0.03	27.0	3	2	1
PRT	sp|Q9NZZ3-2|CHMP5_HUMAN	Isoform 2 of Charged multivesicular body protein 5 OS=Homo sapiens OX=9606 GN=CHMP5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	20-UNIMOD:4	0.10	27.0	1	1	1
PRT	sp|Q9BUQ8|DDX23_HUMAN	Probable ATP-dependent RNA helicase DDX23 OS=Homo sapiens OX=9606 GN=DDX23 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	150-UNIMOD:188	0.02	27.0	2	1	0
PRT	sp|P31942-6|HNRH3_HUMAN	Isoform 6 of Heterogeneous nuclear ribonucleoprotein H3 OS=Homo sapiens OX=9606 GN=HNRNPH3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	85-UNIMOD:267	0.13	27.0	1	1	1
PRT	sp|P54727-2|RD23B_HUMAN	Isoform 2 of UV excision repair protein RAD23 homolog B OS=Homo sapiens OX=9606 GN=RAD23B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	161-UNIMOD:267	0.04	27.0	1	1	1
PRT	sp|P43304-2|GPDM_HUMAN	Isoform 2 of Glycerol-3-phosphate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=GPD2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	159-UNIMOD:4,172-UNIMOD:267	0.02	27.0	1	1	1
PRT	sp|P0DMV8-2|HS71A_HUMAN	Isoform 2 of Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	116-UNIMOD:267,251-UNIMOD:4,256-UNIMOD:267	0.04	27.0	2	2	2
PRT	sp|Q9BXJ9|NAA15_HUMAN	N-alpha-acetyltransferase 15, NatA auxiliary subunit OS=Homo sapiens OX=9606 GN=NAA15 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	128-UNIMOD:267	0.01	27.0	2	1	0
PRT	sp|P42224-2|STAT1_HUMAN	Isoform Beta of Signal transducer and activator of transcription 1-alpha/beta OS=Homo sapiens OX=9606 GN=STAT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	649-UNIMOD:267	0.02	27.0	2	1	0
PRT	sp|P08670|VIME_HUMAN	Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	304-UNIMOD:267,139-UNIMOD:188	0.05	27.0	4	2	0
PRT	sp|P35232|PHB_HUMAN	Prohibitin OS=Homo sapiens OX=9606 GN=PHB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	143-UNIMOD:267,117-UNIMOD:267,93-UNIMOD:267	0.13	27.0	4	3	2
PRT	sp|Q9BX66-9|SRBS1_HUMAN	Isoform 9 of Sorbin and SH3 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SORBS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	535-UNIMOD:188,695-UNIMOD:267	0.04	27.0	2	2	2
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	115-UNIMOD:188	0.05	27.0	2	1	0
PRT	sp|Q99623|PHB2_HUMAN	Prohibitin-2 OS=Homo sapiens OX=9606 GN=PHB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	157-UNIMOD:267	0.04	27.0	2	1	0
PRT	sp|O60942-3|MCE1_HUMAN	Isoform 3 of mRNA-capping enzyme OS=Homo sapiens OX=9606 GN=RNGTT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	375-UNIMOD:4	0.03	27.0	1	1	1
PRT	sp|P55011-3|S12A2_HUMAN	Isoform 2 of Solute carrier family 12 member 2 OS=Homo sapiens OX=9606 GN=SLC12A2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|P17812|PYRG1_HUMAN	CTP synthase 1 OS=Homo sapiens OX=9606 GN=CTPS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	508-UNIMOD:267	0.02	27.0	2	1	0
PRT	sp|Q8TCJ2|STT3B_HUMAN	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Homo sapiens OX=9606 GN=STT3B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|P12429|ANXA3_HUMAN	Annexin A3 OS=Homo sapiens OX=9606 GN=ANXA3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	120-UNIMOD:267,274-UNIMOD:267	0.09	27.0	3	2	1
PRT	sp|P53007|TXTP_HUMAN	Tricarboxylate transport protein, mitochondrial OS=Homo sapiens OX=9606 GN=SLC25A1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	97-UNIMOD:188	0.04	27.0	2	1	0
PRT	sp|P54886-2|P5CS_HUMAN	Isoform Short of Delta-1-pyrroline-5-carboxylate synthase OS=Homo sapiens OX=9606 GN=ALDH18A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	759-UNIMOD:188	0.02	27.0	2	1	0
PRT	sp|Q13428-5|TCOF_HUMAN	Isoform 5 of Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	746-UNIMOD:188	0.02	27.0	2	1	0
PRT	sp|P35998-2|PRS7_HUMAN	Isoform 2 of 26S proteasome regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PSMC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	214-UNIMOD:267	0.04	27.0	1	1	1
PRT	sp|P35251-2|RFC1_HUMAN	Isoform 2 of Replication factor C subunit 1 OS=Homo sapiens OX=9606 GN=RFC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	480-UNIMOD:267	0.01	27.0	2	1	0
PRT	sp|Q9Y617|SERC_HUMAN	Phosphoserine aminotransferase OS=Homo sapiens OX=9606 GN=PSAT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	61-UNIMOD:267,333-UNIMOD:188	0.06	27.0	4	2	0
PRT	sp|Q96FV9|THOC1_HUMAN	THO complex subunit 1 OS=Homo sapiens OX=9606 GN=THOC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	440-UNIMOD:267	0.02	27.0	1	1	1
PRT	sp|O95793-2|STAU1_HUMAN	Isoform Short of Double-stranded RNA-binding protein Staufen homolog 1 OS=Homo sapiens OX=9606 GN=STAU1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	87-UNIMOD:267	0.02	27.0	2	1	0
PRT	sp|Q13630|FCL_HUMAN	GDP-L-fucose synthase OS=Homo sapiens OX=9606 GN=TSTA3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.04	27.0	1	1	1
PRT	sp|P17050|NAGAB_HUMAN	Alpha-N-acetylgalactosaminidase OS=Homo sapiens OX=9606 GN=NAGA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|Q5VW32-2|BROX_HUMAN	Isoform 2 of BRO1 domain-containing protein BROX OS=Homo sapiens OX=9606 GN=BROX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|O75503|CLN5_HUMAN	Ceroid-lipofuscinosis neuronal protein 5 OS=Homo sapiens OX=9606 GN=CLN5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|O60763|USO1_HUMAN	General vesicular transport factor p115 OS=Homo sapiens OX=9606 GN=USO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	212-UNIMOD:267	0.01	27.0	2	1	0
PRT	sp|Q9NX57|RAB20_HUMAN	Ras-related protein Rab-20 OS=Homo sapiens OX=9606 GN=RAB20 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.05	27.0	1	1	1
PRT	sp|O60832-2|DKC1_HUMAN	Isoform 3 of H/ACA ribonucleoprotein complex subunit DKC1 OS=Homo sapiens OX=9606 GN=DKC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|Q9NU22|MDN1_HUMAN	Midasin OS=Homo sapiens OX=9606 GN=MDN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	137-UNIMOD:267	0.00	27.0	2	1	0
PRT	sp|P09086-4|PO2F2_HUMAN	Isoform 4 of POU domain, class 2, transcription factor 2 OS=Homo sapiens OX=9606 GN=POU2F2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	214-UNIMOD:188	0.04	27.0	1	1	1
PRT	sp|P10155-2|RO60_HUMAN	Isoform Short of 60 kDa SS-A/Ro ribonucleoprotein OS=Homo sapiens OX=9606 GN=RO60	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	63-UNIMOD:267	0.06	27.0	2	1	0
PRT	sp|P28340|DPOD1_HUMAN	DNA polymerase delta catalytic subunit OS=Homo sapiens OX=9606 GN=POLD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	639-UNIMOD:267	0.01	27.0	2	1	0
PRT	sp|Q5VYK3|ECM29_HUMAN	Proteasome adapter and scaffold protein ECM29 OS=Homo sapiens OX=9606 GN=ECPAS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|Q9GZY6-2|NTAL_HUMAN	Isoform 2 of Linker for activation of T-cells family member 2 OS=Homo sapiens OX=9606 GN=LAT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.14	27.0	1	1	1
PRT	sp|P04181|OAT_HUMAN	Ornithine aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=OAT PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	372-UNIMOD:267	0.06	27.0	3	2	1
PRT	sp|Q9NYL2-2|M3K20_HUMAN	Isoform 2 of Mitogen-activated protein kinase kinase kinase 20 OS=Homo sapiens OX=9606 GN=MAP3K20	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	337-UNIMOD:267	0.04	27.0	2	1	0
PRT	sp|O75127|PTCD1_HUMAN	Pentatricopeptide repeat-containing protein 1, mitochondrial OS=Homo sapiens OX=9606 GN=PTCD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	161-UNIMOD:267	0.02	27.0	2	1	0
PRT	sp|Q9BVL2-2|NUP58_HUMAN	Isoform 2 of Nucleoporin p58/p45 OS=Homo sapiens OX=9606 GN=NUP58	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	423-UNIMOD:35,435-UNIMOD:267	0.03	27.0	1	1	1
PRT	sp|P63220|RS21_HUMAN	40S ribosomal protein S21 OS=Homo sapiens OX=9606 GN=RPS21 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	62-UNIMOD:35,71-UNIMOD:267	0.13	27.0	2	1	0
PRT	sp|O00625|PIR_HUMAN	Pirin OS=Homo sapiens OX=9606 GN=PIR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	85-UNIMOD:35	0.05	27.0	1	1	1
PRT	sp|Q9NWH9|SLTM_HUMAN	SAFB-like transcription modulator OS=Homo sapiens OX=9606 GN=SLTM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	396-UNIMOD:188	0.01	27.0	1	1	1
PRT	sp|Q8N1F7|NUP93_HUMAN	Nuclear pore complex protein Nup93 OS=Homo sapiens OX=9606 GN=NUP93 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	42-UNIMOD:267	0.01	27.0	1	1	1
PRT	sp|P00492|HPRT_HUMAN	Hypoxanthine-guanine phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=HPRT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	141-UNIMOD:188	0.06	27.0	1	1	1
PRT	sp|P52272-2|HNRPM_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein M OS=Homo sapiens OX=9606 GN=HNRNPM	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	83-UNIMOD:188	0.04	27.0	3	2	1
PRT	sp|Q13530-2|SERC3_HUMAN	Isoform 2 of Serine incorporator 3 OS=Homo sapiens OX=9606 GN=SERINC3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	240-UNIMOD:4,250-UNIMOD:267	0.03	27.0	2	1	0
PRT	sp|Q9BX40-2|LS14B_HUMAN	Isoform 2 of Protein LSM14 homolog B OS=Homo sapiens OX=9606 GN=LSM14B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	327-UNIMOD:188	0.03	27.0	2	1	0
PRT	sp|Q9NVH0-2|EXD2_HUMAN	Isoform 2 of Exonuclease 3'-5' domain-containing protein 2 OS=Homo sapiens OX=9606 GN=EXD2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	96-UNIMOD:188	0.03	27.0	1	1	1
PRT	sp|Q12926-2|ELAV2_HUMAN	Isoform 2 of ELAV-like protein 2 OS=Homo sapiens OX=9606 GN=ELAVL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	68-UNIMOD:4	0.04	27.0	1	1	1
PRT	sp|P21399|ACOC_HUMAN	Cytoplasmic aconitate hydratase OS=Homo sapiens OX=9606 GN=ACO1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1	0.02	27.0	1	1	1
PRT	sp|Q9HD20-2|AT131_HUMAN	Isoform B of Manganese-transporting ATPase 13A1 OS=Homo sapiens OX=9606 GN=ATP13A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	218-UNIMOD:4,224-UNIMOD:267	0.01	27.0	3	1	0
PRT	sp|Q6IAA8|LTOR1_HUMAN	Ragulator complex protein LAMTOR1 OS=Homo sapiens OX=9606 GN=LAMTOR1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	60-UNIMOD:188	0.16	27.0	2	2	2
PRT	sp|O15400-2|STX7_HUMAN	Isoform 2 of Syntaxin-7 OS=Homo sapiens OX=9606 GN=STX7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	49-UNIMOD:267	0.07	27.0	1	1	1
PRT	sp|P60468|SC61B_HUMAN	Protein transport protein Sec61 subunit beta OS=Homo sapiens OX=9606 GN=SEC61B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.13	27.0	1	1	1
PRT	sp|P08559-3|ODPA_HUMAN	Isoform 3 of Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial OS=Homo sapiens OX=9606 GN=PDHA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	230-UNIMOD:4,232-UNIMOD:267	0.03	27.0	2	1	0
PRT	sp|P17980|PRS6A_HUMAN	26S proteasome regulatory subunit 6A OS=Homo sapiens OX=9606 GN=PSMC3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	344-UNIMOD:267	0.03	27.0	2	1	0
PRT	sp|P14866|HNRPL_HUMAN	Heterogeneous nuclear ribonucleoprotein L OS=Homo sapiens OX=9606 GN=HNRNPL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	404-UNIMOD:4,411-UNIMOD:188,56-UNIMOD:267	0.04	27.0	3	2	1
PRT	sp|P48681|NEST_HUMAN	Nestin OS=Homo sapiens OX=9606 GN=NES PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	157-UNIMOD:4	0.02	27.0	2	2	2
PRT	sp|P11216|PYGB_HUMAN	Glycogen phosphorylase, brain form OS=Homo sapiens OX=9606 GN=PYGB PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	29-UNIMOD:267,290-UNIMOD:188	0.03	27.0	4	2	0
PRT	sp|Q92945|FUBP2_HUMAN	Far upstream element-binding protein 2 OS=Homo sapiens OX=9606 GN=KHSRP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|O75153|CLU_HUMAN	Clustered mitochondria protein homolog OS=Homo sapiens OX=9606 GN=CLUH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	494-UNIMOD:267	0.01	27.0	2	1	0
PRT	sp|Q6KB66-2|K2C80_HUMAN	Isoform 2 of Keratin, type II cytoskeletal 80 OS=Homo sapiens OX=9606 GN=KRT80	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	71-UNIMOD:188	0.04	27.0	2	1	0
PRT	sp|O94776-2|MTA2_HUMAN	Isoform 2 of Metastasis-associated protein MTA2 OS=Homo sapiens OX=9606 GN=MTA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	15-UNIMOD:267,438-UNIMOD:188	0.06	27.0	2	2	2
PRT	sp|Q13595-2|TRA2A_HUMAN	Isoform Short of Transformer-2 protein homolog alpha OS=Homo sapiens OX=9606 GN=TRA2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	54-UNIMOD:267	0.13	27.0	2	1	0
PRT	sp|Q9NZL4-3|HPBP1_HUMAN	Isoform 3 of Hsp70-binding protein 1 OS=Homo sapiens OX=9606 GN=HSPBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	205-UNIMOD:267	0.06	27.0	2	2	2
PRT	sp|P45880|VDAC2_HUMAN	Voltage-dependent anion-selective channel protein 2 OS=Homo sapiens OX=9606 GN=VDAC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	247-UNIMOD:188	0.04	27.0	1	1	1
PRT	sp|P54886|P5CS_HUMAN	Delta-1-pyrroline-5-carboxylate synthase OS=Homo sapiens OX=9606 GN=ALDH18A1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	761-UNIMOD:188	0.02	27.0	1	1	0
PRT	sp|P22314|UBA1_HUMAN	Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	693-UNIMOD:267	0.02	27.0	1	1	0
PRT	sp|P50990-2|TCPQ_HUMAN	Isoform 2 of T-complex protein 1 subunit theta OS=Homo sapiens OX=9606 GN=CCT8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	null	12-UNIMOD:267	0.02	27.0	2	1	0
PRT	sp|Q13200|PSMD2_HUMAN	26S proteasome non-ATPase regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PSMD2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|O75390|CISY_HUMAN	Citrate synthase, mitochondrial OS=Homo sapiens OX=9606 GN=CS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	27.0	null	92-UNIMOD:267,393-UNIMOD:188	0.06	27.0	3	2	1
PRT	sp|Q9UNZ2|NSF1C_HUMAN	NSFL1 cofactor p47 OS=Homo sapiens OX=9606 GN=NSFL1C PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.03	27.0	1	1	0
PRT	sp|O75494|SRS10_HUMAN	Serine/arginine-rich splicing factor 10 OS=Homo sapiens OX=9606 GN=SRSF10 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	null	80-UNIMOD:28	0.05	27.0	1	1	1
PRT	sp|Q9HCD5|NCOA5_HUMAN	Nuclear receptor coactivator 5 OS=Homo sapiens OX=9606 GN=NCOA5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	316-UNIMOD:35,325-UNIMOD:267	0.02	27.0	1	1	1
PRT	sp|Q96JB5|CK5P3_HUMAN	CDK5 regulatory subunit-associated protein 3 OS=Homo sapiens OX=9606 GN=CDK5RAP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|Q6Y7W6|GGYF2_HUMAN	GRB10-interacting GYF protein 2 OS=Homo sapiens OX=9606 GN=GIGYF2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q96I99|SUCB2_HUMAN	Succinate--CoA ligase [GDP-forming] subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=SUCLG2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	27.0	null	269-UNIMOD:267	0.03	27.0	3	1	0
PRT	sp|P17655-2|CAN2_HUMAN	Isoform 2 of Calpain-2 catalytic subunit OS=Homo sapiens OX=9606 GN=CAPN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	null	4-UNIMOD:4,16-UNIMOD:267	0.02	27.0	1	1	1
PRT	sp|Q69YN2|C19L1_HUMAN	CWF19-like protein 1 OS=Homo sapiens OX=9606 GN=CWF19L1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	null	176-UNIMOD:385,176-UNIMOD:4,189-UNIMOD:188,191-UNIMOD:267	0.03	27.0	1	1	1
PRT	sp|Q04941|PLP2_HUMAN	Proteolipid protein 2 OS=Homo sapiens OX=9606 GN=PLP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.09	27.0	1	1	1
PRT	sp|Q9UHB9|SRP68_HUMAN	Signal recognition particle subunit SRP68 OS=Homo sapiens OX=9606 GN=SRP68 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.04	27.0	1	1	0
PRT	sp|P20338|RAB4A_HUMAN	Ras-related protein Rab-4A OS=Homo sapiens OX=9606 GN=RAB4A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	98-UNIMOD:267	0.07	27.0	1	1	1
PRT	sp|O75352-2|MPU1_HUMAN	Isoform 2 of Mannose-P-dolichol utilization defect 1 protein OS=Homo sapiens OX=9606 GN=MPDU1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1	0.06	26.0	1	1	1
PRT	sp|P14550|AK1A1_HUMAN	Aldo-keto reductase family 1 member A1 OS=Homo sapiens OX=9606 GN=AKR1A1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1,5-UNIMOD:4	0.04	26.0	1	1	1
PRT	sp|Q7L8L6|FAKD5_HUMAN	FAST kinase domain-containing protein 5, mitochondrial OS=Homo sapiens OX=9606 GN=FASTKD5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	670-UNIMOD:4,675-UNIMOD:188	0.02	26.0	1	1	1
PRT	sp|Q92696|PGTA_HUMAN	Geranylgeranyl transferase type-2 subunit alpha OS=Homo sapiens OX=9606 GN=RABGGTA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	99-UNIMOD:4,101-UNIMOD:267	0.02	26.0	2	1	0
PRT	sp|O94906-2|PRP6_HUMAN	Isoform 2 of Pre-mRNA-processing factor 6 OS=Homo sapiens OX=9606 GN=PRPF6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	616-UNIMOD:188	0.01	26.0	2	1	0
PRT	sp|P35268|RL22_HUMAN	60S ribosomal protein L22 OS=Homo sapiens OX=9606 GN=RPL22 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	65-UNIMOD:267	0.11	26.0	2	1	0
PRT	sp|O15511|ARPC5_HUMAN	Actin-related protein 2/3 complex subunit 5 OS=Homo sapiens OX=9606 GN=ARPC5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	143-UNIMOD:267	0.09	26.0	2	1	0
PRT	sp|O60313-13|OPA1_HUMAN	Isoform 7 of Dynamin-like 120 kDa protein, mitochondrial OS=Homo sapiens OX=9606 GN=OPA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	469-UNIMOD:188,276-UNIMOD:267	0.03	26.0	3	2	1
PRT	sp|P08237-2|PFKAM_HUMAN	Isoform 2 of ATP-dependent 6-phosphofructokinase, muscle type OS=Homo sapiens OX=9606 GN=PFKM	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q12931-2|TRAP1_HUMAN	Isoform 2 of Heat shock protein 75 kDa, mitochondrial OS=Homo sapiens OX=9606 GN=TRAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	594-UNIMOD:267	0.02	26.0	3	1	0
PRT	sp|Q9NSI2-2|F207A_HUMAN	Isoform B of Protein FAM207A OS=Homo sapiens OX=9606 GN=FAM207A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	205-UNIMOD:267	0.07	26.0	1	1	1
PRT	sp|Q9Y490|TLN1_HUMAN	Talin-1 OS=Homo sapiens OX=9606 GN=TLN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	971-UNIMOD:267	0.01	26.0	1	1	1
PRT	sp|P58546|MTPN_HUMAN	Myotrophin OS=Homo sapiens OX=9606 GN=MTPN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1,2-UNIMOD:4,4-UNIMOD:188,11-UNIMOD:188	0.09	26.0	2	1	0
PRT	sp|Q99613-2|EIF3C_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit C OS=Homo sapiens OX=9606 GN=EIF3C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	79-UNIMOD:4,88-UNIMOD:188,862-UNIMOD:267	0.02	26.0	3	2	1
PRT	sp|O15355|PPM1G_HUMAN	Protein phosphatase 1G OS=Homo sapiens OX=9606 GN=PPM1G PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	13-UNIMOD:4,22-UNIMOD:267	0.02	26.0	2	1	0
PRT	sp|Q9P258|RCC2_HUMAN	Protein RCC2 OS=Homo sapiens OX=9606 GN=RCC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	333-UNIMOD:267	0.03	26.0	1	1	1
PRT	sp|P62857|RS28_HUMAN	40S ribosomal protein S28 OS=Homo sapiens OX=9606 GN=RPS28 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	63-UNIMOD:267	0.19	26.0	2	1	0
PRT	sp|P10599-2|THIO_HUMAN	Isoform 2 of Thioredoxin OS=Homo sapiens OX=9606 GN=TXN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	76-UNIMOD:188,74-UNIMOD:188	0.25	26.0	3	2	1
PRT	sp|Q9H078-5|CLPB_HUMAN	Isoform 5 of Caseinolytic peptidase B protein homolog OS=Homo sapiens OX=9606 GN=CLPB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	94-UNIMOD:267	0.03	26.0	1	1	1
PRT	sp|Q03701|CEBPZ_HUMAN	CCAAT/enhancer-binding protein zeta OS=Homo sapiens OX=9606 GN=CEBPZ PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	302-UNIMOD:267	0.01	26.0	1	1	1
PRT	sp|P29317|EPHA2_HUMAN	Ephrin type-A receptor 2 OS=Homo sapiens OX=9606 GN=EPHA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	873-UNIMOD:188	0.01	26.0	2	1	0
PRT	sp|O00267-2|SPT5H_HUMAN	Isoform 2 of Transcription elongation factor SPT5 OS=Homo sapiens OX=9606 GN=SUPT5H	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	490-UNIMOD:267	0.01	26.0	1	1	1
PRT	sp|O00299|CLIC1_HUMAN	Chloride intracellular channel protein 1 OS=Homo sapiens OX=9606 GN=CLIC1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	178-UNIMOD:4	0.15	26.0	2	2	2
PRT	sp|P09525-2|ANXA4_HUMAN	Isoform 2 of Annexin A4 OS=Homo sapiens OX=9606 GN=ANXA4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	26-UNIMOD:4,34-UNIMOD:267	0.12	26.0	2	2	2
PRT	sp|O75475-3|PSIP1_HUMAN	Isoform 3 of PC4 and SFRS1-interacting protein OS=Homo sapiens OX=9606 GN=PSIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.05	26.0	1	1	1
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	42-UNIMOD:188	0.04	26.0	1	1	1
PRT	sp|P51532-5|SMCA4_HUMAN	Isoform 5 of Transcription activator BRG1 OS=Homo sapiens OX=9606 GN=SMARCA4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	370-UNIMOD:267	0.01	26.0	2	1	0
PRT	sp|Q05193-5|DYN1_HUMAN	Isoform 4 of Dynamin-1 OS=Homo sapiens OX=9606 GN=DNM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	15-UNIMOD:267,54-UNIMOD:267	0.03	26.0	3	2	1
PRT	sp|O95292-2|VAPB_HUMAN	Isoform 2 of Vesicle-associated membrane protein-associated protein B/C OS=Homo sapiens OX=9606 GN=VAPB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	31-UNIMOD:188	0.13	26.0	2	1	0
PRT	sp|P53004|BIEA_HUMAN	Biliverdin reductase A OS=Homo sapiens OX=9606 GN=BLVRA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null	161-UNIMOD:267	0.05	26.0	2	1	0
PRT	sp|Q9NUD5|ZCHC3_HUMAN	Zinc finger CCHC domain-containing protein 3 OS=Homo sapiens OX=9606 GN=ZCCHC3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	170-UNIMOD:4,178-UNIMOD:4,356-UNIMOD:385,356-UNIMOD:4,366-UNIMOD:4	0.07	26.0	2	2	2
PRT	sp|Q14839|CHD4_HUMAN	Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|P49959-3|MRE11_HUMAN	Isoform 3 of Double-strand break repair protein MRE11 OS=Homo sapiens OX=9606 GN=MRE11	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	174-UNIMOD:188	0.02	26.0	2	1	0
PRT	sp|Q16718-2|NDUA5_HUMAN	Isoform 2 of NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 OS=Homo sapiens OX=9606 GN=NDUFA5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	40-UNIMOD:188	0.09	26.0	2	1	0
PRT	sp|Q9H8H0-2|NOL11_HUMAN	Isoform 2 of Nucleolar protein 11 OS=Homo sapiens OX=9606 GN=NOL11	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.09	26.0	1	1	1
PRT	sp|P20700|LMNB1_HUMAN	Lamin-B1 OS=Homo sapiens OX=9606 GN=LMNB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	330-UNIMOD:188	0.02	26.0	2	1	0
PRT	sp|Q7Z6Z7-2|HUWE1_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	2	2	2
PRT	sp|P14868-2|SYDC_HUMAN	Isoform 2 of Aspartate--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=DARS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	51-UNIMOD:267	0.03	26.0	2	1	0
PRT	sp|P62937-2|PPIA_HUMAN	Isoform 2 of Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	95-UNIMOD:188,101-UNIMOD:4,31-UNIMOD:188	0.21	26.0	3	2	1
PRT	sp|Q9UDY2-5|ZO2_HUMAN	Isoform A3 of Tight junction protein ZO-2 OS=Homo sapiens OX=9606 GN=TJP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	759-UNIMOD:188	0.01	26.0	1	1	1
PRT	sp|P36543-3|VATE1_HUMAN	Isoform 3 of V-type proton ATPase subunit E 1 OS=Homo sapiens OX=9606 GN=ATP6V1E1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.07	26.0	1	1	0
PRT	sp|Q9UBF2-2|COPG2_HUMAN	Isoform 2 of Coatomer subunit gamma-2 OS=Homo sapiens OX=9606 GN=COPG2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	85-UNIMOD:267	0.02	26.0	2	1	0
PRT	sp|Q9BW92|SYTM_HUMAN	Threonine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=TARS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|P34897-3|GLYM_HUMAN	Isoform 3 of Serine hydroxymethyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=SHMT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	209-UNIMOD:267	0.02	26.0	2	1	0
PRT	sp|Q16531|DDB1_HUMAN	DNA damage-binding protein 1 OS=Homo sapiens OX=9606 GN=DDB1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	889-UNIMOD:267	0.01	26.0	1	1	1
PRT	sp|O75179-5|ANR17_HUMAN	Isoform 5 of Ankyrin repeat domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ANKRD17	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q9NZI8|IF2B1_HUMAN	Insulin-like growth factor 2 mRNA-binding protein 1 OS=Homo sapiens OX=9606 GN=IGF2BP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	213-UNIMOD:188	0.03	26.0	1	1	1
PRT	sp|P54136-2|SYRC_HUMAN	Isoform Monomeric of Arginine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=RARS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	450-UNIMOD:188	0.02	26.0	2	1	0
PRT	sp|Q96Q11|TRNT1_HUMAN	CCA tRNA nucleotidyltransferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=TRNT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|P51153|RAB13_HUMAN	Ras-related protein Rab-13 OS=Homo sapiens OX=9606 GN=RAB13 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null	69-UNIMOD:267	0.06	26.0	2	1	0
PRT	sp|Q9H5V8|CDCP1_HUMAN	CUB domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CDCP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	466-UNIMOD:188,530-UNIMOD:267,401-UNIMOD:4,406-UNIMOD:267	0.04	26.0	4	3	2
PRT	sp|Q06830|PRDX1_HUMAN	Peroxiredoxin-1 OS=Homo sapiens OX=9606 GN=PRDX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	168-UNIMOD:188,151-UNIMOD:267,141-UNIMOD:28	0.12	26.0	6	2	0
PRT	sp|Q8IYB3-2|SRRM1_HUMAN	Isoform 2 of Serine/arginine repetitive matrix protein 1 OS=Homo sapiens OX=9606 GN=SRRM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	471-UNIMOD:35,480-UNIMOD:267	0.01	26.0	2	1	0
PRT	sp|O43776|SYNC_HUMAN	Asparagine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=NARS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	391-UNIMOD:35,401-UNIMOD:188	0.02	26.0	2	1	0
PRT	sp|P55036|PSMD4_HUMAN	26S proteasome non-ATPase regulatory subunit 4 OS=Homo sapiens OX=9606 GN=PSMD4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	272-UNIMOD:267	0.03	26.0	2	1	0
PRT	sp|Q9BUJ2-3|HNRL1_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 OS=Homo sapiens OX=9606 GN=HNRNPUL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	263-UNIMOD:4,272-UNIMOD:267	0.02	26.0	2	1	0
PRT	sp|O43390-4|HNRPR_HUMAN	Isoform 4 of Heterogeneous nuclear ribonucleoprotein R OS=Homo sapiens OX=9606 GN=HNRNPR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	113-UNIMOD:4	0.05	26.0	2	2	2
PRT	sp|P12268|IMDH2_HUMAN	Inosine-5'-monophosphate dehydrogenase 2 OS=Homo sapiens OX=9606 GN=IMPDH2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null	322-UNIMOD:267	0.02	26.0	3	1	0
PRT	sp|P20839-2|IMDH1_HUMAN	Isoform 2 of Inosine-5'-monophosphate dehydrogenase 1 OS=Homo sapiens OX=9606 GN=IMPDH1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	297-UNIMOD:267	0.02	26.0	2	1	0
PRT	sp|Q5TH69|BIG3_HUMAN	Brefeldin A-inhibited guanine nucleotide-exchange protein 3 OS=Homo sapiens OX=9606 GN=ARFGEF3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	883-UNIMOD:267	0.01	26.0	1	1	1
PRT	sp|O94979-5|SC31A_HUMAN	Isoform 5 of Protein transport protein Sec31A OS=Homo sapiens OX=9606 GN=SEC31A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|P39656|OST48_HUMAN	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Homo sapiens OX=9606 GN=DDOST PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	57-UNIMOD:267	0.05	26.0	3	2	1
PRT	sp|P86791|CCZ1_HUMAN	Vacuolar fusion protein CCZ1 homolog OS=Homo sapiens OX=9606 GN=CCZ1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	65-UNIMOD:4,73-UNIMOD:267	0.03	26.0	3	1	0
PRT	sp|Q14566|MCM6_HUMAN	DNA replication licensing factor MCM6 OS=Homo sapiens OX=9606 GN=MCM6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	529-UNIMOD:267	0.02	26.0	2	1	0
PRT	sp|Q9HBH1|DEFM_HUMAN	Peptide deformylase, mitochondrial OS=Homo sapiens OX=9606 GN=PDF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	132-UNIMOD:4,133-UNIMOD:267	0.06	26.0	2	1	0
PRT	sp|P04843|RPN1_HUMAN	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Homo sapiens OX=9606 GN=RPN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	204-UNIMOD:267	0.02	26.0	3	1	0
PRT	sp|Q15758-3|AAAT_HUMAN	Isoform 3 of Neutral amino acid transporter B(0) OS=Homo sapiens OX=9606 GN=SLC1A5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.07	26.0	1	1	1
PRT	sp|Q6PML9|ZNT9_HUMAN	Zinc transporter 9 OS=Homo sapiens OX=9606 GN=SLC30A9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|P29218|IMPA1_HUMAN	Inositol monophosphatase 1 OS=Homo sapiens OX=9606 GN=IMPA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|Q7Z2W4-3|ZCCHV_HUMAN	Isoform 3 of Zinc finger CCCH-type antiviral protein 1 OS=Homo sapiens OX=9606 GN=ZC3HAV1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|O00571-2|DDX3X_HUMAN	Isoform 2 of ATP-dependent RNA helicase DDX3X OS=Homo sapiens OX=9606 GN=DDX3X	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	487-UNIMOD:267	0.02	26.0	1	1	1
PRT	sp|Q00059-2|TFAM_HUMAN	Isoform 2 of Transcription factor A, mitochondrial OS=Homo sapiens OX=9606 GN=TFAM	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.06	26.0	1	1	1
PRT	sp|P53621|COPA_HUMAN	Coatomer subunit alpha OS=Homo sapiens OX=9606 GN=COPA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	572-UNIMOD:267	0.01	26.0	2	1	0
PRT	sp|Q9BZE4-3|NOG1_HUMAN	Isoform 3 of Nucleolar GTP-binding protein 1 OS=Homo sapiens OX=9606 GN=GTPBP4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	58-UNIMOD:4,65-UNIMOD:188	0.03	26.0	2	1	0
PRT	sp|Q13535-2|ATR_HUMAN	Isoform 2 of Serine/threonine-protein kinase ATR OS=Homo sapiens OX=9606 GN=ATR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	941-UNIMOD:188	0.01	26.0	1	1	1
PRT	sp|P50995-2|ANX11_HUMAN	Isoform 2 of Annexin A11 OS=Homo sapiens OX=9606 GN=ANXA11	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|O95456-2|PSMG1_HUMAN	Isoform 2 of Proteasome assembly chaperone 1 OS=Homo sapiens OX=9606 GN=PSMG1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	169-UNIMOD:267	0.06	26.0	2	1	0
PRT	sp|P23284|PPIB_HUMAN	Peptidyl-prolyl cis-trans isomerase B OS=Homo sapiens OX=9606 GN=PPIB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	84-UNIMOD:188,180-UNIMOD:267	0.11	26.0	3	2	1
PRT	sp|P55854|SUMO3_HUMAN	Small ubiquitin-related modifier 3 OS=Homo sapiens OX=9606 GN=SUMO3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	32-UNIMOD:188	0.13	26.0	2	1	0
PRT	sp|Q14790-3|CASP8_HUMAN	Isoform 3 of Caspase-8 OS=Homo sapiens OX=9606 GN=CASP8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	276-UNIMOD:4,283-UNIMOD:188	0.04	26.0	1	1	1
PRT	sp|Q9UBR2|CATZ_HUMAN	Cathepsin Z OS=Homo sapiens OX=9606 GN=CTSZ PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	199-UNIMOD:267	0.04	26.0	1	1	1
PRT	sp|P00338-5|LDHA_HUMAN	Isoform 5 of L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	163-UNIMOD:4,169-UNIMOD:267	0.05	26.0	1	1	0
PRT	sp|Q9Y653-5|AGRG1_HUMAN	Isoform 5 of Adhesion G-protein coupled receptor G1 OS=Homo sapiens OX=9606 GN=ADGRG1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	146-UNIMOD:188	0.02	26.0	2	1	0
PRT	sp|P12270-2|TPR_HUMAN	Isoform 2 of Nucleoprotein TPR OS=Homo sapiens OX=9606 GN=TPR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	0
PRT	sp|Q12788|TBL3_HUMAN	Transducin beta-like protein 3 OS=Homo sapiens OX=9606 GN=TBL3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	59-UNIMOD:267	0.02	26.0	2	1	0
PRT	sp|Q9Y2D4|EXC6B_HUMAN	Exocyst complex component 6B OS=Homo sapiens OX=9606 GN=EXOC6B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null	770-UNIMOD:188	0.02	26.0	3	1	0
PRT	sp|P22681|CBL_HUMAN	E3 ubiquitin-protein ligase CBL OS=Homo sapiens OX=9606 GN=CBL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|E9PRG8|CK098_HUMAN	Uncharacterized protein C11orf98 OS=Homo sapiens OX=9606 GN=C11orf98 PE=4 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.11	26.0	1	1	1
PRT	sp|P38432|COIL_HUMAN	Coilin OS=Homo sapiens OX=9606 GN=COIL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	46-UNIMOD:267	0.02	26.0	2	1	0
PRT	sp|P12081-3|HARS1_HUMAN	Isoform 3 of Histidine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=HARS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	313-UNIMOD:188	0.03	26.0	2	1	0
PRT	sp|P07384|CAN1_HUMAN	Calpain-1 catalytic subunit OS=Homo sapiens OX=9606 GN=CAPN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	46-UNIMOD:267,398-UNIMOD:188	0.04	26.0	4	2	0
PRT	sp|Q13310|PABP4_HUMAN	Polyadenylate-binding protein 4 OS=Homo sapiens OX=9606 GN=PABPC4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.02	26.0	1	1	0
PRT	sp|P56192|SYMC_HUMAN	Methionine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=MARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	388-UNIMOD:267	0.01	26.0	1	1	0
PRT	sp|Q03113|GNA12_HUMAN	Guanine nucleotide-binding protein subunit alpha-12 OS=Homo sapiens OX=9606 GN=GNA12 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	70-UNIMOD:188	0.03	26.0	1	1	1
PRT	sp|Q9NZU5|LMCD1_HUMAN	LIM and cysteine-rich domains protein 1 OS=Homo sapiens OX=9606 GN=LMCD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	null	156-UNIMOD:28	0.04	26.0	1	1	1
PRT	sp|Q15424|SAFB1_HUMAN	Scaffold attachment factor B1 OS=Homo sapiens OX=9606 GN=SAFB PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	225-UNIMOD:4,226-UNIMOD:188	0.01	26.0	1	1	1
PRT	sp|P49915|GUAA_HUMAN	GMP synthase [glutamine-hydrolyzing] OS=Homo sapiens OX=9606 GN=GMPS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	26.0	null	590-UNIMOD:28,600-UNIMOD:267,435-UNIMOD:267	0.03	26.0	2	2	2
PRT	sp|P39687|AN32A_HUMAN	Acidic leucine-rich nuclear phosphoprotein 32 family member A OS=Homo sapiens OX=9606 GN=ANP32A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	26.0	null		0.06	26.0	2	1	0
PRT	sp|Q9Y3F4|STRAP_HUMAN	Serine-threonine kinase receptor-associated protein OS=Homo sapiens OX=9606 GN=STRAP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	null	45-UNIMOD:28,59-UNIMOD:188	0.05	26.0	2	1	0
PRT	sp|Q6IAN0|DRS7B_HUMAN	Dehydrogenase/reductase SDR family member 7B OS=Homo sapiens OX=9606 GN=DHRS7B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	null	186-UNIMOD:28,198-UNIMOD:188	0.04	26.0	1	1	1
PRT	sp|P02768|ALBU_HUMAN	Serum albumin OS=Homo sapiens OX=9606 GN=ALB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q9NZM1-8|MYOF_HUMAN	Isoform 8 of Myoferlin OS=Homo sapiens OX=9606 GN=MYOF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	null	192-UNIMOD:28	0.03	26.0	1	1	1
PRT	sp|Q07955|SRSF1_HUMAN	Serine/arginine-rich splicing factor 1 OS=Homo sapiens OX=9606 GN=SRSF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	28-UNIMOD:267	0.05	26.0	3	1	0
PRT	sp|Q6P1N9|TATD1_HUMAN	Putative deoxyribonuclease TATDN1 OS=Homo sapiens OX=9606 GN=TATDN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	null	168-UNIMOD:385,168-UNIMOD:4	0.05	26.0	1	1	1
PRT	sp|P67936|TPM4_HUMAN	Tropomyosin alpha-4 chain OS=Homo sapiens OX=9606 GN=TPM4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	null	2-UNIMOD:1,11-UNIMOD:188,12-UNIMOD:267	0.05	26.0	1	1	1
PRT	sp|P48643|TCPE_HUMAN	T-complex protein 1 subunit epsilon OS=Homo sapiens OX=9606 GN=CCT5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	null	503-UNIMOD:28,513-UNIMOD:188	0.02	26.0	3	1	0
PRT	sp|P31949|S10AB_HUMAN	Protein S100-A11 OS=Homo sapiens OX=9606 GN=S100A11 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	26.0	null	13-UNIMOD:4,23-UNIMOD:188	0.11	26.0	2	1	0
PRT	sp|O43815|STRN_HUMAN	Striatin OS=Homo sapiens OX=9606 GN=STRN PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	587-UNIMOD:4	0.02	26.0	1	1	0
PRT	sp|P48507|GSH0_HUMAN	Glutamate--cysteine ligase regulatory subunit OS=Homo sapiens OX=9606 GN=GCLM PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	null	206-UNIMOD:28,218-UNIMOD:188	0.05	26.0	1	1	1
PRT	sp|Q14694|UBP10_HUMAN	Ubiquitin carboxyl-terminal hydrolase 10 OS=Homo sapiens OX=9606 GN=USP10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	26.0	null	653-UNIMOD:267	0.02	26.0	2	1	0
PRT	sp|Q9HD15|SRA1_HUMAN	Steroid receptor RNA activator 1 OS=Homo sapiens OX=9606 GN=SRA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	152-UNIMOD:188	0.06	26.0	2	1	0
PRT	sp|Q96B54|ZN428_HUMAN	Zinc finger protein 428 OS=Homo sapiens OX=9606 GN=ZNF428 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	93-UNIMOD:4,96-UNIMOD:4	0.08	25.0	1	1	1
PRT	sp|P61803|DAD1_HUMAN	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Homo sapiens OX=9606 GN=DAD1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	92-UNIMOD:267	0.10	25.0	2	1	0
PRT	sp|O76075-2|DFFB_HUMAN	Isoform Beta of DNA fragmentation factor subunit beta OS=Homo sapiens OX=9606 GN=DFFB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	148-UNIMOD:267	0.05	25.0	2	1	0
PRT	sp|P61619-3|S61A1_HUMAN	Isoform 3 of Protein transport protein Sec61 subunit alpha isoform 1 OS=Homo sapiens OX=9606 GN=SEC61A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	85-UNIMOD:267	0.03	25.0	2	1	0
PRT	sp|P13861-2|KAP2_HUMAN	Isoform 2 of cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	56-UNIMOD:267,251-UNIMOD:35,263-UNIMOD:188	0.07	25.0	2	2	2
PRT	sp|Q01780|EXOSX_HUMAN	Exosome component 10 OS=Homo sapiens OX=9606 GN=EXOSC10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	693-UNIMOD:267	0.02	25.0	1	1	1
PRT	sp|P16949|STMN1_HUMAN	Stathmin OS=Homo sapiens OX=9606 GN=STMN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	27-UNIMOD:267	0.09	25.0	1	1	1
PRT	sp|Q15819|UB2V2_HUMAN	Ubiquitin-conjugating enzyme E2 variant 2 OS=Homo sapiens OX=9606 GN=UBE2V2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.08	25.0	1	1	1
PRT	sp|Q01433-3|AMPD2_HUMAN	Isoform Ex1A-3 of AMP deaminase 2 OS=Homo sapiens OX=9606 GN=AMPD2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	111-UNIMOD:4	0.02	25.0	1	1	1
PRT	sp|O60264|SMCA5_HUMAN	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Homo sapiens OX=9606 GN=SMARCA5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	1001-UNIMOD:4	0.01	25.0	1	1	1
PRT	sp|Q9H2H8|PPIL3_HUMAN	Peptidyl-prolyl cis-trans isomerase-like 3 OS=Homo sapiens OX=9606 GN=PPIL3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.07	25.0	1	1	1
PRT	sp|Q8NC51-4|PAIRB_HUMAN	Isoform 4 of Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	52-UNIMOD:188	0.04	25.0	2	1	0
PRT	sp|P43487-2|RANG_HUMAN	Isoform 2 of Ran-specific GTPase-activating protein OS=Homo sapiens OX=9606 GN=RANBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	150-UNIMOD:188	0.11	25.0	3	2	1
PRT	sp|O60343-2|TBCD4_HUMAN	Isoform 2 of TBC1 domain family member 4 OS=Homo sapiens OX=9606 GN=TBC1D4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	374-UNIMOD:188	0.01	25.0	1	1	0
PRT	sp|O00443|P3C2A_HUMAN	Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha OS=Homo sapiens OX=9606 GN=PIK3C2A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	1414-UNIMOD:188	0.01	25.0	2	1	0
PRT	sp|P17706-2|PTN2_HUMAN	Isoform 2 of Tyrosine-protein phosphatase non-receptor type 2 OS=Homo sapiens OX=9606 GN=PTPN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q52LJ0-1|FA98B_HUMAN	Isoform 1 of Protein FAM98B OS=Homo sapiens OX=9606 GN=FAM98B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|P00387-2|NB5R3_HUMAN	Isoform 2 of NADH-cytochrome b5 reductase 3 OS=Homo sapiens OX=9606 GN=CYB5R3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|O60341|KDM1A_HUMAN	Lysine-specific histone demethylase 1A OS=Homo sapiens OX=9606 GN=KDM1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|P50213|IDH3A_HUMAN	Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=IDH3A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	188-UNIMOD:267	0.03	25.0	2	1	0
PRT	sp|Q15390-2|MTFR1_HUMAN	Isoform 2 of Mitochondrial fission regulator 1 OS=Homo sapiens OX=9606 GN=MTFR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	112-UNIMOD:4,122-UNIMOD:267	0.04	25.0	1	1	1
PRT	sp|P17987|TCPA_HUMAN	T-complex protein 1 subunit alpha OS=Homo sapiens OX=9606 GN=TCP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null	357-UNIMOD:4,365-UNIMOD:188,199-UNIMOD:188	0.04	25.0	5	2	0
PRT	sp|Q6DKI1-2|RL7L_HUMAN	Isoform 2 of 60S ribosomal protein L7-like 1 OS=Homo sapiens OX=9606 GN=RPL7L1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	114-UNIMOD:267	0.07	25.0	1	1	1
PRT	sp|P06239-2|LCK_HUMAN	Isoform Short of Tyrosine-protein kinase Lck OS=Homo sapiens OX=9606 GN=LCK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q9P2Y5|UVRAG_HUMAN	UV radiation resistance-associated gene protein OS=Homo sapiens OX=9606 GN=UVRAG PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	253-UNIMOD:267	0.02	25.0	2	1	0
PRT	sp|Q9NRV9|HEBP1_HUMAN	Heme-binding protein 1 OS=Homo sapiens OX=9606 GN=HEBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	118-UNIMOD:188	0.08	25.0	1	1	1
PRT	sp|Q15075|EEA1_HUMAN	Early endosome antigen 1 OS=Homo sapiens OX=9606 GN=EEA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	534-UNIMOD:188	0.01	25.0	1	1	1
PRT	sp|P19823|ITIH2_HUMAN	Inter-alpha-trypsin inhibitor heavy chain H2 OS=Homo sapiens OX=9606 GN=ITIH2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q00325-2|MPCP_HUMAN	Isoform B of Phosphate carrier protein, mitochondrial OS=Homo sapiens OX=9606 GN=SLC25A3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	200-UNIMOD:267	0.04	25.0	1	1	1
PRT	sp|Q92665|RT31_HUMAN	28S ribosomal protein S31, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS31 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	209-UNIMOD:188	0.03	25.0	2	1	0
PRT	sp|Q7Z5G4-3|GOGA7_HUMAN	Isoform 2 of Golgin subfamily A member 7 OS=Homo sapiens OX=9606 GN=GOLGA7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.12	25.0	1	1	1
PRT	sp|P62760|VISL1_HUMAN	Visinin-like protein 1 OS=Homo sapiens OX=9606 GN=VSNL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.06	25.0	1	1	1
PRT	sp|P16118-2|F261_HUMAN	Isoform 2 of 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Homo sapiens OX=9606 GN=PFKFB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	319-UNIMOD:267	0.03	25.0	1	1	1
PRT	sp|Q99633|PRP18_HUMAN	Pre-mRNA-splicing factor 18 OS=Homo sapiens OX=9606 GN=PRPF18 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	108-UNIMOD:267	0.04	25.0	2	1	0
PRT	sp|Q9H3H3-1|CK068_HUMAN	Isoform 1 of UPF0696 protein C11orf68 OS=Homo sapiens OX=9606 GN=C11orf68	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	193-UNIMOD:267	0.05	25.0	1	1	1
PRT	sp|Q9UKG1|DP13A_HUMAN	DCC-interacting protein 13-alpha OS=Homo sapiens OX=9606 GN=APPL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	563-UNIMOD:267	0.02	25.0	2	1	0
PRT	sp|P00846|ATP6_HUMAN	ATP synthase subunit a OS=Homo sapiens OX=9606 GN=MT-ATP6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	51-UNIMOD:188	0.05	25.0	2	1	0
PRT	sp|O15047|SET1A_HUMAN	Histone-lysine N-methyltransferase SETD1A OS=Homo sapiens OX=9606 GN=SETD1A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q4V328-4|GRAP1_HUMAN	Isoform 4 of GRIP1-associated protein 1 OS=Homo sapiens OX=9606 GN=GRIPAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	796-UNIMOD:4	0.02	25.0	1	1	1
PRT	sp|P21796|VDAC1_HUMAN	Voltage-dependent anion-selective channel protein 1 OS=Homo sapiens OX=9606 GN=VDAC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null	266-UNIMOD:188	0.04	25.0	3	1	0
PRT	sp|P06737-2|PYGL_HUMAN	Isoform 2 of Glycogen phosphorylase, liver form OS=Homo sapiens OX=9606 GN=PYGL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	720-UNIMOD:188	0.02	25.0	1	1	0
PRT	sp|Q9NYL9|TMOD3_HUMAN	Tropomodulin-3 OS=Homo sapiens OX=9606 GN=TMOD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	308-UNIMOD:35,317-UNIMOD:188	0.03	25.0	2	1	0
PRT	sp|P62424|RL7A_HUMAN	60S ribosomal protein L7a OS=Homo sapiens OX=9606 GN=RPL7A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|P26196|DDX6_HUMAN	Probable ATP-dependent RNA helicase DDX6 OS=Homo sapiens OX=9606 GN=DDX6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	390-UNIMOD:4,396-UNIMOD:267	0.02	25.0	2	1	0
PRT	sp|Q9Y2L1|RRP44_HUMAN	Exosome complex exonuclease RRP44 OS=Homo sapiens OX=9606 GN=DIS3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	99-UNIMOD:267	0.01	25.0	2	1	0
PRT	sp|Q96ME1-3|FXL18_HUMAN	Isoform 3 of F-box/LRR-repeat protein 18 OS=Homo sapiens OX=9606 GN=FBXL18	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|A0AVT1-2|UBA6_HUMAN	Isoform 2 of Ubiquitin-like modifier-activating enzyme 6 OS=Homo sapiens OX=9606 GN=UBA6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	225-UNIMOD:4	0.02	25.0	1	1	1
PRT	sp|O75116|ROCK2_HUMAN	Rho-associated protein kinase 2 OS=Homo sapiens OX=9606 GN=ROCK2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q9Y3B9|RRP15_HUMAN	RRP15-like protein OS=Homo sapiens OX=9606 GN=RRP15 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	250-UNIMOD:267	0.04	25.0	1	1	1
PRT	sp|O75874|IDHC_HUMAN	Isocitrate dehydrogenase [NADP] cytoplasmic OS=Homo sapiens OX=9606 GN=IDH1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	269-UNIMOD:4,270-UNIMOD:188	0.03	25.0	1	1	1
PRT	sp|Q8N954|GPT11_HUMAN	G patch domain-containing protein 11 OS=Homo sapiens OX=9606 GN=GPATCH11 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|Q9P2E9-3|RRBP1_HUMAN	Isoform 2 of Ribosome-binding protein 1 OS=Homo sapiens OX=9606 GN=RRBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	537-UNIMOD:267,710-UNIMOD:267	0.03	25.0	2	2	2
PRT	sp|Q8TB52|FBX30_HUMAN	F-box only protein 30 OS=Homo sapiens OX=9606 GN=FBXO30 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q6XZF7|DNMBP_HUMAN	Dynamin-binding protein OS=Homo sapiens OX=9606 GN=DNMBP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	691-UNIMOD:4,697-UNIMOD:267	0.01	25.0	1	1	1
PRT	sp|Q9Y4E8|UBP15_HUMAN	Ubiquitin carboxyl-terminal hydrolase 15 OS=Homo sapiens OX=9606 GN=USP15 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|P20962|PTMS_HUMAN	Parathymosin OS=Homo sapiens OX=9606 GN=PTMS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.12	25.0	1	1	1
PRT	sp|P49848-4|TAF6_HUMAN	Isoform 4 of Transcription initiation factor TFIID subunit 6 OS=Homo sapiens OX=9606 GN=TAF6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	407-UNIMOD:267	0.02	25.0	1	1	1
PRT	sp|P41252|SYIC_HUMAN	Isoleucine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=IARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	1125-UNIMOD:188	0.01	25.0	2	1	0
PRT	sp|Q9H2U1-3|DHX36_HUMAN	Isoform 3 of ATP-dependent DNA/RNA helicase DHX36 OS=Homo sapiens OX=9606 GN=DHX36	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1,11-UNIMOD:267	0.01	25.0	1	1	1
PRT	sp|Q9UMR2-3|DD19B_HUMAN	Isoform 3 of ATP-dependent RNA helicase DDX19B OS=Homo sapiens OX=9606 GN=DDX19B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|P35606-2|COPB2_HUMAN	Isoform 2 of Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	27-UNIMOD:4,32-UNIMOD:267,62-UNIMOD:267	0.02	25.0	3	2	1
PRT	sp|Q15019|SEPT2_HUMAN	Septin-2 OS=Homo sapiens OX=9606 GN=SEPTIN2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	128-UNIMOD:267	0.04	25.0	2	1	0
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	2384-UNIMOD:267	0.02	25.0	4	3	2
PRT	sp|O94874-3|UFL1_HUMAN	Isoform 3 of E3 UFM1-protein ligase 1 OS=Homo sapiens OX=9606 GN=UFL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|P17858|PFKAL_HUMAN	ATP-dependent 6-phosphofructokinase, liver type OS=Homo sapiens OX=9606 GN=PFKL PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	708-UNIMOD:4,713-UNIMOD:188	0.02	25.0	1	1	1
PRT	sp|Q13136-2|LIPA1_HUMAN	Isoform 2 of Liprin-alpha-1 OS=Homo sapiens OX=9606 GN=PPFIA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	2	2	2
PRT	sp|O60508|PRP17_HUMAN	Pre-mRNA-processing factor 17 OS=Homo sapiens OX=9606 GN=CDC40 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	569-UNIMOD:4,576-UNIMOD:188	0.02	25.0	2	1	0
PRT	sp|Q8N7H5-3|PAF1_HUMAN	Isoform 3 of RNA polymerase II-associated factor 1 homolog OS=Homo sapiens OX=9606 GN=PAF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q16629-3|SRSF7_HUMAN	Isoform 3 of Serine/arginine-rich splicing factor 7 OS=Homo sapiens OX=9606 GN=SRSF7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	24-UNIMOD:188	0.10	25.0	1	1	1
PRT	sp|Q8ND30-3|LIPB2_HUMAN	Isoform 3 of Liprin-beta-2 OS=Homo sapiens OX=9606 GN=PPFIBP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	505-UNIMOD:188	0.02	25.0	1	1	1
PRT	sp|P55209-3|NP1L1_HUMAN	Isoform 3 of Nucleosome assembly protein 1-like 1 OS=Homo sapiens OX=9606 GN=NAP1L1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	75-UNIMOD:188	0.04	25.0	2	1	0
PRT	sp|Q96IX5|ATPMD_HUMAN	ATP synthase membrane subunit DAPIT, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5MD PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	27-UNIMOD:267	0.19	25.0	1	1	1
PRT	sp|P23246-2|SFPQ_HUMAN	Isoform Short of Splicing factor, proline- and glutamine-rich OS=Homo sapiens OX=9606 GN=SFPQ	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	330-UNIMOD:188	0.02	25.0	2	1	0
PRT	sp|Q92841|DDX17_HUMAN	Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens OX=9606 GN=DDX17 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.02	25.0	1	1	0
PRT	sp|P05388|RLA0_HUMAN	60S acidic ribosomal protein P0 OS=Homo sapiens OX=9606 GN=RPLP0 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	null	27-UNIMOD:385,27-UNIMOD:4	0.04	25.0	1	1	0
PRT	sp|Q01433-2|AMPD2_HUMAN	Isoform Ex1A-2-3 of AMP deaminase 2 OS=Homo sapiens OX=9606 GN=AMPD2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	null	42-UNIMOD:385,42-UNIMOD:4,43-UNIMOD:188,52-UNIMOD:267	0.02	25.0	2	1	0
PRT	sp|O00429|DNM1L_HUMAN	Dynamin-1-like protein OS=Homo sapiens OX=9606 GN=DNM1L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	null	431-UNIMOD:385,431-UNIMOD:4,441-UNIMOD:267	0.02	25.0	2	1	0
PRT	sp|Q15459|SF3A1_HUMAN	Splicing factor 3A subunit 1 OS=Homo sapiens OX=9606 GN=SF3A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	null	755-UNIMOD:28,756-UNIMOD:188,765-UNIMOD:188	0.02	25.0	2	1	0
PRT	sp|P61224|RAP1B_HUMAN	Ras-related protein Rap-1b OS=Homo sapiens OX=9606 GN=RAP1B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	141-UNIMOD:4,149-UNIMOD:188	0.08	25.0	1	1	0
PRT	sp|P49773|HINT1_HUMAN	Histidine triad nucleotide-binding protein 1 OS=Homo sapiens OX=9606 GN=HINT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	null	84-UNIMOD:385,84-UNIMOD:4,92-UNIMOD:188,95-UNIMOD:267	0.10	25.0	1	1	1
PRT	sp|P22626|ROA2_HUMAN	Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q9UIA9|XPO7_HUMAN	Exportin-7 OS=Homo sapiens OX=9606 GN=XPO7 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	537-UNIMOD:267	0.01	25.0	1	1	1
PRT	sp|P02765|FETUA_HUMAN	Alpha-2-HS-glycoprotein OS=Homo sapiens OX=9606 GN=AHSG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	null	219-UNIMOD:385,219-UNIMOD:4,230-UNIMOD:4	0.04	25.0	1	1	1
PRT	sp|Q14254|FLOT2_HUMAN	Flotillin-2 OS=Homo sapiens OX=9606 GN=FLOT2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	null	308-UNIMOD:28	0.03	25.0	1	1	1
PRT	sp|P05091|ALDH2_HUMAN	Aldehyde dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ALDH2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	208-UNIMOD:35	0.03	25.0	1	1	0
PRT	sp|Q9Y5L4|TIM13_HUMAN	Mitochondrial import inner membrane translocase subunit Tim13 OS=Homo sapiens OX=9606 GN=TIMM13 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	null	50-UNIMOD:385,50-UNIMOD:4,53-UNIMOD:188,64-UNIMOD:188	0.17	25.0	2	1	0
PRT	sp|P51398|RT29_HUMAN	28S ribosomal protein S29, mitochondrial OS=Homo sapiens OX=9606 GN=DAP3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|Q9C005|DPY30_HUMAN	Protein dpy-30 homolog OS=Homo sapiens OX=9606 GN=DPY30 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	null	44-UNIMOD:28	0.12	25.0	1	1	1
PRT	sp|Q9C0C9|UBE2O_HUMAN	(E3-independent) E2 ubiquitin-conjugating enzyme OS=Homo sapiens OX=9606 GN=UBE2O PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	null	353-UNIMOD:385,353-UNIMOD:4,360-UNIMOD:188,365-UNIMOD:188	0.01	25.0	1	1	1
PRT	sp|Q9UKL0|RCOR1_HUMAN	REST corepressor 1 OS=Homo sapiens OX=9606 GN=RCOR1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	null	340-UNIMOD:28,349-UNIMOD:188,350-UNIMOD:267	0.02	25.0	1	1	1
PRT	sp|Q9P2R3|ANFY1_HUMAN	Rabankyrin-5 OS=Homo sapiens OX=9606 GN=ANKFY1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	675-UNIMOD:4,677-UNIMOD:267	0.01	25.0	1	1	1
PRT	sp|Q15773|MLF2_HUMAN	Myeloid leukemia factor 2 OS=Homo sapiens OX=9606 GN=MLF2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	241-UNIMOD:267	0.05	25.0	1	1	1
PRT	sp|Q7L5D6|GET4_HUMAN	Golgi to ER traffic protein 4 homolog OS=Homo sapiens OX=9606 GN=GET4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	122-UNIMOD:267	0.04	25.0	1	1	1
PRT	sp|O14979|HNRDL_HUMAN	Heterogeneous nuclear ribonucleoprotein D-like OS=Homo sapiens OX=9606 GN=HNRNPDL PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	177-UNIMOD:4	0.03	25.0	1	1	1
PRT	sp|Q06210|GFPT1_HUMAN	Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Homo sapiens OX=9606 GN=GFPT1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	620-UNIMOD:4,630-UNIMOD:267	0.02	25.0	1	1	1
PRT	sp|O00410|IPO5_HUMAN	Importin-5 OS=Homo sapiens OX=9606 GN=IPO5 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	457-UNIMOD:267	0.02	25.0	1	1	0
PRT	sp|Q9UID3-2|VPS51_HUMAN	Isoform 2 of Vacuolar protein sorting-associated protein 51 homolog OS=Homo sapiens OX=9606 GN=VPS51	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	297-UNIMOD:4	0.02	24.0	1	1	1
PRT	sp|P62851|RS25_HUMAN	40S ribosomal protein S25 OS=Homo sapiens OX=9606 GN=RPS25 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	94-UNIMOD:188	0.08	24.0	1	1	1
PRT	sp|Q96GQ7|DDX27_HUMAN	Probable ATP-dependent RNA helicase DDX27 OS=Homo sapiens OX=9606 GN=DDX27 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	349-UNIMOD:267,460-UNIMOD:267	0.03	24.0	3	2	1
PRT	sp|Q9UPY3-3|DICER_HUMAN	Isoform 3 of Endoribonuclease Dicer OS=Homo sapiens OX=9606 GN=DICER1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	482-UNIMOD:4,487-UNIMOD:188	0.02	24.0	1	1	1
PRT	sp|Q9Y342|PLLP_HUMAN	Plasmolipin OS=Homo sapiens OX=9606 GN=PLLP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.06	24.0	1	1	1
PRT	sp|Q14244-3|MAP7_HUMAN	Isoform 3 of Ensconsin OS=Homo sapiens OX=9606 GN=MAP7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1,12-UNIMOD:267	0.02	24.0	1	1	1
PRT	sp|Q7Z7K0|COXM1_HUMAN	COX assembly mitochondrial protein homolog OS=Homo sapiens OX=9606 GN=CMC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1,11-UNIMOD:267	0.10	24.0	1	1	1
PRT	sp|O00115-2|DNS2A_HUMAN	Isoform 2 of Deoxyribonuclease-2-alpha OS=Homo sapiens OX=9606 GN=DNASE2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|P57088|TMM33_HUMAN	Transmembrane protein 33 OS=Homo sapiens OX=9606 GN=TMEM33 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.05	24.0	1	1	1
PRT	sp|O00429-4|DNM1L_HUMAN	Isoform 3 of Dynamin-1-like protein OS=Homo sapiens OX=9606 GN=DNM1L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	694-UNIMOD:267,48-UNIMOD:267	0.04	24.0	3	2	1
PRT	sp|P30084|ECHM_HUMAN	Enoyl-CoA hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=ECHS1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.08	24.0	1	1	1
PRT	sp|Q969E2-2|SCAM4_HUMAN	Isoform 2 of Secretory carrier-associated membrane protein 4 OS=Homo sapiens OX=9606 GN=SCAMP4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	162-UNIMOD:267	0.06	24.0	1	1	1
PRT	sp|P25705-2|ATPA_HUMAN	Isoform 2 of ATP synthase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	154-UNIMOD:267,33-UNIMOD:267	0.04	24.0	2	2	2
PRT	sp|Q969V3-2|NCLN_HUMAN	Isoform 2 of Nicalin OS=Homo sapiens OX=9606 GN=NCLN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	207-UNIMOD:267	0.02	24.0	2	1	0
PRT	sp|Q9UBF6-4|RBX2_HUMAN	Isoform 4 of RING-box protein 2 OS=Homo sapiens OX=9606 GN=RNF7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	83-UNIMOD:4,86-UNIMOD:4	0.13	24.0	1	1	1
PRT	sp|P31689-2|DNJA1_HUMAN	Isoform 2 of DnaJ homolog subfamily A member 1 OS=Homo sapiens OX=9606 GN=DNAJA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	302-UNIMOD:4,312-UNIMOD:267	0.04	24.0	1	1	1
PRT	sp|P53618|COPB_HUMAN	Coatomer subunit beta OS=Homo sapiens OX=9606 GN=COPB1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	141-UNIMOD:267	0.01	24.0	1	1	1
PRT	sp|P47895|AL1A3_HUMAN	Aldehyde dehydrogenase family 1 member A3 OS=Homo sapiens OX=9606 GN=ALDH1A3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	421-UNIMOD:188	0.03	24.0	1	1	1
PRT	sp|Q9Y5B0-4|CTDP1_HUMAN	Isoform 4 of RNA polymerase II subunit A C-terminal domain phosphatase OS=Homo sapiens OX=9606 GN=CTDP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	95-UNIMOD:4	0.02	24.0	1	1	1
PRT	sp|Q8N1G4|LRC47_HUMAN	Leucine-rich repeat-containing protein 47 OS=Homo sapiens OX=9606 GN=LRRC47 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q9H845|ACAD9_HUMAN	Complex I assembly factor ACAD9, mitochondrial OS=Homo sapiens OX=9606 GN=ACAD9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	85-UNIMOD:267	0.02	24.0	1	1	1
PRT	sp|P07814|SYEP_HUMAN	Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q8WUM4|PDC6I_HUMAN	Programmed cell death 6-interacting protein OS=Homo sapiens OX=9606 GN=PDCD6IP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	686-UNIMOD:267	0.01	24.0	1	1	1
PRT	sp|O43301|HS12A_HUMAN	Heat shock 70 kDa protein 12A OS=Homo sapiens OX=9606 GN=HSPA12A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q13813-3|SPTN1_HUMAN	Isoform 3 of Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q8WWH5|TRUB1_HUMAN	Probable tRNA pseudouridine synthase 1 OS=Homo sapiens OX=9606 GN=TRUB1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	137-UNIMOD:188	0.04	24.0	2	1	0
PRT	sp|O60488-2|ACSL4_HUMAN	Isoform Short of Long-chain-fatty-acid--CoA ligase 4 OS=Homo sapiens OX=9606 GN=ACSL4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	379-UNIMOD:4	0.02	24.0	1	1	1
PRT	sp|P62269|RS18_HUMAN	40S ribosomal protein S18 OS=Homo sapiens OX=9606 GN=RPS18 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	34-UNIMOD:188,23-UNIMOD:267	0.13	24.0	3	2	1
PRT	sp|Q9NYU2-2|UGGG1_HUMAN	Isoform 2 of UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	948-UNIMOD:267	0.01	24.0	1	1	1
PRT	sp|P19525-2|E2AK2_HUMAN	Isoform 2 of Interferon-induced, double-stranded RNA-activated protein kinase OS=Homo sapiens OX=9606 GN=EIF2AK2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	399-UNIMOD:188	0.02	24.0	1	1	1
PRT	sp|P49189-2|AL9A1_HUMAN	Isoform 2 of 4-trimethylaminobutyraldehyde dehydrogenase OS=Homo sapiens OX=9606 GN=ALDH9A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	256-UNIMOD:267	0.03	24.0	2	1	0
PRT	sp|Q9NR09|BIRC6_HUMAN	Baculoviral IAP repeat-containing protein 6 OS=Homo sapiens OX=9606 GN=BIRC6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	925-UNIMOD:188	0.00	24.0	1	1	1
PRT	sp|Q8IY81|SPB1_HUMAN	pre-rRNA 2'-O-ribose RNA methyltransferase FTSJ3 OS=Homo sapiens OX=9606 GN=FTSJ3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q9Y3P9-2|RBGP1_HUMAN	Isoform 2 of Rab GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RABGAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	479-UNIMOD:188	0.02	24.0	2	1	0
PRT	sp|P16220-3|CREB1_HUMAN	Isoform 3 of Cyclic AMP-responsive element-binding protein 1 OS=Homo sapiens OX=9606 GN=CREB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	150-UNIMOD:267	0.07	24.0	1	1	1
PRT	sp|Q6ICG6-3|K0930_HUMAN	Isoform 3 of Uncharacterized protein KIAA0930 OS=Homo sapiens OX=9606 GN=KIAA0930	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q9P2R7-2|SUCB1_HUMAN	Isoform 2 of Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=SUCLA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	262-UNIMOD:267	0.02	24.0	2	1	0
PRT	sp|Q9UHE8|STEA1_HUMAN	Metalloreductase STEAP1 OS=Homo sapiens OX=9606 GN=STEAP1 PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	332-UNIMOD:188,336-UNIMOD:4	0.03	24.0	1	1	1
PRT	sp|P31150|GDIA_HUMAN	Rab GDP dissociation inhibitor alpha OS=Homo sapiens OX=9606 GN=GDI1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	437-UNIMOD:188	0.03	24.0	2	1	0
PRT	sp|Q9H9Y6-4|RPA2_HUMAN	Isoform 4 of DNA-directed RNA polymerase I subunit RPA2 OS=Homo sapiens OX=9606 GN=POLR1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	607-UNIMOD:188	0.01	24.0	1	1	1
PRT	sp|Q14008-2|CKAP5_HUMAN	Isoform 2 of Cytoskeleton-associated protein 5 OS=Homo sapiens OX=9606 GN=CKAP5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q5SSJ5-3|HP1B3_HUMAN	Isoform 3 of Heterochromatin protein 1-binding protein 3 OS=Homo sapiens OX=9606 GN=HP1BP3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q86Y56-2|DAAF5_HUMAN	Isoform 2 of Dynein assembly factor 5, axonemal OS=Homo sapiens OX=9606 GN=DNAAF5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	262-UNIMOD:267	0.01	24.0	1	1	1
PRT	sp|Q8TE67-2|ES8L3_HUMAN	Isoform 2 of Epidermal growth factor receptor kinase substrate 8-like protein 3 OS=Homo sapiens OX=9606 GN=EPS8L3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q13247-3|SRSF6_HUMAN	Isoform SRP55-3 of Serine/arginine-rich splicing factor 6 OS=Homo sapiens OX=9606 GN=SRSF6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|P20674|COX5A_HUMAN	Cytochrome c oxidase subunit 5A, mitochondrial OS=Homo sapiens OX=9606 GN=COX5A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	107-UNIMOD:267	0.07	24.0	1	1	1
PRT	sp|Q04323|UBXN1_HUMAN	UBX domain-containing protein 1 OS=Homo sapiens OX=9606 GN=UBXN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	231-UNIMOD:267	0.04	24.0	2	1	0
PRT	sp|O60244|MED14_HUMAN	Mediator of RNA polymerase II transcription subunit 14 OS=Homo sapiens OX=9606 GN=MED14 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	960-UNIMOD:188	0.01	24.0	1	1	1
PRT	sp|Q9H0N0|RAB6C_HUMAN	Ras-related protein Rab-6C OS=Homo sapiens OX=9606 GN=RAB6C PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	74-UNIMOD:267	0.04	24.0	2	1	0
PRT	sp|O00154-2|BACH_HUMAN	Isoform 2 of Cytosolic acyl coenzyme A thioester hydrolase OS=Homo sapiens OX=9606 GN=ACOT7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	37-UNIMOD:35,48-UNIMOD:267,141-UNIMOD:267	0.10	24.0	3	2	1
PRT	sp|P42696|RBM34_HUMAN	RNA-binding protein 34 OS=Homo sapiens OX=9606 GN=RBM34 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	272-UNIMOD:267	0.03	24.0	1	1	1
PRT	sp|O75691|UTP20_HUMAN	Small subunit processome component 20 homolog OS=Homo sapiens OX=9606 GN=UTP20 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	1790-UNIMOD:267	0.01	24.0	1	1	1
PRT	sp|P30153|2AAA_HUMAN	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R1A PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	174-UNIMOD:4	0.02	24.0	1	1	1
PRT	sp|P09622|DLDH_HUMAN	Dihydrolipoyl dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=DLD PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	24.0	null	334-UNIMOD:267	0.03	24.0	2	1	0
PRT	sp|Q9ULW3|ABT1_HUMAN	Activator of basal transcription 1 OS=Homo sapiens OX=9606 GN=ABT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	74-UNIMOD:267	0.04	24.0	1	1	1
PRT	sp|O00764-3|PDXK_HUMAN	Isoform 3 of Pyridoxal kinase OS=Homo sapiens OX=9606 GN=PDXK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	145-UNIMOD:267	0.05	24.0	1	1	1
PRT	sp|Q07960|RHG01_HUMAN	Rho GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=ARHGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|O60487|MPZL2_HUMAN	Myelin protein zero-like protein 2 OS=Homo sapiens OX=9606 GN=MPZL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	139-UNIMOD:267	0.07	24.0	1	1	1
PRT	sp|Q13330-2|MTA1_HUMAN	Isoform Short of Metastasis-associated protein MTA1 OS=Homo sapiens OX=9606 GN=MTA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	218-UNIMOD:267	0.03	24.0	1	1	1
PRT	sp|Q16555-2|DPYL2_HUMAN	Isoform 2 of Dihydropyrimidinase-related protein 2 OS=Homo sapiens OX=9606 GN=DPYSL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	20-UNIMOD:188	0.03	24.0	1	1	1
PRT	sp|P48637-2|GSHB_HUMAN	Isoform 2 of Glutathione synthetase OS=Homo sapiens OX=9606 GN=GSS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	172-UNIMOD:267	0.03	24.0	1	1	1
PRT	sp|P49207|RL34_HUMAN	60S ribosomal protein L34 OS=Homo sapiens OX=9606 GN=RPL34 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	46-UNIMOD:4,49-UNIMOD:4,52-UNIMOD:267	0.09	24.0	2	1	0
PRT	sp|P57740|NU107_HUMAN	Nuclear pore complex protein Nup107 OS=Homo sapiens OX=9606 GN=NUP107 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	15-UNIMOD:267	0.01	24.0	2	1	0
PRT	sp|P11172|UMPS_HUMAN	Uridine 5'-monophosphate synthase OS=Homo sapiens OX=9606 GN=UMPS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	41-UNIMOD:267	0.03	24.0	1	1	1
PRT	sp|P52429|DGKE_HUMAN	Diacylglycerol kinase epsilon OS=Homo sapiens OX=9606 GN=DGKE PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	241-UNIMOD:267	0.03	24.0	1	1	1
PRT	sp|P84090|ERH_HUMAN	Enhancer of rudimentary homolog OS=Homo sapiens OX=9606 GN=ERH PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1,12-UNIMOD:188	0.12	24.0	1	1	1
PRT	sp|Q8ND76-3|CCNY_HUMAN	Isoform 3 of Cyclin-Y OS=Homo sapiens OX=9606 GN=CCNY	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	242-UNIMOD:267	0.06	24.0	2	1	0
PRT	sp|O94832|MYO1D_HUMAN	Unconventional myosin-Id OS=Homo sapiens OX=9606 GN=MYO1D PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	605-UNIMOD:267	0.01	24.0	1	1	1
PRT	sp|P62837-2|UB2D2_HUMAN	Isoform 2 of Ubiquitin-conjugating enzyme E2 D2 OS=Homo sapiens OX=9606 GN=UBE2D2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	72-UNIMOD:188	0.10	24.0	1	1	1
PRT	sp|O75947-2|ATP5H_HUMAN	Isoform 2 of ATP synthase subunit d, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5PD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.07	24.0	1	1	1
PRT	sp|Q14683|SMC1A_HUMAN	Structural maintenance of chromosomes protein 1A OS=Homo sapiens OX=9606 GN=SMC1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	24.0	null	160-UNIMOD:267	0.01	24.0	2	1	0
PRT	sp|Q06323-3|PSME1_HUMAN	Isoform 3 of Proteasome activator complex subunit 1 OS=Homo sapiens OX=9606 GN=PSME1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.05	24.0	1	1	1
PRT	sp|Q9P2J5|SYLC_HUMAN	Leucine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=LARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	24.0	null	832-UNIMOD:188,70-UNIMOD:4,78-UNIMOD:267	0.02	24.0	3	2	1
PRT	sp|Q8N163-2|CCAR2_HUMAN	Isoform 2 of Cell cycle and apoptosis regulator protein 2 OS=Homo sapiens OX=9606 GN=CCAR2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	865-UNIMOD:267	0.01	24.0	1	1	1
PRT	sp|O75152|ZC11A_HUMAN	Zinc finger CCCH domain-containing protein 11A OS=Homo sapiens OX=9606 GN=ZC3H11A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	368-UNIMOD:267	0.01	24.0	2	1	0
PRT	sp|P04083|ANXA1_HUMAN	Annexin A1 OS=Homo sapiens OX=9606 GN=ANXA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	124-UNIMOD:267	0.03	24.0	1	1	1
PRT	sp|Q9C040|TRIM2_HUMAN	Tripartite motif-containing protein 2 OS=Homo sapiens OX=9606 GN=TRIM2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	658-UNIMOD:188	0.02	24.0	1	1	1
PRT	sp|O75582-2|KS6A5_HUMAN	Isoform 2 of Ribosomal protein S6 kinase alpha-5 OS=Homo sapiens OX=9606 GN=RPS6KA5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	53-UNIMOD:188	0.02	24.0	2	1	0
PRT	sp|Q16762|THTR_HUMAN	Thiosulfate sulfurtransferase OS=Homo sapiens OX=9606 GN=TST PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|P61960|UFM1_HUMAN	Ubiquitin-fold modifier 1 OS=Homo sapiens OX=9606 GN=UFM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.19	24.0	1	1	1
PRT	sp|Q96H55-2|MYO19_HUMAN	Isoform 2 of Unconventional myosin-XIX OS=Homo sapiens OX=9606 GN=MYO19	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|Q5TA45-2|INT11_HUMAN	Isoform 2 of Integrator complex subunit 11 OS=Homo sapiens OX=9606 GN=INTS11	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|P08243-3|ASNS_HUMAN	Isoform 3 of Asparagine synthetase [glutamine-hydrolyzing] OS=Homo sapiens OX=9606 GN=ASNS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	467-UNIMOD:267	0.02	24.0	1	1	1
PRT	sp|Q13435|SF3B2_HUMAN	Splicing factor 3B subunit 2 OS=Homo sapiens OX=9606 GN=SF3B2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|P55884|EIF3B_HUMAN	Eukaryotic translation initiation factor 3 subunit B OS=Homo sapiens OX=9606 GN=EIF3B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	302-UNIMOD:4,303-UNIMOD:267,515-UNIMOD:4	0.02	24.0	3	2	1
PRT	sp|P02533|K1C14_HUMAN	Keratin, type I cytoskeletal 14 OS=Homo sapiens OX=9606 GN=KRT14 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	232-UNIMOD:267	0.02	24.0	2	1	0
PRT	sp|Q13813|SPTN1_HUMAN	Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	1418-UNIMOD:28,1419-UNIMOD:188,1427-UNIMOD:267	0.00	24.0	2	1	0
PRT	sp|P40925|MDHC_HUMAN	Malate dehydrogenase, cytoplasmic OS=Homo sapiens OX=9606 GN=MDH1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	310-UNIMOD:267	0.04	24.0	1	1	0
PRT	sp|P06737|PYGL_HUMAN	Glycogen phosphorylase, liver form OS=Homo sapiens OX=9606 GN=PYGL PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	754-UNIMOD:188	0.02	24.0	1	1	0
PRT	sp|Q7Z4H3|HDDC2_HUMAN	HD domain-containing protein 2 OS=Homo sapiens OX=9606 GN=HDDC2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	108-UNIMOD:28,118-UNIMOD:267,119-UNIMOD:188	0.06	24.0	1	1	1
PRT	sp|P62633|CNBP_HUMAN	Cellular nucleic acid-binding protein OS=Homo sapiens OX=9606 GN=CNBP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	119-UNIMOD:385,119-UNIMOD:4,122-UNIMOD:4,130-UNIMOD:188	0.07	24.0	2	1	0
PRT	sp|Q9BRT8|CBWD1_HUMAN	COBW domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CBWD1 PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	234-UNIMOD:267	0.04	24.0	1	1	0
PRT	sp|P08729|K2C7_HUMAN	Keratin, type II cytoskeletal 7 OS=Homo sapiens OX=9606 GN=KRT7 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q14C86|GAPD1_HUMAN	GTPase-activating protein and VPS9 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=GAPVD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	1222-UNIMOD:28,1233-UNIMOD:267	0.01	24.0	1	1	1
PRT	sp|Q9UBW7|ZMYM2_HUMAN	Zinc finger MYM-type protein 2 OS=Homo sapiens OX=9606 GN=ZMYM2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	313-UNIMOD:28,325-UNIMOD:188,328-UNIMOD:188	0.01	24.0	1	1	1
PRT	sp|Q92620|PRP16_HUMAN	Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Homo sapiens OX=9606 GN=DHX38 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q6NTF9-2|RHBD2_HUMAN	Isoform 2 of Rhomboid domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RHBDD2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	24-UNIMOD:27,37-UNIMOD:267	0.04	24.0	1	1	1
PRT	sp|Q14393|GAS6_HUMAN	Growth arrest-specific protein 6 OS=Homo sapiens OX=9606 GN=GAS6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	414-UNIMOD:267	0.02	24.0	1	1	1
PRT	sp|Q8WTV0|SCRB1_HUMAN	Scavenger receptor class B member 1 OS=Homo sapiens OX=9606 GN=SCARB1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	57-UNIMOD:188	0.02	24.0	1	1	1
PRT	sp|Q9P2D1|CHD7_HUMAN	Chromodomain-helicase-DNA-binding protein 7 OS=Homo sapiens OX=9606 GN=CHD7 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	148-UNIMOD:267	0.01	24.0	1	1	1
PRT	sp|Q9UNK0|STX8_HUMAN	Syntaxin-8 OS=Homo sapiens OX=9606 GN=STX8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.07	24.0	1	1	1
PRT	sp|P34897|GLYM_HUMAN	Serine hydroxymethyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=SHMT2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	91-UNIMOD:4	0.03	24.0	1	1	1
PRT	sp|P21333|FLNA_HUMAN	Filamin-A OS=Homo sapiens OX=9606 GN=FLNA PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	1477-UNIMOD:188	0.01	24.0	1	1	1
PRT	sp|P08559|ODPA_HUMAN	Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial OS=Homo sapiens OX=9606 GN=PDHA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	261-UNIMOD:4,263-UNIMOD:267	0.03	24.0	1	1	0
PRT	sp|Q01518-2|CAP1_HUMAN	Isoform 2 of Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1,10-UNIMOD:267,13-UNIMOD:267	0.03	23.0	1	1	1
PRT	sp|Q9NQL2-2|RRAGD_HUMAN	Isoform 2 of Ras-related GTP-binding protein D OS=Homo sapiens OX=9606 GN=RRAGD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	117-UNIMOD:188	0.04	23.0	1	1	1
PRT	sp|P61163|ACTZ_HUMAN	Alpha-centractin OS=Homo sapiens OX=9606 GN=ACTR1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|P50453|SPB9_HUMAN	Serpin B9 OS=Homo sapiens OX=9606 GN=SERPINB9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q96T88|UHRF1_HUMAN	E3 ubiquitin-protein ligase UHRF1 OS=Homo sapiens OX=9606 GN=UHRF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	759-UNIMOD:4,762-UNIMOD:4,763-UNIMOD:267	0.01	23.0	1	1	1
PRT	sp|Q9H3H1-4|MOD5_HUMAN	Isoform 4 of tRNA dimethylallyltransferase OS=Homo sapiens OX=9606 GN=TRIT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	112-UNIMOD:267	0.03	23.0	1	1	1
PRT	sp|Q9NVA2|SEP11_HUMAN	Septin-11 OS=Homo sapiens OX=9606 GN=SEPTIN11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.03	23.0	1	1	1
PRT	sp|O15382-2|BCAT2_HUMAN	Isoform B of Branched-chain-amino-acid aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=BCAT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	137-UNIMOD:188	0.04	23.0	1	1	1
PRT	sp|Q14643-4|ITPR1_HUMAN	Isoform 4 of Inositol 1,4,5-trisphosphate receptor type 1 OS=Homo sapiens OX=9606 GN=ITPR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	1382-UNIMOD:4	0.00	23.0	2	1	0
PRT	sp|Q15554|TERF2_HUMAN	Telomeric repeat-binding factor 2 OS=Homo sapiens OX=9606 GN=TERF2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	369-UNIMOD:188	0.03	23.0	1	1	1
PRT	sp|O95169-3|NDUB8_HUMAN	Isoform 3 of NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFB8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	67-UNIMOD:267	0.08	23.0	2	1	0
PRT	sp|P51114-3|FXR1_HUMAN	Isoform 3 of Fragile X mental retardation syndrome-related protein 1 OS=Homo sapiens OX=9606 GN=FXR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	256-UNIMOD:188	0.03	23.0	1	1	1
PRT	sp|Q16891-3|MIC60_HUMAN	Isoform 3 of MICOS complex subunit MIC60 OS=Homo sapiens OX=9606 GN=IMMT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q8N766-3|EMC1_HUMAN	Isoform 3 of ER membrane protein complex subunit 1 OS=Homo sapiens OX=9606 GN=EMC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q9BSJ8|ESYT1_HUMAN	Extended synaptotagmin-1 OS=Homo sapiens OX=9606 GN=ESYT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|P49792|RBP2_HUMAN	E3 SUMO-protein ligase RanBP2 OS=Homo sapiens OX=9606 GN=RANBP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	1910-UNIMOD:188	0.00	23.0	2	1	0
PRT	sp|P82979|SARNP_HUMAN	SAP domain-containing ribonucleoprotein OS=Homo sapiens OX=9606 GN=SARNP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.05	23.0	1	1	1
PRT	sp|P46977|STT3A_HUMAN	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Homo sapiens OX=9606 GN=STT3A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	67-UNIMOD:188	0.01	23.0	2	1	0
PRT	sp|P62330|ARF6_HUMAN	ADP-ribosylation factor 6 OS=Homo sapiens OX=9606 GN=ARF6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.07	23.0	1	1	1
PRT	sp|P78371-2|TCPB_HUMAN	Isoform 2 of T-complex protein 1 subunit beta OS=Homo sapiens OX=9606 GN=CCT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q16630-3|CPSF6_HUMAN	Isoform 3 of Cleavage and polyadenylation specificity factor subunit 6 OS=Homo sapiens OX=9606 GN=CPSF6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q9H444|CHM4B_HUMAN	Charged multivesicular body protein 4b OS=Homo sapiens OX=9606 GN=CHMP4B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.05	23.0	1	1	1
PRT	sp|Q00688|FKBP3_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP3 OS=Homo sapiens OX=9606 GN=FKBP3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.05	23.0	1	1	1
PRT	sp|O60294|TYW4_HUMAN	tRNA wybutosine-synthesizing protein 4 OS=Homo sapiens OX=9606 GN=LCMT2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	133-UNIMOD:4	0.02	23.0	1	1	1
PRT	sp|Q9C0B1|FTO_HUMAN	Alpha-ketoglutarate-dependent dioxygenase FTO OS=Homo sapiens OX=9606 GN=FTO PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	104-UNIMOD:4	0.02	23.0	1	1	1
PRT	sp|O60925|PFD1_HUMAN	Prefoldin subunit 1 OS=Homo sapiens OX=9606 GN=PFDN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	39-UNIMOD:267	0.10	23.0	1	1	1
PRT	sp|O75251-2|NDUS7_HUMAN	Isoform 2 of NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.05	23.0	1	1	1
PRT	sp|P13804-2|ETFA_HUMAN	Isoform 2 of Electron transfer flavoprotein subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ETFA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.05	23.0	1	1	1
PRT	sp|Q9Y678|COPG1_HUMAN	Coatomer subunit gamma-1 OS=Homo sapiens OX=9606 GN=COPG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	85-UNIMOD:267	0.01	23.0	2	1	0
PRT	sp|Q7L576-2|CYFP1_HUMAN	Isoform 2 of Cytoplasmic FMR1-interacting protein 1 OS=Homo sapiens OX=9606 GN=CYFIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q92841-1|DDX17_HUMAN	Isoform 2 of Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens OX=9606 GN=DDX17	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q5JSZ5-5|PRC2B_HUMAN	Isoform 1 of Protein PRRC2B OS=Homo sapiens OX=9606 GN=PRRC2B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	176-UNIMOD:188	0.01	23.0	2	1	0
PRT	sp|Q9P232|CNTN3_HUMAN	Contactin-3 OS=Homo sapiens OX=9606 GN=CNTN3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q15435-2|PP1R7_HUMAN	Isoform 2 of Protein phosphatase 1 regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PPP1R7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	242-UNIMOD:267	0.03	23.0	1	1	1
PRT	sp|Q13617|CUL2_HUMAN	Cullin-2 OS=Homo sapiens OX=9606 GN=CUL2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	423-UNIMOD:188	0.01	23.0	1	1	1
PRT	sp|Q00341|VIGLN_HUMAN	Vigilin OS=Homo sapiens OX=9606 GN=HDLBP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q14653|IRF3_HUMAN	Interferon regulatory factor 3 OS=Homo sapiens OX=9606 GN=IRF3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	236-UNIMOD:267	0.02	23.0	1	1	1
PRT	sp|Q68EM7-4|RHG17_HUMAN	Isoform 4 of Rho GTPase-activating protein 17 OS=Homo sapiens OX=9606 GN=ARHGAP17	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|Q9UQ13-2|SHOC2_HUMAN	Isoform 2 of Leucine-rich repeat protein SHOC-2 OS=Homo sapiens OX=9606 GN=SHOC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q16204|CCDC6_HUMAN	Coiled-coil domain-containing protein 6 OS=Homo sapiens OX=9606 GN=CCDC6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	287-UNIMOD:35	0.02	23.0	1	1	1
PRT	sp|Q16795|NDUA9_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFA9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q9Y5Q8-2|TF3C5_HUMAN	Isoform 2 of General transcription factor 3C polypeptide 5 OS=Homo sapiens OX=9606 GN=GTF3C5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	39-UNIMOD:35,51-UNIMOD:267	0.03	23.0	1	1	1
PRT	sp|Q9NVJ2|ARL8B_HUMAN	ADP-ribosylation factor-like protein 8B OS=Homo sapiens OX=9606 GN=ARL8B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	155-UNIMOD:267	0.05	23.0	1	1	1
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	278-UNIMOD:35	0.05	23.0	1	1	1
PRT	sp|P35222|CTNB1_HUMAN	Catenin beta-1 OS=Homo sapiens OX=9606 GN=CTNNB1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	661-UNIMOD:267	0.02	23.0	2	1	0
PRT	sp|P43246-2|MSH2_HUMAN	Isoform 2 of DNA mismatch repair protein Msh2 OS=Homo sapiens OX=9606 GN=MSH2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	2	2	2
PRT	sp|Q9BYD1|RM13_HUMAN	39S ribosomal protein L13, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL13 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	23.0	null		0.06	23.0	2	1	0
PRT	sp|Q99797|MIPEP_HUMAN	Mitochondrial intermediate peptidase OS=Homo sapiens OX=9606 GN=MIPEP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q9BZI7-2|REN3B_HUMAN	Isoform 2 of Regulator of nonsense transcripts 3B OS=Homo sapiens OX=9606 GN=UPF3B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|P61009|SPCS3_HUMAN	Signal peptidase complex subunit 3 OS=Homo sapiens OX=9606 GN=SPCS3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.06	23.0	1	1	1
PRT	sp|P54709|AT1B3_HUMAN	Sodium/potassium-transporting ATPase subunit beta-3 OS=Homo sapiens OX=9606 GN=ATP1B3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	97-UNIMOD:267	0.04	23.0	1	1	1
PRT	sp|Q99848|EBP2_HUMAN	Probable rRNA-processing protein EBP2 OS=Homo sapiens OX=9606 GN=EBNA1BP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|Q08257-3|QOR_HUMAN	Isoform 3 of Quinone oxidoreductase OS=Homo sapiens OX=9606 GN=CRYZ	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	138-UNIMOD:267	0.05	23.0	1	1	1
PRT	sp|Q5VTL8-2|PR38B_HUMAN	Isoform 2 of Pre-mRNA-splicing factor 38B OS=Homo sapiens OX=9606 GN=PRPF38B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.07	23.0	1	1	1
PRT	sp|Q5SRE5-2|NU188_HUMAN	Isoform 2 of Nucleoporin NUP188 homolog OS=Homo sapiens OX=9606 GN=NUP188	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|P53367-2|ARFP1_HUMAN	Isoform A of Arfaptin-1 OS=Homo sapiens OX=9606 GN=ARFIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|Q99459|CDC5L_HUMAN	Cell division cycle 5-like protein OS=Homo sapiens OX=9606 GN=CDC5L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	414-UNIMOD:267	0.02	23.0	1	1	1
PRT	sp|O00214|LEG8_HUMAN	Galectin-8 OS=Homo sapiens OX=9606 GN=LGALS8 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	222-UNIMOD:188	0.03	23.0	1	1	1
PRT	sp|Q2TB10|ZN800_HUMAN	Zinc finger protein 800 OS=Homo sapiens OX=9606 GN=ZNF800 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	49-UNIMOD:4,51-UNIMOD:267	0.02	23.0	1	1	1
PRT	sp|Q92888-2|ARHG1_HUMAN	Isoform 2 of Rho guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=ARHGEF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	366-UNIMOD:267	0.02	23.0	1	1	1
PRT	sp|P14314-2|GLU2B_HUMAN	Isoform 2 of Glucosidase 2 subunit beta OS=Homo sapiens OX=9606 GN=PRKCSH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|O43524-2|FOXO3_HUMAN	Isoform 2 of Forkhead box protein O3 OS=Homo sapiens OX=9606 GN=FOXO3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	22-UNIMOD:188	0.03	23.0	1	1	1
PRT	sp|Q9BUP3-2|HTAI2_HUMAN	Isoform 2 of Oxidoreductase HTATIP2 OS=Homo sapiens OX=9606 GN=HTATIP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	32-UNIMOD:267	0.11	23.0	1	1	1
PRT	sp|O43148|MCES_HUMAN	mRNA cap guanine-N7 methyltransferase OS=Homo sapiens OX=9606 GN=RNMT PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	190-UNIMOD:188	0.02	23.0	2	1	0
PRT	sp|Q9H267-2|VP33B_HUMAN	Isoform 2 of Vacuolar protein sorting-associated protein 33B OS=Homo sapiens OX=9606 GN=VPS33B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q96BI1|S22AI_HUMAN	Solute carrier family 22 member 18 OS=Homo sapiens OX=9606 GN=SLC22A18 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|P98170|XIAP_HUMAN	E3 ubiquitin-protein ligase XIAP OS=Homo sapiens OX=9606 GN=XIAP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|P31153|METK2_HUMAN	S-adenosylmethionine synthase isoform type-2 OS=Homo sapiens OX=9606 GN=MAT2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|Q6ZSR9|YJ005_HUMAN	Uncharacterized protein FLJ45252 OS=Homo sapiens OX=9606 PE=2 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	350-UNIMOD:188	0.05	23.0	1	1	1
PRT	sp|Q96A33-2|CCD47_HUMAN	Isoform 2 of Coiled-coil domain-containing protein 47 OS=Homo sapiens OX=9606 GN=CCDC47	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	214-UNIMOD:4,215-UNIMOD:4,223-UNIMOD:267	0.03	23.0	1	1	1
PRT	sp|O00232-2|PSD12_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 12 OS=Homo sapiens OX=9606 GN=PSMD12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	171-UNIMOD:267	0.02	23.0	1	1	1
PRT	sp|Q9UEE9-2|CFDP1_HUMAN	Isoform 2 of Craniofacial development protein 1 OS=Homo sapiens OX=9606 GN=CFDP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	177-UNIMOD:267	0.05	23.0	2	1	0
PRT	sp|O00170|AIP_HUMAN	AH receptor-interacting protein OS=Homo sapiens OX=9606 GN=AIP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	304-UNIMOD:267	0.05	23.0	2	1	0
PRT	sp|P20073-2|ANXA7_HUMAN	Isoform 2 of Annexin A7 OS=Homo sapiens OX=9606 GN=ANXA7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	263-UNIMOD:4	0.02	23.0	1	1	1
PRT	sp|P39019|RS19_HUMAN	40S ribosomal protein S19 OS=Homo sapiens OX=9606 GN=RPS19 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.14	23.0	2	2	2
PRT	sp|Q9UHD8-7|SEPT9_HUMAN	Isoform 7 of Septin-9 OS=Homo sapiens OX=9606 GN=SEPTIN9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	167-UNIMOD:188	0.03	23.0	1	1	1
PRT	sp|P62937|PPIA_HUMAN	Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	28-UNIMOD:188	0.06	23.0	2	1	0
PRT	sp|Q9Y262|EIF3L_HUMAN	Eukaryotic translation initiation factor 3 subunit L OS=Homo sapiens OX=9606 GN=EIF3L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	153-UNIMOD:267	0.02	23.0	1	1	1
PRT	sp|Q86Y39|NDUAB_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 OS=Homo sapiens OX=9606 GN=NDUFA11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	55-UNIMOD:188	0.11	23.0	1	1	1
PRT	sp|P15924-2|DESP_HUMAN	Isoform DPII of Desmoplakin OS=Homo sapiens OX=9606 GN=DSP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	103-UNIMOD:267	0.00	23.0	1	1	1
PRT	sp|Q13885|TBB2A_HUMAN	Tubulin beta-2A chain OS=Homo sapiens OX=9606 GN=TUBB2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	354-UNIMOD:4,359-UNIMOD:267	0.02	23.0	1	1	0
PRT	sp|P13646|K1C13_HUMAN	Keratin, type I cytoskeletal 13 OS=Homo sapiens OX=9606 GN=KRT13 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	114-UNIMOD:267	0.02	23.0	3	1	0
PRT	sp|P68363|TBA1B_HUMAN	Tubulin alpha-1B chain OS=Homo sapiens OX=9606 GN=TUBA1B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	347-UNIMOD:4,352-UNIMOD:188	0.03	23.0	1	1	0
PRT	sp|P50570|DYN2_HUMAN	Dynamin-2 OS=Homo sapiens OX=9606 GN=DNM2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	null	2-UNIMOD:1	0.02	23.0	1	1	1
PRT	sp|O95757|HS74L_HUMAN	Heat shock 70 kDa protein 4L OS=Homo sapiens OX=9606 GN=HSPA4L PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	23.0	null	310-UNIMOD:4,316-UNIMOD:267,589-UNIMOD:4,590-UNIMOD:267	0.03	23.0	2	2	2
PRT	sp|P50552|VASP_HUMAN	Vasodilator-stimulated phosphoprotein OS=Homo sapiens OX=9606 GN=VASP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	null	144-UNIMOD:28	0.03	23.0	1	1	1
PRT	sp|P46459|NSF_HUMAN	Vesicle-fusing ATPase OS=Homo sapiens OX=9606 GN=NSF PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	1	1	0
PRT	sp|O14653|GOSR2_HUMAN	Golgi SNAP receptor complex member 2 OS=Homo sapiens OX=9606 GN=GOSR2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	null	11-UNIMOD:28,18-UNIMOD:4	0.06	23.0	1	1	1
PRT	sp|O00203|AP3B1_HUMAN	AP-3 complex subunit beta-1 OS=Homo sapiens OX=9606 GN=AP3B1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	563-UNIMOD:188	0.01	23.0	1	1	0
PRT	sp|Q13404|UB2V1_HUMAN	Ubiquitin-conjugating enzyme E2 variant 1 OS=Homo sapiens OX=9606 GN=UBE2V1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	null	2-UNIMOD:1,10-UNIMOD:188,13-UNIMOD:267	0.09	23.0	1	1	0
PRT	sp|Q92499|DDX1_HUMAN	ATP-dependent RNA helicase DDX1 OS=Homo sapiens OX=9606 GN=DDX1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	506-UNIMOD:35,513-UNIMOD:4,514-UNIMOD:267	0.01	23.0	1	1	1
PRT	sp|Q96QK1|VPS35_HUMAN	Vacuolar protein sorting-associated protein 35 OS=Homo sapiens OX=9606 GN=VPS35 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	null	640-UNIMOD:385,640-UNIMOD:4,650-UNIMOD:267	0.02	23.0	1	1	1
PRT	sp|O95602|RPA1_HUMAN	DNA-directed RNA polymerase I subunit RPA1 OS=Homo sapiens OX=9606 GN=POLR1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	null	521-UNIMOD:28,531-UNIMOD:188,536-UNIMOD:188	0.01	23.0	1	1	1
PRT	sp|O14745|NHRF1_HUMAN	Na(+)/H(+) exchange regulatory cofactor NHE-RF1 OS=Homo sapiens OX=9606 GN=SLC9A3R1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	null	211-UNIMOD:28,220-UNIMOD:267	0.03	23.0	2	1	0
PRT	sp|Q93008|USP9X_HUMAN	Probable ubiquitin carboxyl-terminal hydrolase FAF-X OS=Homo sapiens OX=9606 GN=USP9X PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.00	23.0	1	1	1
PRT	sp|Q8NFV4|ABHDB_HUMAN	Protein ABHD11 OS=Homo sapiens OX=9606 GN=ABHD11 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	195-UNIMOD:267	0.03	23.0	1	1	1
PRT	sp|P47897|SYQ_HUMAN	Glutamine--tRNA ligase OS=Homo sapiens OX=9606 GN=QARS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	null	255-UNIMOD:28	0.02	23.0	1	1	1
PRT	sp|Q03111|ENL_HUMAN	Protein ENL OS=Homo sapiens OX=9606 GN=MLLT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q92896|GSLG1_HUMAN	Golgi apparatus protein 1 OS=Homo sapiens OX=9606 GN=GLG1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	null	1089-UNIMOD:28,1092-UNIMOD:4	0.01	23.0	1	1	1
PRT	sp|O75940|SPF30_HUMAN	Survival of motor neuron-related-splicing factor 30 OS=Homo sapiens OX=9606 GN=SMNDC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	208-UNIMOD:188	0.05	23.0	1	1	1
PRT	sp|Q96T51|RUFY1_HUMAN	RUN and FYVE domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RUFY1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	null	650-UNIMOD:28,651-UNIMOD:4,659-UNIMOD:267	0.02	23.0	1	1	1
PRT	sp|P11171|41_HUMAN	Protein 4.1 OS=Homo sapiens OX=9606 GN=EPB41 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|P12757|SKIL_HUMAN	Ski-like protein OS=Homo sapiens OX=9606 GN=SKIL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	32-UNIMOD:35,41-UNIMOD:188	0.02	23.0	1	1	1
PRT	sp|O43795|MYO1B_HUMAN	Unconventional myosin-Ib OS=Homo sapiens OX=9606 GN=MYO1B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q6ZRS4|ITPI1_HUMAN	Protein ITPRID1 OS=Homo sapiens OX=9606 GN=ITPRID1 PE=2 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	1-UNIMOD:1,5-UNIMOD:188,18-UNIMOD:188	0.02	23.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	ASPAGTAGGPGAGAAAGGTGPLAAR	1	sp|Q12962|TAF10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	56.0	25-UNIMOD:267	ms_run[1]:scan=4525	28.363803333333333	2	1974.010632	1972.995420	K	A	43	68
PSM	AAAAVGAGHGAGGPGAASSSGGAR	2	sp|Q96K37|S35E1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	1-UNIMOD:1	ms_run[2]:scan=2903	19.695	2	1905.9041	1905.9041	M	E	2	26
PSM	APPAPGPASGGSGEVDELFDVK	3	sp|O14579-3|COPE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0		ms_run[2]:scan=10228	60.175	2	2096.0062	2096.0062	M	N	2	24
PSM	ASPAGTAGGPGAGAAAGGTGPLAAR	4	sp|Q12962|TAF10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0		ms_run[2]:scan=4501	28.237	2	1962.9872	1962.9872	K	A	43	68
PSM	TVATPLNQVANPNSAIFGGAR	5	sp|Q15056-2|IF4H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	21-UNIMOD:267	ms_run[2]:scan=10020	58.922	2	2107.105	2107.1050	R	P	197	218
PSM	SSGAPAPGSGATIFALSSGQGR	6	sp|Q969Y2-3|GTPB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0		ms_run[2]:scan=8703	51.082	2	1974.9759	1974.9759	R	C	24	46
PSM	QVPGGGGGGGSGGGGGSGGGGSGGGR	7	sp|Q9UHB9-4|SRP68_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	26-UNIMOD:267	ms_run[2]:scan=490	6.3469	2	1852.8036	1852.8036	K	G	6	32
PSM	ISLGLPVGAVINCADNTGAK	8	sp|P62829|RL23_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	13-UNIMOD:4	ms_run[2]:scan=11459	67.779	2	1969.0303	1969.0303	R	N	16	36
PSM	TIGGGDDSFNTFFSETGAGK	9	sp|P68363-2|TBA1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=10944	64.569	2	2006.8858	2006.8858	K	H	41	61
PSM	TVATPLNQVANPNSAIFGGAR	10	sp|Q15056-2|IF4H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=10021	58.928	2	2097.0967	2097.0967	R	P	197	218
PSM	VYFQSPPGAAGEGPGGADDEGPVR	11	sp|Q96C90|PP14B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=6972	41.377	2	2329.0611	2329.0611	R	R	28	52
PSM	SETAPAAPAAAPPAEKAPVK	12	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	1-UNIMOD:1	ms_run[2]:scan=4155	26.419	2	1915.0051	1915.0051	M	K	2	22
PSM	TIGGGDDSFNTFFSETGAGK	13	sp|P68363-2|TBA1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	20-UNIMOD:188	ms_run[2]:scan=10943	64.563	2	2012.9059	2012.9059	K	H	41	61
PSM	ACGLVASNLNLKPGECLR	14	sp|P09382|LEG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:1,2-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=10065	59.194	2	2013.0136	2013.0136	M	V	2	20
PSM	APPAPGPASGGSGEVDELFDVK	15	sp|O14579-3|COPE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	22-UNIMOD:188	ms_run[2]:scan=10229	60.181	2	2102.0263	2102.0263	M	N	2	24
PSM	GLGAAEFGGAAGNVEAPGETFAQR	16	sp|Q6EEV4-2|GL1AD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=9158	53.749	2	2276.0822	2276.0822	R	K	53	77
PSM	MGAVFMDAPVSGGVGAAR	17	sp|P31937|3HIDH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:35,18-UNIMOD:267	ms_run[2]:scan=7790	45.9	2	1717.8155	1717.8155	K	S	150	168
PSM	QHPQPYIFPDSPGGTSYER	18	sp|Q9Y6M9|NDUB9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	1-UNIMOD:28,19-UNIMOD:267	ms_run[1]:scan=8471	49.751126666666664	2	2167.9972	2167.9832	R	Y	75	94
PSM	ALLAPLVAPEAGEAEPGSQER	19	sp|Q9H0B6-2|KLC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=9612	56.459	2	2104.08	2104.0800	R	C	37	58
PSM	GILFVGSGVSGGEEGAR	20	sp|P52209-2|6PGD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=8516	50.01	2	1590.8002	1590.8002	K	Y	107	124
PSM	LATGSDDNCAAFFEGPPFK	21	sp|O75083|WDR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	9-UNIMOD:4,19-UNIMOD:188	ms_run[2]:scan=10951	64.613	2	2048.9245	2048.9245	R	F	162	181
PSM	MASNIFGTPEENQASWAK	22	sp|Q9UK76-3|JUPI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:35	ms_run[2]:scan=8512	49.982	2	1995.8996	1995.8996	-	S	1	19
PSM	PTPQDSPIFLPVDDTSFR	23	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=11758	69.643	2	2030.9949	2030.9949	R	W	1406	1424
PSM	AFLASPEYVNLPINGNGKQ	24	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=10605	62.482	2	2031.0425	2031.0425	K	-	192	211
PSM	FDTGNLCMVTGGANLGR	25	sp|P62701|RS4X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	7-UNIMOD:4	ms_run[2]:scan=9302	54.627	2	1781.8189	1781.8189	K	I	175	192
PSM	FSPNSSNPIIVSCGWDK	26	sp|P63244|RACK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	13-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=9293	54.571	2	1912.9085	1912.9085	R	L	156	173
PSM	FVLSGANIMCPGLTSPGAK	27	sp|Q9ULC4-2|MCTS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	10-UNIMOD:4	ms_run[2]:scan=10816	63.776	2	1918.9645	1918.9645	K	L	92	111
PSM	GADFLVTEVENGGSLGSK	28	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=10484	61.73	2	1778.8687	1778.8687	K	K	189	207
PSM	LATGSDDNCAAFFEGPPFK	29	sp|O75083|WDR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	9-UNIMOD:4	ms_run[2]:scan=10942	64.557	2	2042.9044	2042.9044	R	F	162	181
PSM	MDEPSPLAQPLELNQHSR	30	sp|Q13085|ACACA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:1	ms_run[2]:scan=9923	58.338	2	2103.0055	2103.0055	-	F	1	19
PSM	NIGWGTDQGIGGFGEEPGIK	31	sp|Q9Y5U9|IR3IP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=10687	62.979	2	2030.9698	2030.9698	K	S	30	50
PSM	NMPGLSAATLASLGGTSSR	32	sp|Q32MZ4-4|LRRF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=10451	61.531	2	1789.8992	1789.8992	R	R	227	246
PSM	NMPGLSAATLASLGGTSSR	33	sp|Q32MZ4-4|LRRF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	19-UNIMOD:267	ms_run[2]:scan=10453	61.542	2	1799.9075	1799.9075	R	R	227	246
PSM	NQQDGQLEDSPGLWPGAGTIR	34	sp|Q96IJ6|GMPPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=9846	57.874	2	2238.0665	2238.0665	R	L	201	222
PSM	PVAVGPYGQSQPSCFDR	35	sp|P60602-2|ROMO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	14-UNIMOD:4	ms_run[2]:scan=6307	37.801	2	1863.8574	1863.8574	M	V	2	19
PSM	SPFVVQVGEACNPNACR	36	sp|O75369-6|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	11-UNIMOD:4,16-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=7320	43.307	2	1913.8752	1913.8752	K	A	440	457
PSM	SSGSPYGGGYGSGGGSGGYGSR	37	sp|P51991-2|ROA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=3248	21.582	2	1909.7827	1909.7827	R	R	333	355
PSM	VIVVGNPANTNCLTASK	38	sp|P40925-2|MDHC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	12-UNIMOD:4	ms_run[2]:scan=6427	38.461	2	1756.9142	1756.9142	K	S	37	54
PSM	AWDQEAEGAGPELGLR	39	sp|Q8IZ83-3|A16A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=8394	49.293	2	1697.8009	1697.8009	R	V	723	739
PSM	FSPNSSNPIIVSCGWDK	40	sp|P63244|RACK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	13-UNIMOD:4	ms_run[2]:scan=9299	54.611	2	1906.8883	1906.8883	R	L	156	173
PSM	GILFVGSGVSGGEEGAR	41	sp|P52209-2|6PGD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	17-UNIMOD:267	ms_run[2]:scan=8525	50.06	2	1600.8085	1600.8085	K	Y	107	124
PSM	ILATPPQEDAPSVDIANIR	42	sp|P29401|TKT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	19-UNIMOD:267	ms_run[2]:scan=9392	55.155	2	2029.0719	2029.0719	K	M	284	303
PSM	MAPYQGPDAVPGALDYK	43	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:35	ms_run[2]:scan=7456	44.059	2	1807.8451	1807.8451	R	S	883	900
PSM	MSGGWELELNGTEAK	44	sp|Q07021|C1QBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:35	ms_run[2]:scan=8354	49.06	2	1636.7403	1636.7403	K	L	105	120
PSM	MTNGFSGADLTEICQR	45	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:35,14-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=7946	46.728	2	1824.801	1824.8010	K	A	678	694
PSM	TPGTGSLAAAVETASGR	46	sp|Q96GD0|PLPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	17-UNIMOD:267	ms_run[2]:scan=8181	48.062	2	1554.7877	1554.7877	R	Q	190	207
PSM	TPGTGSLAAAVETASGR	47	sp|Q96GD0|PLPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=8195	48.143	2	1544.7794	1544.7794	R	Q	190	207
PSM	VIVVGNPANTNCLTASK	48	sp|P40925-2|MDHC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	12-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=6426	38.455	2	1762.9343	1762.9343	K	S	37	54
PSM	ATGNQPPPLVGTYNTLLSR	49	sp|Q96PD2|DCBD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	19-UNIMOD:267	ms_run[2]:scan=10712	63.136	2	2008.0617	2008.0617	K	T	703	722
PSM	FDTGNLCMVTGGANLGR	50	sp|P62701|RS4X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	7-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=9301	54.621	2	1791.8272	1791.8272	K	I	175	192
PSM	FQDGDLTLYQSNTILR	51	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=10327	60.772	2	1882.9425	1882.9425	K	H	56	72
PSM	FQDGDLTLYQSNTILR	52	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	16-UNIMOD:267	ms_run[2]:scan=10338	60.84	2	1892.9508	1892.9508	K	H	56	72
PSM	GADFLVTEVENGGSLGSK	53	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	18-UNIMOD:188	ms_run[2]:scan=10482	61.719	2	1784.8888	1784.8888	K	K	189	207
PSM	ISLGLPVGAVINCADNTGAK	54	sp|P62829|RL23_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	13-UNIMOD:4,20-UNIMOD:188	ms_run[2]:scan=11455	67.75	2	1975.0504	1975.0504	R	N	16	36
PSM	KGQGGAGAGDDEEED	55	sp|P46781|RS9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:188	ms_run[2]:scan=466	6.1881	2	1439.5744	1439.5744	K	-	180	195
PSM	LEAIEDDSVKETDSSSASAATPSK	56	sp|P54578-2|UBP14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	10-UNIMOD:188,24-UNIMOD:188	ms_run[2]:scan=4267	26.993	2	2449.1746	2449.1746	K	K	180	204
PSM	LLPVLLSTAQEADPEVR	57	sp|Q8TEX9|IPO4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	17-UNIMOD:267	ms_run[2]:scan=11460	67.785	2	1860.0232	1860.0232	R	S	900	917
PSM	PVAVGPYGQSQPSCFDR	58	sp|P60602-2|ROMO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	14-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=6296	37.737	2	1873.8657	1873.8657	M	V	2	19
PSM	SETAPAAPAAAPPAEKAPVK	59	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:1,16-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=4161	26.451	2	1927.0454	1927.0454	M	K	2	22
PSM	STNGDTFLGGEDFDQALLR	60	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	19-UNIMOD:267	ms_run[2]:scan=11920	70.668	2	2064.9628	2064.9628	K	H	266	285
PSM	QATVGDINTERPGMLDFTGK	61	sp|P07108|ACBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:28	ms_run[1]:scan=10061	59.166940000000004	2	2132.0220	2132.0203	K	A	34	54
PSM	AGAIAPCEVTVPAQNTGLGPEK	62	sp|P05388-2|RLA0_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:4	ms_run[2]:scan=7358	43.527	2	2179.0943	2179.0943	R	T	113	135
PSM	AGAIAPCEVTVPAQNTGLGPEK	63	sp|P05388-2|RLA0_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:4,22-UNIMOD:188	ms_run[2]:scan=7359	43.533	2	2185.1144	2185.1144	R	T	113	135
PSM	FDTGNLCMVTGGANLGR	64	sp|P62701|RS4X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:4,8-UNIMOD:35	ms_run[2]:scan=7990	46.968	2	1797.8138	1797.8138	K	I	175	192
PSM	FGGGNPELLTQMVSK	65	sp|P40939|ECHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	15-UNIMOD:188	ms_run[2]:scan=9893	58.165	2	1582.8121	1582.8121	R	G	611	626
PSM	FQDVGPQAPVGSVYQK	66	sp|Q9UJU6-5|DBNL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=6325	37.904	2	1718.8628	1718.8628	R	T	46	62
PSM	FVTVQTISGTGALR	67	sp|P00505-2|AATM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	14-UNIMOD:267	ms_run[2]:scan=8190	48.113	2	1458.807	1458.8070	K	I	83	97
PSM	FVTVQTISGTGALR	68	sp|P00505-2|AATM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=8193	48.133	2	1448.7987	1448.7987	K	I	83	97
PSM	GLGLGTEGPQGTGGLEPDLAR	69	sp|Q96EP0-3|RNF31_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=9116	53.496	2	1994.0069	1994.0069	K	G	180	201
PSM	IAPLEEGTLPFNLAEAQR	70	sp|Q9UJS0|CMC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	18-UNIMOD:267	ms_run[2]:scan=11871	70.359	2	1978.0399	1978.0399	R	Q	293	311
PSM	IAPLEEGTLPFNLAEAQR	71	sp|Q9UJS0|CMC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=11874	70.377	2	1968.0316	1968.0316	R	Q	293	311
PSM	KVEEEDEEEEEEEEEEEEEEDE	72	sp|O15347|HMGB3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=4522	28.347	2	2797.9945	2797.9945	K	-	179	201
PSM	LATGSDDNCAAFFEGPPFK	73	sp|O75083|WDR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	9-UNIMOD:4	ms_run[2]:scan=10779	63.548	2	2042.9044	2042.9044	R	F	162	181
PSM	LEQPDPGAVAAAAILR	74	sp|Q3LXA3|TKFC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=10612	62.527	2	1590.873	1590.8730	R	A	552	568
PSM	LIAPVAEEEATVPNNK	75	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	16-UNIMOD:188	ms_run[2]:scan=6358	38.089	2	1699.9088	1699.9088	K	I	8	24
PSM	LQEAGILSAEELQR	76	sp|Q15149|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	14-UNIMOD:267	ms_run[2]:scan=8295	48.707	2	1565.8289	1565.8289	R	L	2795	2809
PSM	MCDLVSDFDGFSER	77	sp|P30520|PURA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:35,2-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=10535	62.048	2	1702.6842	1702.6842	R	F	181	195
PSM	NPGYPQSEGLLGECMIR	78	sp|Q99961|SH3G1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	14-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=9796	57.573	2	1929.8952	1929.8952	K	H	83	100
PSM	PTPQDSPIFLPVDDTSFR	79	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	18-UNIMOD:267	ms_run[2]:scan=11759	69.649	2	2041.0032	2041.0032	R	W	1406	1424
PSM	QFASQANVVGPWIQTK	80	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=9583	56.283	2	1772.921	1772.9210	R	M	653	669
PSM	SETAPLAPTIPAPAEKTPVK	81	sp|P16402|H13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:1,16-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=7723	45.504	2	2071.1604	2071.1604	M	K	2	22
PSM	SGDWVCPNPSCGNMNFAR	82	sp|Q92804-2|RBP56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=8378	49.197	2	2067.8349	2067.8350	K	R	352	370
PSM	SGDWVCPNPSCGNMNFAR	83	sp|Q92804-2|RBP56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:4,11-UNIMOD:4,18-UNIMOD:267	ms_run[2]:scan=8410	49.384	2	2077.8432	2077.8432	K	R	352	370
PSM	SSGAPAPGSGATIFALSSGQGR	84	sp|Q969Y2-3|GTPB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	22-UNIMOD:267	ms_run[2]:scan=8702	51.075	2	1984.9842	1984.9842	R	C	24	46
PSM	STNGDTFLGGEDFDQALLR	85	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=11922	70.68	2	2054.9545	2054.9545	K	H	266	285
PSM	TPVEEVPAAIAPFQGR	86	sp|Q15393|SF3B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	16-UNIMOD:267	ms_run[2]:scan=9416	55.301	2	1690.8918	1690.8918	K	V	943	959
PSM	VLQATVVAVGSGSK	87	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	14-UNIMOD:188	ms_run[2]:scan=5110	31.407	2	1320.7708	1320.7708	K	G	41	55
PSM	VLVVGAGGIGCELLK	88	sp|Q9UBT2|SAE2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	11-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=10837	63.908	2	1489.8634	1489.8634	R	N	20	35
PSM	VLVVGAGGIGCELLK	89	sp|Q9UBT2|SAE2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	11-UNIMOD:4	ms_run[2]:scan=10839	63.919	2	1483.8432	1483.8432	R	N	20	35
PSM	QVFGEATKQPGITFIAAK	90	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:28,8-UNIMOD:188,18-UNIMOD:188	ms_run[1]:scan=10771	63.498536666666666	2	1900.0536	1900.0492	R	F	177	195
PSM	QHPQPYIFPDSPGGTSYER	91	sp|Q9Y6M9|NDUB9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:28	ms_run[1]:scan=8458	49.67143333333333	2	2157.9892	2157.9752	R	Y	75	94
PSM	ACANPAAGSVILLENLR	92	sp|P00558|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:4	ms_run[2]:scan=11921	70.674	2	1767.9302	1767.9302	K	F	107	124
PSM	AGYIIPLQGPGLTTTESR	93	sp|P10253|LYAG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=10194	59.966	2	1872.9945	1872.9945	R	Q	820	838
PSM	FGGGNPELLTQMVSK	94	sp|P40939|ECHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=9995	58.77	2	1576.7919	1576.7919	R	G	611	626
PSM	GVNLPGAAVDLPAVSEK	95	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	17-UNIMOD:188	ms_run[2]:scan=9527	55.95	2	1641.9033	1641.9033	K	D	208	225
PSM	IGPYQPNVPVGIDYVIPK	96	sp|P43243-2|MATR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=11585	68.581	2	1968.072	1968.0720	R	T	493	511
PSM	IISNASCTTNCLAPLAK	97	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:4,11-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=6637	39.61	2	1838.9326	1838.9326	K	V	104	121
PSM	KPVTVSPTTPTSPTEGEAS	98	sp|Q9Y6G9|DC1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:188	ms_run[2]:scan=3853	24.768	2	1890.9518	1890.9518	R	-	505	524
PSM	LGLQYSQGLVSGSNAR	99	sp|Q9UI10-3|EI2BD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=7354	43.502	2	1648.8533	1648.8533	R	C	209	225
PSM	LIAPVAEEEATVPNNK	100	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=6351	38.05	2	1693.8887	1693.8887	K	I	8	24
PSM	NFILDQCNVYNSGQR	101	sp|Q1KMD3|HNRL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:4	ms_run[2]:scan=8157	47.934	2	1826.837	1826.8370	R	R	532	547
PSM	NFILDQTNVSAAAQR	102	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=7939	46.688	2	1646.8376	1646.8376	R	R	557	572
PSM	NLTALGLNLVASGGTAK	103	sp|P31939-2|PUR9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	17-UNIMOD:188	ms_run[2]:scan=11053	65.245	2	1604.9193	1604.9193	R	A	22	39
PSM	SPISVPGGSALISNLGK	104	sp|P51610-2|HCFC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=10497	61.811	2	1595.8883	1595.8883	K	V	597	614
PSM	SVGGSGGGSFGDNLVTR	105	sp|P02545|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=5993	36.098	2	1565.7434	1565.7434	R	S	628	645
PSM	SYELPDGQVITIGNER	106	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	16-UNIMOD:267	ms_run[2]:scan=10091	59.353	2	1799.8929	1799.8929	K	F	239	255
PSM	VIAALLQTMEDQGNQR	107	sp|O00410-2|IPO5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=10705	63.091	2	1785.9043	1785.9043	K	V	382	398
PSM	VLCIINPGNPTGQVQSR	108	sp|Q8TD30-2|ALAT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:4	ms_run[2]:scan=7811	46.016	2	1851.9625	1851.9625	K	K	163	180
PSM	VWLDPNETNEIANANSR	109	sp|P84098|RL19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	17-UNIMOD:267	ms_run[2]:scan=8271	48.568	2	1951.9263	1951.9263	K	Q	22	39
PSM	QNKPTGFALGSIEGR	110	sp|P78406|RAE1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:28	ms_run[1]:scan=8116	47.685156666666664	2	1556.7985	1556.7942	K	V	225	240
PSM	FDTGNLCMVTGGANLGR	111	sp|P62701|RS4X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:4,8-UNIMOD:35,17-UNIMOD:267	ms_run[2]:scan=7988	46.958	2	1807.8221	1807.8221	K	I	175	192
PSM	GLGVGFGSGGGSSSSVK	112	sp|P13647|K2C5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	17-UNIMOD:188	ms_run[2]:scan=5384	32.829	2	1444.7254	1444.7254	R	F	560	577
PSM	IISNASCTTNCLAPLAK	113	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=6641	39.628	2	1832.9125	1832.9125	K	V	104	121
PSM	LATGSDDNCAAFFEGPPFK	114	sp|O75083|WDR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	9-UNIMOD:4	ms_run[2]:scan=11106	65.578	2	2042.9044	2042.9044	R	F	162	181
PSM	LFIGGLSFETTDESLR	115	sp|P09651-3|ROA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=12298	73.071	2	1783.8992	1783.8992	K	S	16	32
PSM	LVPTGLDFGQEGFTR	116	sp|P46087-3|NOP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	15-UNIMOD:267	ms_run[2]:scan=10376	61.064	2	1645.8339	1645.8339	R	F	535	550
PSM	MDEPSPLAQPLELNQHSR	117	sp|Q13085|ACACA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:1,18-UNIMOD:267	ms_run[2]:scan=9906	58.239	2	2113.0138	2113.0138	-	F	1	19
PSM	MGAVFMDAPVSGGVGAAR	118	sp|P31937|3HIDH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:35	ms_run[2]:scan=7783	45.857	2	1707.8073	1707.8073	K	S	150	168
PSM	MSGGWELELNGTEAK	119	sp|Q07021|C1QBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:35,15-UNIMOD:188	ms_run[2]:scan=8355	49.065	2	1642.7604	1642.7604	K	L	105	120
PSM	MYAPAWVAPEALQK	120	sp|Q13418-3|ILK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=10168	59.81	2	1573.7963	1573.7963	R	K	216	230
PSM	NIAFFSTNCVEGTAR	121	sp|P05023-3|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	9-UNIMOD:4	ms_run[2]:scan=9363	54.977	2	1685.7832	1685.7832	R	G	210	225
PSM	NLFEDQNTLTSICEK	122	sp|P55060-4|XPO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	13-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=9339	54.834	2	1816.8609	1816.8609	K	V	276	291
PSM	NTNAGAPPGTAYQSPLPLSR	123	sp|Q02218-3|ODO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	20-UNIMOD:267	ms_run[2]:scan=7345	43.452	2	2021.0206	2021.0206	R	G	82	102
PSM	NVAIFTAGQESPIILR	124	sp|O95071-2|UBR5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=11301	66.776	2	1727.957	1727.9570	R	D	798	814
PSM	PLFTANPFEQDVEK	125	sp|O75886-2|STAM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	14-UNIMOD:188	ms_run[2]:scan=10792	63.633	2	1639.8189	1639.8189	M	A	2	16
PSM	SANSELGGIWSVGQR	126	sp|Q99627-2|CSN8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=9418	55.311	2	1559.7692	1559.7692	K	I	17	32
PSM	SPAGLQVLNDYLADK	127	sp|P24534|EF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=11569	68.478	2	1602.8253	1602.8253	K	S	8	23
PSM	TYVTPPGTGFLPGDTAR	128	sp|Q9NPF4|OSGEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	17-UNIMOD:267	ms_run[2]:scan=8748	51.337	2	1758.8816	1758.8816	R	H	31	48
PSM	VDFPQDQLTALTGR	129	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=10254	60.331	2	1559.7944	1559.7944	K	I	216	230
PSM	VIGNQSLVNELAFTAR	130	sp|Q13011|ECH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=11006	64.953	2	1730.9315	1730.9315	K	K	215	231
PSM	VNQIGSVTESLQACK	131	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	14-UNIMOD:4	ms_run[2]:scan=6748	40.197	2	1632.8141	1632.8141	K	L	344	359
PSM	QSSATSSFGGLGGGSVR	132	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	17-UNIMOD:267	ms_run[1]:scan=5591	33.94977	2	1563.757127	1563.751667	R	F	8	25
PSM	VNQIGSVTESLQACK	133	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	14-UNIMOD:4,15-UNIMOD:188	ms_run[1]:scan=6747	40.1914	2	1638.838536	1638.834250	K	L	344	359
PSM	QIPAAQEQPFIVSNQNKR	134	sp|P17301|ITA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:28	ms_run[1]:scan=8235	48.361	2	2050.0702	2050.0592	R	L	805	823
PSM	QVEPLDPPAGSAPGEHVFVK	135	sp|P54577|SYYC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:28	ms_run[1]:scan=9041	53.03931333333333	2	2056.0382	2056.0262	R	G	451	471
PSM	AFLASPEYVNLPINGNGK	136	sp|P09211|GSTP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=10736	63.281	2	1902.984	1902.9840	K	Q	192	210
PSM	DFLAGGIAAAISK	137	sp|P12236|ADT3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=11188	66.08	2	1232.6765	1232.6765	K	T	11	24
PSM	FAQPGSFEYEYAMR	138	sp|Q15233-2|NONO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:35	ms_run[2]:scan=7596	44.805	2	1710.7348	1710.7348	R	W	168	182
PSM	FGGGNPELLTQMVSK	139	sp|P40939|ECHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	12-UNIMOD:35,15-UNIMOD:188	ms_run[2]:scan=7091	42.049	2	1598.807	1598.8070	R	G	611	626
PSM	FNALFAQGNYSEAAK	140	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:188	ms_run[2]:scan=8115	47.679	2	1635.7988	1635.7988	K	V	368	383
PSM	FNMANALASATCER	141	sp|P48059-3|LIMS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	12-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=9687	56.909	2	1564.7002	1564.7002	K	C	61	75
PSM	GCITIIGGGDTATCCAK	142	sp|P00558|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:4,14-UNIMOD:4,15-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=5951	35.891	2	1759.7999	1759.7999	R	W	366	383
PSM	GFGFVCFSSPEEATK	143	sp|P11940-2|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=10649	62.752	2	1667.7597	1667.7597	K	A	334	349
PSM	GFNEGLWEIENNPGVK	144	sp|Q9Y3E1|HDGR3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=10393	61.168	2	1801.8635	1801.8635	K	F	80	96
PSM	GGGPAGAGGEAPAALR	145	sp|Q5RKV6|EXOS6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	16-UNIMOD:267	ms_run[2]:scan=3351	22.121	2	1317.6665	1317.6665	R	G	78	94
PSM	GGGPAGAGGEAPAALR	146	sp|Q5RKV6|EXOS6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=3352	22.126	2	1307.6582	1307.6582	R	G	78	94
PSM	GNENANGAPAITLLIR	147	sp|Q9Y5B9|SP16H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	16-UNIMOD:267	ms_run[2]:scan=10855	64.019	2	1632.8823	1632.8823	K	E	93	109
PSM	GWEEGVAQMSVGQR	148	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	14-UNIMOD:267	ms_run[2]:scan=7763	45.74	2	1542.7124	1542.7124	R	A	59	73
PSM	IFVGGLNPEATEEK	149	sp|Q99729-3|ROAA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	14-UNIMOD:188	ms_run[2]:scan=7488	44.227	2	1508.7818	1508.7818	K	I	156	170
PSM	IIQTPGLWESENQNK	150	sp|Q9NP72|RAB18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:188	ms_run[2]:scan=7729	45.541	2	1761.8993	1761.8993	K	G	169	184
PSM	ILTFDQLALDSPK	151	sp|Q07020-2|RL18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:188	ms_run[2]:scan=11176	66.011	2	1465.8124	1465.8124	K	G	91	104
PSM	IQFVGACNPPTDPGR	152	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	7-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=6231	37.372	2	1637.7859	1637.7859	R	K	2706	2721
PSM	ISLGLPVGAVINCADNTGAK	153	sp|P62829|RL23_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:4,20-UNIMOD:188	ms_run[2]:scan=11475	67.885	3	1975.0504	1975.0504	R	N	16	36
PSM	KGQGGAGAGDDEEED	154	sp|P46781|RS9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=467	6.1938	2	1433.5543	1433.5543	K	-	180	195
PSM	LAATNALLNSLEFTK	155	sp|Q14974|IMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:188	ms_run[2]:scan=12201	72.458	2	1610.8975	1610.8975	K	A	192	207
PSM	LAGTQPLEVLEAVQR	156	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=11212	66.224	2	1622.8992	1622.8992	R	S	639	654
PSM	LCSGPGIVGNVLVDPSAR	157	sp|Q9Y5P6|GMPPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:4,18-UNIMOD:267	ms_run[2]:scan=9706	57.024	2	1819.949	1819.9490	R	I	244	262
PSM	LCSGPGIVGNVLVDPSAR	158	sp|Q9Y5P6|GMPPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:4	ms_run[2]:scan=9708	57.036	2	1809.9407	1809.9407	R	I	244	262
PSM	LEQPDPGAVAAAAILR	159	sp|Q3LXA3|TKFC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=10587	62.37	2	1590.873	1590.8730	R	A	552	568
PSM	LLPVLLSTAQEADPEVR	160	sp|Q8TEX9|IPO4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=11451	67.726	2	1850.0149	1850.0149	R	S	900	917
PSM	LLQSNPVLEAFGNAK	161	sp|O00159-2|MYO1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:188	ms_run[2]:scan=11185	66.064	2	1605.8822	1605.8822	R	T	139	154
PSM	LPIGDVATQYFADR	162	sp|Q99832-2|TCPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	14-UNIMOD:267	ms_run[2]:scan=10702	63.073	2	1574.7968	1574.7968	K	D	89	103
PSM	LSLLEVGCGTGANFK	163	sp|Q9H8H3|MET7A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	8-UNIMOD:4	ms_run[2]:scan=10100	59.409	2	1564.7919	1564.7919	K	F	72	87
PSM	LTDEDFSPFGSGGGLFSGGK	164	sp|Q9Y4E1-5|WAC2C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=12072	71.641	2	1973.9007	1973.9007	K	G	322	342
PSM	LVVPATQCGSLIGK	165	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	8-UNIMOD:4	ms_run[2]:scan=7311	43.258	2	1441.7963	1441.7963	R	G	102	116
PSM	MAPYQGPDAVPGALDYK	166	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:35,17-UNIMOD:188	ms_run[2]:scan=7455	44.054	2	1813.8652	1813.8652	R	S	883	900
PSM	MLGDQFNGELEASAK	167	sp|Q5TBC7|B2L15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:35,15-UNIMOD:188	ms_run[2]:scan=7142	42.311	2	1630.7604	1630.7604	R	N	59	74
PSM	MLGQMTDQVADLR	168	sp|P18206|VINC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:35	ms_run[2]:scan=7317	43.286	2	1492.7014	1492.7014	K	A	327	340
PSM	NSQFAGGPLGNPNTTAK	169	sp|O75694-2|NU155_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=4966	30.634	2	1672.8169	1672.8169	R	V	665	682
PSM	SETAPAAPAAPAPAEKTPVK	170	sp|P10412|H14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:1,16-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=4263	26.971	2	1957.0559	1957.0559	M	K	2	22
PSM	SPAGLQVLNDYLADK	171	sp|P24534|EF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:188	ms_run[2]:scan=11565	68.456	2	1608.8455	1608.8455	K	S	8	23
PSM	SPFEVQVGPEAGMQK	172	sp|O75369-6|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:188	ms_run[2]:scan=7593	44.789	2	1608.7913	1608.7913	K	V	537	552
PSM	SPFEVQVGPEAGMQK	173	sp|O75369-6|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=7627	44.987	2	1602.7712	1602.7712	K	V	537	552
PSM	TMLELLNQLDGFEATK	174	sp|P62195-2|PRS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:35	ms_run[2]:scan=12332	73.283	2	1837.9132	1837.9132	R	N	264	280
PSM	TPESIVPIAPELQPSTSR	175	sp|Q14676-2|MDC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=9675	56.834	2	1921.0157	1921.0157	K	N	1303	1321
PSM	TPMENIGLQDSLLSR	176	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:267	ms_run[2]:scan=10121	59.534	2	1682.8537	1682.8537	K	F	464	479
PSM	TPVEEVPAAIAPFQGR	177	sp|Q15393|SF3B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=9407	55.247	2	1680.8835	1680.8835	K	V	943	959
PSM	TQGFLALFSGDTGEIK	178	sp|Q9Y230|RUVB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	16-UNIMOD:188	ms_run[2]:scan=13044	78.733	2	1688.8717	1688.8717	R	S	254	270
PSM	TQTPPLGQTPQLGLK	179	sp|P78344-2|IF4G2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=7533	44.46	2	1577.8777	1577.8777	R	T	468	483
PSM	VALVYGQMNEPPGAR	180	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:267	ms_run[2]:scan=6728	40.094	2	1610.8114	1610.8114	K	A	265	280
PSM	VGAEDADGIDMAYR	181	sp|P49588|SYAC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=6416	38.397	2	1481.6457	1481.6457	K	V	283	297
PSM	VGPDVVTDPAFLVTR	182	sp|Q9NV31|IMP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=10694	63.024	2	1584.8512	1584.8512	R	S	138	153
PSM	VIAALLQTMEDQGNQR	183	sp|O00410-2|IPO5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=10713	63.142	3	1785.9043	1785.9043	K	V	382	398
PSM	VLAALPAAELVQACR	184	sp|Q9UK22|FBX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	14-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=10287	60.527	2	1590.8791	1590.8791	R	L	58	73
PSM	VLATAFDTTLGGR	185	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:267	ms_run[2]:scan=8399	49.326	2	1330.712	1330.7120	K	K	222	235
PSM	VLATAFDTTLGGR	186	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=8400	49.33	2	1320.7038	1320.7038	K	K	222	235
PSM	VLCIINPGNPTGQVQSR	187	sp|Q8TD30-2|ALAT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=7848	46.224	2	1861.9708	1861.9708	K	K	163	180
PSM	VLGIQVDTDGSGR	188	sp|P33992|MCM5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:267	ms_run[2]:scan=6493	38.838	2	1325.6815	1325.6815	R	S	296	309
PSM	VNLAIWDTAGQER	189	sp|Q9UL25|RAB21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:267	ms_run[2]:scan=9678	56.856	2	1481.7502	1481.7502	R	F	68	81
PSM	APLNVQFNSPLPGDAVK	190	sp|O75369|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	17-UNIMOD:188	ms_run[1]:scan=9771	57.41923833333333	2	1771.965619	1771.956414	K	D	878	895
PSM	QAIKELPQFATGENLPR	191	sp|Q9BZZ5|API5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:28	ms_run[1]:scan=10385	61.117783333333335	2	1893.9968	1893.9943	R	V	81	98
PSM	ALIPLALEGTDVGQTK	192	sp|Q9H3U1|UN45A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	16-UNIMOD:188	ms_run[1]:scan=10775	63.52557333333333	2	1631.937789	1630.923716	R	A	692	708
PSM	TPMENIGLQDSLLSR	193	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=10122	59.540193333333335	2	1673.852127	1672.845421	K	F	464	479
PSM	QGQETAVAPSLVAPALNKPK	194	sp|Q15691|MARE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:28	ms_run[1]:scan=8213	48.238258333333334	2	2001.1022	2001.0892	R	K	131	151
PSM	QRPYVVTFCGVNGVGK	195	sp|P08240|SRPRA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:28,2-UNIMOD:267,9-UNIMOD:4,16-UNIMOD:188	ms_run[1]:scan=9193	53.960665000000006	2	1779.9052	1778.9102	R	S	416	432
PSM	AAPAGGFQNIACLR	196	sp|Q9UBP6|TRMB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	12-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=8224	48.302	2	1454.7328	1454.7328	R	S	125	139
PSM	AAPAGGFQNIACLR	197	sp|Q9UBP6|TRMB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	12-UNIMOD:4	ms_run[2]:scan=8231	48.341	2	1444.7245	1444.7245	R	S	125	139
PSM	ACANPAAGSVILLENLR	198	sp|P00558|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=11914	70.627	2	1777.9384	1777.9384	K	F	107	124
PSM	AGGEAGVTLGQPHLSR	199	sp|P41091|IF2G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:1	ms_run[2]:scan=6343	38.005	2	1590.8114	1590.8114	M	Q	2	18
PSM	APVPGTPDSLSSGSSR	200	sp|Q9UJZ1-2|STML2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	16-UNIMOD:267	ms_run[2]:scan=4035	25.786	2	1523.7455	1523.7455	K	D	277	293
PSM	CSVLAAANSVFGR	201	sp|P33992|MCM5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=10282	60.5	2	1360.6797	1360.6797	R	W	482	495
PSM	CSVLPLSQNQEFMPFVK	202	sp|P41250|GARS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:4,13-UNIMOD:35	ms_run[2]:scan=11243	66.411	2	2038.9856	2038.9856	K	E	616	633
PSM	CVIFEIPGAPDDEAVR	203	sp|Q96I25|SPF45_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:4	ms_run[2]:scan=11001	64.92	2	1786.856	1786.8560	K	I	339	355
PSM	DPENFPFVVLGNK	204	sp|P51149|RAB7A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=11970	70.995	2	1474.7456	1474.7456	R	I	114	127
PSM	FAAATGATPIAGR	205	sp|P08865|RSSA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:267	ms_run[2]:scan=4172	26.509	2	1212.649	1212.6490	K	F	90	103
PSM	FGGGNPELLTQMVSK	206	sp|P40939|ECHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	12-UNIMOD:35	ms_run[2]:scan=7093	42.059	2	1592.7868	1592.7868	R	G	611	626
PSM	FQLSNSGPNSTIK	207	sp|A0FGR8-5|ESYT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=5170	31.719	2	1391.7045	1391.7045	R	M	42	55
PSM	FTQAGSEVSALLGR	208	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:267	ms_run[2]:scan=9651	56.693	2	1444.755	1444.7550	R	I	311	325
PSM	FYEQMNGPVAGASR	209	sp|P29692-3|EF1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=5273	32.259	2	1525.6984	1525.6984	R	Q	25	39
PSM	GFGFVCFSSPEEATK	210	sp|P11940-2|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:4	ms_run[2]:scan=10652	62.769	2	1661.7396	1661.7396	K	A	334	349
PSM	GGTPAFLPSSLSPQSSLPASR	211	sp|Q96JY6|PDLI2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	21-UNIMOD:267	ms_run[2]:scan=10113	59.486	2	2066.0672	2066.0672	R	A	255	276
PSM	GVNLPGAAVDLPAVSEK	212	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9520	55.907	2	1635.8832	1635.8832	K	D	208	225
PSM	GWEEGVAQMSVGQR	213	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7762	45.734	2	1532.7042	1532.7042	R	A	59	73
PSM	IFVGGLNPEATEEK	214	sp|Q99729-3|ROAA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7496	44.269	2	1502.7617	1502.7617	K	I	156	170
PSM	IQFVGACNPPTDPGR	215	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	7-UNIMOD:4	ms_run[2]:scan=6206	37.223	2	1627.7777	1627.7777	R	K	2706	2721
PSM	LATGSDDNCAAFFEGPPFK	216	sp|O75083|WDR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	9-UNIMOD:4,19-UNIMOD:188	ms_run[2]:scan=10785	63.587	2	2048.9245	2048.9245	R	F	162	181
PSM	LGTPVLQALGDGDFVK	217	sp|Q16822|PCKGM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=11773	69.737	2	1628.8774	1628.8774	R	C	194	210
PSM	LLAEPAGGLVGER	218	sp|Q13572|ITPK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:267	ms_run[2]:scan=6893	40.947	2	1290.7171	1290.7171	K	T	341	354
PSM	LLDAVDTYIPVPAR	219	sp|P49411|EFTU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=10666	62.854	2	1541.8453	1541.8453	K	D	239	253
PSM	LLDISELDMVGAGR	220	sp|Q9H3P2|NELFA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:267	ms_run[2]:scan=11653	69.001	2	1497.7736	1497.7736	K	E	256	270
PSM	LTDEDFSPFGSGGGLFSGGK	221	sp|Q9Y4E1-5|WAC2C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	20-UNIMOD:188	ms_run[2]:scan=12063	71.585	2	1979.9208	1979.9208	K	G	322	342
PSM	LVPTGLDFGQEGFTR	222	sp|P46087-3|NOP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=10381	61.096	2	1635.8257	1635.8257	R	F	535	550
PSM	MASNIFGTPEENQASWAK	223	sp|Q9UK76-3|JUPI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:35,18-UNIMOD:188	ms_run[2]:scan=8505	49.943	2	2001.9198	2001.9198	-	S	1	19
PSM	MIAGQVLDINLAAEPK	224	sp|P07910-4|HNRPC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:35	ms_run[2]:scan=10002	58.813	2	1697.9022	1697.9022	R	V	74	90
PSM	MLGQMTDQVADLR	225	sp|P18206|VINC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:35,13-UNIMOD:267	ms_run[2]:scan=7322	43.319	2	1502.7097	1502.7097	K	A	327	340
PSM	NIAFFSTNCVEGTAR	226	sp|P05023-3|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	9-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=9357	54.94	2	1695.7914	1695.7914	R	G	210	225
PSM	NINDAWVCTNDMFR	227	sp|P61970|NTF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	8-UNIMOD:4	ms_run[2]:scan=10990	64.853	2	1754.7505	1754.7505	K	L	107	121
PSM	NIYVLQELDNPGAK	228	sp|P12956|XRCC6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:188	ms_run[2]:scan=10262	60.38	2	1578.8349	1578.8349	K	R	101	115
PSM	NQLTSNPENTVFDAK	229	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	15-UNIMOD:188	ms_run[2]:scan=6742	40.163	2	1682.8207	1682.8207	K	R	82	97
PSM	NSILAQVLDQSAR	230	sp|O14737|PDCD5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:267	ms_run[2]:scan=11203	66.171	2	1423.7659	1423.7659	R	A	41	54
PSM	NTLCAPEVISLINTR	231	sp|Q96CS3|FAF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=11674	69.136	2	1709.901	1709.9010	R	M	191	206
PSM	PGSLPLNAEACWPK	232	sp|Q01581|HMCS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	11-UNIMOD:4	ms_run[2]:scan=9138	53.622	2	1538.7551	1538.7551	M	D	2	16
PSM	QFASQANVVGPWIQTK	233	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	16-UNIMOD:188	ms_run[2]:scan=9578	56.257	2	1778.9411	1778.9411	R	M	653	669
PSM	SCQAMFQQINDSFR	234	sp|Q6P2E9|EDC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:4	ms_run[2]:scan=9876	58.062	2	1730.7505	1730.7505	K	L	1129	1143
PSM	SIYSLILGQDNAADQSR	235	sp|Q9P0I2-2|EMC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=11669	69.103	2	1849.917	1849.9170	R	M	181	198
PSM	SLFSSIGEVESAK	236	sp|Q15717|ELAV1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:188	ms_run[2]:scan=9913	58.28	2	1358.7025	1358.7025	R	L	38	51
PSM	SLLINAVEASCIR	237	sp|P32322-2|P5CR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	11-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=10340	60.851	2	1454.7791	1454.7791	R	T	252	265
PSM	SMAASGNLGHTPFVDEL	238	sp|P22695|QCR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=10639	62.693	2	1744.809	1744.8090	K	-	437	454
PSM	SPLTQEQLIPNLAMK	239	sp|Q9UNE7-2|CHIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	15-UNIMOD:188	ms_run[2]:scan=10803	63.702	2	1687.9274	1687.9274	R	E	201	216
PSM	SQAEFEKAAEEVR	240	sp|P07108|ACBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:1	ms_run[2]:scan=8332	48.923	2	1534.7264	1534.7264	M	H	2	15
PSM	SSAQDPQAVLGALGR	241	sp|P26640|SYVC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=8773	51.483	2	1468.7634	1468.7634	R	A	123	138
PSM	SSPAAFINPPIGTVTPALK	242	sp|Q9BY77-2|PDIP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=10750	63.371	2	1880.0407	1880.0407	R	L	126	145
PSM	SVGGSGGGSFGDNLVTR	243	sp|P02545|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=6193	37.151	2	1565.7434	1565.7434	R	S	628	645
PSM	TCPVQLWVDSTPPPGTR	244	sp|P04637-8|P53_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=9790	57.535	2	1919.9439	1919.9439	K	V	8	25
PSM	TFDTFCPLGPALVTK	245	sp|Q96GK7|FAH2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:4	ms_run[2]:scan=11346	67.059	2	1665.8436	1665.8436	K	D	210	225
PSM	TGEGFLCVFAINNTK	246	sp|P01116-2|RASK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	7-UNIMOD:4	ms_run[2]:scan=12270	72.899	2	1669.8134	1669.8134	R	S	74	89
PSM	TIQAPTQVPVVVSPR	247	sp|P32519-2|ELF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	15-UNIMOD:267	ms_run[2]:scan=7483	44.202	2	1600.9176	1600.9176	R	N	396	411
PSM	TPMENIGLQDSLLSR	248	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:35,15-UNIMOD:267	ms_run[2]:scan=8752	51.364	2	1698.8486	1698.8486	K	F	464	479
PSM	TVLDPVTGDLSDTR	249	sp|Q15393|SF3B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7612	44.9	2	1487.7468	1487.7468	R	T	677	691
PSM	TVLDPVTGDLSDTR	250	sp|Q15393|SF3B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:267	ms_run[2]:scan=7614	44.912	2	1497.755	1497.7550	R	T	677	691
PSM	VDFPQDQLTALTGR	251	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:267	ms_run[2]:scan=10425	61.369	2	1569.8026	1569.8026	K	I	216	230
PSM	VIAALLQTMEDQGNQR	252	sp|O00410-2|IPO5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	16-UNIMOD:267	ms_run[2]:scan=10703	63.079	2	1795.9126	1795.9126	K	V	382	398
PSM	VIAALLQTMEDQGNQR	253	sp|O00410-2|IPO5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	16-UNIMOD:267	ms_run[2]:scan=10714	63.148	3	1795.9126	1795.9126	K	V	382	398
PSM	VIGNQSLVNELAFTAR	254	sp|Q13011|ECH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	16-UNIMOD:267	ms_run[2]:scan=11007	64.958	2	1740.9398	1740.9398	K	K	215	231
PSM	VIGVGEFGEVCSGR	255	sp|P54764-2|EPHA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	11-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=8086	47.509	2	1474.7114	1474.7114	K	L	575	589
PSM	VLQATVVAVGSGSK	256	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=5112	31.416	2	1314.7507	1314.7507	K	G	41	55
PSM	VLQDMGLPTGAEGR	257	sp|Q12906-4|ILF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=6978	41.415	2	1442.7188	1442.7188	K	D	461	475
PSM	VNLAIWDTAGQER	258	sp|Q9UL25|RAB21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9654	56.708	2	1471.7419	1471.7419	R	F	68	81
PSM	QATKDAGTIAGLNVLR	259	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:28	ms_run[1]:scan=9423	55.335993333333334	2	1609.8841	1609.8782	R	I	156	172
PSM	YLNIFGESQPNPK	260	sp|Q9UJS0|CMC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	13-UNIMOD:188	ms_run[1]:scan=9080	53.27784499999999	2	1512.781396	1511.771573	R	T	44	57
PSM	QVFGEATKQPGITFIAAK	261	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:28	ms_run[1]:scan=10783	63.576080000000005	2	1888.0144	1888.0089	R	F	177	195
PSM	AVLGPLVGAVDQGTSSTR	262	sp|Q14409|GLPK3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=9396	55.177753333333335	2	1727.919924	1726.921363	K	F	7	25
PSM	ADKPDMGEIASFDK	263	sp|P63313|TYB10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:1,3-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=8186	48.092	2	1576.7482	1576.7482	M	A	2	16
PSM	AEAGVPAEFSIWTR	264	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=11313	66.856	2	1532.7623	1532.7623	R	E	2243	2257
PSM	AERPEDLNLPNAVITR	265	sp|Q9NRF9|DPOE3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:1,3-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=9210	54.059	2	1868.9859	1868.9859	M	I	2	18
PSM	AGGEAGVTLGQPHLSR	266	sp|P41091|IF2G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:1,16-UNIMOD:267	ms_run[2]:scan=6340	37.99	2	1600.8197	1600.8197	M	Q	2	18
PSM	AGPGSLELCGLPSQK	267	sp|Q14684-2|RRP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	9-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=7522	44.399	2	1518.7808	1518.7808	K	T	557	572
PSM	ALEIPGEELPGVCSAR	268	sp|P22570-7|ADRO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	13-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=9368	55.005	2	1706.8537	1706.8537	R	A	171	187
PSM	AQQATPGGAAPTIFSR	269	sp|Q9BX68|HINT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	16-UNIMOD:267	ms_run[2]:scan=6470	38.707	2	1581.8139	1581.8139	K	I	43	59
PSM	AVFVDLEPTVIDEVR	270	sp|P68363-2|TBA1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=11971	71.001	2	1700.8985	1700.8985	R	T	65	80
PSM	ELEPGDGPIAVIVCPTR	271	sp|Q86XP3-2|DDX42_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:4	ms_run[2]:scan=10678	62.924	2	1821.9295	1821.9295	K	E	201	218
PSM	FNALFAQGNYSEAAK	272	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=8143	47.848	2	1629.7787	1629.7787	K	V	368	383
PSM	FSASGELGNGNIK	273	sp|P12004|PCNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=4982	30.727	2	1292.6361	1292.6361	K	L	169	182
PSM	GAAGGAEQPGPGGR	274	sp|Q99447|PCY2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=656	7.3317	2	1180.5585	1180.5585	R	R	7	21
PSM	GAAGGAEQPGPGGR	275	sp|Q99447|PCY2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:267	ms_run[2]:scan=660	7.3523	2	1190.5668	1190.5668	R	R	7	21
PSM	GCITIIGGGDTATCCAK	276	sp|P00558|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:4,14-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=5948	35.874	2	1753.7797	1753.7797	R	W	366	383
PSM	GEAGVPAEFSIWTR	277	sp|O75369-6|FLNB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:267	ms_run[2]:scan=11216	66.246	2	1528.755	1528.7550	R	E	2141	2155
PSM	GFGFVDFNSEEDAK	278	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:188	ms_run[2]:scan=10145	59.68	2	1566.6934	1566.6934	K	A	611	625
PSM	GLIVYQLENQPSEFR	279	sp|P78406|RAE1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10545	62.111	2	1791.9155	1791.9155	R	R	191	206
PSM	GQLGDVGALDTVWR	280	sp|Q9H3S7|PTN23_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:267	ms_run[2]:scan=10896	64.266	2	1495.7659	1495.7659	R	E	1183	1197
PSM	GVVDSDDLPLNVSR	281	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:267	ms_run[2]:scan=8029	47.184	2	1494.7554	1494.7554	K	E	435	449
PSM	GVVDSDDLPLNVSR	282	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=8032	47.205	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSEDLPLNISR	283	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=8977	52.654	2	1512.7784	1512.7784	R	E	379	393
PSM	IANLQTDLSDGLR	284	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	13-UNIMOD:267	ms_run[2]:scan=8696	51.043	2	1424.7499	1424.7499	R	L	64	77
PSM	IFLITLDNSDPSLK	285	sp|Q14139|UBE4A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=11842	70.173	2	1574.8556	1574.8556	R	S	91	105
PSM	IGIIGGTGLDDPEILEGR	286	sp|Q13126-7|MTAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=11659	69.04	2	1823.9629	1823.9629	K	T	12	30
PSM	IGNTGGMLDNILASK	287	sp|P53396-3|ACLY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10469	61.642	2	1502.7763	1502.7763	K	L	365	380
PSM	ILPVLCGLTVDPEK	288	sp|Q96KG9-5|SCYL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=11813	69.986	2	1558.8736	1558.8736	K	S	507	521
PSM	IPLFNTDVDNLEGK	289	sp|Q96PZ0|PUS7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:188	ms_run[2]:scan=10416	61.313	2	1579.8189	1579.8189	K	T	596	610
PSM	IPVTIITGYLGAGK	290	sp|Q5RIA9-3|CBWD5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:188	ms_run[2]:scan=11549	68.352	2	1407.8433	1407.8433	K	T	42	56
PSM	LATGSDDNCAAFFEGPPFK	291	sp|O75083|WDR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	9-UNIMOD:4,19-UNIMOD:188	ms_run[2]:scan=11117	65.647	2	2048.9245	2048.9245	R	F	162	181
PSM	LFVLLPEQSPVSYSK	292	sp|Q96K76-2|UBP47_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:188	ms_run[2]:scan=11597	68.656	2	1711.9492	1711.9492	R	R	736	751
PSM	LGLGGNAPVSIPQQSQSVK	293	sp|Q9H2P0|ADNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	19-UNIMOD:188	ms_run[2]:scan=7432	43.927	2	1885.0365	1885.0365	R	Q	349	368
PSM	LGLPPLTPEQQEALQK	294	sp|Q9UHX1-4|PUF60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	16-UNIMOD:188	ms_run[2]:scan=8994	52.754	2	1766.9874	1766.9874	K	A	11	27
PSM	LGLQYSQGLVSGSNAR	295	sp|Q9UI10-3|EI2BD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	16-UNIMOD:267	ms_run[2]:scan=7357	43.522	2	1658.8616	1658.8616	R	C	209	225
PSM	LISWYDNEFGYSNR	296	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:267	ms_run[2]:scan=10738	63.298	2	1772.8034	1772.8034	K	V	268	282
PSM	LISWYDNEFGYSNR	297	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10739	63.304	2	1762.7951	1762.7951	K	V	268	282
PSM	LLDAVDTYIPVPAR	298	sp|P49411|EFTU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:267	ms_run[2]:scan=10613	62.533	2	1551.8536	1551.8536	K	D	239	253
PSM	LLLINNAGSLGDVSK	299	sp|P35270|SPRE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:188	ms_run[2]:scan=9657	56.725	2	1518.8713	1518.8713	R	G	95	110
PSM	LPIGDVATQYFADR	300	sp|Q99832-2|TCPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10704	63.085	2	1564.7886	1564.7886	K	D	89	103
PSM	LSPPYSSPQEFAQDVGR	301	sp|Q13263-2|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	17-UNIMOD:267	ms_run[2]:scan=9086	53.31	2	1886.9038	1886.9038	K	M	669	686
PSM	LSPPYSSPQEFAQDVGR	302	sp|Q13263-2|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9099	53.392	2	1876.8955	1876.8955	K	M	669	686
PSM	MAPYQGPDAVPGALDYK	303	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	17-UNIMOD:188	ms_run[2]:scan=8288	48.665	2	1797.8703	1797.8703	R	S	883	900
PSM	MINLSVPDTIDER	304	sp|P13796|PLSL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:35	ms_run[2]:scan=8529	50.08	2	1517.7396	1517.7396	K	T	166	179
PSM	MLAIYDGFDGFAK	305	sp|Q01813-2|PFKAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:35	ms_run[2]:scan=11119	65.658	2	1462.6803	1462.6803	R	G	435	448
PSM	MNDLTIIQTTQGFCR	306	sp|Q96G03|PGM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:35,14-UNIMOD:4	ms_run[2]:scan=9296	54.589	2	1812.8499	1812.8499	R	Y	73	88
PSM	MTNGFSGADLTEICQR	307	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:35,14-UNIMOD:4	ms_run[2]:scan=7957	46.786	2	1814.7927	1814.7927	K	A	678	694
PSM	MVDDGSGEVQVWR	308	sp|P09327|VILI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:35	ms_run[2]:scan=6205	37.218	2	1492.6616	1492.6616	K	I	392	405
PSM	NLTNPNTVIILIGNK	309	sp|P61106|RAB14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:188	ms_run[2]:scan=10936	64.518	2	1628.9557	1628.9557	R	A	111	126
PSM	QNFIDPLQNLCEK	310	sp|Q99961|SH3G1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	11-UNIMOD:4	ms_run[2]:scan=10730	63.246	2	1617.7821	1617.7821	K	D	137	150
PSM	SDGALLLGASSLSGR	311	sp|Q9BQA1-2|MEP50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:267	ms_run[2]:scan=8870	52.05	2	1412.7499	1412.7499	R	C	38	53
PSM	SETAPAAPAAPAPAEKTPVK	312	sp|P10412|H14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:1	ms_run[2]:scan=4262	26.965	2	1945.0157	1945.0157	M	K	2	22
PSM	SPDFTNENPLETR	313	sp|P05023-3|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7151	42.362	2	1518.6951	1518.6951	R	N	197	210
PSM	SPFEVQVGPEAGMQK	314	sp|O75369-6|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7619	44.943	2	1602.7712	1602.7712	K	V	537	552
PSM	SVFPEQANNNEWAR	315	sp|O43242|PSMD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:267	ms_run[2]:scan=7152	42.367	2	1670.7677	1670.7677	K	Y	274	288
PSM	SVGGSGGGSFGDNLVTR	316	sp|P02545|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	17-UNIMOD:267	ms_run[2]:scan=5984	36.056	2	1575.7517	1575.7517	R	S	628	645
PSM	SVGNTIDPVILFQK	317	sp|P46821|MAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=11493	67.999	2	1529.8453	1529.8453	R	M	401	415
PSM	SWCPDCVQAEPVVR	318	sp|Q9BRA2|TXD17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:4,6-UNIMOD:4	ms_run[2]:scan=7154	42.378	2	1701.7603	1701.7603	K	E	41	55
PSM	TALALAIAQELGSK	319	sp|Q9Y265|RUVB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=12303	73.103	2	1384.7926	1384.7926	K	V	77	91
PSM	TCPVQLWVDSTPPPGTR	320	sp|P04637-8|P53_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:4	ms_run[2]:scan=9745	57.261	2	1909.9356	1909.9356	K	V	8	25
PSM	TLAVSGLGVVGR	321	sp|P11388|TOP2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	12-UNIMOD:267	ms_run[2]:scan=7709	45.434	2	1137.6745	1137.6745	K	D	467	479
PSM	TTPSVVAFTADGER	322	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6899	40.982	2	1449.71	1449.7100	R	L	86	100
PSM	TVQSLEIDLDSMR	323	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10600	62.448	2	1505.7396	1505.7396	R	N	302	315
PSM	VDFPQDQLTALTGR	324	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10424	61.363	2	1559.7944	1559.7944	K	I	216	230
PSM	VLAALPAAELVQACR	325	sp|Q9UK22|FBX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:4	ms_run[2]:scan=10299	60.602	2	1580.8708	1580.8708	R	L	58	73
PSM	VLVTGATGLLGR	326	sp|Q9NZL9-5|MAT2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	12-UNIMOD:267	ms_run[2]:scan=8256	48.482	2	1165.7058	1165.7058	R	A	21	33
PSM	VPSEGAYDIILPR	327	sp|Q9NQ84|GPC5C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9625	56.538	2	1428.7613	1428.7613	K	A	381	394
PSM	VVLVTGAGAGLGR	328	sp|P51659|DHB4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6378	38.196	2	1168.6928	1168.6928	R	A	11	24
PSM	CTVFHGAQVEDAFR	329	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:385,1-UNIMOD:4,14-UNIMOD:267	ms_run[1]:scan=9915	58.28986999999999	2	1628.7294	1628.7276	K	Y	1828	1842
PSM	NFILDQTNVSAAAQR	330	sp|Q00839|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	15-UNIMOD:267	ms_run[1]:scan=7964	46.825496666666666	2	1656.839800	1656.845902	R	R	576	591
PSM	CTTDHISAAGPWLK	331	sp|Q99798|ACON_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:385,1-UNIMOD:4,14-UNIMOD:188	ms_run[1]:scan=9180	53.884919999999994	2	1544.7430	1544.7384	K	F	592	606
PSM	LDVGNFSWGSECCTR	332	sp|P62241|RS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	12-UNIMOD:4,13-UNIMOD:4,15-UNIMOD:267	ms_run[1]:scan=9686	56.90452166666667	2	1796.753765	1796.748573	R	K	60	75
PSM	NLETLQQELGIEGENR	333	sp|Q9Y4W6|AFG32_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	16-UNIMOD:267	ms_run[1]:scan=10524	61.97931	2	1851.910890	1851.920189	R	V	225	241
PSM	QAIKELPQFATGENLPR	334	sp|Q9BZZ5|API5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:28,4-UNIMOD:188,17-UNIMOD:267	ms_run[1]:scan=10386	61.123891666666665	2	1910.0242	1910.0227	R	V	81	98
PSM	ILPTLEAVAALGNK	335	sp|Q12905|ILF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=11772	69.73229833333333	2	1408.829139	1408.828966	K	V	128	142
PSM	GPVFAPPYEPLPENVK	336	sp|P11387|TOP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	16-UNIMOD:188	ms_run[1]:scan=9848	57.89094833333333	2	1758.948752	1758.928802	K	F	224	240
PSM	CGFCHVGEEENEAR	337	sp|Q8IWS0|PHF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:385,1-UNIMOD:4,4-UNIMOD:4,14-UNIMOD:267	ms_run[1]:scan=5477	33.335818333333336	2	1685.6495	1685.6432	K	G	212	226
PSM	AGFADPDDFTLGAGPR	338	sp|Q6ZRV2|FA83H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	16-UNIMOD:267	ms_run[1]:scan=9841	57.846243333333334	2	1616.743080	1615.750605	R	F	481	497
PSM	AAAGQESEGPAVGPPQPLGK	339	sp|O14497-2|ARI1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=5080	31.245	2	1859.9377	1859.9377	K	E	52	72
PSM	AKPQVVVAPVLMSK	340	sp|Q9H074-3|PAIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:1	ms_run[2]:scan=8813	51.721	2	1507.8796	1507.8796	M	L	2	16
PSM	ALIAGGGAPEIELALR	341	sp|P50991-2|TCPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	16-UNIMOD:267	ms_run[2]:scan=11264	66.545	2	1559.8911	1559.8911	R	L	390	406
PSM	ALPAVQQNNLDEDLIR	342	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9221	54.125	2	1807.9428	1807.9428	R	K	329	345
PSM	ALPAVQQNNLDEDLIR	343	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	16-UNIMOD:267	ms_run[2]:scan=9236	54.217	2	1817.9511	1817.9511	R	K	329	345
PSM	ANINVENAFFTLAR	344	sp|P61006|RAB8A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=12679	75.72	2	1578.8154	1578.8154	K	D	154	168
PSM	APAMQPAEIQFAQR	345	sp|Q14684-2|RRP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7162	42.423	2	1556.7769	1556.7769	M	L	2	16
PSM	APILIATDVASR	346	sp|P17844-2|DDX5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:267	ms_run[2]:scan=7367	43.578	2	1235.7113	1235.7113	K	G	313	325
PSM	CDPVFDFGTGPR	347	sp|Q9BY44-4|EIF2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=8926	52.374	2	1376.6059	1376.6059	K	N	245	257
PSM	CEGINISGNFYR	348	sp|P40429|RL13A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=8077	47.455	2	1438.6539	1438.6539	R	N	38	50
PSM	CFIVGADNVGSK	349	sp|P05388-2|RLA0_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:4	ms_run[2]:scan=5693	34.446	2	1265.6074	1265.6074	K	Q	27	39
PSM	CIDSGLWVPNSK	350	sp|Q16543|CDC37_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:4,12-UNIMOD:188	ms_run[2]:scan=7903	46.505	2	1380.6803	1380.6803	R	A	336	348
PSM	CIDSGLWVPNSK	351	sp|Q16543|CDC37_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:4	ms_run[2]:scan=7908	46.531	2	1374.6602	1374.6602	R	A	336	348
PSM	CLMDQATDPNILGR	352	sp|P78527-2|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=8485	49.831	2	1612.7577	1612.7577	K	T	4075	4089
PSM	CLMDQATDPNILGR	353	sp|P78527-2|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:4	ms_run[2]:scan=8493	49.877	2	1602.7494	1602.7494	K	T	4075	4089
PSM	CPADNPGLVQAQPR	354	sp|Q68CZ2-2|TENS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:4	ms_run[2]:scan=3518	22.961	2	1521.7358	1521.7358	R	V	375	389
PSM	CVIFEIPGAPDDEAVR	355	sp|Q96I25|SPF45_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=10999	64.909	2	1796.8643	1796.8643	K	I	339	355
PSM	DFLAGGIAAAISK	356	sp|P12236|ADT3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:188	ms_run[2]:scan=11187	66.074	2	1238.6966	1238.6966	K	T	11	24
PSM	DPENFPFVVLGNK	357	sp|P51149|RAB7A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:188	ms_run[2]:scan=11961	70.939	2	1480.7658	1480.7658	R	I	114	127
PSM	FAAATGATPIAGR	358	sp|P08865|RSSA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=4179	26.547	2	1202.6408	1202.6408	K	F	90	103
PSM	FFTDDLFQYAGEK	359	sp|Q6NYC1-2|JMJD6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=12105	71.853	2	1579.7195	1579.7195	K	R	155	168
PSM	FGIDDQDFQNSLTR	360	sp|P48426-2|PI42A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9497	55.774	2	1654.7587	1654.7587	R	S	46	60
PSM	FGIDDQDFQNSLTR	361	sp|P48426-2|PI42A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:267	ms_run[2]:scan=9507	55.833	2	1664.767	1664.7670	R	S	46	60
PSM	FQPQSPDFLDITNPK	362	sp|Q92890-3|UFD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=10403	61.229	2	1745.8625	1745.8625	K	A	125	140
PSM	FQSVESGANNVVFIR	363	sp|Q9NXG2|THUM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	15-UNIMOD:267	ms_run[2]:scan=8690	51.005	2	1675.8557	1675.8557	R	T	117	132
PSM	GCDVVVIPAGVPR	364	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=7959	46.802	2	1347.7208	1347.7208	K	K	92	105
PSM	GFGFVDFNSEEDAK	365	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=10136	59.627	2	1560.6733	1560.6733	K	A	611	625
PSM	GFSEGLWEIENNPTVK	366	sp|P51858|HDGF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=10790	63.616	2	1818.8788	1818.8788	K	A	81	97
PSM	GILIPLCESGTCTLR	367	sp|Q13895|BYST_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=10322	60.739	2	1688.859	1688.8590	K	E	289	304
PSM	GKVEIDQQQLTQQQLNGN	368	sp|Q8IWS0-5|PHF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=5601	34.001	2	2040.0236	2040.0236	R	-	314	332
PSM	IFVGGLSPDTPEEK	369	sp|Q14103-4|HNRPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7339	43.419	2	1487.7508	1487.7508	K	I	165	179
PSM	IGIFGQDEDVTSK	370	sp|P16615-5|AT2A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:188	ms_run[2]:scan=7770	45.784	2	1413.7083	1413.7083	R	A	638	651
PSM	IGNLQTDLSDGLR	371	sp|O75369-6|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8403	49.343	2	1400.726	1400.7260	R	L	37	50
PSM	IGNTGGMLDNILASK	372	sp|P53396-3|ACLY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:35,15-UNIMOD:188	ms_run[2]:scan=7858	46.274	2	1524.7913	1524.7913	K	L	365	380
PSM	IGPYQPNVPVGIDYVIPK	373	sp|P43243-2|MATR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	18-UNIMOD:188	ms_run[2]:scan=11586	68.588	2	1974.0922	1974.0922	R	T	493	511
PSM	IIENELEGFGIR	374	sp|Q9Y295|DRG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=10388	61.141	2	1388.73	1388.7300	K	L	160	172
PSM	IMGIPEEEQMGLLR	375	sp|P35579-2|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:35,10-UNIMOD:35	ms_run[2]:scan=7740	45.605	2	1646.8008	1646.8008	R	V	192	206
PSM	IMNTFSVVPSPK	376	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8184	48.083	2	1318.6955	1318.6955	R	V	163	175
PSM	IMVANIEEVLQR	377	sp|O75396|SC22B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:267	ms_run[2]:scan=11533	68.251	2	1423.7733	1423.7733	R	G	148	160
PSM	ISSLLEEQFQQGK	378	sp|P62241|RS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:188	ms_run[2]:scan=7989	46.963	2	1511.7927	1511.7927	K	L	158	171
PSM	ISSLLEEQFQQGK	379	sp|P62241|RS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7995	46.998	2	1505.7726	1505.7726	K	L	158	171
PSM	ISVYYNEATGGK	380	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=4784	29.662	2	1300.6299	1300.6299	R	Y	47	59
PSM	IVLTNPVCTEVGEK	381	sp|P41091|IF2G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	8-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=7433	43.934	2	1563.8274	1563.8274	K	I	427	441
PSM	LAATNALLNSLEFTK	382	sp|Q14974|IMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=12207	72.498	2	1604.8774	1604.8774	K	A	192	207
PSM	LFQVQGTGANNTK	383	sp|P09327|VILI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=4053	25.889	2	1376.7048	1376.7048	R	A	517	530
PSM	LFQVQGTGANNTK	384	sp|P09327|VILI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:188	ms_run[2]:scan=4083	26.052	2	1382.725	1382.7250	R	A	517	530
PSM	LFVTNDAATILR	385	sp|P50990|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:267	ms_run[2]:scan=9911	58.272	2	1342.7484	1342.7484	K	E	63	75
PSM	LFVTNDAATILR	386	sp|P50990|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9912	58.276	2	1332.7402	1332.7402	K	E	63	75
PSM	LGASALDSIQEFR	387	sp|Q8IY17-5|PLPL6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:267	ms_run[2]:scan=9797	57.579	2	1415.7284	1415.7284	R	L	750	763
PSM	LGLPPLTPEQQEALQK	388	sp|Q9UHX1-4|PUF60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9153	53.721	2	1760.9672	1760.9672	K	A	11	27
PSM	LIPLITSNCTSK	389	sp|O75122-2|CLAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	9-UNIMOD:4	ms_run[2]:scan=7503	44.304	2	1345.7275	1345.7275	R	S	219	231
PSM	LLTFMGMAVENK	390	sp|Q7L2H7-2|EIF3M_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:188	ms_run[2]:scan=11304	66.799	2	1358.7034	1358.7034	R	E	147	159
PSM	LLTIGDANGEIQR	391	sp|Q86X55-2|CARM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:267	ms_run[2]:scan=7059	41.873	2	1408.755	1408.7550	R	H	37	50
PSM	LPETNLFETEETR	392	sp|Q15046|SYK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8466	49.719	2	1577.7573	1577.7573	K	K	408	421
PSM	LTSLGVIGALVK	393	sp|Q92600-3|CNOT9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:188	ms_run[2]:scan=12006	71.232	2	1175.7585	1175.7585	R	T	137	149
PSM	LVAIVDVIDQNR	394	sp|P50914|RL14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:267	ms_run[2]:scan=10486	61.746	2	1363.7699	1363.7699	K	A	24	36
PSM	LVAIVDVIDQNR	395	sp|P50914|RL14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=10489	61.763	2	1353.7616	1353.7616	K	A	24	36
PSM	LVGPEEALSPGEAR	396	sp|O60568|PLOD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:267	ms_run[2]:scan=6254	37.499	2	1433.739	1433.7390	K	D	359	373
PSM	LVVPASQCGSLIGK	397	sp|Q15366-7|PCBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	8-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=6853	40.743	2	1433.8008	1433.8008	R	G	102	116
PSM	LVVPATQCGSLIGK	398	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	8-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=7305	43.22	2	1447.8164	1447.8164	R	G	102	116
PSM	LYDNLLEQNLIR	399	sp|O00231|PSD11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=11126	65.703	2	1502.8093	1502.8093	K	V	326	338
PSM	LYDNLLEQNLIR	400	sp|O00231|PSD11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:267	ms_run[2]:scan=11131	65.736	2	1512.8176	1512.8176	K	V	326	338
PSM	LYGPSSVSFADDFVR	401	sp|P50454|SERPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	15-UNIMOD:267	ms_run[2]:scan=11120	65.664	2	1668.8023	1668.8023	R	S	134	149
PSM	MCDLVSDFDGFSER	402	sp|P30520|PURA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:35,2-UNIMOD:4	ms_run[2]:scan=10526	61.991	2	1692.676	1692.6760	R	F	181	195
PSM	MDGIVPDIAVGTKR	403	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=8267	48.545	2	1528.7919	1528.7919	-	G	1	15
PSM	MGGGSIEVSVPR	404	sp|Q96I24|FUBP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:35,12-UNIMOD:267	ms_run[2]:scan=5067	31.173	2	1213.6	1213.6000	R	F	251	263
PSM	MLVLDEADEMLNK	405	sp|P38919|IF4A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:35	ms_run[2]:scan=9895	58.174	2	1535.7211	1535.7211	K	G	183	196
PSM	MLVLDEADEMLNK	406	sp|P38919|IF4A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:35,13-UNIMOD:188	ms_run[2]:scan=9897	58.185	2	1541.7413	1541.7413	K	G	183	196
PSM	MWEVLESTTQTK	407	sp|Q01082-3|SPTB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:35,12-UNIMOD:188	ms_run[2]:scan=7352	43.492	2	1473.7117	1473.7117	K	A	1348	1360
PSM	NALFPEVFSPTPDENSDQNSR	408	sp|Q8IVT2|MISP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	21-UNIMOD:267	ms_run[2]:scan=11043	65.183	2	2373.0749	2373.0749	R	S	567	588
PSM	NELSGALTGLTR	409	sp|P26639|SYTC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8642	50.721	2	1230.6568	1230.6568	R	V	443	455
PSM	NFILDQCNVYNSGQR	410	sp|Q1KMD3|HNRL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=8148	47.881	2	1836.8452	1836.8453	R	R	532	547
PSM	NGQVIGIGAGQQSR	411	sp|P31939-2|PUR9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=3577	23.282	2	1383.7219	1383.7219	K	I	437	451
PSM	NGQVIGIGAGQQSR	412	sp|P31939-2|PUR9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:267	ms_run[2]:scan=3583	23.318	2	1393.7301	1393.7301	K	I	437	451
PSM	NIEDVIAQGIGK	413	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=10141	59.653	2	1255.6772	1255.6772	K	L	50	62
PSM	NSILAQVLDQSAR	414	sp|O14737|PDCD5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=11204	66.176	2	1413.7576	1413.7576	R	A	41	54
PSM	NVLLTGATGFLGK	415	sp|Q8WVX9|FACR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=10740	63.31	2	1289.7343	1289.7343	K	V	12	25
PSM	SANSELGGIWSVGQR	416	sp|Q99627-2|CSN8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	15-UNIMOD:267	ms_run[2]:scan=9417	55.306	2	1569.7775	1569.7775	K	I	17	32
PSM	SASLCAATLAAVLQR	417	sp|P52789|HXK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=11686	69.208	2	1540.8271	1540.8271	R	I	382	397
PSM	SIYSLILGQDNAADQSR	418	sp|Q9P0I2-2|EMC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	17-UNIMOD:267	ms_run[2]:scan=11675	69.142	2	1859.9253	1859.9253	R	M	181	198
PSM	SLGPPQGEEDSVPR	419	sp|P78527-2|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=4486	28.16	2	1466.7001	1466.7001	R	D	2107	2121
PSM	SLVQEMVGSFGK	420	sp|O75643|U520_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=11736	69.515	2	1280.6435	1280.6435	R	R	546	558
PSM	SPFEVQVGPEAGMQK	421	sp|O75369-6|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:35	ms_run[2]:scan=6634	39.591	2	1618.7661	1618.7661	K	V	537	552
PSM	SQLDLFDDVGTFASGPPK	422	sp|Q8N6H7-3|ARFG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	18-UNIMOD:188	ms_run[2]:scan=12373	73.554	2	1898.9357	1898.9357	R	Y	71	89
PSM	TFDTFCPLGPALVTK	423	sp|Q96GK7|FAH2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=11342	67.037	2	1671.8638	1671.8638	K	D	210	225
PSM	TGEGFLCVFAINNTK	424	sp|P01116-2|RASK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=12268	72.888	2	1675.8335	1675.8335	R	S	74	89
PSM	TIAIIAEGIPEALTR	425	sp|P53396-3|ACLY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=12180	72.328	2	1566.8981	1566.8981	R	K	322	337
PSM	TIGGGDDSFNTFFSETGAGK	426	sp|P68363-2|TBA1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	20-UNIMOD:188	ms_run[2]:scan=10929	64.474	2	2012.9059	2012.9059	K	H	41	61
PSM	TIQAPTQVPVVVSPR	427	sp|P32519-2|ELF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7487	44.222	2	1590.9093	1590.9093	R	N	396	411
PSM	TLTLVDTGIGMTK	428	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9282	54.506	2	1348.7272	1348.7272	R	A	83	96
PSM	TQTPPLGQTPQLGLK	429	sp|P78344-2|IF4G2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	15-UNIMOD:188	ms_run[2]:scan=7532	44.455	2	1583.8978	1583.8978	R	T	468	483
PSM	TSFFQALGITTK	430	sp|P05388-2|RLA0_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:188	ms_run[2]:scan=12286	73	2	1318.7228	1318.7228	K	I	135	147
PSM	TSFFQALGITTK	431	sp|P05388-2|RLA0_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=12287	73.005	2	1312.7027	1312.7027	K	I	135	147
PSM	VAAIEALNDGELQK	432	sp|Q8IZP2|ST134_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:188	ms_run[2]:scan=7370	43.593	2	1475.7927	1475.7927	K	A	115	129
PSM	VALVYGQMNEPPGAR	433	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6993	41.497	2	1600.8032	1600.8032	K	A	265	280
PSM	VFIGNLNTLVVK	434	sp|P07910-4|HNRPC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=10768	63.482	2	1315.7864	1315.7864	R	K	18	30
PSM	VFIGNLNTLVVK	435	sp|P07910-4|HNRPC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:188	ms_run[2]:scan=10774	63.521	2	1321.8065	1321.8065	R	K	18	30
PSM	VGDPQELNGITR	436	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:267	ms_run[2]:scan=4955	30.574	2	1307.6709	1307.6709	K	A	299	311
PSM	VLEQLTGQTPVFSK	437	sp|P62913-2|RL11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:188	ms_run[2]:scan=8433	49.517	2	1551.8604	1551.8604	K	A	38	52
PSM	VLGIQVDTDGSGR	438	sp|P33992|MCM5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6494	38.842	2	1315.6732	1315.6732	R	S	296	309
PSM	VPAINVNDSVTK	439	sp|P23526|SAHH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:188	ms_run[2]:scan=5066	31.168	2	1261.6973	1261.6973	K	S	175	187
PSM	VPLQQNFQDNQFQGK	440	sp|P80188-2|NGAL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	15-UNIMOD:188	ms_run[2]:scan=6483	38.781	2	1795.8949	1795.8949	K	W	36	51
PSM	VPSEGAYDIILPR	441	sp|Q9NQ84|GPC5C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:267	ms_run[2]:scan=9628	56.554	2	1438.7695	1438.7695	K	A	381	394
PSM	VTPNEGLTVSFPFGK	442	sp|Q14690|RRP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	15-UNIMOD:188	ms_run[2]:scan=11132	65.74	2	1597.8447	1597.8447	K	I	1240	1255
PSM	VTWDSSFCAVNPR	443	sp|Q9ULV4|COR1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	8-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=8541	50.149	2	1547.7066	1547.7066	R	F	32	45
PSM	VTWDSSFCAVNPR	444	sp|Q9ULV4|COR1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	8-UNIMOD:4	ms_run[2]:scan=8557	50.243	2	1537.6984	1537.6984	R	F	32	45
PSM	VVSGMVNCNDDQGVLLGR	445	sp|P21980|TGM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	8-UNIMOD:4,18-UNIMOD:267	ms_run[2]:scan=7804	45.978	2	1941.9276	1941.9276	R	W	223	241
PSM	YLNTNPVGGLLEYAR	446	sp|P55265-5|DSRAD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	15-UNIMOD:267	ms_run[2]:scan=11769	69.71	2	1688.8761	1688.8761	R	S	427	442
PSM	LEGLTDEINFLR	447	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	12-UNIMOD:267	ms_run[1]:scan=11853	70.24871	2	1428.749710	1428.748814	R	Q	214	226
PSM	LEGLTDEINFLR	448	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=11844	70.19085333333334	2	1418.741920	1418.740545	R	Q	214	226
PSM	CTVFHGAQVEDAFR	449	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=9921	58.326993333333334	2	1618.7203	1618.7193	K	Y	1828	1842
PSM	TALALAIAQELGSK	450	sp|Q9Y265|RUVB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	14-UNIMOD:188	ms_run[1]:scan=12295	73.05360666666667	2	1390.812926	1390.812709	K	V	77	91
PSM	GVVDSEDLPLNISR	451	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	14-UNIMOD:267	ms_run[1]:scan=8976	52.64856999999999	2	1522.789671	1522.786656	R	E	387	401
PSM	QNGDDPLLTYRFPPK	452	sp|P02545|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:28,11-UNIMOD:267,15-UNIMOD:188	ms_run[1]:scan=11181	66.03702833333334	2	1758.8934	1758.8907	R	F	472	487
PSM	QAGPASVPLRTEEEFK	453	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:28,10-UNIMOD:267,16-UNIMOD:188	ms_run[1]:scan=8080	47.47103833333333	2	1756.9032	1756.8961	K	K	131	147
PSM	VFIGNLNTLVVK	454	sp|O60812|HNRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	12-UNIMOD:188	ms_run[1]:scan=10769	63.48738833333333	2	1321.803623	1321.806502	R	K	18	30
PSM	AMGIMNSFVNDIFER	455	sp|P33778|H2B1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	2-UNIMOD:35,15-UNIMOD:267	ms_run[1]:scan=12093	71.77850333333333	2	1769.806313	1768.815196	K	I	59	74
PSM	CHAIIDEQPLIFK	456	sp|P48059-3|LIMS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:385,1-UNIMOD:4,13-UNIMOD:188	ms_run[1]:scan=11051	65.23425999999999	2	1571.8102	1571.8108	K	N	200	213
PSM	CHAIIDEQPLIFK	457	sp|P48059-3|LIMS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=11054	65.25116166666668	2	1565.7909	1565.7907	K	N	200	213
PSM	CGFCHVGEEENEAR	458	sp|Q8IWS0|PHF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:385,1-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=5487	33.388421666666666	2	1675.6409	1675.6350	K	G	212	226
PSM	QAQNPDQGPKLDLGFK	459	sp|Q9NVZ3|NECP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:28	ms_run[1]:scan=8640	50.70470833333333	2	1737.8751	1737.8681	K	E	138	154
PSM	GFGFVTFENSADADR	460	sp|Q9NWB1|RFOX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=10511	61.89435	2	1631.727047	1631.721600	K	A	157	172
PSM	AAILPTSIFLTNK	461	sp|O14744-3|ANM5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11872	70.365	2	1387.8075	1387.8075	K	K	167	180
PSM	AAILPTSIFLTNK	462	sp|O14744-3|ANM5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:188	ms_run[2]:scan=11880	70.417	2	1393.8276	1393.8276	K	K	167	180
PSM	ADKPDMGEIASFDK	463	sp|P63313|TYB10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:1	ms_run[2]:scan=8217	48.26	2	1564.7079	1564.7079	M	A	2	16
PSM	AFYGDTLVTGFAR	464	sp|Q9HCC0-2|MCCB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10621	62.583	2	1416.7038	1416.7038	K	I	311	324
PSM	AGIEGPLLASDVGR	465	sp|P18583-6|SON_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:267	ms_run[2]:scan=8247	48.431	2	1363.7335	1363.7335	R	D	1750	1764
PSM	ALAGCDFLTISPK	466	sp|P37837|TALDO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	5-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=9768	57.403	2	1397.732	1397.7320	K	L	246	259
PSM	ALIAGGGAPEIELALR	467	sp|P50991-2|TCPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11269	66.579	2	1549.8828	1549.8828	R	L	390	406
PSM	AQLFALTGVQPAR	468	sp|P54578-2|UBP14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:267	ms_run[2]:scan=9457	55.532	2	1380.7753	1380.7753	K	Q	31	44
PSM	AQLFALTGVQPAR	469	sp|P54578-2|UBP14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9459	55.541	2	1370.767	1370.7670	K	Q	31	44
PSM	ASVSSATFSGHGAR	470	sp|Q7Z4H3-3|HDDC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:1	ms_run[2]:scan=4409	27.767	2	1375.648	1375.6480	M	S	2	16
PSM	ATGNQPPPLVGTYNTLLSR	471	sp|Q96PD2|DCBD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10717	63.164	2	1998.0534	1998.0534	K	T	703	722
PSM	CSILSPELALPTGSR	472	sp|O75592-2|MYCB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=10223	60.141	2	1609.8373	1609.8373	R	A	1169	1184
PSM	CSVLAAANSVFGR	473	sp|P33992|MCM5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:4	ms_run[2]:scan=10290	60.548	2	1350.6714	1350.6714	R	W	482	495
PSM	ELFSNLQEFAGPSGK	474	sp|Q9H8H3|MET7A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10617	62.555	2	1622.794	1622.7940	R	L	57	72
PSM	FAQPGSFEYEYAMR	475	sp|Q15233-2|NONO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:35,14-UNIMOD:267	ms_run[2]:scan=7594	44.795	2	1720.7431	1720.7431	R	W	168	182
PSM	FLESPDFQPNIAK	476	sp|Q13362-2|2A5G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8630	50.645	2	1504.7562	1504.7562	R	K	144	157
PSM	FQGQDTILDYTLR	477	sp|P36639-4|8ODP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:267	ms_run[2]:scan=10648	62.747	2	1578.7917	1578.7917	K	E	139	152
PSM	FYALSASFEPFSNK	478	sp|P27797|CALR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11696	69.267	2	1606.7668	1606.7668	R	G	74	88
PSM	FYEQMNGPVAGASR	479	sp|P29692-3|EF1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:267	ms_run[2]:scan=5278	32.286	2	1535.7066	1535.7066	R	Q	25	39
PSM	GALQNIIPASTGAAK	480	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	15-UNIMOD:188	ms_run[2]:scan=7464	44.104	2	1416.8032	1416.8032	R	A	159	174
PSM	GFGFVTFADPASVDK	481	sp|Q96DH6-2|MSI2H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11732	69.488	2	1556.7511	1556.7511	R	V	59	74
PSM	GGLPLDGITELAGR	482	sp|O43542|XRCC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11162	65.921	2	1367.7409	1367.7409	R	S	95	109
PSM	GLIVYQLENQPSEFR	483	sp|P78406|RAE1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	15-UNIMOD:267	ms_run[2]:scan=10543	62.099	2	1801.9238	1801.9238	R	R	191	206
PSM	GNAPEGLPQLMEVVR	484	sp|A5YKK6-3|CNOT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	15-UNIMOD:267	ms_run[2]:scan=11594	68.639	2	1618.8376	1618.8376	R	S	1795	1810
PSM	GVDEVTIVNILTNR	485	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=12711	75.933	2	1541.8413	1541.8413	K	S	50	64
PSM	IFVGGLSPDTPEEK	486	sp|Q14103-4|HNRPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:188	ms_run[2]:scan=7350	43.482	2	1493.7709	1493.7709	K	I	165	179
PSM	IGAFGYMECSAK	487	sp|P61586|RHOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:4	ms_run[2]:scan=7395	43.733	2	1332.5842	1332.5842	R	T	151	163
PSM	IGAFGYMECSAK	488	sp|P61586|RHOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:4,12-UNIMOD:188	ms_run[2]:scan=7397	43.742	2	1338.6044	1338.6044	R	T	151	163
PSM	IGASTLLSDIER	489	sp|Q9Y315|DEOC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10590	62.386	2	1273.6878	1273.6878	R	Q	288	300
PSM	IGNTGGMLDNILASK	490	sp|P53396-3|ACLY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	15-UNIMOD:188	ms_run[2]:scan=10468	61.637	2	1508.7964	1508.7964	K	L	365	380
PSM	ILTFDQLALDSPK	491	sp|Q07020-2|RL18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11169	65.965	2	1459.7922	1459.7922	K	G	91	104
PSM	ILTFDQLALDSPK	492	sp|Q07020-2|RL18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:188	ms_run[2]:scan=11341	67.031	2	1465.8124	1465.8124	K	G	91	104
PSM	IMNTFSVMPSPK	493	sp|Q9BVA1|TBB2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	12-UNIMOD:188	ms_run[2]:scan=8418	49.432	2	1356.6877	1356.6877	R	V	163	175
PSM	IMNTFSVVPSPK	494	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	12-UNIMOD:188	ms_run[2]:scan=8175	48.034	2	1324.7156	1324.7156	R	V	163	175
PSM	INAWNSPTLPIYEPGLK	495	sp|O60701|UGDH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11495	68.01	2	1912.0094	1912.0094	R	E	42	59
PSM	ISVYYNEATGGK	496	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	12-UNIMOD:188	ms_run[2]:scan=4785	29.667	2	1306.6501	1306.6501	R	Y	47	59
PSM	KLASQADSTEQVDDTILT	497	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:188	ms_run[2]:scan=6811	40.525	2	1939.9682	1939.9682	K	-	2654	2672
PSM	LAGTQPLEVLEAVQR	498	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	15-UNIMOD:267	ms_run[2]:scan=11213	66.23	2	1632.9074	1632.9074	R	S	639	654
PSM	LATQSNEITIPVTFESR	499	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10031	58.99	2	1904.9844	1904.9844	K	A	172	189
PSM	LENYPIPEPGPNEVLLR	500	sp|Q00796|DHSO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	17-UNIMOD:267	ms_run[2]:scan=10532	62.031	2	1959.0341	1959.0341	R	M	22	39
PSM	LLELQEVDSLLR	501	sp|P16144-4|ITB4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	12-UNIMOD:267	ms_run[2]:scan=12855	77.113	2	1436.8114	1436.8114	K	G	1061	1073
PSM	LLFEGAGSNPGDK	502	sp|P61421|VA0D1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6008	36.164	2	1303.6408	1303.6408	K	T	276	289
PSM	LLGVCCSVDNCR	503	sp|A0AV96|RBM47_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	5-UNIMOD:4,6-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=5607	34.032	2	1451.6319	1451.6319	R	L	141	153
PSM	LQIWDTAGQESFR	504	sp|P61019-2|RAB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9536	56.003	2	1549.7525	1549.7525	K	S	33	46
PSM	LQIWDTAGQESFR	505	sp|P61019-2|RAB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:267	ms_run[2]:scan=9588	56.315	2	1559.7608	1559.7608	K	S	33	46
PSM	LQPSSSPENSLDPFPPR	506	sp|Q8WWM7-6|ATX2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	17-UNIMOD:267	ms_run[2]:scan=8446	49.599	2	1876.9195	1876.9195	K	I	554	571
PSM	LSDPGIPITVLSR	507	sp|P23458|JAK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:267	ms_run[2]:scan=10107	59.447	2	1376.7903	1376.7903	K	Q	737	750
PSM	LVIPSELGYGER	508	sp|P26885|FKBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8780	51.525	2	1331.7085	1331.7085	K	G	104	116
PSM	MINLSEPDTIDER	509	sp|Q14651|PLSI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:35,13-UNIMOD:267	ms_run[2]:scan=6664	39.742	2	1557.722	1557.7220	K	A	168	181
PSM	MINLSVPDTIDER	510	sp|P13796|PLSL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:35,13-UNIMOD:267	ms_run[2]:scan=8576	50.348	2	1527.7478	1527.7478	K	T	166	179
PSM	NFLEDGESDGFLR	511	sp|Q9BXS4|TMM59_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:267	ms_run[2]:scan=10303	60.624	2	1507.6819	1507.6819	R	C	220	233
PSM	NLANTVTEEILEK	512	sp|O60506-4|HNRPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:188	ms_run[2]:scan=11168	65.96	2	1478.7924	1478.7924	R	A	309	322
PSM	NLTALGLNLVASGGTAK	513	sp|P31939-2|PUR9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11046	65.2	2	1598.8992	1598.8992	R	A	22	39
PSM	NPPLAEALLSGDLEK	514	sp|Q5TDH0-2|DDI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11973	71.012	2	1565.8301	1565.8301	R	F	156	171
PSM	NTGIICTIGPASR	515	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:4	ms_run[2]:scan=6082	36.55	2	1358.6976	1358.6976	R	S	44	57
PSM	NTGIICTIGPASR	516	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:4	ms_run[2]:scan=6267	37.577	2	1358.6976	1358.6976	R	S	44	57
PSM	PAVLGFEGSANK	517	sp|Q9NPF4|OSGEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	12-UNIMOD:188	ms_run[2]:scan=5712	34.541	2	1194.634	1194.6340	M	I	2	14
PSM	PGSLPLNAEACWPK	518	sp|Q01581|HMCS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	11-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=9092	53.347	2	1544.7753	1544.7753	M	D	2	16
PSM	PLFTANPFEQDVEK	519	sp|O75886-2|STAM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10793	63.639	2	1633.7988	1633.7988	M	A	2	16
PSM	QSLGELIGTLNAAK	520	sp|P60174|TPIS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:188	ms_run[2]:scan=11391	67.342	2	1419.8029	1419.8029	K	V	57	71
PSM	SDGALLLGASSLSGR	521	sp|Q9BQA1-2|MEP50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8871	52.055	2	1402.7416	1402.7416	R	C	38	53
PSM	SGGMSNELNNIISR	522	sp|P53396-3|ACLY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:267	ms_run[2]:scan=8805	51.671	2	1500.723	1500.7230	R	T	392	406
PSM	SIQLDGLVWGASK	523	sp|P29692-3|EF1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11150	65.849	2	1372.7351	1372.7351	R	L	196	209
PSM	SLLINAVEASCIR	524	sp|P32322-2|P5CR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	11-UNIMOD:4	ms_run[2]:scan=10352	60.925	2	1444.7708	1444.7708	R	T	252	265
PSM	SNILLLGPTGSGK	525	sp|O76031|CLPX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:188	ms_run[2]:scan=8049	47.303	2	1261.7337	1261.7337	K	T	287	300
PSM	SPFEVQVGPEAGMQK	526	sp|O75369-6|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:35,15-UNIMOD:188	ms_run[2]:scan=6611	39.468	2	1624.7862	1624.7862	K	V	537	552
PSM	SPFSVAVSPSLDLSK	527	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	15-UNIMOD:188	ms_run[2]:scan=10208	60.053	2	1538.8288	1538.8288	K	I	959	974
PSM	SPFVVQVGEACNPNACR	528	sp|O75369-6|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	11-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=7333	43.381	2	1903.8669	1903.8669	K	A	440	457
PSM	SPISVPGGSALISNLGK	529	sp|P51610-2|HCFC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	17-UNIMOD:188	ms_run[2]:scan=10498	61.817	2	1601.9084	1601.9084	K	V	597	614
PSM	SQETECTYFSTPLLLGK	530	sp|P40926|MDHM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:4	ms_run[2]:scan=11554	68.38	2	1972.9452	1972.9452	K	K	280	297
PSM	SQFTITPGSEQIR	531	sp|Q99798|ACON_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6600	39.406	2	1462.7416	1462.7416	K	A	412	425
PSM	SWCPDCVQAEPVVR	532	sp|Q9BRA2|TXD17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:4,6-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=7156	42.389	2	1711.7686	1711.7686	K	E	41	55
PSM	TELPQFVSYFQQR	533	sp|Q14166|TTL12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:267	ms_run[2]:scan=11929	70.727	2	1651.8234	1651.8234	R	E	395	408
PSM	TFNMDEYVGLPR	534	sp|P46926|GNPI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	12-UNIMOD:267	ms_run[2]:scan=10264	60.391	2	1450.679	1450.6790	K	D	68	80
PSM	TGGLEIDSDFGGFR	535	sp|O95831-3|AIFM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10316	60.707	2	1469.6787	1469.6787	K	V	405	419
PSM	TGGLEIDSDFGGFR	536	sp|O95831-3|AIFM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:267	ms_run[2]:scan=10317	60.712	2	1479.6869	1479.6869	K	V	405	419
PSM	TIDDLKNQILNLTTDNANILLQIDNAR	537	sp|P13645|K1C10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=13987	91.037	3	3051.62	3051.6200	K	L	202	229
PSM	TINEVENQILTR	538	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7834	46.146	2	1428.7573	1428.7573	R	D	746	758
PSM	TSAALSTVGSAISR	539	sp|O43399-6|TPD54_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:267	ms_run[2]:scan=6352	38.056	2	1329.7128	1329.7128	K	K	97	111
PSM	TSTVWDNNNPIWSVR	540	sp|P14222|PERF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	15-UNIMOD:267	ms_run[2]:scan=10913	64.372	2	1797.8674	1797.8674	R	L	450	465
PSM	VALVYGQMNEPPGAR	541	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6866	40.806	2	1600.8032	1600.8032	K	A	265	280
PSM	VAPSAVLGPNVSIGK	542	sp|Q96IJ6|GMPPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	15-UNIMOD:188	ms_run[2]:scan=7420	43.865	2	1413.8287	1413.8287	K	G	295	310
PSM	VEEGGWWEGTLNGR	543	sp|Q15052-2|ARHG6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9756	57.327	2	1588.727	1588.7270	R	T	38	52
PSM	VGINYQPPTVVPGGDLAK	544	sp|P68363-2|TBA1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	18-UNIMOD:188	ms_run[2]:scan=8807	51.682	2	1829.9983	1829.9983	K	V	237	255
PSM	VPAINVNDSVTK	545	sp|P23526|SAHH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5071	31.196	2	1255.6772	1255.6772	K	S	175	187
PSM	VPTANVSVVDLTCR	546	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=8005	47.052	2	1539.7954	1539.7954	R	L	193	207
PSM	VSAPGVLTAQDR	547	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=4676	29.106	2	1212.6463	1212.6463	K	V	812	824
PSM	VSLAGACGVGGYGSR	548	sp|P13647|K2C5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=5400	32.915	2	1419.6804	1419.6804	R	S	49	64
PSM	VTPNEGLTVSFPFGK	549	sp|Q14690|RRP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11113	65.625	2	1591.8246	1591.8246	K	I	1240	1255
PSM	VWLDPNETNEIANANSR	550	sp|P84098|RL19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8270	48.562	2	1941.9181	1941.9181	K	Q	22	39
PSM	VYFGMQDGSVNMR	551	sp|P49247|RPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8081	47.477	2	1502.6646	1502.6646	R	E	294	307
PSM	YGEYFPGTGDLR	552	sp|Q92769-3|HDAC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	12-UNIMOD:267	ms_run[2]:scan=7962	46.815	2	1383.6334	1383.6334	K	D	172	184
PSM	YIGEVGDIVVGR	553	sp|Q13868-3|EXOS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8526	50.064	2	1275.6823	1275.6823	R	I	76	88
PSM	YISPDQLADLYK	554	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	12-UNIMOD:188	ms_run[2]:scan=10267	60.408	2	1430.7389	1430.7389	R	S	270	282
PSM	YLNTNPVGGLLEYAR	555	sp|P55265-5|DSRAD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11768	69.704	2	1678.8679	1678.8679	R	S	427	442
PSM	YWLCAATGPSIK	556	sp|P63244|RACK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:4	ms_run[2]:scan=8741	51.3	2	1365.6751	1365.6751	R	I	246	258
PSM	QRSQVEEELFSVR	557	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:28	ms_run[1]:scan=9954	58.522043333333336	2	1588.7825	1588.7840	R	V	2359	2372
PSM	MSTSPEAFLALR	558	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	1-UNIMOD:35	ms_run[1]:scan=9877	58.06776166666667	2	1338.659793	1337.664937	R	S	3890	3902
PSM	AFLASPEYVNLPINGNGKQ	559	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=10777	63.536751666666675	2	2032.033844	2031.042541	K	-	192	211
PSM	IQFVGACNPPTDPGR	560	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	7-UNIMOD:4,15-UNIMOD:267	ms_run[1]:scan=6192	37.14470333333333	2	1639.773206	1637.785945	R	K	2706	2721
PSM	QATKDAGTIAGLNVLR	561	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:28,4-UNIMOD:188,16-UNIMOD:267	ms_run[1]:scan=9414	55.28465166666667	2	1625.9136	1625.9066	R	I	156	172
PSM	TLTIVDTGIGMTK	562	sp|Q58FG1|HS904_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	13-UNIMOD:188	ms_run[1]:scan=8922	52.35410666666667	2	1354.748737	1354.747332	R	A	28	41
PSM	QEYDESGPSIVHR	563	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:28,13-UNIMOD:267	ms_run[1]:scan=5114	31.430790000000002	2	1508.6800	1508.6766	K	K	360	373
PSM	QMADTGKLNTLLQR	564	sp|Q00839|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:28,2-UNIMOD:35	ms_run[1]:scan=7617	44.93250166666667	2	1586.8129	1586.8081	K	A	545	559
PSM	SIQLDGLVWGASK	565	sp|P29692|EF1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	13-UNIMOD:188	ms_run[1]:scan=11149	65.84388333333334	2	1379.754741	1378.755194	R	L	220	233
PSM	IMGIPEEEQMGLLR	566	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=10996	64.89163666666667	2	1614.811169	1614.810949	R	V	328	342
PSM	QAGPASVPLRTEEEFK	567	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:28	ms_run[1]:scan=8062	47.371035	2	1740.8757	1740.8677	K	K	131	147
PSM	QQNELAELHANLAR	568	sp|Q14980|NUMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:28	ms_run[1]:scan=9163	53.78156833333333	2	1588.7966	1588.7952	R	A	870	884
PSM	AQLFALTGVQPAR	569	sp|P54578|UBP14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=9524	55.933780000000006	2	1370.768574	1370.767034	K	Q	31	44
PSM	QQQEILAAKPWTK	570	sp|Q92905|CSN5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:28	ms_run[1]:scan=8158	47.93946666666667	2	1522.8186	1522.8139	K	D	35	48
PSM	QLSLDINKLPGEK	571	sp|P25440|BRD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:28	ms_run[1]:scan=10128	59.577128333333334	2	1436.7838	1436.7870	R	L	649	662
PSM	QLSLDINKLPGEK	572	sp|P25440|BRD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:28,8-UNIMOD:188,13-UNIMOD:188	ms_run[1]:scan=10129	59.58278166666666	2	1448.8239	1448.8272	R	L	649	662
PSM	SPQELLCGASLISDR	573	sp|P00734|THRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	7-UNIMOD:4	ms_run[1]:scan=10098	59.392215	2	1644.810502	1644.814121	K	W	385	400
PSM	AAPAQQTTQPGGGKR	574	sp|Q9NXG2|THUM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:1	ms_run[2]:scan=848	8.4239	2	1508.7696	1508.7696	M	K	2	17
PSM	AFDSGIIPMEFVNK	575	sp|P53396-3|ACLY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:188	ms_run[2]:scan=11908	70.592	2	1572.7953	1572.7953	K	M	678	692
PSM	AGGIETIANEFSDR	576	sp|Q92598-2|HS105_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:267	ms_run[2]:scan=9842	57.852	2	1488.7084	1488.7084	R	C	20	34
PSM	AGPGSLELCGLPSQK	577	sp|Q14684-2|RRP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	9-UNIMOD:4	ms_run[2]:scan=7527	44.429	2	1512.7606	1512.7606	K	T	557	572
PSM	ALASPEQLAQLPSSGVPR	578	sp|Q9Y3Q8|T22D4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	18-UNIMOD:267	ms_run[2]:scan=9405	55.231	2	1829.9875	1829.9875	R	L	367	385
PSM	CAAGLAELAAR	579	sp|Q13098-5|CSN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:4,11-UNIMOD:267	ms_run[2]:scan=6020	36.229	2	1111.5683	1111.5683	K	K	247	258
PSM	CIPALDSLTPANEDQK	580	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:4	ms_run[2]:scan=8496	49.893	2	1770.8458	1770.8458	R	I	447	463
PSM	CSVLPLSQNQEFMPFVK	581	sp|P41250|GARS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=12433	73.949	2	2029.0108	2029.0108	K	E	616	633
PSM	DPENFPFVVLGNK	582	sp|P51149|RAB7A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=11808	69.959	2	1474.7456	1474.7456	R	I	114	127
PSM	EQLWLANEGLITR	583	sp|P46940|IQGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=10958	64.653	2	1541.8202	1541.8202	R	L	739	752
PSM	FCSFSPCIEQVQR	584	sp|Q96FX7|TRM61_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=7880	46.389	2	1656.7388	1656.7388	R	T	203	216
PSM	FIQSSGQPVPLVVESCIR	585	sp|P98171|RHG04_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	16-UNIMOD:4	ms_run[2]:scan=10025	58.952	2	2015.051	2015.0510	K	F	512	530
PSM	FLGDIEVWDQAEK	586	sp|P26639|SYTC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=11034	65.127	2	1548.746	1548.7460	K	Q	505	518
PSM	FMQTFVLAPEGSVANK	587	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=10089	59.336	2	1737.876	1737.8760	R	F	108	124
PSM	FNVLQYVVPEVK	588	sp|Q14152-2|EIF3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=12877	77.296	2	1433.7919	1433.7919	R	D	343	355
PSM	FQSVESGANNVVFIR	589	sp|Q9NXG2|THUM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8691	51.011	2	1665.8475	1665.8475	R	T	117	132
PSM	FSPGAPGGSGSQPNQK	590	sp|Q15942-2|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=1532	12.269	2	1514.7114	1514.7114	K	L	123	139
PSM	FTQAGSEVSALLGR	591	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9652	56.698	2	1434.7467	1434.7467	R	I	311	325
PSM	GAVSAEQVIAGFNR	592	sp|Q9UHV9|PFD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9591	56.333	2	1417.7314	1417.7314	K	L	19	33
PSM	GCDVVVIPAGVPR	593	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=7912	46.548	2	1347.7208	1347.7208	K	K	92	105
PSM	GGGGGGPGEGFDVAK	594	sp|Q9Y295|DRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	15-UNIMOD:188	ms_run[2]:scan=3784	24.414	2	1266.5936	1266.5936	K	T	47	62
PSM	GGSGTAGTEPSDIIIPLR	595	sp|P98172|EFNB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	18-UNIMOD:267	ms_run[2]:scan=9483	55.686	2	1749.9136	1749.9136	K	T	290	308
PSM	GIQVSNNGPCLGSR	596	sp|P33121-2|ACSL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	10-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=4721	29.353	2	1467.7128	1467.7128	R	K	99	113
PSM	GLEPSPAAVAALPPEVR	597	sp|Q9P265|DIP2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9382	55.094	2	1672.9148	1672.9148	R	A	5	22
PSM	GLPWSCSADEVMR	598	sp|P55795|HNRH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:4,12-UNIMOD:35,13-UNIMOD:267	ms_run[2]:scan=7385	43.68	2	1532.6627	1532.6627	R	F	17	30
PSM	GLPWSCSADEVMR	599	sp|P55795|HNRH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=9308	54.661	2	1516.6678	1516.6678	R	F	17	30
PSM	GLPWSCSADEVQR	600	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=7185	42.554	2	1513.6859	1513.6859	R	F	17	30
PSM	GQDEASAGGIWGFIK	601	sp|Q96M27-4|PRRC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	15-UNIMOD:188	ms_run[2]:scan=11911	70.61	2	1540.7617	1540.7617	R	G	204	219
PSM	GSPMEISLPIALSK	602	sp|P09960-4|LKHA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:35	ms_run[2]:scan=10116	59.504	2	1457.78	1457.7800	K	N	60	74
PSM	IALTDNALIAR	603	sp|P18124|RL7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7909	46.535	2	1169.6768	1169.6768	R	S	167	178
PSM	IANLQTDLSDGLR	604	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8712	51.13	2	1414.7416	1414.7416	R	L	64	77
PSM	IGASTLLSDIER	605	sp|Q9Y315|DEOC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:267	ms_run[2]:scan=10588	62.375	2	1283.696	1283.6960	R	Q	288	300
PSM	IGASTLLSDIER	606	sp|Q9Y315|DEOC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:267	ms_run[2]:scan=10615	62.544	2	1283.696	1283.6960	R	Q	288	300
PSM	IGNTGGMLDNILASK	607	sp|P53396-3|ACLY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	7-UNIMOD:35	ms_run[2]:scan=7862	46.297	2	1518.7712	1518.7712	K	L	365	380
PSM	IIASSPEMNLPTVSALR	608	sp|Q96C36|P5CR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	17-UNIMOD:267	ms_run[2]:scan=10434	61.426	2	1807.9741	1807.9741	K	K	30	47
PSM	IIGLDQVAGMSETALPGAFK	609	sp|P35579-2|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	10-UNIMOD:35	ms_run[2]:scan=11329	66.951	2	2033.0503	2033.0503	R	T	482	502
PSM	IIQTPGLWESENQNK	610	sp|Q9NP72|RAB18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7695	45.356	2	1755.8792	1755.8792	K	G	169	184
PSM	ILGPAESDEFLAR	611	sp|Q5T4S7-3|UBR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8628	50.634	2	1416.7249	1416.7249	R	V	1337	1350
PSM	ILQDSLGGNCR	612	sp|O60282-2|KIF5C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	10-UNIMOD:4,11-UNIMOD:267	ms_run[2]:scan=3647	23.675	2	1241.6062	1241.6062	R	T	55	66
PSM	IMVANIEEVLQR	613	sp|O75396|SC22B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:35	ms_run[2]:scan=10700	63.057	2	1429.7599	1429.7599	R	G	148	160
PSM	IQIAPDSGGLPER	614	sp|Q96AE4|FUBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5989	36.076	2	1351.7096	1351.7096	K	S	134	147
PSM	IWSVPNASCVQVVR	615	sp|Q9UMS4|PRP19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	9-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=9218	54.108	2	1623.8431	1623.8431	R	A	290	304
PSM	LALPQSDASLLSR	616	sp|Q9H583|HEAT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:267	ms_run[2]:scan=8762	51.422	2	1379.7648	1379.7648	R	D	11	24
PSM	LDVGNFSWGSECCTR	617	sp|P62241|RS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=9671	56.811	2	1786.7403	1786.7403	R	K	60	75
PSM	LFIGGLNTETNEK	618	sp|P38159-3|RBMX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7754	45.69	2	1434.7355	1434.7355	K	A	10	23
PSM	LFIGGLNTETNEK	619	sp|P38159-3|RBMX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:188	ms_run[2]:scan=7755	45.695	2	1440.7556	1440.7556	K	A	10	23
PSM	LFQEDDEIPLYLK	620	sp|P14406|CX7A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=11415	67.492	2	1621.8239	1621.8239	K	G	34	47
PSM	LFVSGACDASAK	621	sp|P62873-2|GBB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	7-UNIMOD:4	ms_run[2]:scan=4005	25.614	2	1224.5809	1224.5809	R	L	198	210
PSM	LGDVISIQPCPDVK	622	sp|P55072|TERA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	10-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=8085	47.503	2	1545.8168	1545.8168	R	Y	96	110
PSM	LGLGGNAPVSIPQQSQSVK	623	sp|Q9H2P0|ADNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7425	43.889	2	1879.0163	1879.0163	R	Q	349	368
PSM	LGQDSLTPEQVAWR	624	sp|Q86UU0-3|BCL9L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:267	ms_run[2]:scan=8431	49.506	2	1608.8135	1608.8135	R	K	508	522
PSM	LGSELIQGLGYR	625	sp|Q9UHN6-2|CEIP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9411	55.269	2	1304.7089	1304.7089	R	Q	334	346
PSM	LGSELIQGLGYR	626	sp|Q9UHN6-2|CEIP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:267	ms_run[2]:scan=9413	55.279	2	1314.7171	1314.7171	R	Q	334	346
PSM	LLQSNPVLEAFGNAK	627	sp|O00159-2|MYO1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=11160	65.909	2	1599.8621	1599.8621	R	T	139	154
PSM	LQPSSSPENSLDPFPPR	628	sp|Q8WWM7-6|ATX2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8445	49.593	2	1866.9112	1866.9112	K	I	554	571
PSM	LQVVDQPLPVR	629	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:267	ms_run[2]:scan=7113	42.168	2	1272.7429	1272.7429	R	G	374	385
PSM	LSILYPATTGR	630	sp|P30041|PRDX6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:267	ms_run[2]:scan=7707	45.426	2	1200.6742	1200.6742	K	N	145	156
PSM	LSPPYSSPQEFAQDVGR	631	sp|Q13263-2|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	17-UNIMOD:267	ms_run[2]:scan=9250	54.309	2	1886.9038	1886.9038	K	M	669	686
PSM	LTFSCLGGSDNFK	632	sp|Q15185-3|TEBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	5-UNIMOD:4	ms_run[2]:scan=8788	51.57	2	1444.6657	1444.6657	K	H	36	49
PSM	LTFSCLGGSDNFK	633	sp|Q15185-3|TEBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	5-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=8789	51.575	2	1450.6858	1450.6858	K	H	36	49
PSM	LVILANNCPALR	634	sp|P62888|RL30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	8-UNIMOD:4	ms_run[2]:scan=7986	46.948	2	1352.7598	1352.7598	K	K	45	57
PSM	LVVLGSGGVGK	635	sp|P61224-2|RAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:188	ms_run[2]:scan=5322	32.514	2	990.61691	990.6169	K	S	6	17
PSM	LVVVGAGGVGK	636	sp|P01111|RASN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:188	ms_run[2]:scan=4505	28.26	2	960.60635	960.6063	K	S	6	17
PSM	LYSLLSDPIPEVR	637	sp|Q8N122|RPTOR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:267	ms_run[2]:scan=11760	69.655	2	1510.8271	1510.8271	K	C	604	617
PSM	MIAGQVLDINLAAEPK	638	sp|P07910-4|HNRPC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:35,16-UNIMOD:188	ms_run[2]:scan=9999	58.793	2	1703.9223	1703.9223	R	V	74	90
PSM	MINLSEPDTIDER	639	sp|Q14651|PLSI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:35	ms_run[2]:scan=6668	39.762	2	1547.7137	1547.7137	K	A	168	181
PSM	MLQPCGPPADKPEEN	640	sp|Q9BWJ5|SF3B5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:35,5-UNIMOD:4,11-UNIMOD:188	ms_run[2]:scan=2701	18.607	2	1703.759	1703.7590	K	-	72	87
PSM	MSTSPEAFLALR	641	sp|P78527-2|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:35,12-UNIMOD:267	ms_run[2]:scan=9849	57.896	2	1347.6732	1347.6732	R	S	3859	3871
PSM	MSTSPEAFLALR	642	sp|P78527-2|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:267	ms_run[2]:scan=10761	63.439	2	1331.6783	1331.6783	R	S	3859	3871
PSM	NALFPEVFSPTPDENSDQNSR	643	sp|Q8IVT2|MISP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=11028	65.088	2	2363.0666	2363.0666	R	S	567	588
PSM	NFSGAELEGLVR	644	sp|P46459-2|NSF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9785	57.507	2	1290.6568	1290.6568	K	A	341	353
PSM	NIEDVIAQGIGK	645	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:188	ms_run[2]:scan=10139	59.642	2	1261.6973	1261.6973	K	L	50	62
PSM	NTLCAPEVISLINTR	646	sp|Q96CS3|FAF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:4	ms_run[2]:scan=11679	69.165	2	1699.8927	1699.8927	R	M	191	206
PSM	NVLLTGATGFLGK	647	sp|Q8WVX9|FACR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:188	ms_run[2]:scan=10725	63.213	2	1295.7545	1295.7545	K	V	12	25
PSM	NVTELNEPLSNEER	648	sp|P61981|1433G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5580	33.887	2	1642.7798	1642.7798	K	N	29	43
PSM	PDNFVFGQSGAGNNWAK	649	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	17-UNIMOD:188	ms_run[2]:scan=9120	53.518	2	1813.8479	1813.8479	R	G	87	104
PSM	QDAFANFANFSK	650	sp|Q14677|EPN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:188	ms_run[2]:scan=9885	58.116	2	1364.6456	1364.6456	K	-	614	626
PSM	QLLQANPILESFGNAK	651	sp|P35580|MYH10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=11846	70.202	2	1741.9363	1741.9363	R	T	217	233
PSM	SAAEAGGVFHR	652	sp|Q9BRF8-3|CPPED_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:1,11-UNIMOD:267	ms_run[2]:scan=4997	30.809	2	1152.5551	1152.5551	M	A	2	13
PSM	SAQGTGFELGQLQSIR	653	sp|Q9C0B5-2|ZDHC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	16-UNIMOD:267	ms_run[2]:scan=9747	57.272	2	1700.8721	1700.8721	K	S	379	395
PSM	SCDGNQELLNFLR	654	sp|Q9UIG0-2|BAZ1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:4	ms_run[2]:scan=11693	69.251	2	1564.7304	1564.7304	K	S	1040	1053
PSM	SDSEKLNLDSIIGR	655	sp|P62136-3|PP1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:1	ms_run[2]:scan=10516	61.928	2	1587.8104	1587.8104	M	L	2	16
PSM	SFFDNISCDDNR	656	sp|Q8ND56-3|LS14A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	8-UNIMOD:4	ms_run[2]:scan=7966	46.837	2	1488.594	1488.5940	K	E	327	339
PSM	SGALLACGIVNSGVR	657	sp|Q13200-2|PSMD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	7-UNIMOD:4	ms_run[2]:scan=8164	47.967	2	1472.7769	1472.7769	K	N	283	298
PSM	SGPEPLQEGPGPK	658	sp|P57737-2|CORO7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:188	ms_run[2]:scan=3037	20.469	2	1297.661	1297.6610	R	G	583	596
PSM	SIQADGLVWGSSK	659	sp|P24534|EF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:188	ms_run[2]:scan=7916	46.57	2	1352.7032	1352.7032	R	L	164	177
PSM	SIQFVDWCPTGFK	660	sp|P68363-2|TBA1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	8-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=11738	69.526	2	1589.7644	1589.7644	R	V	224	237
PSM	SIQFVDWCPTGFK	661	sp|P68363-2|TBA1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	8-UNIMOD:4	ms_run[2]:scan=11739	69.532	2	1583.7442	1583.7443	R	V	224	237
PSM	SLFSSIGEVESAK	662	sp|Q15717|ELAV1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9914	58.285	2	1352.6824	1352.6824	R	L	38	51
PSM	SPLTQEQLIPNLAMK	663	sp|Q9UNE7-2|CHIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=10801	63.69	2	1681.9073	1681.9073	R	E	201	216
PSM	SQFTITPGSEQIR	664	sp|Q99798|ACON_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:267	ms_run[2]:scan=6593	39.366	2	1472.7499	1472.7499	K	A	412	425
PSM	SSGLPNIPVQTISR	665	sp|P02786|TFR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8230	48.336	2	1467.8045	1467.8045	R	A	326	340
PSM	SSPAAFINPPIGTVTPALK	666	sp|Q9BY77-2|PDIP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	19-UNIMOD:188	ms_run[2]:scan=10752	63.383	2	1886.0609	1886.0609	R	L	126	145
PSM	SVFPEQANNNEWAR	667	sp|O43242|PSMD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7159	42.409	2	1660.7594	1660.7594	K	Y	274	288
PSM	TGAAPIIDVVR	668	sp|P46776|RL27A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:267	ms_run[2]:scan=7398	43.746	2	1120.648	1120.6480	K	S	95	106
PSM	TLAMDTILANAR	669	sp|P46926|GNPI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:267	ms_run[2]:scan=9894	58.17	2	1298.6892	1298.6892	K	F	161	173
PSM	TTPSYVAFTDTER	670	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6805	40.491	2	1486.694	1486.6940	R	L	37	50
PSM	VAQIQNAGLGEFR	671	sp|Q9ULR0|ISY1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:267	ms_run[2]:scan=7273	43.034	2	1411.7447	1411.7447	K	I	57	70
PSM	VCTLAIIDPGDSDIIR	672	sp|P62888|RL30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=11096	65.515	2	1766.9112	1766.9112	R	S	91	107
PSM	VFLDPNILSDDGTVALR	673	sp|P48147|PPCE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=12229	72.635	2	1843.968	1843.9680	R	G	112	129
PSM	VGGVQSLGGTGALR	674	sp|P17174-2|AATC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:267	ms_run[2]:scan=5474	33.321	2	1280.7076	1280.7076	R	I	80	94
PSM	VLAALPAAELVQACR	675	sp|Q9UK22|FBX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=10307	60.652	3	1590.8791	1590.8791	R	L	58	73
PSM	VLSGDLGQLPTGIR	676	sp|Q16822|PCKGM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9110	53.457	2	1424.7987	1424.7987	R	D	32	46
PSM	VTPPAVTGSPEFER	677	sp|Q99735-2|MGST2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:267	ms_run[2]:scan=6131	36.798	2	1495.7546	1495.7546	K	V	35	49
PSM	VTTQTSLPLFR	678	sp|Q13596-2|SNX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:267	ms_run[2]:scan=8949	52.507	2	1271.7113	1271.7113	K	S	102	113
PSM	YIQPWESEFIDSQR	679	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:267	ms_run[2]:scan=10732	63.257	2	1806.8452	1806.8452	R	V	1371	1385
PSM	YVFLDPLAGAVTK	680	sp|Q9NQA3|WASH6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=12052	71.518	2	1392.7653	1392.7653	K	T	168	181
PSM	QRSQVEEELFSVR	681	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:28,2-UNIMOD:267,13-UNIMOD:267	ms_run[1]:scan=9936	58.41573666666667	2	1608.7990	1608.8005	R	V	2359	2372
PSM	VGDPQELNGITR	682	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=4957	30.58462	2	1298.657276	1297.662629	K	A	299	311
PSM	TLTIVDTGIGMTK	683	sp|Q58FG1|HS904_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	13-UNIMOD:188	ms_run[1]:scan=9272	54.44713666666667	2	1354.750081	1354.747332	R	A	28	41
PSM	QMADTGKLNTLLQR	684	sp|Q00839|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:28,2-UNIMOD:35,7-UNIMOD:188,14-UNIMOD:267	ms_run[1]:scan=7619	44.942748333333334	2	1602.8375	1602.8365	K	A	545	559
PSM	QMADTGKLNTLLQR	685	sp|Q00839|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:28	ms_run[1]:scan=9184	53.907783333333334	2	1570.8176	1570.8132	K	A	545	559
PSM	QMADTGKLNTLLQR	686	sp|Q00839|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:28,7-UNIMOD:188,14-UNIMOD:267	ms_run[1]:scan=9188	53.93413	2	1586.8460	1586.8416	K	A	545	559
PSM	QNGDDPLLTYRFPPK	687	sp|P02545|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:28,11-UNIMOD:267,15-UNIMOD:188	ms_run[1]:scan=10222	60.135416666666664	2	1758.8897	1758.8907	R	F	472	487
PSM	QNGDDPLLTYRFPPK	688	sp|P02545|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:28,11-UNIMOD:267,15-UNIMOD:188	ms_run[1]:scan=10572	62.276475	2	1758.8916	1758.8907	R	F	472	487
PSM	TALINSTGEEVAMR	689	sp|P02545|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	14-UNIMOD:267	ms_run[1]:scan=6430	38.48310333333333	2	1500.758583	1500.748162	R	K	528	542
PSM	ELDALDANDELTPLGR	690	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=9860	57.96285666666667	2	1742.864179	1740.853008	R	I	838	854
PSM	QLPSLACKYPVSSR	691	sp|P42166|LAP2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:28,7-UNIMOD:4	ms_run[1]:scan=8254	48.46610333333333	2	1587.8102	1587.8074	R	E	512	526
PSM	QQEGFKGTFPDAR	692	sp|Q15233|NONO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:28,6-UNIMOD:188,13-UNIMOD:267	ms_run[1]:scan=6303	37.77974833333333	2	1478.7148	1478.7120	R	E	366	379
PSM	FSASGELGNGNIK	693	sp|P12004|PCNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	13-UNIMOD:188	ms_run[1]:scan=5177	31.760938333333335	2	1299.641480	1298.656209	K	L	169	182
PSM	QQNELAELHANLAR	694	sp|Q14980|NUMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:28,14-UNIMOD:267	ms_run[1]:scan=9161	53.770891666666664	2	1598.8100	1598.8035	R	A	870	884
PSM	GNLGAGNGNLQGPR	695	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	14-UNIMOD:267	ms_run[1]:scan=3029	20.424548333333334	2	1334.659144	1333.672629	R	H	374	388
PSM	CPSILGGLAPEKDQPK	696	sp|A5YKK6|CNOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:385,1-UNIMOD:4,12-UNIMOD:188,16-UNIMOD:188	ms_run[1]:scan=9951	58.50551333333333	2	1703.8969	1703.8950	R	S	624	640
PSM	LSDGFNGADLR	697	sp|P62333|PRS10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=5867	35.424928333333334	2	1164.558084	1163.557101	K	N	334	345
PSM	NPPLAEALLSGDLEK	698	sp|Q5TDH0|DDI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	15-UNIMOD:188	ms_run[1]:scan=11976	71.02938	2	1571.845627	1571.850217	R	F	156	171
PSM	SNILLLGPTGSGK	699	sp|O76031|CLPX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=8058	47.351636666666664	2	1255.724230	1255.713602	K	T	287	300
PSM	TPGTGSLAAAVETASGR	700	sp|Q96GD0|PLPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=8150	47.892084999999994	2	1545.798188	1544.779450	R	Q	190	207
PSM	FMQTFVLAPEGSVANK	701	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	16-UNIMOD:188	ms_run[1]:scan=10071	59.228518333333334	2	1743.900854	1743.896121	R	F	108	124
PSM	QGGASQSDKTPEELFHPLGADSQV	702	sp|P11166|GTR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:28,9-UNIMOD:188	ms_run[1]:scan=10461	61.59148666666667	2	2486.1702	2486.1652	R	-	469	493
PSM	ALIPLALEGTDVGQTK	703	sp|Q9H3U1|UN45A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	16-UNIMOD:188	ms_run[1]:scan=10723	63.20206833333334	2	1631.937789	1630.923716	R	A	692	708
PSM	QGQETAVAPSLVAPALNKPK	704	sp|Q15691|MARE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:28,18-UNIMOD:188,20-UNIMOD:188	ms_run[1]:scan=8221	48.28723166666666	2	2013.1402	2013.1292	R	K	131	151
PSM	AVVGVVAGGGR	705	sp|P62917|RL8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0		ms_run[1]:scan=2603	18.026255	2	940.5362	940.5449	R	I	164	175
PSM	ALYALQDIVSR	706	sp|Q15154|PCM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	11-UNIMOD:267	ms_run[1]:scan=10105	59.435134999999995	2	1257.699446	1257.695656	R	H	1422	1433
PSM	AAAVLPVLDLAQR	707	sp|P19404|NDUV2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:267	ms_run[2]:scan=11426	67.559	3	1345.7957	1345.7957	K	Q	76	89
PSM	AAAVLPVLDLAQR	708	sp|P19404|NDUV2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11352	67.099	2	1335.7874	1335.7874	K	Q	76	89
PSM	AFNSSSFNSNTFLTR	709	sp|P46060|RAGP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9265	54.404	2	1691.7903	1691.7903	K	L	501	516
PSM	ALEIADFSGNPLSR	710	sp|Q14160-2|SCRIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	14-UNIMOD:267	ms_run[2]:scan=10586	62.364	2	1498.7655	1498.7655	K	L	25	39
PSM	ALLNLPGTQTSGEAK	711	sp|Q96GM8|TOE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	15-UNIMOD:188	ms_run[2]:scan=7749	45.66	2	1504.8193	1504.8193	R	D	348	363
PSM	ANFLNSNDVFVLK	712	sp|P09327|VILI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11583	68.57	2	1479.7722	1479.7722	R	T	537	550
PSM	ANSEEFIPIFANNPR	713	sp|Q9H270|VPS11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10972	64.742	2	1717.8424	1717.8424	R	E	588	603
PSM	APAMQPAEIQFAQR	714	sp|Q14684-2|RRP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	14-UNIMOD:267	ms_run[2]:scan=7167	42.453	2	1566.7852	1566.7852	M	L	2	16
PSM	APILIATDVASR	715	sp|P17844-2|DDX5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7366	43.574	2	1225.703	1225.7030	K	G	313	325
PSM	AQQATPGGAAPTIFSR	716	sp|Q9BX68|HINT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6474	38.732	2	1571.8056	1571.8056	K	I	43	59
PSM	ASVSSATFSGHGAR	717	sp|Q7Z4H3-3|HDDC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:1,14-UNIMOD:267	ms_run[2]:scan=4402	27.73	2	1385.6563	1385.6563	M	S	2	16
PSM	ATAEVLNIGKK	718	sp|P22234|PUR6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:1,10-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=7108	42.14	2	1196.7167	1196.7167	M	L	2	13
PSM	AVQGFFTSNNATR	719	sp|O43242|PSMD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6094	36.608	2	1411.6844	1411.6844	K	D	116	129
PSM	CCSGAIIVLTK	720	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:4,2-UNIMOD:4,11-UNIMOD:188	ms_run[2]:scan=6541	39.077	2	1226.6458	1226.6458	K	S	423	434
PSM	CITDPQTGLCLLPLK	721	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:4,10-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=11544	68.317	2	1733.9151	1733.9151	R	E	4245	4260
PSM	CLYALEEGIVR	722	sp|Q9P0M9|RM27_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:4	ms_run[2]:scan=9546	56.062	2	1321.67	1321.6700	K	Y	88	99
PSM	CLYALEEGIVR	723	sp|Q9P0M9|RM27_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:4,11-UNIMOD:267	ms_run[2]:scan=9542	56.041	2	1331.6783	1331.6783	K	Y	88	99
PSM	CSILSPELALPTGSR	724	sp|O75592-2|MYCB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:4	ms_run[2]:scan=10226	60.164	2	1599.829	1599.8290	R	A	1169	1184
PSM	CSSEFLASLPQPK	725	sp|Q9UHJ6|SHPK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:4	ms_run[2]:scan=8900	52.224	2	1462.7126	1462.7126	R	S	132	145
PSM	DAGTIAGLNVLR	726	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:267	ms_run[2]:scan=9362	54.971	2	1208.6753	1208.6753	K	I	160	172
PSM	DGEDQTQDTELVETRPAGDGTFQK	727	sp|P10321-2|HLAC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5858	35.371	2	2636.1838	2636.1838	R	W	244	268
PSM	DGLGGLPDIVR	728	sp|P45974-2|UBP5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:267	ms_run[2]:scan=9720	57.107	2	1120.6116	1120.6116	R	D	134	145
PSM	EFSPFGSITSAK	729	sp|Q13310-2|PABP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9336	54.819	2	1269.6241	1269.6241	K	V	313	325
PSM	ELCQGLGQPGSVLR	730	sp|P13489|RINI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=7043	41.78	2	1522.7801	1522.7801	R	V	360	374
PSM	ELLLQPVTISR	731	sp|P59998|ARPC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:267	ms_run[2]:scan=9452	55.511	2	1277.7583	1277.7583	K	N	45	56
PSM	EQLWLANEGLITR	732	sp|P46940|IQGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:267	ms_run[2]:scan=10969	64.725	2	1551.8285	1551.8285	R	L	739	752
PSM	FAQPGSFEYEYAMR	733	sp|Q15233-2|NONO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	14-UNIMOD:267	ms_run[2]:scan=9071	53.224	2	1704.7482	1704.7482	R	W	168	182
PSM	FAVALLDDSVR	734	sp|Q9NRG9|AAAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:267	ms_run[2]:scan=10227	60.169	2	1214.6535	1214.6535	K	V	166	177
PSM	FCSFSPCIEQVQR	735	sp|Q96FX7|TRM61_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:4,7-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=7881	46.394	2	1666.7471	1666.7471	R	T	203	216
PSM	FDEISFVNFAR	736	sp|Q08945|SSRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11745	69.569	2	1343.651	1343.6510	R	G	371	382
PSM	FDEISFVNFAR	737	sp|Q08945|SSRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:267	ms_run[2]:scan=11743	69.554	2	1353.6593	1353.6593	R	G	371	382
PSM	FFDDPMLLELAK	738	sp|Q15029-2|U5S1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	6-UNIMOD:35	ms_run[2]:scan=11833	70.114	2	1453.7163	1453.7163	K	Q	917	929
PSM	FFDEESYSLLR	739	sp|P51571|SSRD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10477	61.692	2	1404.6561	1404.6561	R	K	106	117
PSM	FFDEESYSLLR	740	sp|P51571|SSRD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:267	ms_run[2]:scan=10478	61.697	2	1414.6644	1414.6644	R	K	106	117
PSM	FFDTELENLER	741	sp|O94804|STK10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:267	ms_run[2]:scan=10367	61.013	2	1421.6702	1421.6702	K	Q	608	619
PSM	FLQDYFDGNLK	742	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10101	59.414	2	1358.6507	1358.6507	R	R	352	363
PSM	FLQDYFDGNLK	743	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:188	ms_run[2]:scan=10118	59.519	2	1364.6708	1364.6708	R	R	352	363
PSM	FSYLAVIEGAK	744	sp|P18031|PTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:188	ms_run[2]:scan=11151	65.855	2	1202.6643	1202.6643	R	F	269	280
PSM	FSYLAVIEGAK	745	sp|P18031|PTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11158	65.899	2	1196.6441	1196.6441	R	F	269	280
PSM	FVEGLPINDFSR	746	sp|P40925-2|MDHC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10172	59.838	2	1392.7038	1392.7038	K	E	210	222
PSM	GFVLQDTVEQLR	747	sp|P56192-2|SYMC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:267	ms_run[2]:scan=10441	61.471	2	1413.7491	1413.7491	R	C	377	389
PSM	GILEQGWQADSTTR	748	sp|Q99627-2|CSN8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	14-UNIMOD:267	ms_run[2]:scan=7269	43.012	2	1570.7615	1570.7615	K	M	98	112
PSM	GILIPLCESGTCTLR	749	sp|Q13895|BYST_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	7-UNIMOD:4,12-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=10328	60.778	2	1698.8672	1698.8672	K	E	289	304
PSM	GLCAIAQAESLR	750	sp|P23396|RS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=7726	45.525	2	1297.6688	1297.6688	R	Y	95	107
PSM	GLPWQSSDQDIAR	751	sp|Q6NXG1-2|ESRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:267	ms_run[2]:scan=7622	44.957	2	1481.7138	1481.7138	R	F	231	244
PSM	GLPWQSSDQDIAR	752	sp|Q6NXG1-2|ESRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7630	45	2	1471.7056	1471.7056	R	F	231	244
PSM	GMAAAGNYAWVNR	753	sp|Q9Y3I0|RTCB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6765	40.286	2	1379.6405	1379.6405	K	S	309	322
PSM	GPATLVAPASVITIVK	754	sp|Q9ULX9-2|MAFF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	16-UNIMOD:188	ms_run[2]:scan=11122	65.681	2	1541.9488	1541.9488	R	S	97	113
PSM	GQSEDPGSLLSLFR	755	sp|P08195-2|4F2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=12926	77.671	2	1504.7522	1504.7522	K	R	410	424
PSM	GQSSWGTGESFR	756	sp|Q03252|LMNB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:267	ms_run[2]:scan=5141	31.566	2	1307.577	1307.5770	K	T	550	562
PSM	GQSSWGTGESFR	757	sp|Q03252|LMNB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5144	31.579	2	1297.5687	1297.5687	K	T	550	562
PSM	GSPMEISLPIALSK	758	sp|P09960-4|LKHA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	4-UNIMOD:35,14-UNIMOD:188	ms_run[2]:scan=10112	59.481	2	1463.8001	1463.8001	K	N	60	74
PSM	GSPMEISLPIALSK	759	sp|P09960-4|LKHA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11741	69.543	2	1441.7851	1441.7851	K	N	60	74
PSM	GVDEVTIVNILTNR	760	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	14-UNIMOD:267	ms_run[2]:scan=12702	75.876	2	1551.8496	1551.8496	K	S	50	64
PSM	GVTIASGGVLPR	761	sp|Q9P0M6|H2AW_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6521	38.981	2	1125.6506	1125.6506	K	I	97	109
PSM	GVTIASGGVLPR	762	sp|Q9P0M6|H2AW_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:267	ms_run[2]:scan=6531	39.028	2	1135.6589	1135.6589	K	I	97	109
PSM	GYISPYFINTSK	763	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:188	ms_run[2]:scan=8833	51.834	2	1394.7177	1394.7177	R	G	222	234
PSM	IALTDNALIAR	764	sp|P18124|RL7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:267	ms_run[2]:scan=7924	46.613	2	1179.6851	1179.6851	R	S	167	178
PSM	IDCFSEVPTSVFGEK	765	sp|O00567|NOP56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=10419	61.33	2	1719.8121	1719.8121	R	L	382	397
PSM	IISLETYNLLR	766	sp|Q15149|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:267	ms_run[2]:scan=11567	68.467	2	1343.7688	1343.7688	R	E	3794	3805
PSM	IIYGGSVTGATCK	767	sp|P60174|TPIS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:4	ms_run[2]:scan=4306	27.21	2	1325.6649	1325.6649	R	E	244	257
PSM	ILDMCCAPGGK	768	sp|P46087-3|NOP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	5-UNIMOD:4,6-UNIMOD:4	ms_run[2]:scan=4991	30.775	2	1220.5352	1220.5352	R	T	384	395
PSM	ILGVGPDDPDLVR	769	sp|P48449-2|ERG7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8975	52.643	2	1364.73	1364.7300	R	A	83	96
PSM	ILMVGLDAAGK	770	sp|P18085|ARF4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:35,11-UNIMOD:188	ms_run[2]:scan=6516	38.955	2	1108.6258	1108.6258	R	T	20	31
PSM	ILMVGLDAAGK	771	sp|P18085|ARF4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:35	ms_run[2]:scan=6525	38.998	2	1102.6056	1102.6056	R	T	20	31
PSM	ILMVGLDAAGK	772	sp|P18085|ARF4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8070	47.416	2	1086.6107	1086.6107	R	T	20	31
PSM	ILPTLEAVAALGNK	773	sp|Q12905|ILF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11728	69.466	2	1408.829	1408.8290	K	V	128	142
PSM	ILPTLEAVAALGNK	774	sp|Q12905|ILF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	14-UNIMOD:188	ms_run[2]:scan=11729	69.472	2	1414.8491	1414.8491	K	V	128	142
PSM	IMNTFSVMPSPK	775	sp|Q9BVA1|TBB2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8490	49.863	2	1350.6676	1350.6676	R	V	163	175
PSM	INAWNSPTLPIYEPGLK	776	sp|O60701|UGDH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	17-UNIMOD:188	ms_run[2]:scan=11499	68.033	2	1918.0296	1918.0296	R	E	42	59
PSM	INVYYNEATGGK	777	sp|P68371|TBB4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:188	ms_run[2]:scan=4810	29.801	2	1333.661	1333.6610	R	Y	47	59
PSM	IPDQLVILDMK	778	sp|P49755|TMEDA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	10-UNIMOD:35,11-UNIMOD:188	ms_run[2]:scan=9326	54.763	2	1305.731	1305.7310	R	H	117	128
PSM	IPDQLVILDMK	779	sp|P49755|TMEDA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	10-UNIMOD:35	ms_run[2]:scan=9328	54.773	2	1299.7108	1299.7108	R	H	117	128
PSM	IPDQLVILDMK	780	sp|P49755|TMEDA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11222	66.284	2	1283.7159	1283.7159	R	H	117	128
PSM	IPQSTLSEFYPR	781	sp|P21281|VATB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9167	53.803	2	1436.73	1436.7300	R	D	495	507
PSM	IQELGDLYTPAPGR	782	sp|Q9NWS0|PIHD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7828	46.109	2	1528.7886	1528.7886	R	A	187	201
PSM	ISISTSGGSFR	783	sp|P13647|K2C5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:267	ms_run[2]:scan=5483	33.372	2	1120.5752	1120.5752	R	N	74	85
PSM	IVDDWANDGWGLK	784	sp|P27824-2|CALX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:188	ms_run[2]:scan=10589	62.381	2	1493.7246	1493.7246	R	K	481	494
PSM	LAGTQPLEVLEAVQR	785	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11268	66.573	3	1622.8992	1622.8992	R	S	639	654
PSM	LAIWDTAGQER	786	sp|Q9NP72|RAB18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7559	44.605	2	1258.6306	1258.6306	K	F	59	70
PSM	LDIDSPPITAR	787	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:267	ms_run[2]:scan=6651	39.673	2	1206.6484	1206.6484	R	N	33	44
PSM	LDIDSPPITAR	788	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6654	39.691	2	1196.6401	1196.6401	R	N	33	44
PSM	LDQQTLPLGGR	789	sp|P98175-4|RBM10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:267	ms_run[2]:scan=5413	32.983	2	1206.6596	1206.6596	R	E	176	187
PSM	LGPALATGNVVVMK	790	sp|P05091-2|ALDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8248	48.436	2	1368.7799	1368.7799	K	V	149	163
PSM	LLELQEVDSLLR	791	sp|P16144-4|ITB4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=12856	77.118	2	1426.8031	1426.8031	K	G	1061	1073
PSM	LLGELLQDNAK	792	sp|P37837|TALDO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:188	ms_run[2]:scan=8274	48.59	2	1218.6915	1218.6915	K	L	259	270
PSM	LLGELLQDNAK	793	sp|P37837|TALDO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8276	48.599	2	1212.6714	1212.6714	K	L	259	270
PSM	LLLIGDSGVGK	794	sp|P62820-2|RAB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7716	45.473	2	1070.6336	1070.6336	K	S	14	25
PSM	LLLIGDSGVGK	795	sp|P62820-2|RAB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8229	48.332	2	1070.6336	1070.6336	K	S	14	25
PSM	LLLLGAGESGK	796	sp|Q5JWF2|GNAS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7489	44.232	2	1056.6179	1056.6179	R	S	686	697
PSM	LLTQDEGPALVPGGR	797	sp|Q5T440|CAF17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	15-UNIMOD:267	ms_run[2]:scan=6974	41.389	2	1531.8234	1531.8234	R	L	198	213
PSM	LLTQDEGPALVPGGR	798	sp|Q5T440|CAF17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6981	41.43	2	1521.8151	1521.8151	R	L	198	213
PSM	LLTQYILNLGK	799	sp|O00203-3|AP3B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:188	ms_run[2]:scan=12130	72.011	2	1280.78	1280.7800	K	Y	504	515
PSM	LLYEANLPENFR	800	sp|Q8IYB5-3|SMAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:267	ms_run[2]:scan=9644	56.651	2	1487.7648	1487.7648	R	R	96	108
PSM	LLYNNVSNFGR	801	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:267	ms_run[2]:scan=7451	44.032	2	1305.6705	1305.6705	K	L	1216	1227
PSM	LPEFYDETLLR	802	sp|Q15386|UBE3C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11064	65.312	2	1394.7082	1394.7082	K	S	1057	1068
PSM	LQPLSPVPSDIEISR	803	sp|Q6UB35|C1TM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9317	54.713	2	1649.8988	1649.8988	K	G	353	368
PSM	LQVAGEITTGPR	804	sp|Q9UJS0|CMC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5255	32.173	2	1240.6776	1240.6776	R	V	456	468
PSM	LQVAGEITTGPR	805	sp|Q9UJS0|CMC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:267	ms_run[2]:scan=5260	32.201	2	1250.6858	1250.6858	R	V	456	468
PSM	LVFLGEQSVGK	806	sp|P20340-2|RAB6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7887	46.43	2	1175.655	1175.6550	K	T	16	27
PSM	LVFLGEQSVGK	807	sp|P20340-2|RAB6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:188	ms_run[2]:scan=7888	46.434	2	1181.6752	1181.6752	K	T	16	27
PSM	LVILANNCPALR	808	sp|P62888|RL30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	8-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=7980	46.916	2	1362.7681	1362.7681	K	K	45	57
PSM	LVIPSELGYGER	809	sp|P26885|FKBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:267	ms_run[2]:scan=8779	51.52	2	1341.7168	1341.7168	K	G	104	116
PSM	LVLLGESAVGK	810	sp|P61020-2|RAB5B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:188	ms_run[2]:scan=7653	45.128	2	1090.6693	1090.6693	K	S	23	34
PSM	LVLLGESAVGK	811	sp|P61020-2|RAB5B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7654	45.132	2	1084.6492	1084.6492	K	S	23	34
PSM	LVVLGSGGVGK	812	sp|P61224-2|RAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5326	32.529	2	984.59678	984.5968	K	S	6	17
PSM	LWDLTTGTTTR	813	sp|P63244|RACK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:267	ms_run[2]:scan=7906	46.523	2	1273.6542	1273.6542	R	R	89	100
PSM	MGGGSIEVSVPR	814	sp|Q96I24|FUBP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:35	ms_run[2]:scan=5058	31.127	2	1203.5918	1203.5918	R	F	251	263
PSM	MGNTPDSASDNLGFR	815	sp|Q8NBJ7-2|SUMF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:35	ms_run[2]:scan=5148	31.598	2	1596.6838	1596.6838	R	C	187	202
PSM	MGNTPDSASDNLGFR	816	sp|Q8NBJ7-2|SUMF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:35,15-UNIMOD:267	ms_run[2]:scan=5156	31.643	2	1606.6921	1606.6921	R	C	187	202
PSM	MIDMLAANSGR	817	sp|Q7L014|DDX46_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:35,11-UNIMOD:267	ms_run[2]:scan=5002	30.832	2	1203.5615	1203.5615	R	V	506	517
PSM	MLLADQGQSWK	818	sp|P09211|GSTP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6958	41.293	2	1275.6282	1275.6282	R	E	20	31
PSM	MNRPAPVEISYENMR	819	sp|Q12974-2|TP4A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:1	ms_run[2]:scan=8441	49.566	2	1847.8658	1847.8658	-	F	1	16
PSM	NFLEDGESDGFLR	820	sp|Q9BXS4|TMM59_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10295	60.574	2	1497.6736	1497.6736	R	C	220	233
PSM	NGGQILIADLR	821	sp|P55735-2|SEC13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:267	ms_run[2]:scan=8612	50.55	2	1178.6647	1178.6647	R	G	30	41
PSM	NIGDLLSSSIDR	822	sp|Q70UQ0-2|IKIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:267	ms_run[2]:scan=10102	59.419	2	1298.6706	1298.6706	K	T	107	119
PSM	NINDAWVCTNDMFR	823	sp|P61970|NTF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	8-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=10994	64.875	2	1764.7587	1764.7587	K	L	107	121
PSM	NLGMTDAFELGK	824	sp|P35237|SPB6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:188	ms_run[2]:scan=9641	56.637	2	1300.6429	1300.6429	R	A	288	300
PSM	NLLTAAADAIER	825	sp|P33897|ABCD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11952	70.88	2	1256.6725	1256.6725	R	I	390	402
PSM	NLQEEIDALESR	826	sp|Q9NQP4|PFD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:267	ms_run[2]:scan=10711	63.13	2	1425.6975	1425.6975	K	V	93	105
PSM	NLQEEIDALESR	827	sp|Q9NQP4|PFD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10715	63.154	2	1415.6892	1415.6892	K	V	93	105
PSM	NNLAGAEELFAR	828	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9198	53.992	2	1303.6521	1303.6521	R	K	355	367
PSM	NSILFLNSLDAK	829	sp|Q8IXB1|DJC10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:188	ms_run[2]:scan=11296	66.747	2	1339.7443	1339.7443	K	E	326	338
PSM	NSSYFVEWIPNNVK	830	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11584	68.576	2	1695.8257	1695.8257	K	T	337	351
PSM	NVCTEAGMFAIR	831	sp|P62333|PRS10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=8707	51.106	2	1377.6409	1377.6409	R	A	345	357
PSM	PAVLGFEGSANK	832	sp|Q9NPF4|OSGEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5704	34.501	2	1188.6139	1188.6139	M	I	2	14
PSM	PLFATNPFDQDVEK	833	sp|Q92783-2|STAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	14-UNIMOD:188	ms_run[2]:scan=10555	62.173	2	1625.8033	1625.8033	M	A	2	16
PSM	PQYQTWEEFSR	834	sp|P49458-2|SRP09_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:267	ms_run[2]:scan=7945	46.723	2	1479.6658	1479.6658	M	A	2	13
PSM	PQYQTWEEFSR	835	sp|P49458-2|SRP09_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7952	46.762	2	1469.6575	1469.6575	M	A	2	13
PSM	PSENLGQVLFGER	836	sp|Q99805|TM9S2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:267	ms_run[2]:scan=10924	64.446	2	1454.7393	1454.7393	R	I	92	105
PSM	PTPQDSPIFLPVDDTSFR	837	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	18-UNIMOD:267	ms_run[2]:scan=11764	69.681	3	2041.0032	2041.0032	R	W	1406	1424
PSM	QGATGFGQGNIR	838	sp|Q96IR7|HPDL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:267	ms_run[2]:scan=3165	21.13	2	1214.6032	1214.6032	R	A	344	356
PSM	QIIVDPLSFSEER	839	sp|P35221-2|CTNA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:267	ms_run[2]:scan=11061	65.296	2	1541.7965	1541.7965	K	F	288	301
PSM	QIWQNLGLDDTK	840	sp|P49588|SYAC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9461	55.556	2	1429.7201	1429.7201	K	I	154	166
PSM	QLGEANEEFALR	841	sp|Q9Y679-3|AUP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:267	ms_run[2]:scan=7180	42.523	2	1385.6815	1385.6815	R	V	232	244
PSM	QLLTLSSELSQAR	842	sp|P15311|EZRI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:267	ms_run[2]:scan=9342	54.85	2	1454.7968	1454.7968	R	D	530	543
PSM	QMEQISQFLQAAER	843	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	14-UNIMOD:267	ms_run[2]:scan=11650	68.983	2	1687.8227	1687.8227	K	Y	89	103
PSM	SGELPPNINIKEPR	844	sp|Q9H9B4|SFXN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:1	ms_run[2]:scan=7323	43.324	2	1604.8522	1604.8522	M	W	2	16
PSM	SGPEPLQEGPGPK	845	sp|P57737-2|CORO7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=3031	20.435	2	1291.6408	1291.6408	R	G	583	596
PSM	SINGLGQILETQR	846	sp|Q5RIA9-3|CBWD5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:267	ms_run[2]:scan=9449	55.489	2	1437.7815	1437.7815	R	S	193	206
PSM	SLEEGEGPIAVIMTPTR	847	sp|Q7L014|DDX46_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	17-UNIMOD:267	ms_run[2]:scan=11084	65.435	2	1808.9218	1808.9218	R	E	439	456
PSM	SLVQEMVGSFGK	848	sp|O75643|U520_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:188	ms_run[2]:scan=11737	69.52	2	1286.6636	1286.6636	R	R	546	558
PSM	SNTLPISLQSIR	849	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:267	ms_run[2]:scan=9506	55.828	2	1337.7542	1337.7542	K	S	530	542
PSM	SPAAPGQSPTGSVCYER	850	sp|O75534|CSDE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	14-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=3643	23.649	2	1772.8027	1772.8027	K	N	116	133
PSM	SPDFTNENPLETR	851	sp|P05023-3|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:267	ms_run[2]:scan=7136	42.277	2	1528.7033	1528.7033	R	N	197	210
PSM	SPFSVAVSPSLDLSK	852	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10218	60.114	2	1532.8086	1532.8086	K	I	959	974
PSM	SPVDIVTGGISPVR	853	sp|P50851-2|LRBA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9047	53.077	2	1395.7722	1395.7722	K	D	1488	1502
PSM	SVGGSGGGSFGDNLVTR	854	sp|P02545|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	17-UNIMOD:267	ms_run[2]:scan=6225	37.333	2	1575.7517	1575.7517	R	S	628	645
PSM	SYELPDGQVITIGNER	855	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10094	59.37	2	1789.8846	1789.8846	K	F	239	255
PSM	TGAAPIIDVVR	856	sp|P46776|RL27A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7402	43.77	2	1110.6397	1110.6397	K	S	95	106
PSM	TGEGFLCVFAINNSK	857	sp|P01111|RASN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	7-UNIMOD:4	ms_run[2]:scan=12183	72.345	2	1655.7977	1655.7977	R	S	74	89
PSM	TIQFVDWCPTGFK	858	sp|Q71U36-2|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	8-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=11826	70.074	2	1603.78	1603.7800	R	V	305	318
PSM	TIQTPIGSTWNTQR	859	sp|Q9BVJ6-3|UT14A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	14-UNIMOD:267	ms_run[2]:scan=7325	43.335	2	1611.8244	1611.8244	R	A	646	660
PSM	TLAMDTILANAR	860	sp|P46926|GNPI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9896	58.18	2	1288.6809	1288.6809	K	F	161	173
PSM	TLAVSGLGVVGR	861	sp|P11388|TOP2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7719	45.484	2	1127.6663	1127.6663	K	D	467	479
PSM	TLIQNCGASTIR	862	sp|P49368-2|TCPG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	6-UNIMOD:4	ms_run[2]:scan=4423	27.843	2	1332.682	1332.6820	R	L	412	424
PSM	TLIQNCGASTIR	863	sp|P49368-2|TCPG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	6-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=4424	27.849	2	1342.6903	1342.6903	R	L	412	424
PSM	TPLENLVLQAK	864	sp|Q7L2E3-3|DHX30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:188	ms_run[2]:scan=9530	55.967	2	1230.7279	1230.7279	R	I	775	786
PSM	TPMENIGLQDSLLSR	865	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:35	ms_run[2]:scan=8753	51.37	2	1688.8403	1688.8403	K	F	464	479
PSM	TQGFLALFSGDTGEIK	866	sp|Q9Y230|RUVB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=13040	78.704	2	1682.8516	1682.8516	R	S	254	270
PSM	TTPSYVAFTDTER	867	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:267	ms_run[2]:scan=6793	40.428	2	1496.7023	1496.7023	R	L	37	50
PSM	VAQIQNAGLGEFR	868	sp|Q9ULR0|ISY1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7271	43.023	2	1401.7365	1401.7365	K	I	57	70
PSM	VAQVLEGFITR	869	sp|O00411|RPOM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:267	ms_run[2]:scan=9970	58.617	2	1241.7007	1241.7007	R	K	977	988
PSM	VDFPQDQLTALTGR	870	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	14-UNIMOD:267	ms_run[2]:scan=10255	60.337	2	1569.8026	1569.8026	K	I	216	230
PSM	VFDFLVDSINK	871	sp|Q12965|MYO1E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11925	70.705	2	1295.6762	1295.6762	R	A	363	374
PSM	VFGAPEVLENLEVK	872	sp|Q8TEM1|PO210_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=12031	71.391	2	1542.8294	1542.8294	R	S	1711	1725
PSM	VLANPGNSQVAR	873	sp|Q14974|IMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:267	ms_run[2]:scan=2001	14.951	2	1234.6658	1234.6658	R	V	43	55
PSM	VLLQAFDVVER	874	sp|Q15750-2|TAB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10953	64.624	2	1287.7187	1287.7187	R	S	105	116
PSM	VSAPGVLTAQDR	875	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:267	ms_run[2]:scan=4675	29.102	2	1222.6545	1222.6545	K	V	812	824
PSM	VSSGYVPPPVATPFSSK	876	sp|Q15942-2|ZYX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	17-UNIMOD:188	ms_run[2]:scan=8206	48.199	2	1724.9081	1724.9081	R	S	11	28
PSM	VVTYGMANLLTGPK	877	sp|Q99536-2|VAT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10454	61.548	2	1462.7854	1462.7854	K	R	148	162
PSM	YGDLANWMIPGK	878	sp|Q9BYC2|SCOT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11032	65.116	2	1363.6595	1363.6595	K	K	404	416
PSM	YGDLANWMIPGK	879	sp|Q9BYC2|SCOT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:188	ms_run[2]:scan=11033	65.121	2	1369.6796	1369.6796	K	K	404	416
PSM	YGSVAFPNFEQGVACLR	880	sp|O00116|ADAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	15-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=11830	70.096	2	1923.9177	1923.9177	K	E	390	407
PSM	YIQPWESEFIDSQR	881	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10741	63.315	2	1796.837	1796.8370	R	V	1371	1385
PSM	YLAEFATGNDR	882	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:267	ms_run[2]:scan=5794	35.012	2	1265.5916	1265.5916	R	K	131	142
PSM	YVVVTGITPTPLGEGK	883	sp|P11586|C1TC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8879	52.103	2	1629.8978	1629.8978	K	S	371	387
PSM	SLDMDSIIAEVK	884	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=11592	68.62820333333333	2	1319.663818	1319.664268	R	A	253	265
PSM	SLDMDSIIAEVK	885	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	12-UNIMOD:188	ms_run[1]:scan=11589	68.60482333333333	2	1325.682730	1325.684397	R	A	253	265
PSM	QNISPDKIPWSALK	886	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:28	ms_run[1]:scan=10794	63.644915000000005	2	1578.8408	1578.8401	R	T	4231	4245
PSM	SNTLPISLQSIR	887	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	12-UNIMOD:267	ms_run[1]:scan=9535	55.998265	2	1337.756496	1337.754234	K	S	530	542
PSM	VIGSGCNLDSAR	888	sp|Q6ZMR3|LDH6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	6-UNIMOD:4	ms_run[1]:scan=2944	19.935325	2	1247.587326	1247.592835	R	F	158	170
PSM	QNKPTGFALGSIEGR	889	sp|P78406|RAE1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:28,3-UNIMOD:188,15-UNIMOD:267	ms_run[1]:scan=8108	47.636140000000005	2	1572.8270	1572.8226	K	V	225	240
PSM	LFVTNDAATILR	890	sp|P50990|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	12-UNIMOD:267	ms_run[1]:scan=9902	58.217483333333334	2	1342.749158	1342.748420	K	E	63	75
PSM	LLLIGDSGVGK	891	sp|P61026|RAB10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	11-UNIMOD:188	ms_run[1]:scan=8225	48.306581666666666	2	1076.653448	1076.653689	K	T	12	23
PSM	LVILANNCPALR	892	sp|P62888|RL30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	8-UNIMOD:4,12-UNIMOD:267	ms_run[1]:scan=8393	49.28776333333334	2	1363.752251	1362.768110	K	K	45	57
PSM	CTTDHISAAGPWLK	893	sp|Q99798|ACON_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=9179	53.88033166666666	2	1538.7233	1538.7182	K	F	592	606
PSM	LVAIVDVIDQNR	894	sp|P50914|RL14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	12-UNIMOD:267	ms_run[1]:scan=10558	62.194406666666666	2	1363.766979	1363.769884	K	A	24	36
PSM	AQLFALTGVQPAR	895	sp|P54578|UBP14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=9517	55.892005000000005	2	1370.768574	1370.767034	K	Q	31	44
PSM	GNLGAGNGNLQGPR	896	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=3028	20.41921	2	1324.651043	1323.664360	R	H	374	388
PSM	GNLGAGNGNLQGPR	897	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0		ms_run[1]:scan=3225	21.453613333333333	2	1324.6512	1323.6642	R	H	374	388
PSM	AMGIMNSFVNDIFER	898	sp|P33778|H2B1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	2-UNIMOD:35,5-UNIMOD:35,15-UNIMOD:267	ms_run[1]:scan=11581	68.55188166666666	2	1785.798286	1784.810111	K	I	59	74
PSM	NGALDQQKDELDVR	899	sp|P12270|TPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=4954	30.568081666666664	2	1600.775878	1599.785263	R	I	1585	1599
PSM	NPPLAEALLSGDLEK	900	sp|Q5TDH0|DDI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=11927	70.716175	2	1565.830092	1565.830088	R	F	156	171
PSM	CKELFPIQMEGVK	901	sp|O96008|TOM40_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:188,13-UNIMOD:188	ms_run[1]:scan=11403	67.41909166666666	2	1572.8097	1572.8078	K	L	90	103
PSM	QQQEILAAKPWTK	902	sp|Q92905|CSN5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:28,9-UNIMOD:188,13-UNIMOD:188	ms_run[1]:scan=8151	47.89772333333333	2	1534.8569	1534.8541	K	D	35	48
PSM	LGPEGGEGFVVK	903	sp|P52597|HNRPF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	12-UNIMOD:188	ms_run[1]:scan=6497	38.85641	2	1193.6388	1193.6382	M	L	3	15
PSM	QVTGQPQNASFVKR	904	sp|Q5JTV8|TOIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:28,13-UNIMOD:188,14-UNIMOD:267	ms_run[1]:scan=4500	28.231476666666666	2	1557.8286	1557.8229	R	N	322	336
PSM	SDNGELEDKPPAPPVR	905	sp|Q13177|PAK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:1	ms_run[1]:scan=5612	34.05954166666667	2	1762.8442	1761.8532	M	M	2	18
PSM	NLQTYLQEEDTR	906	sp|Q6KC79|NIPBL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	12-UNIMOD:267	ms_run[1]:scan=7297	43.17289666666667	2	1518.730296	1518.718970	K	M	2236	2248
PSM	QVCPLDNREWEFQK	907	sp|P62877|RBX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:28,3-UNIMOD:4,8-UNIMOD:267,14-UNIMOD:188	ms_run[1]:scan=9723	57.12742666666667	2	1846.8762	1846.8642	R	Y	92	106
PSM	QALREAGDEFELR	908	sp|Q07817|B2CL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:28,4-UNIMOD:267,13-UNIMOD:267	ms_run[1]:scan=8896	52.202846666666666	2	1535.7520	1535.7478	K	Y	88	101
PSM	AAAVLPVLDLAQR	909	sp|P19404|NDUV2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:267	ms_run[2]:scan=11351	67.093	2	1345.7957	1345.7957	K	Q	76	89
PSM	AATTGSGVKVPR	910	sp|Q13404-8|UB2V1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:1	ms_run[2]:scan=3182	21.218	2	1184.6513	1184.6513	M	N	2	14
PSM	ALAGCDFLTISPK	911	sp|P37837|TALDO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	5-UNIMOD:4	ms_run[2]:scan=9770	57.414	2	1391.7119	1391.7119	K	L	246	259
PSM	ALIPLALEGTDVGQTK	912	sp|Q9H3U1-2|UN45A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10709	63.114	2	1624.9036	1624.9036	R	A	677	693
PSM	ALLPLELQDDGSDSR	913	sp|Q15906|VPS72_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	15-UNIMOD:267	ms_run[2]:scan=9988	58.724	2	1637.8136	1637.8136	K	K	116	131
PSM	ALTVPELTQQMFDAK	914	sp|P68371|TBB4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:35,15-UNIMOD:188	ms_run[2]:scan=9383	55.1	2	1712.8751	1712.8751	R	N	283	298
PSM	ALVDGPCTQVR	915	sp|P50914|RL14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	7-UNIMOD:4,11-UNIMOD:267	ms_run[2]:scan=4165	26.471	2	1224.616	1224.6160	R	R	36	47
PSM	ANFLNSNDVFVLK	916	sp|P09327|VILI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:188	ms_run[2]:scan=11595	68.645	2	1485.7923	1485.7923	R	T	537	550
PSM	APLNVQFNSPLPGDAVK	917	sp|O75369-6|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	17-UNIMOD:188	ms_run[2]:scan=9754	57.316	2	1771.9564	1771.9564	K	D	878	895
PSM	AQFEGIVTDLIR	918	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=12137	72.056	2	1360.7351	1360.7351	R	R	349	361
PSM	AQFEGIVTDLIR	919	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:267	ms_run[2]:scan=12146	72.113	2	1370.7433	1370.7433	R	R	349	361
PSM	ASFENNCEIGCFAK	920	sp|P56537-2|IF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	7-UNIMOD:4,11-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=7078	41.979	2	1651.7066	1651.7066	R	L	5	19
PSM	ATAEVLNIGKK	921	sp|P22234|PUR6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:1	ms_run[2]:scan=7105	42.127	2	1184.6765	1184.6765	M	L	2	13
PSM	AVFVDLEPTVIDEVR	922	sp|P68363-2|TBA1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	15-UNIMOD:267	ms_run[2]:scan=11963	70.95	2	1710.9068	1710.9068	R	T	65	80
PSM	AWDQEAEGAGPELGLR	923	sp|Q8IZ83-3|A16A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	16-UNIMOD:267	ms_run[2]:scan=8396	49.304	2	1707.8092	1707.8092	R	V	723	739
PSM	AWQGAMDAGAASR	924	sp|Q14151|SAFB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4317	27.272	2	1290.5775	1290.5775	R	E	861	874
PSM	CAGNEDIITLR	925	sp|P12004|PCNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:4,11-UNIMOD:267	ms_run[2]:scan=6583	39.306	2	1270.6215	1270.6215	K	A	81	92
PSM	CDENILWLDYK	926	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:4	ms_run[2]:scan=11141	65.795	2	1467.6704	1467.6704	K	N	152	163
PSM	CEGINISGNFYR	927	sp|P40429|RL13A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:4	ms_run[2]:scan=8078	47.46	2	1428.6456	1428.6456	R	N	38	50
PSM	CITDPQTGLCLLPLK	928	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=11558	68.41	2	1727.895	1727.8950	R	E	4245	4260
PSM	CSVLPLSQNQEFMPFVK	929	sp|P41250|GARS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:4,13-UNIMOD:35,17-UNIMOD:188	ms_run[2]:scan=11242	66.405	2	2045.0057	2045.0057	K	E	616	633
PSM	DGPNALTPPPTTPEWIK	930	sp|P05023-3|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9761	57.359	2	1832.9309	1832.9309	R	F	44	61
PSM	EECGPLPIVVASPR	931	sp|P82675|RT05_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:4	ms_run[2]:scan=8595	50.455	2	1522.7814	1522.7814	R	G	375	389
PSM	ELALPGELTQSR	932	sp|O75436|VP26A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8202	48.18	2	1312.6987	1312.6987	K	S	94	106
PSM	ELCQGLGQPGSVLR	933	sp|P13489|RINI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:4	ms_run[2]:scan=7044	41.786	2	1512.7719	1512.7719	R	V	360	374
PSM	ELEPGDGPIAVIVCPTR	934	sp|Q86XP3-2|DDX42_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	14-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=10699	63.051	2	1831.9378	1831.9378	K	E	201	218
PSM	FASGGCDNLIK	935	sp|P55735-2|SEC13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:4,11-UNIMOD:188	ms_run[2]:scan=4586	28.668	2	1186.5748	1186.5748	R	L	168	179
PSM	FASGGCDNLIK	936	sp|P55735-2|SEC13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:4	ms_run[2]:scan=4587	28.673	2	1180.5547	1180.5547	R	L	168	179
PSM	FCADCIITALR	937	sp|Q99496-2|RING2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:4,5-UNIMOD:4,11-UNIMOD:267	ms_run[2]:scan=11155	65.877	2	1348.6507	1348.6507	R	S	71	82
PSM	FCADCIITALR	938	sp|Q99496-2|RING2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:4,5-UNIMOD:4	ms_run[2]:scan=11163	65.926	2	1338.6424	1338.6424	R	S	71	82
PSM	FNVWDTAGQEK	939	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7284	43.1	2	1293.599	1293.5990	K	F	61	72
PSM	FQLSNSGPNSTIK	940	sp|A0FGR8-5|ESYT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:188	ms_run[2]:scan=5169	31.715	2	1397.7246	1397.7246	R	M	42	55
PSM	FSASGELGNGNIK	941	sp|P12004|PCNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:188	ms_run[2]:scan=4980	30.716	2	1298.6562	1298.6562	K	L	169	182
PSM	FSFSPEPTLEDIR	942	sp|Q9H773|DCTP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:267	ms_run[2]:scan=10831	63.87	2	1546.7543	1546.7543	R	R	23	36
PSM	FVLSGANIMCPGLTSPGAK	943	sp|Q9ULC4-2|MCTS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	9-UNIMOD:35,10-UNIMOD:4,19-UNIMOD:188	ms_run[2]:scan=9246	54.28	2	1940.9795	1940.9795	K	L	92	111
PSM	GATALEMGMPLLLQK	944	sp|Q5UIP0-2|RIF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	15-UNIMOD:188	ms_run[2]:scan=12465	74.172	2	1577.8616	1577.8617	R	Q	203	218
PSM	GCDVVVIPAGVPR	945	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:4	ms_run[2]:scan=7911	46.544	2	1337.7126	1337.7126	K	K	92	105
PSM	GIDPFSLDALSK	946	sp|P40227-2|TCPZ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:188	ms_run[2]:scan=11376	67.253	2	1267.6755	1267.6755	K	E	251	263
PSM	GIDPFSLDALSK	947	sp|P40227-2|TCPZ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11377	67.258	2	1261.6554	1261.6554	K	E	251	263
PSM	GIQVSNNGPCLGSR	948	sp|P33121-2|ACSL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	10-UNIMOD:4	ms_run[2]:scan=4714	29.311	2	1457.7045	1457.7045	R	K	99	113
PSM	GKVEIDQQQLTQQQLNGN	949	sp|Q8IWS0-5|PHF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:188	ms_run[2]:scan=5602	34.007	2	2046.0437	2046.0437	R	-	314	332
PSM	GLLPGGTQVLDGTSGFSPAPK	950	sp|Q96S94-3|CCNL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10428	61.386	2	1998.0422	1998.0422	R	L	92	113
PSM	GLPWSCSADEVMR	951	sp|P55795|HNRH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:4,12-UNIMOD:35	ms_run[2]:scan=7386	43.685	2	1522.6544	1522.6544	R	F	17	30
PSM	GLPWSCSADEVMR	952	sp|P55795|HNRH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:4	ms_run[2]:scan=9305	54.642	2	1506.6595	1506.6595	R	F	17	30
PSM	GLTPTGMLPSGVLSGGK	953	sp|Q08209-4|PP2BA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	17-UNIMOD:188	ms_run[2]:scan=10219	60.119	2	1576.859	1576.8590	K	Q	193	210
PSM	GPCIIYNEDNGIIK	954	sp|P36578|RL4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:4	ms_run[2]:scan=8045	47.276	2	1604.7868	1604.7868	R	A	206	220
PSM	GPVFAPPYEPLPENVK	955	sp|P11387|TOP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9835	57.808	2	1752.9087	1752.9087	K	F	224	240
PSM	GQDIFIIQTIPR	956	sp|Q14558|KPRA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11063	65.307	2	1399.7823	1399.7823	R	D	57	69
PSM	GQDIFIIQTIPR	957	sp|Q14558|KPRA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:267	ms_run[2]:scan=11086	65.453	2	1409.7906	1409.7906	R	D	57	69
PSM	GSFSEQGINEFLR	958	sp|Q15084-3|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:267	ms_run[2]:scan=10330	60.79	2	1492.7186	1492.7186	K	E	371	384
PSM	GSFSEQGINEFLR	959	sp|Q15084-3|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10343	60.873	2	1482.7103	1482.7103	K	E	371	384
PSM	GSPMEISLPIALSK	960	sp|P09960-4|LKHA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	14-UNIMOD:188	ms_run[2]:scan=11740	69.537	2	1447.8052	1447.8052	K	N	60	74
PSM	GVGGAVPGAVLEPVAR	961	sp|Q9Y446|PKP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	16-UNIMOD:267	ms_run[2]:scan=7640	45.052	2	1457.823	1457.8230	R	A	262	278
PSM	GVVQELQQAISK	962	sp|P29692-3|EF1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:188	ms_run[2]:scan=10887	64.212	2	1304.7395	1304.7395	R	L	72	84
PSM	GVVQELQQAISK	963	sp|P29692-3|EF1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10888	64.217	2	1298.7194	1298.7194	R	L	72	84
PSM	IGDLLVQQFSGENGER	964	sp|Q6ZSZ5-2|ARHGI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	16-UNIMOD:267	ms_run[2]:scan=9711	57.053	2	1770.8776	1770.8776	K	M	184	200
PSM	IGGGPGDAADVQR	965	sp|Q9UBS0|KS6B2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=2045	15.175	2	1211.5895	1211.5895	R	H	312	325
PSM	IGNLQTDLSDGLR	966	sp|O75369-6|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:267	ms_run[2]:scan=8381	49.219	2	1410.7342	1410.7342	R	L	37	50
PSM	IGNTGGMLDNILASK	967	sp|P53396-3|ACLY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	7-UNIMOD:35,15-UNIMOD:188	ms_run[2]:scan=7941	46.703	2	1524.7913	1524.7913	K	L	365	380
PSM	ILDMCAAPGSK	968	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	5-UNIMOD:4	ms_run[2]:scan=4934	30.46	2	1161.5522	1161.5522	K	T	180	191
PSM	ILDMCAAPGSK	969	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	5-UNIMOD:4,11-UNIMOD:188	ms_run[2]:scan=4935	30.464	2	1167.5723	1167.5723	K	T	180	191
PSM	ILGLAIESQDAGIK	970	sp|O00161-2|SNP23_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	14-UNIMOD:188	ms_run[2]:scan=9652	56.698	2	1432.8233	1432.8233	R	T	27	41
PSM	ILGVGPDDPDLVR	971	sp|P48449-2|ERG7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:267	ms_run[2]:scan=8970	52.613	2	1374.7382	1374.7382	R	A	83	96
PSM	ILLTEPPMNPTK	972	sp|P61160|ARP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7449	44.022	2	1352.7374	1352.7374	K	N	107	119
PSM	ILMVGLDAAGK	973	sp|P18085|ARF4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:188	ms_run[2]:scan=8068	47.408	2	1092.6308	1092.6308	R	T	20	31
PSM	IMNVIGEPIDER	974	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7860	46.288	2	1384.7021	1384.7021	R	G	144	156
PSM	IMVANIEEVLQR	975	sp|O75396|SC22B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11540	68.296	2	1413.765	1413.7650	R	G	148	160
PSM	ISAPNVDFNLEGPK	976	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9192	53.955	2	1499.762	1499.7620	R	V	5447	5461
PSM	IVEANPLLEAFGNAK	977	sp|Q9UM54-5|MYO6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=12089	71.749	2	1584.8512	1584.8512	R	T	182	197
PSM	IVEIPFNSTNK	978	sp|P05023-3|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:188	ms_run[2]:scan=7221	42.744	2	1266.6915	1266.6915	K	Y	446	457
PSM	IVEPYIAWGYPNLK	979	sp|P18124|RL7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	14-UNIMOD:188	ms_run[2]:scan=11912	70.616	2	1667.9019	1667.9019	R	S	135	149
PSM	IVEPYIAWGYPNLK	980	sp|P18124|RL7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11917	70.651	2	1661.8817	1661.8817	R	S	135	149
PSM	IVQELPQLLDAR	981	sp|Q6PIU2-2|NCEH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10127	59.572	2	1393.7929	1393.7929	R	S	320	332
PSM	IYVGNLPTDVR	982	sp|Q13242|SRSF9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7348	43.473	2	1245.6717	1245.6717	R	E	16	27
PSM	KIVITDCGQLS	983	sp|P30405|PPIF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:188,7-UNIMOD:4	ms_run[2]:scan=5438	33.119	2	1238.6636	1238.6636	K	-	197	208
PSM	LAPGTIVEVWK	984	sp|P07686|HEXB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:188	ms_run[2]:scan=9966	58.595	2	1217.7115	1217.7115	K	D	415	426
PSM	LATQSNEITIPVTFESR	985	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	17-UNIMOD:267	ms_run[2]:scan=10032	58.996	2	1914.9926	1914.9926	K	A	172	189
PSM	LAVNCFVNNNR	986	sp|P16422|EPCAM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	5-UNIMOD:4,11-UNIMOD:267	ms_run[2]:scan=5966	35.968	2	1329.6487	1329.6487	K	Q	34	45
PSM	LAVNCFVNNNR	987	sp|P16422|EPCAM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	5-UNIMOD:4	ms_run[2]:scan=5969	35.98	2	1319.6405	1319.6405	K	Q	34	45
PSM	LDGNLLTQPGQAR	988	sp|Q9BTW9-5|TBCD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5787	34.97	2	1381.7314	1381.7314	R	M	153	166
PSM	LEQPDPGAVAAAAILR	989	sp|Q3LXA3|TKFC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	16-UNIMOD:267	ms_run[2]:scan=10597	62.431	2	1600.8812	1600.8812	R	A	552	568
PSM	LFEAEAQDLFR	990	sp|Q9H223|EHD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10825	63.831	2	1337.6616	1337.6616	R	D	273	284
PSM	LFTAESLIGLK	991	sp|P48444|COPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11677	69.154	2	1190.6911	1190.6911	K	N	337	348
PSM	LGVQDLFNSSK	992	sp|P30740|ILEU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9664	56.768	2	1206.6245	1206.6245	R	A	291	302
PSM	LGVQDLFNSSK	993	sp|P30740|ILEU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:188	ms_run[2]:scan=9668	56.795	2	1212.6446	1212.6446	R	A	291	302
PSM	LIADVAPSAIR	994	sp|P39748|FEN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6627	39.559	2	1124.6554	1124.6554	K	E	9	20
PSM	LLADPTGAFGK	995	sp|P30044-2|PRDX5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7104	42.123	2	1088.5866	1088.5866	R	E	97	108
PSM	LLAGCEGGCCCWDVR	996	sp|Q9UFC0|LRWD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	5-UNIMOD:4,9-UNIMOD:4,10-UNIMOD:4,11-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=7341	43.43	2	1821.7294	1821.7294	R	L	459	474
PSM	LLEEAASLFNR	997	sp|Q6ZMZ3-3|SYNE3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:267	ms_run[2]:scan=10259	60.359	2	1271.6749	1271.6749	R	I	173	184
PSM	LLGGFQETCSK	998	sp|Q9BVP2-2|GNL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	9-UNIMOD:4,11-UNIMOD:188	ms_run[2]:scan=5294	32.374	2	1244.6167	1244.6167	K	A	231	242
PSM	LLLCGGAPLSATTQR	999	sp|O95573|ACSL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	4-UNIMOD:4	ms_run[2]:scan=7910	46.539	2	1556.8345	1556.8345	R	F	447	462
PSM	LLLINNAGSLGDVSK	1000	sp|P35270|SPRE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9656	56.719	2	1512.8512	1512.8512	R	G	95	110
PSM	LLSCSADGTLR	1001	sp|O43815-2|STRN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	4-UNIMOD:4	ms_run[2]:scan=4342	27.412	2	1191.5918	1191.5918	R	L	535	546
PSM	LLTFMGMAVENK	1002	sp|Q7L2H7-2|EIF3M_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11305	66.805	2	1352.6832	1352.6832	R	E	147	159
PSM	LLYNNVSNFGR	1003	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7453	44.04	2	1295.6622	1295.6622	K	L	1216	1227
PSM	LMGCQDILENVPGR	1004	sp|Q16513-5|PKN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	4-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=9052	53.104	2	1610.7784	1610.7784	R	S	9	23
PSM	LPTGQISGPEIK	1005	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:188	ms_run[2]:scan=5692	34.442	2	1244.7072	1244.7072	K	G	5513	5525
PSM	LQAQSLSTVGPR	1006	sp|O43290|SNUT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:267	ms_run[2]:scan=4596	28.716	2	1265.6967	1265.6967	R	L	374	386
PSM	LQAQSLSTVGPR	1007	sp|O43290|SNUT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4598	28.725	2	1255.6884	1255.6884	R	L	374	386
PSM	LQNLQLQPGNAKL	1008	sp|P22307-6|NLTP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7662	45.179	2	1435.8147	1435.8147	K	-	128	141
PSM	LSLDGQNIYNACCTLR	1009	sp|P26599|PTBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=9016	52.884	2	1896.8822	1896.8822	K	I	239	255
PSM	LYGDVPFIEER	1010	sp|Q9NRF8|PYRG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9832	57.791	2	1336.6663	1336.6663	K	H	467	478
PSM	MFVLDEADEMLSR	1011	sp|P60842|IF4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:267	ms_run[2]:scan=12518	74.576	2	1564.7141	1564.7141	K	G	178	191
PSM	MFVLDEADEMLSR	1012	sp|P60842|IF4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=12521	74.599	2	1554.7058	1554.7058	K	G	178	191
PSM	MLAIYDGFDGFAK	1013	sp|Q01813-2|PFKAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11983	71.078	2	1446.6853	1446.6853	R	G	435	448
PSM	MVEFLQCTVPCR	1014	sp|Q96D46|NMD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:35,7-UNIMOD:4,11-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=7759	45.714	2	1564.7076	1564.7076	K	Y	208	220
PSM	NGIDILVGTPGR	1015	sp|Q9NR30-2|DDX21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8553	50.222	2	1210.667	1210.6670	R	I	239	251
PSM	NIGDLLSSSIDR	1016	sp|Q70UQ0-2|IKIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10103	59.424	2	1288.6623	1288.6623	K	T	107	119
PSM	NLNWTPAEVPQLAAAK	1017	sp|Q6ZW49-2|PAXI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10517	61.934	2	1721.9101	1721.9101	R	R	16	32
PSM	NLQTYLQEEDTR	1018	sp|Q6KC79-2|NIPBL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7287	43.115	2	1508.7107	1508.7107	K	M	2236	2248
PSM	NNLAGAEELFAR	1019	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:267	ms_run[2]:scan=9197	53.988	2	1313.6603	1313.6603	R	K	355	367
PSM	NPTIVNFPITNVDLR	1020	sp|Q53GS9-2|SNUT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	15-UNIMOD:267	ms_run[2]:scan=11652	68.995	2	1721.934	1721.9340	K	E	364	379
PSM	NSILFLNSLDAK	1021	sp|Q8IXB1|DJC10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11289	66.701	2	1333.7242	1333.7242	K	E	326	338
PSM	NSNILEDLETLR	1022	sp|P48444|COPD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=12770	76.38	2	1415.7256	1415.7256	K	L	73	85
PSM	NTGIICTIGPASR	1023	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=6240	37.425	2	1368.7059	1368.7059	R	S	44	57
PSM	NVAIFTAGQESPIILR	1024	sp|O95071-2|UBR5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	16-UNIMOD:267	ms_run[2]:scan=11299	66.764	2	1737.9653	1737.9653	R	D	798	814
PSM	PGAVATGDIGR	1025	sp|P09001|RM03_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=2241	16.143	2	1012.5302	1012.5302	R	V	240	251
PSM	QAQEYEALLNIK	1026	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:188	ms_run[2]:scan=9659	56.741	2	1424.7607	1424.7607	R	V	359	371
PSM	QITLNDLPVGR	1027	sp|Q13162|PRDX4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8570	50.32	2	1224.6826	1224.6826	R	S	213	224
PSM	RSGPTDDGEEEMEEDTVTNGS	1028	sp|P09661|RU2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4687	29.163	2	2253.8815	2253.8815	R	-	235	256
PSM	SAGSATHPGAGGR	1029	sp|Q7Z7F0-4|KHDC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:1	ms_run[2]:scan=669	7.4011	2	1166.5428	1166.5428	M	R	2	15
PSM	SANGVILTPGNTDGFLLPK	1030	sp|Q86TN4-2|TRPT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	19-UNIMOD:188	ms_run[2]:scan=11337	67.002	2	1919.046	1919.0460	R	Y	145	164
PSM	SGFSLDNGELR	1031	sp|Q9UNZ2-4|NSF1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7203	42.651	2	1193.5677	1193.5677	K	S	158	169
PSM	SIVVSPILIPENQR	1032	sp|P55290-3|CAD13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10068	59.212	2	1563.8984	1563.8984	R	Q	139	153
PSM	SLEEGEGPIAVIMTPTR	1033	sp|Q7L014|DDX46_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11090	65.476	2	1798.9135	1798.9135	R	E	439	456
PSM	SLGSVQAPSYGAR	1034	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:267	ms_run[2]:scan=4632	28.894	2	1301.6603	1301.6603	R	P	15	28
PSM	SLGSVQAPSYGAR	1035	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4644	28.953	2	1291.6521	1291.6521	R	P	15	28
PSM	SLVPAAELLESR	1036	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:267	ms_run[2]:scan=10190	59.945	2	1293.7168	1293.7168	R	V	3116	3128
PSM	SLWNDPGIQECYDR	1037	sp|P50148|GNAQ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=8819	51.751	2	1761.7656	1761.7656	K	R	134	148
PSM	SPNCLQELLHE	1038	sp|Q92786|PROX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	4-UNIMOD:4	ms_run[2]:scan=10130	59.588	2	1338.6238	1338.6238	K	-	727	738
PSM	SQAPGQPGASQWGSR	1039	sp|Q96EP5-2|DAZP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=2965	20.044	2	1512.707	1512.7070	K	V	195	210
PSM	STGSIVGQQPFGGAR	1040	sp|P30038|AL4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5851	35.331	2	1460.7372	1460.7372	K	A	510	525
PSM	STSVPQGHTWTQR	1041	sp|Q9NYJ1|COA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:1	ms_run[2]:scan=4230	26.808	2	1525.7274	1525.7274	M	V	2	15
PSM	TALINSTGEEVAMR	1042	sp|P02545|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6444	38.559	2	1490.7399	1490.7399	R	K	528	542
PSM	TELPQFVSYFQQR	1043	sp|Q14166|TTL12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11932	70.744	2	1641.8151	1641.8151	R	E	395	408
PSM	TFNMDEYVGLPR	1044	sp|P46926|GNPI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10272	60.439	2	1440.6708	1440.6708	K	D	68	80
PSM	TFNPGAGLPTDK	1045	sp|P09661|RU2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5738	34.684	2	1216.6088	1216.6088	K	K	180	192
PSM	TFVNITPAEVGVLVGK	1046	sp|P07737|PROF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=12210	72.515	2	1642.9294	1642.9294	K	D	39	55
PSM	TGLLSFEESQR	1047	sp|Q9H089|LSG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:267	ms_run[2]:scan=7892	46.45	2	1275.6334	1275.6334	R	I	89	100
PSM	TGNFQVTELGR	1048	sp|O75643|U520_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:267	ms_run[2]:scan=6377	38.191	2	1230.6232	1230.6232	K	I	976	987
PSM	TIAEIFGNPNYLR	1049	sp|Q16401-2|PSMD5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11167	65.954	2	1506.7831	1506.7831	K	L	425	438
PSM	TINEVENQILTR	1050	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:267	ms_run[2]:scan=7833	46.141	2	1438.7655	1438.7655	R	D	746	758
PSM	TLGVDLVALATR	1051	sp|P27708|PYR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:267	ms_run[2]:scan=11722	69.428	2	1237.727	1237.7270	K	V	1229	1241
PSM	TLINAEDPPMVVVR	1052	sp|P46940|IQGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9216	54.097	2	1552.8283	1552.8283	K	K	857	871
PSM	TPEILTVNSIGQLK	1053	sp|Q8NFH3|NUP43_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10095	59.376	2	1511.8559	1511.8559	R	I	183	197
PSM	TPLENLVLQAK	1054	sp|Q7L2E3-3|DHX30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9538	56.015	2	1224.7078	1224.7078	R	I	775	786
PSM	TVEICPFSFDSR	1055	sp|Q9ULW0|TPX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	5-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=10292	60.559	2	1466.6739	1466.6739	R	D	532	544
PSM	TVEICPFSFDSR	1056	sp|Q9ULW0|TPX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	5-UNIMOD:4	ms_run[2]:scan=10294	60.569	2	1456.6657	1456.6657	R	D	532	544
PSM	TVTAMDVVYALK	1057	sp|P62805|H4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:188	ms_run[2]:scan=11512	68.12	2	1315.7153	1315.7153	K	R	81	93
PSM	TYVTPPGTGFLPGDTAR	1058	sp|Q9NPF4|OSGEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8746	51.326	2	1748.8733	1748.8733	R	H	31	48
PSM	VAPSAVLGPNVSIGK	1059	sp|Q96IJ6|GMPPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7422	43.874	2	1407.8086	1407.8086	K	G	295	310
PSM	VCGTLLEYLGK	1060	sp|Q8NCJ5|SPRY3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:4	ms_run[2]:scan=10673	62.892	2	1251.6533	1251.6533	R	G	228	239
PSM	VCGTLLEYLGK	1061	sp|Q8NCJ5|SPRY3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:4	ms_run[2]:scan=10684	62.962	2	1251.6533	1251.6533	R	G	228	239
PSM	VCTLAIIDPGDSDIIR	1062	sp|P62888|RL30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:4	ms_run[2]:scan=11104	65.567	2	1756.9029	1756.9029	R	S	91	107
PSM	VFNIYTDATPLR	1063	sp|Q8N8A6|DDX51_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:267	ms_run[2]:scan=9627	56.549	2	1418.7433	1418.7433	K	V	300	312
PSM	VFSGLVSTGLK	1064	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7878	46.38	2	1106.6336	1106.6336	R	V	416	427
PSM	VGINYQPPTVVPGGDLAK	1065	sp|P68363-2|TBA1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8842	51.885	2	1823.9781	1823.9781	K	V	237	255
PSM	VLANPGNSQVAR	1066	sp|Q14974|IMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:267	ms_run[2]:scan=1836	13.862	2	1234.6658	1234.6658	R	V	43	55
PSM	VLANPGNSQVAR	1067	sp|Q14974|IMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=1891	14.256	2	1224.6575	1224.6575	R	V	43	55
PSM	VLFSSNGGVVK	1068	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:188	ms_run[2]:scan=5637	34.181	2	1111.6333	1111.6333	K	G	472	483
PSM	VLSGDLGQLPTGIR	1069	sp|Q16822|PCKGM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	14-UNIMOD:267	ms_run[2]:scan=9109	53.452	2	1434.807	1434.8070	R	D	32	46
PSM	VPSENVLGEVGSGFK	1070	sp|P49748-2|ACADV_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9513	55.867	2	1517.7726	1517.7726	R	V	295	310
PSM	VQELQQGAFGR	1071	sp|Q8TDD1|DDX54_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4491	28.186	2	1231.6309	1231.6309	R	G	858	869
PSM	VSPIQIDGAGR	1072	sp|Q8NFQ8|TOIP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:267	ms_run[2]:scan=4897	30.252	2	1121.6068	1121.6068	K	T	325	336
PSM	VTDLLGGLFSK	1073	sp|O43615|TIM44_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:188	ms_run[2]:scan=12273	72.916	2	1154.6643	1154.6643	K	T	283	294
PSM	VVLIGDSGVGK	1074	sp|P62491-2|RB11A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5543	33.686	2	1042.6023	1042.6023	K	S	14	25
PSM	WAAVVVPSGQEQR	1075	sp|P10321-2|HLAC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6366	38.133	2	1425.7365	1425.7365	K	Y	268	281
PSM	YGEYFPGTGDLR	1076	sp|Q92769-3|HDAC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7968	46.853	2	1373.6252	1373.6252	K	D	172	184
PSM	YIIIGDMGVGK	1077	sp|P61106|RAB14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9391	55.15	2	1164.6213	1164.6213	K	S	14	25
PSM	YYLAPKIEDEEGS	1078	sp|P12004|PCNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:188	ms_run[2]:scan=6614	39.485	2	1518.7185	1518.7185	K	-	249	262
PSM	CDENILWLDYK	1079	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:4	ms_run[1]:scan=11138	65.772625	2	1467.666532	1467.670417	K	N	152	163
PSM	CCSGAIIVLTK	1080	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:4,2-UNIMOD:4	ms_run[1]:scan=6549	39.118955	2	1221.625608	1220.625715	K	S	423	434
PSM	QAQEYEALLNIK	1081	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:28,12-UNIMOD:188	ms_run[1]:scan=12170	72.26564666666667	2	1407.7346	1407.7336	R	V	359	371
PSM	AALEDTLAETEAR	1082	sp|P08727|K1C19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=6585	39.316955	2	1388.681471	1388.678338	K	F	318	331
PSM	QEYDESGPSIVHR	1083	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:28	ms_run[1]:scan=5096	31.332186666666665	2	1498.6725	1498.6683	K	K	360	373
PSM	QNGDDPLLTYRFPPK	1084	sp|P02545|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:28	ms_run[1]:scan=9972	58.62724	2	1742.8637	1742.8623	R	F	472	487
PSM	VIGSGCNLDSAR	1085	sp|Q6ZMR3|LDH6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	6-UNIMOD:4	ms_run[1]:scan=3244	21.56086	2	1248.579141	1247.592835	R	F	158	170
PSM	YWLCAATGPSIK	1086	sp|P63244|RACK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	4-UNIMOD:4	ms_run[1]:scan=8709	51.116018333333336	2	1365.676668	1365.675108	R	I	246	258
PSM	QADLYISEGLHPR	1087	sp|P40227|TCPZ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:28	ms_run[1]:scan=8885	52.13962333333333	2	1480.7350	1480.7305	K	I	105	118
PSM	LQIWDTAGQER	1088	sp|P61026|RAB10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	11-UNIMOD:267	ms_run[1]:scan=7116	42.17922	2	1325.660426	1325.660333	K	F	60	71
PSM	ILMVGLDAAGK	1089	sp|P84077|ARF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:35,11-UNIMOD:188	ms_run[1]:scan=6530	39.023831666666666	2	1108.626077	1108.625761	R	T	20	31
PSM	NPPLAEALLSGDLEK	1090	sp|Q5TDH0|DDI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	15-UNIMOD:188	ms_run[1]:scan=11908	70.59249666666666	2	1571.8451	1571.8497	R	F	156	171
PSM	DFLAGGIAAAISK	1091	sp|P12236|ADT3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	13-UNIMOD:188	ms_run[1]:scan=11205	66.18074666666666	2	1239.696803	1238.696617	K	T	11	24
PSM	QQQEILAAKPWTK	1092	sp|Q92905|CSN5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:28,9-UNIMOD:188,13-UNIMOD:188	ms_run[1]:scan=8166	47.981703333333336	2	1534.8569	1534.8541	K	D	35	48
PSM	QVQHILASASPSGR	1093	sp|O94979|SC31A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:28,14-UNIMOD:267	ms_run[1]:scan=7099	42.09287	2	1442.7519	1442.7500	R	A	179	193
PSM	LPPNVVEESAR	1094	sp|P01023|A2MG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=4392	27.677359999999997	2	1209.636695	1209.635351	K	A	935	946
PSM	IPDQLVILDMK	1095	sp|P49755|TMEDA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=11322	66.91247333333332	2	1283.714172	1283.715910	R	H	117	128
PSM	VFQNEVLGTLQR	1096	sp|Q13144|EI2BE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	12-UNIMOD:267	ms_run[1]:scan=8536	50.12214166666667	2	1412.772181	1412.765133	K	G	552	564
PSM	QVCPLDNREWEFQK	1097	sp|P62877|RBX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:28,3-UNIMOD:4	ms_run[1]:scan=9740	57.232594999999996	2	1830.8462	1830.8352	R	Y	92	106
PSM	FEINLISPDTK	1098	sp|O60343|TBCD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	11-UNIMOD:188	ms_run[1]:scan=9934	58.40450666666666	2	1281.688595	1281.691197	R	S	364	375
PSM	LDLIAQQMMPEVR	1099	sp|P36543|VATE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	13-UNIMOD:267	ms_run[1]:scan=10893	64.24925833333334	2	1552.801687	1552.798089	R	G	200	213
PSM	EGSGNPTPLINPLAGR	1100	sp|Q9NZN8|CNOT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	16-UNIMOD:267	ms_run[1]:scan=8657	50.80784833333333	2	1601.849811	1601.840088	R	A	240	256
PSM	QLRFEDVVNQSSPK	1101	sp|Q01085|TIAR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:28,3-UNIMOD:267,14-UNIMOD:188	ms_run[1]:scan=8861	51.997953333333335	2	1644.8502	1644.8437	K	N	190	204
PSM	QLHDDYFYHDEL	1102	sp|Q14257|RCN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:28	ms_run[1]:scan=10271	60.433856666666664	2	1576.6444	1576.6465	R	-	306	318
PSM	SAWLSGYENPVVSR	1103	sp|P13674|P4HA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=9159	53.754855000000006	2	1563.763373	1563.768157	K	I	383	397
PSM	LSLVDLAGSER	1104	sp|Q9NQT8|KI13B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	11-UNIMOD:267	ms_run[1]:scan=9131	53.582735	2	1168.654081	1168.632721	K	A	249	260
PSM	SMCGYQTFFAGK	1105	sp|P15586|GNS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:4,12-UNIMOD:188	ms_run[1]:scan=8871	52.055325	2	1403.623635	1401.615272	R	Y	138	150
PSM	AAEWQLDQPSWSGR	1106	sp|Q9NVZ3-3|NECP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:267	ms_run[2]:scan=8877	52.092	2	1639.7618	1639.7618	R	L	32	46
PSM	ACARPLISVYSEK	1107	sp|P36578|RL4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:1,2-UNIMOD:4	ms_run[2]:scan=7864	46.306	2	1534.7814	1534.7814	M	G	2	15
PSM	ADLINNLGTIAK	1108	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8876	52.088	2	1241.698	1241.6980	K	S	96	108
PSM	AEQEPTAEQLAQIAAENEEDEHSVNYKPPAQK	1109	sp|P52565-2|GDIR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:1	ms_run[2]:scan=9632	56.581	3	3605.6758	3605.6758	M	S	2	34
PSM	AFLASPEYVNLPINGNGKQ	1110	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	18-UNIMOD:188	ms_run[2]:scan=10607	62.494	2	2037.0627	2037.0627	K	-	192	211
PSM	AGGIETIANEFSDR	1111	sp|Q92598-2|HS105_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9871	58.03	2	1478.7001	1478.7001	R	C	20	34
PSM	AGPNASIISLK	1112	sp|Q9H0A0-2|NAT10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6566	39.212	2	1069.6132	1069.6132	K	S	907	918
PSM	ALDLADMITR	1113	sp|P49916-4|DNLI3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=10722	63.197	2	1127.5884	1127.5884	K	V	552	562
PSM	ANSEEFIPIFANNPR	1114	sp|Q9H270|VPS11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	15-UNIMOD:267	ms_run[2]:scan=10974	64.753	2	1727.8507	1727.8507	R	E	588	603
PSM	APPPSLTDCIGTVDSR	1115	sp|Q9NZZ3-2|CHMP5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	9-UNIMOD:4	ms_run[2]:scan=7246	42.875	2	1684.809	1684.8090	K	A	12	28
PSM	AQPLSLEELLAK	1116	sp|Q9BUQ8|DDX23_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:188	ms_run[2]:scan=11863	70.309	2	1316.7647	1316.7647	K	K	139	151
PSM	ATENDIANFFSPLNPIR	1117	sp|P31942-6|HNRH3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	17-UNIMOD:267	ms_run[2]:scan=13246	80.754	2	1927.9667	1927.9667	R	V	69	86
PSM	AVEYLLMGIPGDR	1118	sp|P54727-2|RD23B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:267	ms_run[2]:scan=11382	67.285	2	1442.7467	1442.7467	R	E	149	162
PSM	AVVGVVAGGGR	1119	sp|P62917|RL8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:267	ms_run[2]:scan=2549	17.737	2	950.55368	950.5537	R	I	164	175
PSM	AYGPGIEPTGNMVK	1120	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:188	ms_run[2]:scan=5868	35.43	2	1438.7222	1438.7222	R	K	286	300
PSM	CFIVGADNVGSK	1121	sp|P05388-2|RLA0_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:4,12-UNIMOD:188	ms_run[2]:scan=5699	34.479	2	1271.6276	1271.6276	K	Q	27	39
PSM	CVINATGPFTDSVR	1122	sp|P43304-2|GPDM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=8150	47.892	2	1545.7485	1545.7485	K	K	159	173
PSM	DAGVIAGLNVLR	1123	sp|P0DMV8-2|HS71A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:267	ms_run[2]:scan=10457	61.564	2	1206.696	1206.6960	K	I	105	117
PSM	DLSLLQIQMR	1124	sp|Q9BXJ9|NAA15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=11156	65.882	2	1225.6728	1225.6728	R	D	119	129
PSM	ELSAVTFPDIIR	1125	sp|P42224-2|STAT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11624	68.823	2	1359.7398	1359.7398	K	N	638	650
PSM	ESAALSEVLAGPLAQR	1126	sp|P98171|RHG04_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10808	63.731	2	1610.8628	1610.8628	R	L	116	132
PSM	FADLSEAANR	1127	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=4368	27.556	2	1102.5283	1102.5283	K	N	295	305
PSM	FADLSEAANR	1128	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4369	27.56	2	1092.52	1092.5200	K	N	295	305
PSM	FAEAFEAIPR	1129	sp|P50990|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=8392	49.283	2	1159.5901	1159.5901	K	A	441	451
PSM	FAEAFEAIPR	1130	sp|P50990|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8401	49.334	2	1149.5819	1149.5819	K	A	441	451
PSM	FDAGELITQR	1131	sp|P35232|PHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7668	45.207	2	1148.5826	1148.5826	R	E	134	144
PSM	FGDLLNIDDTAK	1132	sp|Q9BX66-9|SRBS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:188	ms_run[2]:scan=9620	56.508	2	1326.6763	1326.6763	R	R	524	536
PSM	FLEMCNDLLAR	1133	sp|P34932|HSP74_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	5-UNIMOD:4	ms_run[2]:scan=10224	60.147	2	1380.653	1380.6530	K	V	306	317
PSM	FLIPNASQAESK	1134	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6538	39.065	2	1303.6772	1303.6772	K	V	104	116
PSM	FNASQLITQR	1135	sp|Q99623|PHB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=7384	43.675	2	1186.6334	1186.6334	K	A	148	158
PSM	FNSQPVGDCDFNVR	1136	sp|O60942-3|MCE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	9-UNIMOD:4	ms_run[2]:scan=6589	39.338	2	1653.7206	1653.7206	K	L	367	381
PSM	FNVWDTAGQEK	1137	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:188	ms_run[2]:scan=7277	43.058	2	1299.6191	1299.6191	K	F	61	72
PSM	FQVDLVSENAGR	1138	sp|P55011-3|S12A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7460	44.078	2	1333.6626	1333.6626	R	A	81	93
PSM	FVEGLPINDFSR	1139	sp|P40925-2|MDHC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:267	ms_run[2]:scan=10154	59.733	2	1402.712	1402.7120	K	E	210	222
PSM	FVGQDVEGER	1140	sp|P17812|PYRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3127	20.932	2	1134.5306	1134.5306	K	M	499	509
PSM	FYSLWDTGYAK	1141	sp|Q8TCJ2|STT3B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10608	62.5	2	1349.6292	1349.6292	R	I	384	395
PSM	GAGTNEDALIEILTTR	1142	sp|P12429|ANXA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	16-UNIMOD:267	ms_run[2]:scan=12886	77.36	2	1682.8714	1682.8714	K	T	105	121
PSM	GFTLNDAANSR	1143	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:267	ms_run[2]:scan=4877	30.147	2	1174.5606	1174.5606	K	L	1099	1110
PSM	GFTLNDAANSR	1144	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4879	30.156	2	1164.5523	1164.5523	K	L	1099	1110
PSM	GGGGGGPGEGFDVAK	1145	sp|Q9Y295|DRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3810	24.548	2	1260.5735	1260.5735	K	T	47	62
PSM	GLSSLLYGSIPK	1146	sp|P53007|TXTP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11134	65.751	2	1233.6969	1233.6969	R	A	86	98
PSM	GLSSLLYGSIPK	1147	sp|P53007|TXTP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:188	ms_run[2]:scan=11136	65.762	2	1239.717	1239.7170	R	A	86	98
PSM	GPVGLEGLLTTK	1148	sp|P54886-2|P5CS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10359	60.964	2	1183.6812	1183.6812	R	W	748	760
PSM	GPVGLEGLLTTK	1149	sp|P54886-2|P5CS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:188	ms_run[2]:scan=10383	61.107	2	1189.7014	1189.7014	R	W	748	760
PSM	GSLGQGTAPVLPGK	1150	sp|Q13428-5|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5101	31.357	2	1280.7089	1280.7089	K	T	733	747
PSM	GSTAPVGGGAFPTIVER	1151	sp|Q15084-3|PDIA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	17-UNIMOD:267	ms_run[2]:scan=8342	48.982	2	1624.8448	1624.8448	R	E	390	407
PSM	IAELLSPGSVDPLTR	1152	sp|P35237|SPB6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	15-UNIMOD:267	ms_run[2]:scan=10471	61.654	2	1576.87	1576.8700	K	L	146	161
PSM	IAELLSPGSVDPLTR	1153	sp|P35237|SPB6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10490	61.768	2	1566.8617	1566.8617	K	L	146	161
PSM	IDCFSEVPTSVFGEK	1154	sp|O00567|NOP56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:4	ms_run[2]:scan=10420	61.335	2	1713.792	1713.7920	R	L	382	397
PSM	IEFSLPDLEGR	1155	sp|P35998-2|PRS7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:267	ms_run[2]:scan=11421	67.531	2	1284.6589	1284.6589	K	T	204	215
PSM	IEVIEIMTDR	1156	sp|P09651-3|ROA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10182	59.897	2	1217.6326	1217.6326	K	G	131	141
PSM	IEVIEIMTDR	1157	sp|P09651-3|ROA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=10185	59.913	2	1227.6408	1227.6408	K	G	131	141
PSM	IGNTGGMLDNILASK	1158	sp|P53396-3|ACLY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10583	62.343	2	1502.7763	1502.7763	K	L	365	380
PSM	IGPYQPNVPVGIDYVIPK	1159	sp|P43243-2|MATR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11602	68.689	3	1968.072	1968.0720	R	T	493	511
PSM	IIDEDGLLNLIR	1160	sp|P35251-2|RFC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=12890	77.389	2	1382.7769	1382.7769	K	T	469	481
PSM	IINEPTAAAIAYGLDK	1161	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	16-UNIMOD:188	ms_run[2]:scan=9996	58.775	2	1664.9081	1664.9081	R	K	172	188
PSM	IINNTENLVR	1162	sp|Q9Y617|SERC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4435	27.903	2	1184.6513	1184.6513	K	E	52	62
PSM	IINNTENLVR	1163	sp|Q9Y617|SERC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=4441	27.934	2	1194.6596	1194.6596	K	E	52	62
PSM	ILMGNEELTR	1164	sp|Q96FV9|THOC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=5876	35.477	2	1184.6099	1184.6099	K	L	431	441
PSM	ILQDSLGGNCR	1165	sp|O60282-2|KIF5C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:4	ms_run[2]:scan=3639	23.629	2	1231.5979	1231.5979	R	T	55	66
PSM	ILQEAWTEGR	1166	sp|Q9UI10-3|EI2BD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=6015	36.199	2	1211.6174	1211.6174	R	R	344	354
PSM	ILQNEPLPER	1167	sp|O95793-2|STAU1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=4508	28.273	2	1217.6644	1217.6644	R	L	78	88
PSM	ILVTGGSGLVGK	1168	sp|Q13630|FCL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5902	35.621	2	1099.6601	1099.6601	R	A	10	22
PSM	IMGIPEEEQMGLLR	1169	sp|P35579-2|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10955	64.636	2	1614.8109	1614.8109	R	V	192	206
PSM	INDFVLSPGPQPYK	1170	sp|Q9BY44-4|EIF2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8563	50.28	2	1573.814	1573.8140	K	V	109	123
PSM	INISEGNCPER	1171	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	8-UNIMOD:4	ms_run[2]:scan=2808	19.184	2	1287.5877	1287.5877	R	I	47	58
PSM	INQDPLGIQGR	1172	sp|P17050|NAGAB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5499	33.452	2	1209.6466	1209.6466	K	R	305	316
PSM	IPDQLVILDMK	1173	sp|P49755|TMEDA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:188	ms_run[2]:scan=11221	66.278	2	1289.736	1289.7360	R	H	117	128
PSM	IPTEAPQLELK	1174	sp|Q5VW32-2|BROX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7097	42.083	2	1237.6918	1237.6918	K	A	303	314
PSM	IQIAPDSGGLPER	1175	sp|Q96AE4|FUBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:267	ms_run[2]:scan=5986	36.064	2	1361.7178	1361.7178	K	S	134	147
PSM	ISGLIYEETR	1176	sp|P62805|H4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=6331	37.94	2	1189.6218	1189.6218	R	G	47	57
PSM	ITPSYVAFTPEGER	1177	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:267	ms_run[2]:scan=7836	46.155	2	1575.7808	1575.7808	R	L	61	75
PSM	ITPSYVAFTPEGER	1178	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7839	46.173	2	1565.7726	1565.7726	R	L	61	75
PSM	ITYEEIPLPIR	1179	sp|O75503|CLN5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10835	63.891	2	1342.7497	1342.7497	K	N	341	352
PSM	IVAFENAFER	1180	sp|O60763|USO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=8914	52.308	2	1204.6116	1204.6116	K	L	203	213
PSM	IVLLGDMNVGK	1181	sp|Q9NX57|RAB20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9573	56.224	2	1157.6478	1157.6478	K	T	8	19
PSM	IWSVPNASCVQVVR	1182	sp|Q9UMS4|PRP19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	9-UNIMOD:4	ms_run[2]:scan=9220	54.119	2	1613.8348	1613.8348	R	A	290	304
PSM	LDTSQWPLLLK	1183	sp|O60832-2|DKC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=12250	72.775	2	1312.7391	1312.7391	K	N	47	58
PSM	LENYPIPEPGPNEVLLR	1184	sp|Q00796|DHSO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10527	61.996	2	1949.0258	1949.0258	R	M	22	39
PSM	LFLESSDANPVR	1185	sp|Q9NU22|MDN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7241	42.847	2	1346.683	1346.6830	R	Y	126	138
PSM	LFQEDDEIPLYLK	1186	sp|P14406|CX7A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:188	ms_run[2]:scan=11427	67.564	2	1627.8441	1627.8441	K	G	34	47
PSM	LFTAESLIGLK	1187	sp|P48444|COPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:188	ms_run[2]:scan=11676	69.148	2	1196.7112	1196.7112	K	N	337	348
PSM	LGFTQGDVGLAMGK	1188	sp|P09086-4|PO2F2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:188	ms_run[2]:scan=9176	53.859	2	1398.7273	1398.7273	K	L	201	215
PSM	LGLENAEALIR	1189	sp|P10155-2|RO60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:267	ms_run[2]:scan=10203	60.021	2	1207.68	1207.6800	K	L	53	64
PSM	LGLTEDQFIR	1190	sp|P28340|DPOD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8588	50.421	2	1190.6295	1190.6295	K	T	630	640
PSM	LGLTEDQFIR	1191	sp|P28340|DPOD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=8589	50.426	2	1200.6378	1200.6378	K	T	630	640
PSM	LLADPTGAFGK	1192	sp|P30044-2|PRDX5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:188	ms_run[2]:scan=7106	42.132	2	1094.6067	1094.6067	R	E	97	108
PSM	LLLIGDSGVGK	1193	sp|P62820-2|RAB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8432	49.512	2	1070.6336	1070.6336	K	S	14	25
PSM	LLLQGLMDSVEAK	1194	sp|Q5VYK3|ECM29_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=12664	75.616	2	1415.7694	1415.7694	K	Q	880	893
PSM	LLNENSYVPR	1195	sp|P02786|TFR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5564	33.803	2	1203.6248	1203.6248	K	E	146	156
PSM	LLQFYPSLEDPASSR	1196	sp|Q9GZY6-2|NTAL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10734	63.269	2	1721.8625	1721.8625	K	Y	80	95
PSM	LLTIGDANGEIQR	1197	sp|Q86X55-2|CARM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7055	41.847	2	1398.7467	1398.7467	R	H	37	50
PSM	LLTQYILNLGK	1198	sp|O00203-3|AP3B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=12128	72	2	1274.7598	1274.7598	K	Y	504	515
PSM	LPSDVVTAVR	1199	sp|P04181|OAT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=5630	34.145	2	1065.6058	1065.6058	K	G	363	373
PSM	LQNLQLQPGNAKL	1200	sp|P22307-6|NLTP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:188	ms_run[2]:scan=7663	45.183	2	1441.8348	1441.8348	K	-	128	141
PSM	LSILYPATTGR	1201	sp|P30041|PRDX6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7708	45.43	2	1190.6659	1190.6659	K	N	145	156
PSM	LTEQSNTPLLLPLAAR	1202	sp|Q9NYL2-2|M3K20_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	16-UNIMOD:267	ms_run[2]:scan=11070	65.351	2	1745.9915	1745.9915	K	M	322	338
PSM	LVEALDLFER	1203	sp|O75127|PTCD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=11757	69.638	2	1213.6582	1213.6582	K	Q	152	162
PSM	MFLGDAVDVFETR	1204	sp|Q9BVL2-2|NUP58_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:35,13-UNIMOD:267	ms_run[2]:scan=11632	68.873	2	1524.7158	1524.7158	K	R	423	436
PSM	MGESDDSILR	1205	sp|P63220|RS21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:35,10-UNIMOD:267	ms_run[2]:scan=3324	21.979	2	1147.5055	1147.5055	R	L	62	72
PSM	MNPGDLQWMTAGR	1206	sp|O00625|PIR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:35	ms_run[2]:scan=8347	49.014	2	1491.6599	1491.6599	K	G	85	98
PSM	NFGAENPDPFVPVLNTAVK	1207	sp|Q9H583|HEAT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	19-UNIMOD:188	ms_run[2]:scan=11667	69.091	2	2034.0518	2034.0518	K	L	1680	1699
PSM	NIWVSGLSSNTK	1208	sp|Q9NWH9|SLTM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:188	ms_run[2]:scan=7552	44.567	2	1310.6926	1310.6926	K	A	385	397
PSM	NLQEIQQAGER	1209	sp|Q8N1F7|NUP93_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:267	ms_run[2]:scan=3454	22.643	2	1294.6505	1294.6505	R	L	32	43
PSM	NLTNPNTVIILIGNK	1210	sp|P61106|RAB14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10948	64.59	2	1622.9356	1622.9356	R	A	111	126
PSM	NPVDYMDLPFSSSPSR	1211	sp|Q9BX66-9|SRBS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	16-UNIMOD:267	ms_run[2]:scan=10897	64.271	2	1820.8279	1820.8279	K	S	680	696
PSM	NTGIICTIGPASR	1212	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=6055	36.405	2	1368.7059	1368.7059	R	S	44	57
PSM	NVLIVEDIIDTGK	1213	sp|P00492|HPRT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:188	ms_run[2]:scan=11999	71.185	2	1433.8073	1433.8073	K	T	129	142
PSM	PLFATNPFDQDVEK	1214	sp|Q92783-2|STAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10580	62.326	2	1619.7831	1619.7831	M	A	2	16
PSM	PSENLGQVLFGER	1215	sp|Q99805|TM9S2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10910	64.355	2	1444.731	1444.7310	R	I	92	105
PSM	QGGGGGGGSVPGIER	1216	sp|P52272-2|HNRPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=2430	17.098	2	1283.6218	1283.6218	K	M	350	365
PSM	QIWQNLGLDDTK	1217	sp|P49588|SYAC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:188	ms_run[2]:scan=9470	55.611	2	1435.7403	1435.7403	K	I	154	166
PSM	SCNPNLMSFITR	1218	sp|Q13530-2|SERC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=11002	64.926	2	1448.678	1448.6780	R	I	239	251
PSM	SCNPNLMSFITR	1219	sp|Q13530-2|SERC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:4	ms_run[2]:scan=11019	65.032	2	1438.6697	1438.6697	R	I	239	251
PSM	SDNGELEDKPPAPPVR	1220	sp|Q13177|PAK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:1	ms_run[2]:scan=5128	31.495	2	1761.8533	1761.8533	M	M	2	18
PSM	SEGTYCCGPVPVR	1221	sp|P21980|TGM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:4,7-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=4270	27.013	2	1490.6522	1490.6522	K	A	365	378
PSM	SFFDNISSELK	1222	sp|Q9BX40-2|LS14B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11322	66.912	2	1285.619	1285.6190	K	T	317	328
PSM	SLAETVLNFPLDK	1223	sp|Q9NVH0-2|EXD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:188	ms_run[2]:scan=12181	72.334	2	1451.7967	1451.7967	K	S	84	97
PSM	SLFGSIGEIESCK	1224	sp|Q12926-2|ELAV2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:4	ms_run[2]:scan=10500	61.828	2	1425.681	1425.6810	K	L	57	70
PSM	SLGPPQGEEDSVPR	1225	sp|P78527-2|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:267	ms_run[2]:scan=4471	28.083	2	1476.7084	1476.7084	R	D	2107	2121
PSM	SLVPAAELLESR	1226	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10199	60	2	1283.7085	1283.7085	R	V	3116	3128
PSM	SLVQEMVGSFGK	1227	sp|O75643|U520_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11707	69.335	2	1280.6435	1280.6435	R	R	546	558
PSM	SNPFAHLAEPLDPVQPGK	1228	sp|P21399|ACOC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:1	ms_run[2]:scan=11750	69.596	2	1957.9898	1957.9898	M	K	2	20
PSM	SPGADLLQVLTK	1229	sp|Q3LXA3|TKFC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11824	70.056	2	1240.7027	1240.7027	K	A	511	523
PSM	SPQENLVPCDVLLLR	1230	sp|Q9HD20-2|AT131_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	9-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=12067	71.614	2	1761.9323	1761.9323	R	G	210	225
PSM	SQLDLFDDVGTFASGPPK	1231	sp|Q8N6H7-3|ARFG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=12374	73.56	2	1892.9156	1892.9156	R	Y	71	89
PSM	TAVHAGNINFK	1232	sp|P35221-2|CTNA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:1,11-UNIMOD:188	ms_run[2]:scan=5763	34.83	2	1218.6452	1218.6452	M	W	2	13
PSM	TDEQALLSSILAK	1233	sp|Q6IAA8|LTOR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:188	ms_run[2]:scan=11698	69.279	2	1393.776	1393.7760	R	T	48	61
PSM	TFDEIASGFR	1234	sp|P11166|GTR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=8238	48.383	2	1151.5487	1151.5487	R	Q	459	469
PSM	TFDEIASGFR	1235	sp|P11166|GTR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8239	48.387	2	1141.5404	1141.5404	R	Q	459	469
PSM	TIAIIAEGIPEALTR	1236	sp|P53396-3|ACLY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	15-UNIMOD:267	ms_run[2]:scan=12162	72.215	2	1576.9064	1576.9064	R	K	322	337
PSM	TIIPLISQCTPK	1237	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	9-UNIMOD:4	ms_run[2]:scan=8991	52.735	2	1369.7639	1369.7639	K	V	204	216
PSM	TIIPLISQCTPK	1238	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	9-UNIMOD:4,12-UNIMOD:188	ms_run[2]:scan=8993	52.75	2	1375.7841	1375.7841	K	V	204	216
PSM	TIQTPIGSTWNTQR	1239	sp|Q9BVJ6-3|UT14A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7340	43.425	2	1601.8162	1601.8162	R	A	646	660
PSM	TLINAEDPPMVVVR	1240	sp|P46940|IQGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:267	ms_run[2]:scan=9215	54.091	2	1562.8366	1562.8366	K	K	857	871
PSM	TLNQLGTPQDSPELR	1241	sp|O15400-2|STX7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	15-UNIMOD:267	ms_run[2]:scan=6326	37.91	2	1677.8561	1677.8561	R	Q	35	50
PSM	TLVQILTEPR	1242	sp|O76031|CLPX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=9905	58.234	2	1178.6898	1178.6898	K	N	513	523
PSM	TLVQILTEPR	1243	sp|O76031|CLPX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9908	58.251	2	1168.6816	1168.6816	K	N	513	523
PSM	TTPSVVAFTADGER	1244	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:267	ms_run[2]:scan=6900	40.987	2	1459.7182	1459.7182	R	L	86	100
PSM	TTSAGTGGMWR	1245	sp|P60468|SC61B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3448	22.615	2	1123.508	1123.5080	R	F	47	58
PSM	TVATPLNQVANPNSAIFGGAR	1246	sp|Q15056-2|IF4H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10048	59.091	3	2097.0967	2097.0967	R	P	197	218
PSM	TVTAMDVVYALK	1247	sp|P62805|H4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11511	68.114	2	1309.6952	1309.6952	K	R	81	93
PSM	VDGMDILCVR	1248	sp|P08559-3|ODPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	8-UNIMOD:4	ms_run[2]:scan=9570	56.207	2	1176.5631	1176.5631	R	E	223	233
PSM	VDGMDILCVR	1249	sp|P08559-3|ODPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	8-UNIMOD:4,10-UNIMOD:267	ms_run[2]:scan=9581	56.273	2	1186.5714	1186.5714	R	E	223	233
PSM	VDILDPALLR	1250	sp|P17980|PRS6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=11159	65.904	2	1133.6684	1133.6684	R	S	335	345
PSM	VFNIYTDATPLR	1251	sp|Q8N8A6|DDX51_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9616	56.485	2	1408.7351	1408.7351	K	V	300	312
PSM	VFNVFCLYGNVEK	1252	sp|P14866|HNRPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=12640	75.455	2	1593.7957	1593.7957	R	V	399	412
PSM	VFSGLVSTGLK	1253	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:188	ms_run[2]:scan=7874	46.357	2	1112.6537	1112.6537	R	V	416	427
PSM	VGLNAQAACAPR	1254	sp|P48681|NEST_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	9-UNIMOD:4	ms_run[2]:scan=3266	21.677	2	1226.619	1226.6190	R	C	149	161
PSM	VIGVGEFGEVCSGR	1255	sp|P54764-2|EPHA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:4	ms_run[2]:scan=8099	47.584	2	1464.7031	1464.7031	K	L	575	589
PSM	VLFSSNGGVVK	1256	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5636	34.177	2	1105.6132	1105.6132	K	G	472	483
PSM	VLITTDLLAR	1257	sp|P60842|IF4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=9800	57.596	2	1123.684	1123.6840	R	G	325	335
PSM	VLITTDLLAR	1258	sp|P60842|IF4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9803	57.617	2	1113.6758	1113.6758	R	G	325	335
PSM	VLQSALAAIR	1259	sp|Q12905|ILF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7123	42.216	2	1040.6342	1040.6342	K	H	197	207
PSM	VLQSALAAIR	1260	sp|Q12905|ILF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=7124	42.22	2	1050.6425	1050.6425	K	H	197	207
PSM	VLYPNDNFFEGK	1261	sp|P11216|PYGB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9364	54.982	2	1441.6878	1441.6878	R	E	279	291
PSM	VNNADDFPNLFR	1262	sp|Q13085|ACACA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:267	ms_run[2]:scan=10510	61.889	2	1430.6818	1430.6818	K	Q	324	336
PSM	VQISPDSGGLPER	1263	sp|Q92945|FUBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5056	31.117	2	1353.6888	1353.6888	K	S	178	191
PSM	VTAQSIIPGILER	1264	sp|O75153|CLU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:267	ms_run[2]:scan=11116	65.641	2	1405.8168	1405.8168	R	D	482	495
PSM	VTDLLGGLFSK	1265	sp|O43615|TIM44_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=12279	72.956	2	1148.6441	1148.6441	K	T	283	294
PSM	VTVNPGLLVPLDVK	1266	sp|Q6KB66-2|K2C80_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:188	ms_run[2]:scan=11623	68.818	2	1468.896	1468.8960	K	L	58	72
PSM	VWDPDNPLTDR	1267	sp|O94776-2|MTA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:267	ms_run[2]:scan=7779	45.836	2	1336.6287	1336.6287	K	Q	5	16
PSM	YDGQVAVFGSDLQEK	1268	sp|P22314-2|UBA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8114	47.674	2	1654.7839	1654.7839	R	L	411	426
PSM	YGGQPVPNFPSK	1269	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:188	ms_run[2]:scan=5434	33.094	2	1295.6606	1295.6606	K	L	1235	1247
PSM	YGGQPVPNFPSK	1270	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5458	33.227	2	1289.6404	1289.6404	K	L	1235	1247
PSM	YGPLSGVNVVYDQR	1271	sp|Q13595-2|TRA2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8719	51.171	2	1565.7838	1565.7838	R	T	41	55
PSM	YIGEVGDIVVGR	1272	sp|Q13868-3|EXOS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:267	ms_run[2]:scan=8519	50.023	2	1285.6906	1285.6906	R	I	76	88
PSM	YIIIGDMGVGK	1273	sp|P61106|RAB14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:188	ms_run[2]:scan=9398	55.195	2	1170.6414	1170.6414	K	S	14	25
PSM	YLEAGAAGLR	1274	sp|Q9NZL4-3|HPBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=4553	28.507	2	1029.5483	1029.5483	R	W	196	206
PSM	YLLDSCAPLLR	1275	sp|Q92616|GCN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:4	ms_run[2]:scan=10155	59.738	2	1319.6908	1319.6908	K	Y	241	252
PSM	YQLDPTASISAK	1276	sp|P45880|VDAC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:188	ms_run[2]:scan=6316	37.851	2	1298.6814	1298.6814	K	V	236	248
PSM	QLQLAQEAAQKR	1277	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:28,11-UNIMOD:188,12-UNIMOD:267	ms_run[1]:scan=7023	41.67087	2	1381.7647	1381.7643	R	L	2172	2184
PSM	CITDPQTGLCLLPLKEK	1278	sp|Q15149|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:385,1-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=12190	72.39152333333332	2	1968.0147	1968.0055	R	K	4245	4262
PSM	CCSGAIIVLTK	1279	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:4,2-UNIMOD:4	ms_run[1]:scan=6618	39.51023166666666	2	1221.625608	1220.625715	K	S	423	434
PSM	ASLEAAIADAEQR	1280	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	13-UNIMOD:267	ms_run[1]:scan=8627	50.628161666666664	2	1353.678105	1353.676377	R	G	329	342
PSM	FWEVISDEHGID	1281	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0		ms_run[1]:scan=10237	60.22956	2	1445.6411	1445.6458	K	P	20	32
PSM	QSSATSSFGGLGGGSVR	1282	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=5592	33.954433333333334	2	1553.749488	1553.743398	R	F	8	25
PSM	ALEAANGELEVK	1283	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=5124	31.477246666666666	2	1242.647458	1242.645582	R	I	100	112
PSM	GFQEVVTPNIFNSR	1284	sp|P26639|SYTC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	14-UNIMOD:267	ms_run[1]:scan=10541	62.08806166666667	2	1617.803472	1616.818625	R	L	368	382
PSM	QNGDDPLLTYRFPPK	1285	sp|P02545|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:28,11-UNIMOD:267,15-UNIMOD:188	ms_run[1]:scan=10402	61.223571666666665	2	1758.8916	1758.8907	R	F	472	487
PSM	QNGDDPLLTYRFPPK	1286	sp|P02545|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:28,11-UNIMOD:267,15-UNIMOD:188	ms_run[1]:scan=10052	59.11313333333334	2	1758.8897	1758.8907	R	F	472	487
PSM	QNGDDPLLTYRFPPK	1287	sp|P02545|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:28	ms_run[1]:scan=11048	65.211715	2	1744.8682	1742.8622	R	F	472	487
PSM	GPVGLEGLLTTK	1288	sp|P54886|P5CS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	12-UNIMOD:188	ms_run[1]:scan=10354	60.93679	2	1189.696564	1189.701368	R	W	750	762
PSM	LWDLTTGTTTR	1289	sp|P63244|RACK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	11-UNIMOD:267	ms_run[1]:scan=7892	46.450493333333334	2	1273.653932	1273.654185	R	R	89	100
PSM	QADLYISEGLHPR	1290	sp|P40227|TCPZ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:28,13-UNIMOD:267	ms_run[1]:scan=8882	52.119398333333336	2	1490.7427	1490.7388	K	I	105	118
PSM	LAGTQPLEVLEAVQR	1291	sp|P22314|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	15-UNIMOD:267	ms_run[1]:scan=11295	66.74155833333333	3	1633.906389	1632.907440	R	S	679	694
PSM	FSGLEEAVYR	1292	sp|P50990-2|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0		ms_run[1]:scan=7215	42.71256666666667	2	1169.5723	1169.5712	H	N	3	13
PSM	FSGLEEAVYR	1293	sp|P50990-2|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	10-UNIMOD:267	ms_run[1]:scan=7214	42.708216666666665	2	1179.5799	1179.5794	H	N	3	13
PSM	FGGSGSQVDSAR	1294	sp|Q13200|PSMD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1229	10.505738333333333	2	1166.536415	1166.531615	R	M	358	370
PSM	QLPSLACKYPVSSR	1295	sp|P42166|LAP2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:28,7-UNIMOD:4,8-UNIMOD:188,14-UNIMOD:267	ms_run[1]:scan=8263	48.51818166666666	2	1603.8415	1603.8358	R	E	512	526
PSM	CPSILGGLAPEKDQPK	1296	sp|A5YKK6|CNOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=9935	58.409909999999996	2	1691.8586	1691.8547	R	S	624	640
PSM	GLVYETSVLDPDEGIR	1297	sp|O75390|CISY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	16-UNIMOD:267	ms_run[1]:scan=9872	58.035095	2	1772.910420	1771.886764	K	F	77	93
PSM	SGFSLDNGELR	1298	sp|Q9UNZ2|NSF1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=7179	42.518735	2	1193.567441	1193.567666	K	S	189	200
PSM	VYFGMQDGSVNMR	1299	sp|P49247|RPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	13-UNIMOD:267	ms_run[1]:scan=8079	47.46545166666667	2	1512.668412	1512.672888	R	E	294	307
PSM	LSDGFNGADLR	1300	sp|P62333|PRS10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=5893	35.57134166666667	2	1164.558084	1163.557101	K	N	334	345
PSM	LSDGFNGADLR	1301	sp|P62333|PRS10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	11-UNIMOD:267	ms_run[1]:scan=5866	35.42035666666666	2	1174.570171	1173.565370	K	N	334	345
PSM	LSDGFNGADLR	1302	sp|P62333|PRS10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	11-UNIMOD:267	ms_run[1]:scan=5894	35.57530833333333	2	1174.570171	1173.565370	K	N	334	345
PSM	QIEIQFAQGDRK	1303	sp|O75494|SRS10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:28	ms_run[1]:scan=8002	47.031821666666666	2	1414.7185	1414.7200	R	T	80	92
PSM	MADEAILQER	1304	sp|Q9HCD5|NCOA5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:35,10-UNIMOD:267	ms_run[1]:scan=4352	27.469078333333332	2	1201.575417	1200.568407	K	E	316	326
PSM	LYGDVPFIEER	1305	sp|Q9NRF8|PYRG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	11-UNIMOD:267	ms_run[1]:scan=9826	57.75240166666667	2	1347.677888	1346.674586	K	H	467	478
PSM	GPDALTLLEYTETR	1306	sp|Q96JB5|CK5P3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=11895	70.50617666666668	2	1577.804408	1577.793703	R	N	337	351
PSM	IPDQLVILDMK	1307	sp|P49755|TMEDA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	11-UNIMOD:188	ms_run[1]:scan=11323	66.917885	2	1289.733934	1289.736039	R	H	117	128
PSM	ALSSGGSITSPPLSPALPK	1308	sp|Q6Y7W6|GGYF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=8459	49.67754333333333	2	1779.989807	1778.977815	R	Y	17	36
PSM	INFDDNAEFR	1309	sp|Q96I99|SUCB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	10-UNIMOD:267	ms_run[1]:scan=7034	41.73028	2	1249.560035	1249.560285	K	Q	260	270
PSM	ICADPQFIIGGATR	1310	sp|P17655-2|CAN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	2-UNIMOD:4,14-UNIMOD:267	ms_run[1]:scan=9051	53.098778333333335	2	1527.7749	1527.7738	E	T	3	17
PSM	CGSALVSSLATGLKPR	1311	sp|Q69YN2|C19L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:385,1-UNIMOD:4,14-UNIMOD:188,16-UNIMOD:267	ms_run[1]:scan=11815	69.997725	2	1614.8743	1614.8729	K	Y	176	192
PSM	HTAAPTDPADGPV	1312	sp|Q04941|PLP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=2823	19.259795	2	1247.587326	1247.578230	R	-	140	153
PSM	QVPGGGGGGGSGGGGGSGGGGSGGGR	1313	sp|Q9UHB9|SRP68_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=487	6.324013333333333	2	1842.803263	1842.795327	K	G	6	32
PSM	QDAFANFANFSK	1314	sp|Q14677|EPN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=9886	58.12193166666667	2	1358.630278	1358.625515	K	-	614	626
PSM	QVEPLDPPAGSAPGEHVFVK	1315	sp|P54577|SYYC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:28,20-UNIMOD:188	ms_run[1]:scan=9029	52.964125	2	2062.0572	2062.0462	R	G	451	471
PSM	GAAGALLVYDITSR	1316	sp|P20338|RAB4A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	14-UNIMOD:267	ms_run[1]:scan=10976	64.76419166666666	2	1417.780677	1415.764798	R	E	85	99
PSM	AAEADGPLKR	1317	sp|O75352-2|MPU1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:1	ms_run[2]:scan=2802	19.158	2	1068.5564	1068.5564	M	L	2	12
PSM	AASCVLLHTGQK	1318	sp|P14550|AK1A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:1,4-UNIMOD:4	ms_run[2]:scan=6145	36.881	2	1325.6762	1325.6762	M	M	2	14
PSM	AAVPLGGFLCNVADK	1319	sp|Q7L8L6|FAKD5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=11255	66.489	2	1536.8066	1536.8066	K	S	661	676
PSM	AELGFLESCLR	1320	sp|Q92696|PGTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	9-UNIMOD:4,11-UNIMOD:267	ms_run[2]:scan=10696	63.035	2	1303.647	1303.6470	K	V	91	102
PSM	AELGFLESCLR	1321	sp|Q92696|PGTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	9-UNIMOD:4	ms_run[2]:scan=10698	63.045	2	1293.6387	1293.6387	K	V	91	102
PSM	AEVLWLMGAK	1322	sp|O94906-2|PRP6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:188	ms_run[2]:scan=11324	66.923	2	1122.6203	1122.6203	K	S	607	617
PSM	AGNLGGGVVTIER	1323	sp|P35268|RL22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:267	ms_run[2]:scan=5735	34.669	2	1251.6811	1251.6811	K	S	53	66
PSM	AGPNASIISLK	1324	sp|Q9H0A0-2|NAT10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:188	ms_run[2]:scan=6565	39.208	2	1075.6333	1075.6333	K	S	907	918
PSM	AILVDLEPGTMDSVR	1325	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	15-UNIMOD:267	ms_run[2]:scan=10404	61.235	2	1624.837	1624.8370	R	S	63	78
PSM	ALAAGGVGSIVR	1326	sp|O15511|ARPC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5927	35.762	2	1069.6244	1069.6244	K	V	132	144
PSM	ALAAGGVGSIVR	1327	sp|O15511|ARPC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:267	ms_run[2]:scan=5933	35.794	2	1079.6327	1079.6327	K	V	132	144
PSM	ALELNMLSLK	1328	sp|Q9Y617|SERC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11135	65.757	2	1130.6369	1130.6369	K	G	324	334
PSM	ALGYFAVVTGK	1329	sp|O60313-13|OPA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:188	ms_run[2]:scan=9456	55.528	2	1130.6431	1130.6431	K	G	459	470
PSM	ALLNLPGTQTSGEAK	1330	sp|Q96GM8|TOE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7748	45.654	2	1498.7991	1498.7991	R	D	348	363
PSM	ALVFQPVAELK	1331	sp|P08237-2|PFKAM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10008	58.847	2	1213.7071	1213.7071	R	D	686	697
PSM	ANINVENAFFTLAR	1332	sp|P61006|RAB8A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	14-UNIMOD:267	ms_run[2]:scan=12676	75.697	2	1588.8237	1588.8237	K	D	154	168
PSM	AQLLQPTLEINPR	1333	sp|Q12931-2|TRAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8936	52.43	2	1491.8409	1491.8409	R	H	582	595
PSM	AQLLQPTLEINPR	1334	sp|Q12931-2|TRAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:267	ms_run[2]:scan=8948	52.503	2	1501.8492	1501.8492	R	H	582	595
PSM	AQPLSLEELLAK	1335	sp|Q9BUQ8|DDX23_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11862	70.304	2	1310.7446	1310.7446	K	K	139	151
PSM	ASPLVAIGQTLAR	1336	sp|Q9NSI2-2|F207A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:267	ms_run[2]:scan=10753	63.389	2	1305.7644	1305.7644	R	Q	193	206
PSM	AVAEQIPLLVQGVR	1337	sp|Q9Y490|TLN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	14-UNIMOD:267	ms_run[2]:scan=10675	62.908	2	1501.8856	1501.8856	K	G	958	972
PSM	AVAGWEEVLR	1338	sp|Q7L2E3-3|DHX30_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:267	ms_run[2]:scan=9440	55.438	2	1138.601	1138.6010	R	W	903	913
PSM	CDKEFMWALK	1339	sp|P58546|MTPN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:1,1-UNIMOD:4	ms_run[2]:scan=10970	64.731	2	1368.6206	1368.6206	M	N	2	12
PSM	CDKEFMWALK	1340	sp|P58546|MTPN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:1,1-UNIMOD:4,3-UNIMOD:188,10-UNIMOD:188	ms_run[2]:scan=10971	64.736	2	1380.6609	1380.6609	M	N	2	12
PSM	CLEEFELLGK	1341	sp|Q99613-2|EIF3C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:4,10-UNIMOD:188	ms_run[2]:scan=10319	60.722	2	1242.6262	1242.6262	K	A	79	89
PSM	CLEEFELLGK	1342	sp|Q99613-2|EIF3C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:4	ms_run[2]:scan=10320	60.728	2	1236.606	1236.6060	K	A	79	89
PSM	CLIATGGTPR	1343	sp|O95831-3|AIFM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:4,10-UNIMOD:267	ms_run[2]:scan=3426	22.493	2	1054.5469	1054.5469	K	S	252	262
PSM	CSGDGVGAPR	1344	sp|O15355|PPM1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:4	ms_run[2]:scan=822	8.2886	2	974.42398	974.4240	K	L	13	23
PSM	CWEVQDSGQTIPK	1345	sp|P78406|RAE1L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=6228	37.35	2	1552.7287	1552.7287	R	A	68	81
PSM	DAGQISGLNVLR	1346	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8361	49.096	2	1241.6728	1241.6728	K	V	207	219
PSM	DGQILPVPNVVVR	1347	sp|Q9P258|RCC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:267	ms_run[2]:scan=9983	58.697	2	1414.8172	1414.8172	K	D	321	334
PSM	EANLLNAVIVQR	1348	sp|Q9UNZ2-4|NSF1C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10059	59.156	2	1338.7619	1338.7619	K	L	326	338
PSM	EFSPFGSITSAK	1349	sp|Q13310-2|PABP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:188	ms_run[2]:scan=9335	54.815	2	1275.6442	1275.6442	K	V	313	325
PSM	EGDVLTLLESER	1350	sp|P62857|RS28_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:267	ms_run[2]:scan=11422	67.537	2	1369.6964	1369.6964	R	E	52	64
PSM	EKLEATINELV	1351	sp|P10599-2|THIO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:188	ms_run[2]:scan=10047	59.087	2	1263.7018	1263.7018	K	-	75	86
PSM	ELLDGGANPLQR	1352	sp|Q9H078-5|CLPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:267	ms_run[2]:scan=7190	42.577	2	1291.676	1291.6760	K	N	83	95
PSM	ELLITDLLPDNR	1353	sp|Q03701|CEBPZ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:267	ms_run[2]:scan=12655	75.56	2	1420.7801	1420.7801	K	K	291	303
PSM	FADIVSILDK	1354	sp|P29317|EPHA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:188	ms_run[2]:scan=11692	69.246	2	1125.6377	1125.6377	K	L	864	874
PSM	FAQPGSFEYEYAMR	1355	sp|Q15233-2|NONO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9072	53.23	2	1694.7399	1694.7399	R	W	168	182
PSM	FDAGELITQR	1356	sp|P35232|PHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:267	ms_run[2]:scan=7667	45.203	2	1158.5909	1158.5909	R	E	134	144
PSM	FEELNMDLFR	1357	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:267	ms_run[2]:scan=11926	70.711	2	1322.6204	1322.6204	K	S	327	337
PSM	FEGDTGLIVR	1358	sp|O00267-2|SPT5H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:267	ms_run[2]:scan=6526	39.002	2	1115.585	1115.5850	R	V	481	491
PSM	FICTTSAIQNR	1359	sp|P53396-3|ACLY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	3-UNIMOD:4,11-UNIMOD:267	ms_run[2]:scan=4512	28.296	2	1319.6531	1319.6531	K	F	18	29
PSM	FICTTSAIQNR	1360	sp|P53396-3|ACLY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	3-UNIMOD:4	ms_run[2]:scan=4518	28.323	2	1309.6449	1309.6449	K	F	18	29
PSM	FLDGNELTLADCNLLPK	1361	sp|O00299|CLIC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:4	ms_run[2]:scan=12027	71.361	2	1931.9663	1931.9663	K	L	167	184
PSM	FLESPDFQPNIAK	1362	sp|Q13362-2|2A5G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:188	ms_run[2]:scan=8629	50.639	2	1510.7763	1510.7763	R	K	144	157
PSM	FLGDIEVWDQAEK	1363	sp|P26639|SYTC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:188	ms_run[2]:scan=11035	65.132	2	1554.7662	1554.7662	K	Q	505	518
PSM	FNASQLITQR	1364	sp|Q99623|PHB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7393	43.724	2	1176.6251	1176.6251	K	A	148	158
PSM	FQGQDTILDYTLR	1365	sp|P36639-4|8ODP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10650	62.758	2	1568.7835	1568.7835	K	E	139	152
PSM	FSASSGGGGSR	1366	sp|P78344-2|IF4G2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:267	ms_run[2]:scan=709	7.6204	2	978.43944	978.4394	R	G	13	24
PSM	FSPGAPGGSGSQPNQK	1367	sp|Q15942-2|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	16-UNIMOD:188	ms_run[2]:scan=1531	12.264	2	1520.7315	1520.7315	K	L	123	139
PSM	FVGQDVEGER	1368	sp|P17812|PYRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:267	ms_run[2]:scan=3123	20.909	2	1144.5388	1144.5388	K	M	499	509
PSM	GAGTDEGCLIEILASR	1369	sp|P09525-2|ANXA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	8-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=12038	71.435	2	1670.8173	1670.8173	K	T	19	35
PSM	GALQNIIPASTGAAK	1370	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7457	44.064	2	1410.7831	1410.7831	R	A	159	174
PSM	GFEGSFEELCR	1371	sp|P33121-2|ACSL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:4	ms_run[2]:scan=8462	49.699	2	1329.566	1329.5660	R	N	606	617
PSM	GFNEGLWEIDNNPK	1372	sp|O75475-3|PSIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9781	57.48	2	1631.758	1631.7580	K	V	76	90
PSM	GILAADESTGSIAK	1373	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	14-UNIMOD:188	ms_run[2]:scan=5378	32.794	2	1337.7134	1337.7134	K	R	29	43
PSM	GLDPVEILQER	1374	sp|P51532-5|SMCA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:267	ms_run[2]:scan=10495	61.8	2	1277.6855	1277.6855	R	E	360	371
PSM	GMEDLIPLVNR	1375	sp|Q05193-5|DYN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:267	ms_run[2]:scan=11066	65.323	2	1265.6677	1265.6677	R	L	5	16
PSM	GNENANGAPAITLLIR	1376	sp|Q9Y5B9|SP16H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10830	63.864	2	1622.874	1622.8740	K	E	93	109
PSM	GPFTDVVTTNLK	1377	sp|O95292-2|VAPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8549	50.196	2	1290.682	1290.6820	R	L	20	32
PSM	GSLLFTAGPLEEER	1378	sp|P53004|BIEA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10569	62.259	2	1517.7726	1517.7726	K	F	148	162
PSM	GTRDDEYDYLFK	1379	sp|P62491-2|RB11A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:1	ms_run[2]:scan=9598	56.377	2	1562.6889	1562.6889	M	V	2	14
PSM	GVEICIATPGR	1380	sp|P17844-2|DDX5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:4,11-UNIMOD:267	ms_run[2]:scan=6643	39.637	2	1181.6102	1181.6102	R	L	138	149
PSM	GVGSPEPGPTAPYLGR	1381	sp|Q9C0B5-2|ZDHC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6280	37.643	2	1553.7838	1553.7838	R	S	565	581
PSM	ICFQGDEGACPTR	1382	sp|Q9NUD5|ZCHC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=4346	27.433	2	1509.634	1509.6340	R	D	169	182
PSM	IDFSSIAVPGTSSPR	1383	sp|Q5TDH0-2|DDI2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	15-UNIMOD:267	ms_run[2]:scan=9525	55.939	2	1542.7917	1542.7917	R	Q	94	109
PSM	IDGGITGNMR	1384	sp|Q14839|CHD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3431	22.521	2	1032.5022	1032.5022	R	Q	1096	1106
PSM	IDISPVLLQK	1385	sp|P49959-3|MRE11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:188	ms_run[2]:scan=9313	54.687	2	1130.7006	1130.7006	K	G	165	175
PSM	IFTSIGEDYDER	1386	sp|P35232|PHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:267	ms_run[2]:scan=7111	42.153	2	1453.6601	1453.6601	R	V	106	118
PSM	ILDMCCAPGGK	1387	sp|P46087-3|NOP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:4,6-UNIMOD:4,11-UNIMOD:188	ms_run[2]:scan=4990	30.77	2	1226.5553	1226.5553	R	T	384	395
PSM	ILDVLEEIPK	1388	sp|Q16718-2|NDUA5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11550	68.358	2	1167.6751	1167.6751	K	N	31	41
PSM	ILLAELEQLK	1389	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11379	67.269	2	1168.7067	1168.7067	K	G	130	140
PSM	ILLAELEQLK	1390	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:188	ms_run[2]:scan=11385	67.308	2	1174.7269	1174.7269	K	G	130	140
PSM	ILPVLCGLTVDPEK	1391	sp|Q96KG9-5|SCYL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	6-UNIMOD:4	ms_run[2]:scan=11812	69.981	2	1552.8535	1552.8535	K	S	507	521
PSM	ILSVQGTEPLVLFK	1392	sp|Q9H8H0-2|NOL11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=12161	72.209	2	1542.9021	1542.9021	R	E	112	126
PSM	IMGIPEEEQMGLLR	1393	sp|P35579-2|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:35,10-UNIMOD:35,14-UNIMOD:267	ms_run[2]:scan=7750	45.666	2	1656.809	1656.8090	R	V	192	206
PSM	IQELEDLLAK	1394	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9833	57.797	2	1170.6496	1170.6496	R	E	321	331
PSM	IQELGDLYTPAPGR	1395	sp|Q9NWS0|PIHD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	14-UNIMOD:267	ms_run[2]:scan=7821	46.067	2	1538.7968	1538.7968	R	A	187	201
PSM	ISFLENNLEQLTK	1396	sp|O60282-2|KIF5C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:188	ms_run[2]:scan=11635	68.89	2	1553.8397	1553.8397	K	V	602	615
PSM	IVGPSGAAVPCK	1397	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:4	ms_run[2]:scan=3301	21.857	2	1154.6118	1154.6118	K	V	1008	1020
PSM	IVNQPSSLFGSK	1398	sp|Q7Z6Z7-2|HUWE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6498	38.861	2	1275.6823	1275.6823	R	S	2256	2268
PSM	IVPNVLLEQGK	1399	sp|O75390|CISY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:188	ms_run[2]:scan=7566	44.643	2	1214.733	1214.7330	K	A	383	394
PSM	IVPNVLLEQGK	1400	sp|O75390|CISY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7572	44.679	2	1208.7129	1208.7129	K	A	383	394
PSM	IYVISLAEPR	1401	sp|P14868-2|SYDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:267	ms_run[2]:scan=9303	54.633	2	1169.6684	1169.6684	K	L	42	52
PSM	KITIADCGQLE	1402	sp|P62937-2|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:188,7-UNIMOD:4	ms_run[2]:scan=5638	34.185	2	1252.6429	1252.6429	K	-	95	106
PSM	LANELPDWFQTAK	1403	sp|Q9UDY2-5|ZO2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:188	ms_run[2]:scan=11344	67.048	2	1537.7872	1537.7872	K	T	747	760
PSM	LDGNLLTQPGQAR	1404	sp|Q9BTW9-5|TBCD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:267	ms_run[2]:scan=5795	35.016	2	1391.7396	1391.7396	R	M	153	166
PSM	LDLIAQQMMPEVR	1405	sp|P36543-3|VATE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10877	64.152	2	1542.7898	1542.7898	R	G	170	183
PSM	LDPSIFESLQK	1406	sp|Q9Y265|RUVB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10309	60.664	2	1275.6711	1275.6711	K	E	172	183
PSM	LFQSNDQTLR	1407	sp|Q9UBF2-2|COPG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:267	ms_run[2]:scan=4361	27.518	2	1230.6232	1230.6232	R	R	76	86
PSM	LGEWDLPEAVQR	1408	sp|Q9BW92|SYTM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9634	56.593	2	1411.7096	1411.7096	R	L	691	703
PSM	LGLPPLTPEQQEALQK	1409	sp|Q9UHX1-4|PUF60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	16-UNIMOD:188	ms_run[2]:scan=9165	53.792	2	1766.9874	1766.9874	K	A	11	27
PSM	LGQDSLTPEQVAWR	1410	sp|Q86UU0-3|BCL9L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8430	49.5	2	1598.8053	1598.8053	R	K	508	522
PSM	LGSLVENNER	1411	sp|Q99613-2|EIF3C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:267	ms_run[2]:scan=2833	19.308	2	1139.581	1139.5810	K	V	853	863
PSM	LICCDILDVLDK	1412	sp|P62258|1433E_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	3-UNIMOD:4,4-UNIMOD:4	ms_run[2]:scan=12750	76.236	2	1475.7364	1475.7364	K	H	95	107
PSM	LIIAGTSAYAR	1413	sp|P34897-3|GLYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:267	ms_run[2]:scan=5885	35.528	2	1144.648	1144.6480	R	L	199	210
PSM	LIIAGTSAYAR	1414	sp|P34897-3|GLYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5886	35.532	2	1134.6397	1134.6397	R	L	199	210
PSM	LLASINSTVR	1415	sp|Q16531|DDB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:267	ms_run[2]:scan=5333	32.563	2	1082.6323	1082.6323	K	L	880	890
PSM	LLLSGTADGADLR	1416	sp|O75179-5|ANR17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7467	44.118	2	1300.6987	1300.6987	K	T	153	166
PSM	LLQSNPVLEAFGNAK	1417	sp|O00159-2|MYO1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	15-UNIMOD:188	ms_run[2]:scan=11143	65.806	2	1605.8822	1605.8822	R	T	139	154
PSM	LLQSNPVLEAFGNAK	1418	sp|O00159-2|MYO1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11327	66.94	2	1599.8621	1599.8621	R	T	139	154
PSM	LLVPTQYVGAIIGK	1419	sp|Q9NZI8|IF2B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	14-UNIMOD:188	ms_run[2]:scan=12418	73.852	2	1476.9011	1476.9011	R	E	200	214
PSM	LNDYIFSFDK	1420	sp|P54136-2|SYRC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:188	ms_run[2]:scan=10874	64.136	2	1266.6228	1266.6228	R	M	441	451
PSM	LQSPEFQSLFTEGLK	1421	sp|Q96Q11|TRNT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=12291	73.027	2	1722.8829	1722.8829	K	S	32	47
PSM	LQVWDTAGQER	1422	sp|P51153|RAB13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:267	ms_run[2]:scan=5923	35.742	2	1311.6447	1311.6447	K	F	59	70
PSM	LSLVLVPAQK	1423	sp|Q9H5V8|CDCP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:188	ms_run[2]:scan=8760	51.412	2	1072.6952	1072.6952	R	L	457	467
PSM	LVEALDLFER	1424	sp|O75127|PTCD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11766	69.693	2	1203.6499	1203.6499	K	Q	152	162
PSM	LVQAFQFTDK	1425	sp|Q06830|PRDX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:188	ms_run[2]:scan=7819	46.058	2	1201.6439	1201.6439	R	H	159	169
PSM	LYSLLSDPIPEVR	1426	sp|Q8N122|RPTOR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11746	69.574	2	1500.8188	1500.8188	K	C	604	617
PSM	MAAADSVQQR	1427	sp|Q8IYB3-2|SRRM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:35	ms_run[2]:scan=659	7.347	2	1091.503	1091.5030	K	R	471	481
PSM	MAAADSVQQR	1428	sp|Q8IYB3-2|SRRM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:35,10-UNIMOD:267	ms_run[2]:scan=661	7.3576	2	1101.5112	1101.5112	K	R	471	481
PSM	MDGIVPDIAVGTKR	1429	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:1	ms_run[2]:scan=10658	62.806	2	1512.797	1512.7970	-	G	1	15
PSM	MIDMLAANSGR	1430	sp|Q7L014|DDX46_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:35	ms_run[2]:scan=5004	30.843	2	1193.5533	1193.5533	R	V	506	517
PSM	MNYSDAIVWLK	1431	sp|O43776|SYNC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:35	ms_run[2]:scan=10640	62.699	2	1354.6591	1354.6591	R	E	391	402
PSM	MTISQQEFGR	1432	sp|P55036|PSMD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5336	32.577	2	1195.5656	1195.5656	K	T	263	273
PSM	NCAVEFNFGQR	1433	sp|Q9BUJ2-3|HNRL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:4	ms_run[2]:scan=7621	44.953	2	1340.5932	1340.5932	K	A	262	273
PSM	NCAVEFNFGQR	1434	sp|Q9BUJ2-3|HNRL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:4,11-UNIMOD:267	ms_run[2]:scan=7626	44.983	2	1350.6014	1350.6014	K	A	262	273
PSM	NFSGAELEGLVR	1435	sp|P46459-2|NSF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:267	ms_run[2]:scan=9758	57.343	2	1300.6651	1300.6651	K	A	341	353
PSM	NGGQILIADLR	1436	sp|P55735-2|SEC13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8616	50.573	2	1168.6564	1168.6564	R	G	30	41
PSM	NLATTVTEEILEK	1437	sp|O43390-4|HNRPR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=12370	73.537	2	1459.777	1459.7770	R	S	249	262
PSM	NLIDAGVDALR	1438	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:267	ms_run[2]:scan=9759	57.348	2	1165.6331	1165.6331	K	V	312	323
PSM	NLIDAGVDALR	1439	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9762	57.365	2	1155.6248	1155.6248	K	V	312	323
PSM	NLIDAGVDGLR	1440	sp|P20839-2|IMDH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8373	49.171	2	1141.6091	1141.6091	K	V	287	298
PSM	NLIDTLSTPLTGR	1441	sp|Q5TH69|BIG3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:267	ms_run[2]:scan=11371	67.218	2	1409.7754	1409.7754	K	M	871	884
PSM	NLLTAAADAIER	1442	sp|P33897|ABCD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:267	ms_run[2]:scan=11958	70.914	2	1266.6807	1266.6807	R	I	390	402
PSM	NLQDAMQVCR	1443	sp|P49368-2|TCPG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	9-UNIMOD:4	ms_run[2]:scan=5132	31.521	2	1233.5594	1233.5594	R	N	352	362
PSM	NPAVLSAASFDGR	1444	sp|O94979-5|SC31A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7194	42.603	2	1303.6521	1303.6521	R	I	315	328
PSM	NTLLIAGLQAR	1445	sp|P39656|OST48_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8750	51.353	2	1168.6928	1168.6928	K	N	240	251
PSM	NVCTEAGMFAIR	1446	sp|P62333|PRS10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	3-UNIMOD:4	ms_run[2]:scan=8709	51.116	2	1367.6326	1367.6326	R	A	345	357
PSM	NVGLCEAIVQFTR	1447	sp|P86791|CCZ1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=11829	70.091	2	1515.7743	1515.7743	R	T	61	74
PSM	QITVNDLPVGR	1448	sp|Q06830|PRDX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6943	41.216	2	1210.667	1210.6670	R	S	141	152
PSM	QMEQISQFLQAAER	1449	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11665	69.08	2	1677.8145	1677.8145	K	Y	89	103
PSM	QNINLSAPIMSR	1450	sp|Q14566|MCM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7665	45.193	2	1342.7027	1342.7027	K	F	518	530
PSM	QPAIISQLDPVNER	1451	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	14-UNIMOD:267	ms_run[2]:scan=8904	52.251	2	1588.8448	1588.8448	K	M	1117	1131
PSM	QTLMWSATWPK	1452	sp|P17844-2|DDX5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:188	ms_run[2]:scan=10812	63.754	2	1353.6847	1353.6847	R	E	195	206
PSM	QVLALELPEALCR	1453	sp|Q9HBH1|DEFM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=11947	70.844	2	1520.826	1520.8260	R	E	121	134
PSM	QVSDLISVLR	1454	sp|P17844-2|DDX5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:267	ms_run[2]:scan=10372	61.043	2	1138.6585	1138.6585	K	E	373	383
PSM	SEDLLDYGPFR	1455	sp|P04843|RPN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:267	ms_run[2]:scan=10965	64.697	2	1320.6225	1320.6226	R	D	194	205
PSM	SELPLDPLPVPTEEGNPLLK	1456	sp|Q15758-3|AAAT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=12716	75.967	2	2157.1569	2157.1569	K	H	275	295
PSM	SGFSLDNGELR	1457	sp|Q9UNZ2-4|NSF1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7186	42.558	2	1193.5677	1193.5677	K	S	158	169
PSM	SLEVWGSPEALAR	1458	sp|Q6PML9|ZNT9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9696	56.963	2	1413.7252	1413.7252	K	E	177	190
PSM	SLLVTELGSSR	1459	sp|P29218|IMPA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7817	46.049	2	1160.6401	1160.6401	K	T	157	168
PSM	SLTSWTNDQGAR	1460	sp|Q7Z2W4-3|ZCCHV_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5201	31.882	2	1334.6215	1334.6215	K	R	361	373
PSM	SPILVATAVAAR	1461	sp|O00571-2|DDX3X_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:267	ms_run[2]:scan=7214	42.708	2	1177.7058	1177.7058	K	G	476	488
PSM	SQAPGQPGASQWGSR	1462	sp|Q96EP5-2|DAZP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	15-UNIMOD:267	ms_run[2]:scan=2978	20.119	2	1522.7152	1522.7152	K	V	195	210
PSM	SSGLPNIPVQTISR	1463	sp|P02786|TFR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	14-UNIMOD:267	ms_run[2]:scan=8220	48.283	2	1477.8128	1477.8128	R	A	326	340
PSM	SVGNTIDPVILFQK	1464	sp|P46821|MAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	14-UNIMOD:188	ms_run[2]:scan=11457	67.768	2	1535.8655	1535.8655	R	M	401	415
PSM	SWEEQMIEVGR	1465	sp|Q00059-2|TFAM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9310	54.671	2	1362.6238	1362.6238	K	K	185	196
PSM	TDGEPGPQGWSPR	1466	sp|Q9H773|DCTP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4654	28.999	2	1382.6215	1382.6215	K	E	75	88
PSM	TIFAYFTGSK	1467	sp|Q9BRA2|TXD17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10720	63.186	2	1133.5757	1133.5757	K	D	26	36
PSM	TIIPLISQCTPK	1468	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	9-UNIMOD:4	ms_run[2]:scan=9152	53.717	2	1369.7639	1369.7639	K	V	204	216
PSM	TIIPLISQCTPK	1469	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	9-UNIMOD:4,12-UNIMOD:188	ms_run[2]:scan=9125	53.552	2	1375.7841	1375.7841	K	V	204	216
PSM	TIQFVDWCPTGFK	1470	sp|Q71U36-2|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	8-UNIMOD:4	ms_run[2]:scan=11827	70.079	2	1597.7599	1597.7599	R	V	305	318
PSM	TLDLPIYVTR	1471	sp|P53621|COPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10174	59.847	2	1189.6707	1189.6707	R	V	563	573
PSM	TLLLCGYPNVGK	1472	sp|Q9BZE4-3|NOG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:4	ms_run[2]:scan=8687	50.989	2	1333.7064	1333.7064	R	S	54	66
PSM	TLQVLLPDLAAK	1473	sp|Q13535-2|ATR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:188	ms_run[2]:scan=11197	66.133	2	1286.7905	1286.7905	R	A	930	942
PSM	TLVLLDNLNVR	1474	sp|P39656|OST48_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:267	ms_run[2]:scan=11118	65.653	2	1278.7535	1278.7535	R	E	47	58
PSM	TLVLLDNLNVR	1475	sp|P39656|OST48_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11124	65.692	2	1268.7452	1268.7452	R	E	47	58
PSM	TMLELLNQLDGFEATK	1476	sp|P62195-2|PRS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:35,16-UNIMOD:188	ms_run[2]:scan=12328	73.255	2	1843.9333	1843.9333	R	N	264	280
PSM	TPESIVPIAPELQPSTSR	1477	sp|Q14676-2|MDC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	18-UNIMOD:267	ms_run[2]:scan=9684	56.887	2	1931.0239	1931.0239	K	N	1303	1321
PSM	TPVLFDIYEIK	1478	sp|P50995-2|ANX11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=12559	74.852	2	1336.7279	1336.7279	K	E	239	250
PSM	TSESTGSLPSPFLR	1479	sp|O95456-2|PSMG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	14-UNIMOD:267	ms_run[2]:scan=8556	50.238	2	1487.7495	1487.7495	K	A	156	170
PSM	TVDNFVALATGEK	1480	sp|P23284|PPIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9662	56.757	2	1363.6983	1363.6983	K	G	72	85
PSM	TVQSLEIDLDSMR	1481	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:35,13-UNIMOD:267	ms_run[2]:scan=8216	48.255	2	1531.7427	1531.7427	R	N	302	315
PSM	VAGQDGSVVQFK	1482	sp|P55854|SUMO3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4634	28.904	2	1233.6354	1233.6354	K	I	21	33
PSM	VFFIQACQGDNYQK	1483	sp|Q14790-3|CASP8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	7-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=8134	47.794	2	1722.8131	1722.8131	K	G	270	284
PSM	VFNVFCLYGNVEK	1484	sp|P14866|HNRPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	6-UNIMOD:4	ms_run[2]:scan=12631	75.369	2	1587.7755	1587.7756	R	V	399	412
PSM	VGDYGSLSGR	1485	sp|Q9UBR2|CATZ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:267	ms_run[2]:scan=2901	19.685	2	1019.4911	1019.4911	R	E	190	200
PSM	VIGSGCNLDSAR	1486	sp|P00338-5|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	6-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=2906	19.716	2	1257.6011	1257.6011	R	F	158	170
PSM	VLANPGNSQVAR	1487	sp|Q14974|IMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:267	ms_run[2]:scan=1844	13.933	2	1234.6658	1234.6658	R	V	43	55
PSM	VLEQLTGQTPVFSK	1488	sp|P62913-2|RL11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8444	49.588	2	1545.8403	1545.8403	K	A	38	52
PSM	VLGIVVQNTK	1489	sp|Q9Y653-5|AGRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5682	34.397	2	1069.6495	1069.6495	K	V	137	147
PSM	VLLMELEEAR	1490	sp|P12270-2|TPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9959	58.553	2	1201.6377	1201.6377	R	G	502	512
PSM	VNILEVASGAVLR	1491	sp|Q12788|TBL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:267	ms_run[2]:scan=12699	75.853	2	1349.7906	1349.7906	R	S	47	60
PSM	VNPVTALTLLEK	1492	sp|Q9Y2D4|EXC6B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:188	ms_run[2]:scan=12065	71.603	2	1302.7854	1302.7854	R	M	759	771
PSM	VPVSAPSSSDPWTGR	1493	sp|P22681|CBL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6142	36.86	2	1541.7474	1541.7474	K	E	598	613
PSM	VQELQQGAFGR	1494	sp|Q8TDD1|DDX54_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:267	ms_run[2]:scan=4488	28.171	2	1241.6392	1241.6392	R	G	858	869
PSM	VQQTVQDLFGR	1495	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:267	ms_run[2]:scan=7925	46.617	2	1299.6811	1299.6811	K	A	395	406
PSM	VTVNPGLLVPLDVK	1496	sp|Q6KB66-2|K2C80_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11622	68.812	2	1462.8759	1462.8759	K	L	58	72
PSM	VVGAVIDQGLITR	1497	sp|E9PRG8|CK098_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8139	47.827	2	1339.7823	1339.7823	R	H	36	49
PSM	VVTDLISLIR	1498	sp|P38432|COIL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:267	ms_run[2]:scan=12198	72.442	2	1137.6997	1137.6997	R	Q	37	47
PSM	YDGLVGMFDPK	1499	sp|P12081-3|HARS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:188	ms_run[2]:scan=10866	64.086	2	1246.5999	1246.5999	R	G	303	314
PSM	YDGLVGMFDPK	1500	sp|P12081-3|HARS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10882	64.185	2	1240.5798	1240.5798	R	G	303	314
PSM	YLGQDYEQLR	1501	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6386	38.238	2	1283.6146	1283.6146	K	V	37	47
PSM	YVDIAIPCNNK	1502	sp|P08865|RSSA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	8-UNIMOD:4	ms_run[2]:scan=6478	38.751	2	1305.6387	1305.6387	R	G	156	167
PSM	YWEAFLPEAK	1503	sp|Q13596-2|SNX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10767	63.477	2	1252.6128	1252.6128	K	A	445	455
PSM	YWLCAATGPSIK	1504	sp|P63244|RACK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	4-UNIMOD:4,12-UNIMOD:188	ms_run[2]:scan=8714	51.146	2	1371.6952	1371.6952	R	I	246	258
PSM	QFASQANVVGPWIQTK	1505	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28,16-UNIMOD:188	ms_run[1]:scan=11619	68.79504	2	1761.9199	1761.9140	R	M	653	669
PSM	VEIIANDQGNR	1506	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	11-UNIMOD:267	ms_run[1]:scan=2779	19.039201666666667	2	1237.632519	1237.629033	R	I	50	61
PSM	QMADTGKLNTLLQR	1507	sp|Q00839|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	7-UNIMOD:188,14-UNIMOD:267	ms_run[1]:scan=7599	44.826418333333336	2	1604.855419	1603.868674	K	A	545	559
PSM	QMADTGKLNTLLQR	1508	sp|Q00839|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28,2-UNIMOD:35,7-UNIMOD:188,14-UNIMOD:267	ms_run[1]:scan=7627	44.987186666666666	2	1602.8375	1602.8365	K	A	545	559
PSM	SIQLDGLVWGASK	1509	sp|P29692|EF1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	13-UNIMOD:188	ms_run[1]:scan=11191	66.096075	2	1379.7772	1378.7542	R	L	220	233
PSM	IMGIPEEEQMGLLR	1510	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	10-UNIMOD:35,14-UNIMOD:267	ms_run[1]:scan=9527	55.950161666666666	2	1640.819153	1640.814133	R	V	328	342
PSM	QQEGFKGTFPDAR	1511	sp|Q15233|NONO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28	ms_run[1]:scan=6305	37.789876666666665	2	1462.6863	1462.6836	R	E	366	379
PSM	EFSPFGSITSAK	1512	sp|Q13310|PABP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=9306	54.64656333333333	2	1269.625419	1269.624118	K	V	313	325
PSM	GFVLQDTVEQLR	1513	sp|P56192|SYMC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	12-UNIMOD:267	ms_run[1]:scan=10478	61.697425	2	1413.746702	1413.749148	R	C	377	389
PSM	AQLFALTGVQPAR	1514	sp|P54578|UBP14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	13-UNIMOD:267	ms_run[1]:scan=9516	55.886466666666664	2	1380.777071	1380.775303	K	Q	31	44
PSM	AMGIMNSFVNDIFER	1515	sp|P33778|H2B1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	2-UNIMOD:35,5-UNIMOD:35	ms_run[1]:scan=11579	68.54001166666667	2	1775.789955	1774.801842	K	I	59	74
PSM	ILLLGAGESGK	1516	sp|Q03113|GNA12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	11-UNIMOD:188	ms_run[1]:scan=7493	44.25503	2	1062.637260	1062.638039	K	S	60	71
PSM	QLMHQLPIYDQDPSR	1517	sp|Q9NZU5|LMCD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28	ms_run[1]:scan=9861	57.968756666666664	2	1822.8772	1822.8662	R	C	156	171
PSM	ILDILGETCK	1518	sp|Q15424|SAFB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	9-UNIMOD:4,10-UNIMOD:188	ms_run[1]:scan=8797	51.622725	2	1167.612273	1166.631240	K	S	217	227
PSM	QAQNPDQGPKLDLGFK	1519	sp|Q9NVZ3|NECP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28,10-UNIMOD:188,16-UNIMOD:188	ms_run[1]:scan=8649	50.75805	2	1749.9149	1749.9083	K	E	138	154
PSM	QADFEAHNILR	1520	sp|P49915|GUAA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28,11-UNIMOD:267	ms_run[1]:scan=7789	45.894890000000004	2	1305.6366	1305.6336	R	E	590	601
PSM	LLPQLTYLDGYDR	1521	sp|P39687|AN32A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=11372	67.223495	2	1565.809552	1565.808959	K	D	138	151
PSM	QGDTGDWIGTFLGHK	1522	sp|Q9Y3F4|STRAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28	ms_run[1]:scan=12942	77.79790833333334	2	1613.7521	1613.7469	R	G	45	60
PSM	QGHIVAISSIQGK	1523	sp|Q6IAN0|DRS7B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28,13-UNIMOD:188	ms_run[1]:scan=6468	38.69567833333333	2	1325.7385	1325.7394	R	M	186	199
PSM	VPQVSTPTLVEVSR	1524	sp|P02768|ALBU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=7647	45.09119333333334	2	1510.838350	1510.835508	K	N	439	453
PSM	QLSGNNIRPVVK	1525	sp|Q9NZM1-8|MYOF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28	ms_run[1]:scan=5611	34.05504333333334	2	1306.7367	1306.7352	R	V	192	204
PSM	GVGGAVPGAVLEPVAR	1526	sp|Q9Y446|PKP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=7645	45.081205	2	1447.815301	1447.814713	R	A	262	278
PSM	IYVGNLPPDIR	1527	sp|Q07955|SRSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=8022	47.150551666666665	2	1255.691464	1255.692472	R	T	18	29
PSM	CVGGVVHSFDGTK	1528	sp|Q6P1N9|TATD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=8320	48.858445	2	1344.6143	1344.6127	R	E	168	181
PSM	AVVGVVAGGGR	1529	sp|P62917|RL8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=2550	17.741041666666664	2	940.536709	940.545414	R	I	164	175
PSM	AGLNSLEAVKR	1530	sp|P67936|TPM4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:1,10-UNIMOD:188,11-UNIMOD:267	ms_run[1]:scan=6717	40.037706666666665	2	1214.6943	1214.6949	M	K	2	13
PSM	QQHVIETLIGK	1531	sp|P48643|TCPE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28,11-UNIMOD:188	ms_run[1]:scan=9679	56.86114666666667	2	1253.7082	1253.7070	K	K	503	514
PSM	CIESLIAVFQK	1532	sp|P31949|S10AB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:4,11-UNIMOD:188	ms_run[1]:scan=12394	73.691455	2	1312.705380	1312.715638	R	Y	13	24
PSM	LLLCGGAPLSATTQR	1533	sp|O95573|ACSL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:4,15-UNIMOD:267	ms_run[1]:scan=7917	46.57481166666666	2	1566.844481	1566.842731	R	F	447	462
PSM	LLSCSADGTLR	1534	sp|O43815|STRN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:4	ms_run[1]:scan=4329	27.339868333333335	2	1193.592625	1191.591772	R	L	584	595
PSM	QFDIQLLTHNDPK	1535	sp|P48507|GSH0_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28,13-UNIMOD:188	ms_run[1]:scan=11413	67.48010833333333	2	1556.7931	1556.7925	K	E	206	219
PSM	TVQDALESLVAR	1536	sp|Q14694|UBP10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	12-UNIMOD:267	ms_run[1]:scan=11140	65.78912166666667	2	1310.704035	1310.706949	R	E	642	654
PSM	LALLQEQWAGGK	1537	sp|Q9HD15|SRA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=9393	55.161048333333326	2	1313.741015	1312.713936	R	L	141	153
PSM	VNPVTALTLLEK	1538	sp|Q9Y2D4|EXC6B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	12-UNIMOD:188	ms_run[1]:scan=11998	71.17913833333333	2	1302.784634	1302.785432	R	M	759	771
PSM	GSLLFTAGPLEEER	1539	sp|P53004|BIEA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	14-UNIMOD:267	ms_run[1]:scan=10657	62.801291666666664	2	1527.778246	1527.780842	K	F	148	162
PSM	AAEWQLDQPSWSGR	1540	sp|Q9NVZ3-3|NECP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8879	52.103	2	1629.7536	1629.7536	R	L	32	46
PSM	AAQPPAQPCQLCGR	1541	sp|Q96B54|ZN428_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	9-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=3113	20.858	2	1552.7239	1552.7239	R	S	85	99
PSM	ACANPAAGSVILLENLR	1542	sp|P00558|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=11954	70.891	3	1777.9384	1777.9384	K	F	107	124
PSM	ADFQGISPER	1543	sp|P61803|DAD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4620	28.838	2	1118.5356	1118.5356	K	A	83	93
PSM	AEDPPWFEGLESR	1544	sp|O76075-2|DFFB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10984	64.815	2	1531.6943	1531.6943	R	F	136	149
PSM	AFAETYPAASSLPNGDCGRPR	1545	sp|P30520|PURA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:1,17-UNIMOD:4	ms_run[2]:scan=8424	49.462	2	2278.0437	2278.0437	M	A	2	23
PSM	AFITNIPFDVK	1546	sp|P52272-2|HNRPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11286	66.685	2	1263.6863	1263.6863	R	W	73	84
PSM	AFITNIPFDVK	1547	sp|P52272-2|HNRPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:188	ms_run[2]:scan=11288	66.696	2	1269.7065	1269.7065	R	W	73	84
PSM	AFSPTTVNTGR	1548	sp|P61619-3|S61A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:267	ms_run[2]:scan=3389	22.312	2	1159.5861	1159.5861	K	G	75	86
PSM	AGFAGDDAPR	1549	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:267	ms_run[2]:scan=1878	14.169	2	985.44928	985.4493	K	A	19	29
PSM	AGFAGDDAPR	1550	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:267	ms_run[2]:scan=2049	15.198	2	985.44928	985.4493	K	A	19	29
PSM	AGNLGGGVVTIER	1551	sp|P35268|RL22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5753	34.774	2	1241.6728	1241.6728	K	S	53	66
PSM	ALEIADFSGNPLSR	1552	sp|Q14160-2|SCRIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10614	62.538	2	1488.7573	1488.7573	K	L	25	39
PSM	APASVLPAATPR	1553	sp|P13861-2|KAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:267	ms_run[2]:scan=4648	28.974	2	1159.6589	1159.6589	R	Q	45	57
PSM	AQNIMESFENPFR	1554	sp|Q01780|EXOSX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:267	ms_run[2]:scan=11962	70.944	2	1591.7328	1591.7328	K	M	681	694
PSM	ASGQAFELILSPR	1555	sp|P16949|STMN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:267	ms_run[2]:scan=10763	63.45	2	1397.7542	1397.7542	R	S	15	28
PSM	AVSTGVKVPR	1556	sp|Q15819|UB2V2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:1	ms_run[2]:scan=4345	27.428	2	1054.6135	1054.6135	M	N	2	12
PSM	CDENILWLDYK	1557	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:4,11-UNIMOD:188	ms_run[2]:scan=11142	65.8	2	1473.6905	1473.6905	K	N	152	163
PSM	CGVPFTDLLDAAK	1558	sp|Q01433-3|AMPD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:4	ms_run[2]:scan=11900	70.541	2	1405.6912	1405.6912	K	S	111	124
PSM	CLIATGGTPR	1559	sp|O95831-3|AIFM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:4	ms_run[2]:scan=3423	22.479	2	1044.5386	1044.5386	K	S	252	262
PSM	CMQLTDFILK	1560	sp|P50914|RL14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:4,2-UNIMOD:35	ms_run[2]:scan=10167	59.805	2	1283.6254	1283.6254	K	F	54	64
PSM	CNTLITLIER	1561	sp|O60264|SMCA5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:4	ms_run[2]:scan=10851	63.991	2	1231.6595	1231.6595	R	E	1001	1011
PSM	CSGDGVGAPR	1562	sp|O15355|PPM1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:4,10-UNIMOD:267	ms_run[2]:scan=821	8.2844	2	984.43225	984.4322	K	L	13	23
PSM	CTPACISFGPK	1563	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:4,5-UNIMOD:4	ms_run[2]:scan=5940	35.83	2	1236.5631	1236.5631	R	N	34	45
PSM	DGPNALTPPPTTPEWIK	1564	sp|P05023-3|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	17-UNIMOD:188	ms_run[2]:scan=9760	57.353	2	1838.951	1838.9510	R	F	44	61
PSM	DITIHANPFAQ	1565	sp|Q9H2H8|PPIL3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8769	51.462	2	1225.6091	1225.6091	K	-	151	162
PSM	DPENFPFVVLGNK	1566	sp|P51149|RAB7A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:188	ms_run[2]:scan=11800	69.908	2	1480.7658	1480.7658	R	I	114	127
PSM	EAGGGGVGGPGAK	1567	sp|Q8NC51-4|PAIRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=630	7.1792	2	1012.4938	1012.4938	K	S	40	53
PSM	EDGLAQQQTQLNLR	1568	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	14-UNIMOD:267	ms_run[2]:scan=5918	35.711	2	1622.8252	1622.8252	K	S	2207	2221
PSM	EGAFSNFPISEETIK	1569	sp|Q9NR30-2|DDX21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10149	59.7	2	1667.8043	1667.8043	K	L	117	132
PSM	ELPPDQAEYCIAR	1570	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=5869	35.436	2	1570.7325	1570.7325	R	M	870	883
PSM	EQEAGLLQFLR	1571	sp|Q9NZL4-3|HPBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=12224	72.607	2	1302.6932	1302.6932	R	L	261	272
PSM	FADIVSILDK	1572	sp|P29317|EPHA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11694	69.257	2	1119.6176	1119.6176	K	L	864	874
PSM	FASENDLPEWK	1573	sp|P43487-2|RANG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7853	46.252	2	1334.6143	1334.6143	R	E	58	69
PSM	FEELCSDLFR	1574	sp|P0DMV8-2|HS71A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	5-UNIMOD:4,10-UNIMOD:267	ms_run[2]:scan=10211	60.069	2	1324.5997	1324.5997	R	S	247	257
PSM	FEELNADLFR	1575	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10293	60.564	2	1252.6088	1252.6088	R	G	302	312
PSM	FEINLISPDTK	1576	sp|O60343-2|TBCD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:188	ms_run[2]:scan=9960	58.559	2	1281.6912	1281.6912	R	S	364	375
PSM	FFTDDLFQYAGEK	1577	sp|Q6NYC1-2|JMJD6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:188	ms_run[2]:scan=12114	71.909	2	1585.7396	1585.7396	K	R	155	168
PSM	FNQVLDQFGEK	1578	sp|O43242|PSMD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:188	ms_run[2]:scan=7629	44.996	2	1329.666	1329.6660	K	F	375	386
PSM	FQPQSPDFLDITNPK	1579	sp|Q92890-3|UFD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	15-UNIMOD:188	ms_run[2]:scan=10406	61.253	2	1751.8826	1751.8826	K	A	125	140
PSM	FSGLPSNDEPILSFSPK	1580	sp|O00443|P3C2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	17-UNIMOD:188	ms_run[2]:scan=11292	66.717	2	1839.935	1839.9350	R	T	1398	1415
PSM	FSGLPSNDEPILSFSPK	1581	sp|O00443|P3C2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11297	66.753	2	1833.9149	1833.9149	R	T	1398	1415
PSM	FSYMAIIEGAK	1582	sp|P17706-2|PTN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11277	66.63	2	1228.6162	1228.6162	R	C	267	278
PSM	GCGTVLLSGPR	1583	sp|Q07020-2|RL18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:4,11-UNIMOD:267	ms_run[2]:scan=4936	30.469	2	1125.584	1125.5840	K	K	104	115
PSM	GCGTVLLSGPR	1584	sp|Q07020-2|RL18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:4	ms_run[2]:scan=4947	30.528	2	1115.5757	1115.5757	K	K	104	115
PSM	GFAFVTFESPADAK	1585	sp|P38159-3|RBMX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11041	65.172	2	1485.714	1485.7140	R	D	50	64
PSM	GGLPLDGITELAGR	1586	sp|O43542|XRCC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	14-UNIMOD:267	ms_run[2]:scan=11149	65.844	2	1377.7491	1377.7491	R	S	95	109
PSM	GIDPFSLDALSK	1587	sp|P40227-2|TCPZ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11542	68.307	2	1261.6554	1261.6554	K	E	251	263
PSM	GIGTDEFTLNR	1588	sp|P12429|ANXA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:267	ms_run[2]:scan=7213	42.704	2	1231.6072	1231.6072	K	I	264	275
PSM	GIGTDEFTLNR	1589	sp|P12429|ANXA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7217	42.721	2	1221.599	1221.5990	K	I	264	275
PSM	GILEQGWQADSTTR	1590	sp|Q99627-2|CSN8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7313	43.267	2	1560.7532	1560.7532	K	M	98	112
PSM	GISQEQMQEFR	1591	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:267	ms_run[2]:scan=5533	33.633	2	1361.6273	1361.6273	K	A	761	772
PSM	GISQEQMQEFR	1592	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5548	33.715	2	1351.619	1351.6190	K	A	761	772
PSM	GLAGLGDVAEVR	1593	sp|P11216|PYGB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:267	ms_run[2]:scan=7765	45.751	2	1165.6331	1165.6331	R	K	18	30
PSM	GLDPVEILQER	1594	sp|P51532-5|SMCA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10492	61.779	2	1267.6772	1267.6772	R	E	360	371
PSM	GLGLDDALEPR	1595	sp|Q9Y230|RUVB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:267	ms_run[2]:scan=7928	46.631	2	1164.6014	1164.6014	R	Q	30	41
PSM	GMAAAGNYAWVNR	1596	sp|Q9Y3I0|RTCB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:267	ms_run[2]:scan=6762	40.271	2	1389.6487	1389.6487	K	S	309	322
PSM	GPFTDVVTTNLK	1597	sp|O95292-2|VAPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:188	ms_run[2]:scan=8548	50.191	2	1296.7021	1296.7021	R	L	20	32
PSM	GPLLEEQALTK	1598	sp|Q52LJ0-1|FA98B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6472	38.717	2	1197.6605	1197.6605	K	A	27	38
PSM	GPSGLLVYQGK	1599	sp|P00387-2|NB5R3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6053	36.392	2	1117.6132	1117.6132	R	G	121	132
PSM	GSLGQGTAPVLPGK	1600	sp|Q13428-5|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	14-UNIMOD:188	ms_run[2]:scan=5097	31.336	2	1286.729	1286.7290	K	T	733	747
PSM	GVEICIATPGR	1601	sp|P17844-2|DDX5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	5-UNIMOD:4	ms_run[2]:scan=6642	39.633	2	1171.6019	1171.6019	R	L	138	149
PSM	IADQFLGAMYTLPR	1602	sp|O60341|KDM1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11946	70.838	2	1594.8177	1594.8177	R	Q	825	839
PSM	IAEFAFEYAR	1603	sp|P50213|IDH3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9409	55.259	2	1215.5924	1215.5924	R	N	179	189
PSM	IAEFAFEYAR	1604	sp|P50213|IDH3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:267	ms_run[2]:scan=9412	55.274	2	1225.6007	1225.6007	R	N	179	189
PSM	IAVEPVNPSELPK	1605	sp|Q15029-2|U5S1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7525	44.414	2	1391.766	1391.7660	K	M	555	568
PSM	ICALENELAALR	1606	sp|Q15390-2|MTFR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=10905	64.322	2	1381.7263	1381.7263	K	A	111	123
PSM	ICDDELILIK	1607	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:4,10-UNIMOD:188	ms_run[2]:scan=9717	57.091	2	1236.6731	1236.6731	R	N	356	366
PSM	ICDDELILIK	1608	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:4	ms_run[2]:scan=9725	57.138	2	1230.653	1230.6530	R	N	356	366
PSM	IDGVSLLVQR	1609	sp|Q6DKI1-2|RL7L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:267	ms_run[2]:scan=8467	49.725	2	1108.648	1108.6480	R	T	105	115
PSM	IDISPVLLQK	1610	sp|P49959-3|MRE11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9311	54.676	2	1124.6805	1124.6805	K	G	165	175
PSM	IFAQDGEGQR	1611	sp|O75369-6|FLNB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:267	ms_run[2]:scan=1725	13.276	2	1129.5392	1129.5392	K	I	682	692
PSM	ILEQSGEWWK	1612	sp|P06239-2|LCK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8843	51.89	2	1274.6295	1274.6295	R	A	90	100
PSM	ILVLQNELER	1613	sp|Q9P2Y5|UVRAG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8421	49.446	2	1225.703	1225.7030	K	Q	244	254
PSM	IMNVIGEPIDER	1614	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:267	ms_run[2]:scan=7852	46.247	2	1394.7103	1394.7103	R	G	144	156
PSM	INFDDNAEFR	1615	sp|Q96I99|SUCB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6988	41.47	2	1239.552	1239.5520	K	Q	260	270
PSM	INFDDNAEFR	1616	sp|Q96I99|SUCB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7005	41.566	2	1239.552	1239.5520	K	Q	260	270
PSM	IPNQFQSDPPAPSDK	1617	sp|Q9NRV9|HEBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	15-UNIMOD:188	ms_run[2]:scan=4328	27.334	2	1645.8043	1645.8043	R	S	104	119
PSM	IQELEDLLAK	1618	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:188	ms_run[2]:scan=9818	57.705	2	1176.6697	1176.6697	R	E	321	331
PSM	IQNLEALLQK	1619	sp|Q15075|EEA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:188	ms_run[2]:scan=9519	55.902	2	1174.7017	1174.7017	K	S	525	535
PSM	IQPSGGTNINEALLR	1620	sp|P19823|ITIH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7201	42.636	2	1581.8475	1581.8475	K	A	380	395
PSM	IQTQPGYANTLR	1621	sp|Q00325-2|MPCP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:267	ms_run[2]:scan=4212	26.718	2	1370.7182	1370.7182	R	D	189	201
PSM	ISFSNIISDMK	1622	sp|Q92665|RT31_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11934	70.763	2	1253.6326	1253.6326	K	V	199	210
PSM	ITQDIFQQLLK	1623	sp|P56192-2|SYMC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=12357	73.453	2	1345.7606	1345.7606	K	R	365	376
PSM	IVAFENAFER	1624	sp|O60763|USO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8905	52.257	2	1194.6033	1194.6033	K	L	203	213
PSM	IVGPSGAAVPCK	1625	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:4,12-UNIMOD:188	ms_run[2]:scan=3282	21.758	2	1160.6319	1160.6319	K	V	1008	1020
PSM	IVLTNPVCTEVGEK	1626	sp|P41091|IF2G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	8-UNIMOD:4	ms_run[2]:scan=7440	43.972	2	1557.8072	1557.8072	K	I	427	441
PSM	IYAPQGLLLTDPIER	1627	sp|Q7Z5G4-3|GOGA7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11560	68.422	2	1697.9352	1697.9352	K	G	104	119
PSM	KITIADCGQLE	1628	sp|P62937-2|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	7-UNIMOD:4	ms_run[2]:scan=5639	34.189	2	1246.6227	1246.6227	K	-	95	106
PSM	KSGGATIEELTEF	1629	sp|P18583-6|SON_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:188	ms_run[2]:scan=10160	59.762	2	1386.6974	1386.6974	K	-	2096	2109
PSM	LAPEVMEDLVK	1630	sp|P62760|VISL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9738	57.216	2	1242.653	1242.6530	K	S	8	19
PSM	LEPVIMELER	1631	sp|P16118-2|F261_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:267	ms_run[2]:scan=10417	61.319	2	1237.6616	1237.6616	R	Q	310	320
PSM	LFGETDYDAFQR	1632	sp|Q99633|PRP18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:267	ms_run[2]:scan=9014	52.873	2	1470.6655	1470.6655	R	L	97	109
PSM	LFQSNDQTLR	1633	sp|Q9UBF2-2|COPG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4362	27.522	2	1220.6149	1220.6149	R	R	76	86
PSM	LGLENAEALIR	1634	sp|P10155-2|RO60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10236	60.225	2	1197.6717	1197.6717	K	L	53	64
PSM	LGVLEADSAIR	1635	sp|Q9H3H3-1|CK068_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:267	ms_run[2]:scan=7033	41.726	2	1152.6378	1152.6378	R	A	183	194
PSM	LIADVAPSAIR	1636	sp|P39748|FEN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:267	ms_run[2]:scan=6628	39.563	2	1134.6636	1134.6636	K	E	9	20
PSM	LIDPQTQVTR	1637	sp|Q9UKG1|DP13A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:267	ms_run[2]:scan=4012	25.655	2	1179.6487	1179.6487	K	L	554	564
PSM	LITTQQWLIK	1638	sp|P00846|ATP6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9804	57.622	2	1242.7336	1242.7336	R	L	42	52
PSM	LITTQQWLIK	1639	sp|P00846|ATP6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:188	ms_run[2]:scan=9805	57.628	2	1248.7537	1248.7537	R	L	42	52
PSM	LIVDPALDPALR	1640	sp|O15047|SET1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9858	57.952	2	1291.75	1291.7500	K	R	22	34
PSM	LLFEGAGSNPGDK	1641	sp|P61421|VA0D1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:188	ms_run[2]:scan=6017	36.21	2	1309.661	1309.6610	K	T	276	289
PSM	LLFNDVQTLK	1642	sp|Q15149|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9319	54.722	2	1189.6707	1189.6707	R	D	588	598
PSM	LLGGFQETCSK	1643	sp|Q9BVP2-2|GNL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	9-UNIMOD:4	ms_run[2]:scan=5297	32.386	2	1238.5965	1238.5965	K	A	231	242
PSM	LLPQLTYLDGYDR	1644	sp|P39687|AN32A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11383	67.291	2	1565.809	1565.8090	K	D	138	151
PSM	LLSCSADGTLR	1645	sp|O43815-2|STRN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	4-UNIMOD:4,11-UNIMOD:267	ms_run[2]:scan=4352	27.469	2	1201.6	1201.6000	R	L	535	546
PSM	LNDYIFSFDK	1646	sp|P54136-2|SYRC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10878	64.157	2	1260.6027	1260.6027	R	M	441	451
PSM	LNNCGMGIGGGK	1647	sp|P46060|RAGP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	4-UNIMOD:4,12-UNIMOD:188	ms_run[2]:scan=2622	18.122	2	1182.5581	1182.5581	K	I	149	161
PSM	LNVGAPDVTLR	1648	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:267	ms_run[2]:scan=7088	42.036	2	1163.6538	1163.6538	K	G	5356	5367
PSM	LPSDVVTAVR	1649	sp|P04181|OAT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5623	34.111	2	1055.5975	1055.5975	K	G	363	373
PSM	LQLWDTAGQER	1650	sp|P20340-2|RAB6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7118	42.187	2	1315.6521	1315.6521	R	F	64	75
PSM	LQLWDTAGQER	1651	sp|P20340-2|RAB6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7636	45.035	2	1315.6521	1315.6521	R	F	64	75
PSM	LSKECVGPPDPDLEPGETS	1652	sp|Q4V328-4|GRAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	5-UNIMOD:4	ms_run[2]:scan=6226	37.338	2	2025.9201	2025.9201	R	-	792	811
PSM	LTLSALLDGK	1653	sp|P21796|VDAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11137	65.768	2	1029.607	1029.6070	K	N	257	267
PSM	LVIDQIDNGFFSPK	1654	sp|P06737-2|PYGL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	14-UNIMOD:188	ms_run[2]:scan=11817	70.016	2	1597.8447	1597.8447	K	Q	707	721
PSM	LWDLTTGTTTR	1655	sp|P63244|RACK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7907	46.527	2	1263.6459	1263.6459	R	R	89	100
PSM	MISDAIPELK	1656	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:35	ms_run[2]:scan=7383	43.671	2	1131.5846	1131.5846	K	A	315	325
PSM	MLEENTNILK	1657	sp|Q9NYL9|TMOD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:35,10-UNIMOD:188	ms_run[2]:scan=5072	31.201	2	1225.632	1225.6320	K	F	308	318
PSM	MLEENTNILK	1658	sp|Q9NYL9|TMOD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:35	ms_run[2]:scan=5075	31.216	2	1219.6118	1219.6118	K	F	308	318
PSM	MMGLEVLGEK	1659	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:35,10-UNIMOD:188	ms_run[2]:scan=7818	46.054	2	1127.5662	1127.5662	R	K	701	711
PSM	MNYSDAIVWLK	1660	sp|O43776|SYNC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:35,11-UNIMOD:188	ms_run[2]:scan=10630	62.638	2	1360.6793	1360.6793	R	E	391	402
PSM	MTISQQEFGR	1661	sp|P55036|PSMD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:267	ms_run[2]:scan=5335	32.572	2	1205.5738	1205.5738	K	T	263	273
PSM	NFGIGQDIQPK	1662	sp|P62424|RL7A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6370	38.153	2	1215.6248	1215.6248	K	R	38	49
PSM	NFIAQGPYENR	1663	sp|P21281|VATB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:267	ms_run[2]:scan=5346	32.629	2	1317.6341	1317.6341	R	T	461	472
PSM	NFSDNQLQEGK	1664	sp|P37802|TAGL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3070	20.639	2	1278.584	1278.5840	R	N	161	172
PSM	NICFTVWDVGGQDR	1665	sp|P18085|ARF4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=11307	66.816	2	1675.7652	1675.7652	K	I	60	74
PSM	NLIDAGVDGLR	1666	sp|P20839-2|IMDH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:267	ms_run[2]:scan=8372	49.167	2	1151.6174	1151.6174	K	V	287	298
PSM	NLVCTDLFTR	1667	sp|P26196|DDX6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	4-UNIMOD:4	ms_run[2]:scan=9337	54.824	2	1237.6125	1237.6125	R	G	387	397
PSM	NVIVLQTVLQEVR	1668	sp|Q9Y2L1|RRP44_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=12739	76.16	2	1509.8879	1509.8879	R	N	87	100
PSM	NVVLDALQLPK	1669	sp|Q96ME1-3|FXL18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10912	64.367	2	1208.7129	1208.7129	R	S	289	300
PSM	NWSQCVELAR	1670	sp|A0AVT1-2|UBA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	5-UNIMOD:4	ms_run[2]:scan=6700	39.94	2	1261.5874	1261.5874	R	L	221	231
PSM	NYPATFWVNPQFK	1671	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11248	66.445	2	1610.7882	1610.7882	R	I	386	399
PSM	QGATGFGQGNIR	1672	sp|Q96IR7|HPDL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3157	21.085	2	1204.5949	1204.5949	R	A	344	356
PSM	QITVNDLPVGR	1673	sp|Q06830|PRDX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:267	ms_run[2]:scan=6942	41.212	2	1220.6753	1220.6753	R	S	141	152
PSM	QVSDLISVLR	1674	sp|P17844-2|DDX5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10375	61.059	2	1128.6503	1128.6503	K	E	373	383
PSM	QWNNCAFLESSAK	1675	sp|P61224-2|RAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	5-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=7600	44.831	2	1559.7134	1559.7134	R	S	90	103
PSM	QWNNCAFLESSAK	1676	sp|P61224-2|RAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	5-UNIMOD:4	ms_run[2]:scan=7603	44.847	2	1553.6933	1553.6933	R	S	90	103
PSM	SAGLAFSLYQAMAK	1677	sp|P50454|SERPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	14-UNIMOD:188	ms_run[2]:scan=12254	72.797	2	1462.7586	1462.7586	R	D	47	61
PSM	SCDGNQELLNFLR	1678	sp|Q9UIG0-2|BAZ1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=11691	69.24	2	1574.7387	1574.7387	K	S	1040	1053
PSM	SDSAFFWEER	1679	sp|O75116|ROCK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10053	59.119	2	1272.5411	1272.5411	R	D	132	142
PSM	SEDLLDYGPFR	1680	sp|P04843|RPN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:267	ms_run[2]:scan=11123	65.686	2	1320.6225	1320.6226	R	D	194	205
PSM	SEEGPGWTILR	1681	sp|Q9Y3B9|RRP15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:267	ms_run[2]:scan=8906	52.262	2	1253.628	1253.6280	K	D	240	251
PSM	SEGGFIWACK	1682	sp|O75874|IDHC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	9-UNIMOD:4,10-UNIMOD:188	ms_run[2]:scan=7977	46.904	2	1159.5428	1159.5428	K	N	261	271
PSM	SGGGIVEPIPLNIK	1683	sp|Q8N954|GPT11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9918	58.306	2	1392.7977	1392.7977	K	T	117	131
PSM	SIEALLEAGQAR	1684	sp|Q9P2E9-3|RRBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:267	ms_run[2]:scan=9389	55.139	2	1266.6807	1266.6807	R	D	526	538
PSM	SIQFVDWCPTGFK	1685	sp|P68363-2|TBA1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	8-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=11901	70.546	2	1589.7644	1589.7644	R	V	224	237
PSM	SLAAALDILNTATR	1686	sp|Q8TB52|FBX30_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=12608	75.208	2	1428.7936	1428.7936	R	D	192	206
PSM	SLADGILLCK	1687	sp|Q14651|PLSI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	9-UNIMOD:4,10-UNIMOD:188	ms_run[2]:scan=8729	51.228	2	1094.6101	1094.6101	K	M	158	168
PSM	SLDQTSPCPLVLVR	1688	sp|Q6XZF7|DNMBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	8-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=9222	54.131	2	1593.8424	1593.8424	R	I	684	698
PSM	SLEEGEGPIAVIMTPTR	1689	sp|Q7L014|DDX46_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:35	ms_run[2]:scan=8828	51.803	2	1814.9084	1814.9084	R	E	439	456
PSM	SPGASNFSTLPK	1690	sp|Q9Y4E8|UBP15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4976	30.69	2	1204.6088	1204.6088	K	I	229	241
PSM	SPQENLVPCDVLLLR	1691	sp|Q9HD20-2|AT131_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	9-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=12083	71.716	2	1761.9323	1761.9323	R	G	210	225
PSM	SVEAAAELSAK	1692	sp|P20962|PTMS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3329	22.004	2	1074.5557	1074.5557	K	D	5	16
PSM	SVLDGPVLSNIDR	1693	sp|P49848-4|TAF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:267	ms_run[2]:scan=9189	53.939	2	1393.7441	1393.7441	R	I	395	408
PSM	SVVTSIFGVK	1694	sp|P41252|SYIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:188	ms_run[2]:scan=10374	61.054	2	1041.6166	1041.6166	K	N	1116	1126
PSM	SYDYHQNWGR	1695	sp|Q9H2U1-3|DHX36_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:1,10-UNIMOD:267	ms_run[2]:scan=5520	33.57	2	1376.5773	1376.5773	M	D	2	12
PSM	TASWLAAELSK	1696	sp|Q9UMR2-3|DD19B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9695	56.958	2	1175.6186	1175.6186	K	E	236	247
PSM	TAVETAVLLLR	1697	sp|P49368-2|TCPG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:267	ms_run[2]:scan=10985	64.82	2	1194.7211	1194.7211	K	I	470	481
PSM	TAVHAGNINFK	1698	sp|P35221-2|CTNA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:1	ms_run[2]:scan=5771	34.876	2	1212.6251	1212.6251	M	W	2	13
PSM	TFAPSFQQEASR	1699	sp|Q9H5V8|CDCP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:267	ms_run[2]:scan=5706	34.51	2	1377.6552	1377.6552	R	Q	519	531
PSM	TFEVCDLPVR	1700	sp|P35606-2|COPB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	5-UNIMOD:4,10-UNIMOD:267	ms_run[2]:scan=8481	49.81	2	1244.6099	1244.6099	K	A	23	33
PSM	TIFAYFTGSK	1701	sp|Q9BRA2|TXD17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:188	ms_run[2]:scan=10721	63.192	2	1139.5958	1139.5958	K	D	26	36
PSM	TIISYIDEQFER	1702	sp|Q15019|SEPT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=12503	74.432	2	1512.746	1512.7460	K	Y	117	129
PSM	TLGVDLVALATR	1703	sp|P27708|PYR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11724	69.439	2	1227.7187	1227.7187	K	V	1229	1241
PSM	TLLLCGYPNVGK	1704	sp|Q9BZE4-3|NOG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	5-UNIMOD:4,12-UNIMOD:188	ms_run[2]:scan=8678	50.936	2	1339.7265	1339.7265	R	S	54	66
PSM	TPAIPTAVNLADSR	1705	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7680	45.273	2	1424.7623	1424.7623	R	T	2247	2261
PSM	TPEILTVNSIGQLK	1706	sp|Q8NFH3|NUP43_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	14-UNIMOD:188	ms_run[2]:scan=10092	59.359	2	1517.876	1517.8760	R	I	183	197
PSM	TQSTWVDSFFR	1707	sp|O94874-3|UFL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=12110	71.887	2	1372.6412	1372.6412	R	Q	252	263
PSM	TSFFQALGITTK	1708	sp|P05388-2|RLA0_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:188	ms_run[2]:scan=12443	74.012	2	1318.7228	1318.7228	K	I	135	147
PSM	TSVLEMIAQAR	1709	sp|O60313-13|OPA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:267	ms_run[2]:scan=11509	68.097	2	1227.6521	1227.6521	K	I	266	277
PSM	TVDNFVALATGEK	1710	sp|P23284|PPIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:188	ms_run[2]:scan=9665	56.773	2	1369.7185	1369.7185	K	G	72	85
PSM	VAGQDGSVVQFK	1711	sp|P55854|SUMO3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:188	ms_run[2]:scan=4636	28.915	2	1239.6555	1239.6555	K	I	21	33
PSM	VALVYGQMNEPPGAR	1712	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6727	40.089	2	1600.8032	1600.8032	K	A	265	280
PSM	VDILDPALLR	1713	sp|P17980|PRS6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11153	65.866	2	1123.6601	1123.6601	R	S	335	345
PSM	VFANAPDSACVIGLK	1714	sp|P17858|PFKAL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=8413	49.401	2	1566.8171	1566.8171	R	K	699	714
PSM	VFDFLVDSINK	1715	sp|Q12965|MYO1E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:188	ms_run[2]:scan=11928	70.722	2	1301.6963	1301.6963	R	A	363	374
PSM	VFLDPNILSDDGTVALR	1716	sp|P48147|PPCE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	17-UNIMOD:267	ms_run[2]:scan=12240	72.705	2	1853.9762	1853.9762	R	G	112	129
PSM	VGSGSLDNLGR	1717	sp|Q13136-2|LIPA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4108	26.192	2	1073.5465	1073.5465	R	F	664	675
PSM	VITCGWDGLIK	1718	sp|O60508|PRP17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	4-UNIMOD:4	ms_run[2]:scan=9836	57.814	2	1260.6536	1260.6536	K	L	566	577
PSM	VLGIVVQNTK	1719	sp|Q9Y653-5|AGRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:188	ms_run[2]:scan=5694	34.45	2	1075.6697	1075.6697	K	V	137	147
PSM	VLYPNDNFFEGK	1720	sp|P11216|PYGB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:188	ms_run[2]:scan=9366	54.994	2	1447.7079	1447.7079	R	E	279	291
PSM	VPTANVSVVDLTCR	1721	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:4	ms_run[2]:scan=8006	47.057	2	1529.7872	1529.7872	R	L	193	207
PSM	VTAQSIIPGILER	1722	sp|O75153|CLU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11115	65.636	2	1395.8086	1395.8086	R	D	482	495
PSM	VTPNEGLTVSFPFGK	1723	sp|Q14690|RRP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11097	65.521	2	1591.8246	1591.8246	K	I	1240	1255
PSM	VTPVEVMPVFPDFK	1724	sp|Q8N7H5-3|PAF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=12629	75.357	2	1603.832	1603.8320	R	M	189	203
PSM	VTTQTSLPLFR	1725	sp|Q13596-2|SNX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8943	52.473	2	1261.703	1261.7030	K	S	102	113
PSM	VYVGNLGTGAGK	1726	sp|Q16629-3|SRSF7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:188	ms_run[2]:scan=4101	26.153	2	1140.6235	1140.6235	K	G	13	25
PSM	WEDAIPLALK	1727	sp|P09960-4|LKHA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10504	61.856	2	1154.6336	1154.6336	K	M	524	534
PSM	WLDDIGLPQYK	1728	sp|Q8ND30-3|LIPB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:188	ms_run[2]:scan=10952	64.619	2	1352.7072	1352.7072	R	D	495	506
PSM	YAVLYQPLFDK	1729	sp|P55209-3|NP1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:188	ms_run[2]:scan=10758	63.422	2	1361.7327	1361.7327	K	E	65	76
PSM	YAVLYQPLFDK	1730	sp|P55209-3|NP1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10759	63.428	2	1355.7125	1355.7125	K	E	65	76
PSM	YDWDLLAAR	1731	sp|Q15029-2|U5S1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10834	63.886	2	1121.5506	1121.5506	K	S	687	696
PSM	YFNSYTLTGR	1732	sp|Q96IX5|ATPMD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:267	ms_run[2]:scan=6787	40.396	2	1230.5909	1230.5909	K	M	18	28
PSM	YGEPGEVFINK	1733	sp|P23246-2|SFPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6495	38.847	2	1251.6136	1251.6136	K	G	320	331
PSM	YGVNPGPIVGTTR	1734	sp|P42166|LAP2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:267	ms_run[2]:scan=5733	34.654	2	1339.7124	1339.7124	K	K	127	140
PSM	YISPDQLADLYK	1735	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10280	60.488	2	1424.7187	1424.7187	R	S	270	282
PSM	YLAEFATGNDR	1736	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5779	34.923	2	1255.5833	1255.5833	R	K	131	142
PSM	YLGQDYEQLR	1737	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:267	ms_run[2]:scan=6376	38.187	2	1293.6229	1293.6229	K	V	37	47
PSM	YLNIFGESQPNPK	1738	sp|Q9UJS0|CMC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9081	53.283	2	1505.7514	1505.7514	R	T	44	57
PSM	YVFLDPLAGAVTK	1739	sp|Q9NQA3|WASH6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:188	ms_run[2]:scan=12051	71.513	2	1398.7854	1398.7854	K	T	168	181
PSM	YYGGGSEGGR	1740	sp|P14866|HNRPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:267	ms_run[2]:scan=814	8.2468	2	1011.4285	1011.4285	R	A	47	57
PSM	YYLAPKIEDEEGS	1741	sp|P12004|PCNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6613	39.479	2	1512.6984	1512.6984	K	-	249	262
PSM	QLQLAQEAAQKR	1742	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28	ms_run[1]:scan=7041	41.77104333333334	2	1365.7319	1365.7359	R	L	2172	2184
PSM	SLVPAAELLESR	1743	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=10191	59.950715	2	1283.704707	1283.708516	R	V	3116	3128
PSM	NTGIICTIGPASR	1744	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	6-UNIMOD:4	ms_run[1]:scan=6910	41.042535	2	1359.6812	1358.6972	R	S	44	57
PSM	SLDMDSIIAEVK	1745	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:35,12-UNIMOD:188	ms_run[1]:scan=8118	47.696175	2	1341.674679	1341.679312	R	A	253	265
PSM	YEELQSLAGK	1746	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=5488	33.39362833333333	2	1136.573893	1136.571354	K	H	286	296
PSM	QLREYQELMNVK	1747	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28	ms_run[1]:scan=10361	60.97990333333333	2	1532.7618	1532.7652	R	L	370	382
PSM	QLREYQELMNVK	1748	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28,3-UNIMOD:267,12-UNIMOD:188	ms_run[1]:scan=10370	61.033831666666664	2	1548.7886	1548.7936	R	L	370	382
PSM	ILGATIENSR	1749	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	10-UNIMOD:267	ms_run[1]:scan=4326	27.32361	2	1082.596609	1082.595942	K	I	141	151
PSM	GLGVGFGSGGGSSSSVK	1750	sp|P13647|K2C5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	17-UNIMOD:188	ms_run[1]:scan=4975	30.684231666666665	2	1444.727913	1444.725351	R	F	560	577
PSM	MISDAIPELK	1751	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	10-UNIMOD:188	ms_run[1]:scan=8249	48.440265000000004	2	1122.6382	1121.6092	K	A	315	325
PSM	QTLMWSATWPK	1752	sp|Q92841|DDX17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=10795	63.65061166666667	2	1347.666145	1347.664543	R	E	351	362
PSM	CFIVGADNVGSK	1753	sp|P05388|RLA0_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=10026	58.95788666666667	2	1248.5753	1248.5803	K	Q	27	39
PSM	QNGDDPLLTYRFPPK	1754	sp|P02545|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28	ms_run[1]:scan=10796	63.65608833333333	2	1744.8682	1742.8622	R	F	472	487
PSM	VIGSGCNLDSAR	1755	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	6-UNIMOD:4	ms_run[1]:scan=3882	24.929685	2	1248.5782	1247.5922	R	F	159	171
PSM	LLLIGDSGVGK	1756	sp|P61026|RAB10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	11-UNIMOD:188	ms_run[1]:scan=7714	45.45869833333333	2	1076.653273	1076.653689	K	T	12	23
PSM	QRMESALDQLK	1757	sp|P37837|TALDO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28,2-UNIMOD:267,11-UNIMOD:188	ms_run[1]:scan=7429	43.913335	2	1316.6733	1316.6724	R	Q	9	20
PSM	LVILANNCPALR	1758	sp|P62888|RL30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	8-UNIMOD:4	ms_run[1]:scan=8402	49.33810833333333	2	1353.7462	1352.7592	K	K	45	57
PSM	CKEIAEELFTR	1759	sp|Q01433-2|AMPD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:188,11-UNIMOD:267	ms_run[1]:scan=11506	68.07977	2	1393.6883	1393.6877	K	S	42	53
PSM	CKEIAEELFTR	1760	sp|Q01433-2|AMPD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=11503	68.06344833333333	2	1377.6581	1377.6593	K	S	42	53
PSM	CMQLTDFILK	1761	sp|P50914|RL14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:4,2-UNIMOD:35	ms_run[1]:scan=10199	59.9998	2	1283.621769	1283.625381	K	F	54	64
PSM	CVELVHEEMQR	1762	sp|O00429|DNM1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=9274	54.457898333333326	2	1411.6256	1411.6219	R	I	431	442
PSM	VVLAYEPVWAIGTGK	1763	sp|P60174|TPIS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	15-UNIMOD:188	ms_run[1]:scan=11821	70.037825	2	1607.904920	1607.901859	K	T	198	213
PSM	QVHPDTGISSK	1764	sp|P33778|H2B1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28,11-UNIMOD:188	ms_run[1]:scan=2168	15.78997	2	1156.5842	1156.5815	K	A	48	59
PSM	AMGIMNSFVNDIFER	1765	sp|P33778|H2B1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	2-UNIMOD:35	ms_run[1]:scan=12610	75.22563333333333	2	1759.798013	1758.806927	K	I	59	74
PSM	AMGIMNSFVNDIFER	1766	sp|P33778|H2B1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	5-UNIMOD:35	ms_run[1]:scan=12425	73.897035	2	1759.795974	1758.806927	K	I	59	74
PSM	FAAATGATPIAGR	1767	sp|P08865|RSSA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	13-UNIMOD:267	ms_run[1]:scan=4166	26.476478333333333	2	1212.649693	1212.649040	K	F	90	103
PSM	SPDPFGAVAAQK	1768	sp|Q9Y3Q8|T22D4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=6025	36.249495	2	1187.597449	1186.598238	K	F	279	291
PSM	NGALDQQKDELDVR	1769	sp|P12270|TPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	8-UNIMOD:188,14-UNIMOD:267	ms_run[1]:scan=4950	30.543598333333335	2	1616.804051	1615.813661	R	I	1585	1599
PSM	QKLQYEGIFIK	1770	sp|Q15459|SF3A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28,2-UNIMOD:188,11-UNIMOD:188	ms_run[1]:scan=10055	59.13464333333334	2	1360.7749	1360.7788	K	D	755	766
PSM	QKLQYEGIFIK	1771	sp|Q15459|SF3A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28	ms_run[1]:scan=10056	59.140105000000005	2	1348.7322	1348.7386	K	D	755	766
PSM	GKVEIDQQQLTQQQLNGN	1772	sp|Q8IWS0|PHF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=6016	36.20348	2	2041.019381	2040.023596	R	-	348	366
PSM	CKELFPIQMEGVK	1773	sp|O96008|TOM40_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=11405	67.430145	2	1560.7656	1560.7675	K	L	90	103
PSM	ELGLPEELVSR	1774	sp|P49915|GUAA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	11-UNIMOD:267	ms_run[1]:scan=9534	55.993276666666674	2	1250.676247	1250.674586	R	H	425	436
PSM	QWNNCAFLESSAK	1775	sp|P61224|RAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	5-UNIMOD:4,13-UNIMOD:188	ms_run[1]:scan=7591	44.77952	2	1560.737740	1559.713406	R	S	137	150
PSM	QGDTGDWIGTFLGHK	1776	sp|Q9Y3F4|STRAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28,15-UNIMOD:188	ms_run[1]:scan=12935	77.746055	2	1619.7723	1619.7670	R	G	45	60
PSM	CAADLGLNKGYR	1777	sp|P49773|HINT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:385,1-UNIMOD:4,9-UNIMOD:188,12-UNIMOD:267	ms_run[1]:scan=7014	41.61802166666667	2	1335.6570	1335.6571	K	M	84	96
PSM	GFGFVTFDDHD	1778	sp|P22626|ROA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0		ms_run[1]:scan=10731	63.251931666666664	2	1255.5115	1255.5140	R	P	154	165
PSM	VLQLMNLTDSR	1779	sp|Q9UIA9|XPO7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	11-UNIMOD:267	ms_run[1]:scan=9705	57.01882166666667	2	1299.685465	1298.689190	R	L	527	538
PSM	CNLLAEKQYGFCK	1780	sp|P02765|FETUA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:385,1-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=9128	53.565506666666664	2	1612.7413	1612.7373	K	A	219	232
PSM	QVLLAQAEAEKIR	1781	sp|Q14254|FLOT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28	ms_run[1]:scan=9500	55.790319999999994	2	1450.8162	1450.8139	K	K	308	321
PSM	LGPALATGNVVVMK	1782	sp|P05091|ALDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	13-UNIMOD:35	ms_run[1]:scan=6612	39.47340166666667	2	1384.784429	1384.774822	K	V	196	210
PSM	LTLSALLDGK	1783	sp|P21796|VDAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	10-UNIMOD:188	ms_run[1]:scan=11133	65.746135	2	1035.624006	1035.627140	K	N	257	267
PSM	LTLSALLDGK	1784	sp|P21796|VDAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	10-UNIMOD:188	ms_run[1]:scan=10562	62.21586833333333	2	1035.622656	1035.627140	K	N	257	267
PSM	CIGKPGGSLDNSEQK	1785	sp|Q9Y5L4|TIM13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:385,1-UNIMOD:4,4-UNIMOD:188,15-UNIMOD:188	ms_run[1]:scan=4866	30.092534999999998	2	1583.7706	1583.7647	K	C	50	65
PSM	CIGKPGGSLDNSEQK	1786	sp|Q9Y5L4|TIM13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=4859	30.05273	2	1571.7299	1571.7244	K	C	50	65
PSM	QQHVIETLIGK	1787	sp|P48643|TCPE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28	ms_run[1]:scan=9680	56.86573333333334	2	1247.6886	1247.6869	K	K	503	514
PSM	ELLFLSNANPSLLER	1788	sp|P51398|RT29_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=12461	74.14263333333334	2	1714.940773	1714.925386	K	H	379	394
PSM	QKVDLQSLPTR	1789	sp|Q9C005|DPY30_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28	ms_run[1]:scan=6528	39.01583333333333	2	1266.6932	1266.6927	K	A	44	55
PSM	CLYVFPAKVEPAK	1790	sp|Q9C0C9|UBE2O_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:385,1-UNIMOD:4,8-UNIMOD:188,13-UNIMOD:188	ms_run[1]:scan=11042	65.17724833333332	2	1515.8177	1515.8193	R	I	353	366
PSM	QLDMELVSVKR	1791	sp|Q9UKL0|RCOR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28,10-UNIMOD:188,11-UNIMOD:267	ms_run[1]:scan=9697	56.96898	2	1315.7157	1315.7135	R	Q	340	351
PSM	NQLPLVVDAICTR	1792	sp|Q9P2R3|ANFY1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	11-UNIMOD:4,13-UNIMOD:267	ms_run[1]:scan=10432	61.41477	2	1508.794706	1507.805617	R	G	665	678
PSM	LAIQGPEDSPSR	1793	sp|Q15773|MLF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	12-UNIMOD:267	ms_run[1]:scan=4059	25.919079999999997	2	1279.642110	1278.644349	R	Q	230	242
PSM	VFSLMDPNSPER	1794	sp|Q7L5D6|GET4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	12-UNIMOD:267	ms_run[1]:scan=8162	47.95815833333333	2	1400.666290	1400.663370	K	V	111	123
PSM	FGEVVDCTIK	1795	sp|O14979|HNRDL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	7-UNIMOD:4	ms_run[1]:scan=5841	35.27679166666667	2	1168.557639	1166.564161	R	T	171	181
PSM	VLLMELEEAR	1796	sp|P12270|TPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	10-UNIMOD:267	ms_run[1]:scan=9958	58.548743333333334	2	1213.645489	1211.645929	R	G	502	512
PSM	CQNALQQVVAR	1797	sp|Q06210|GFPT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:4,11-UNIMOD:267	ms_run[1]:scan=5301	32.40452666666667	2	1297.650862	1295.664373	K	Q	620	631
PSM	VIAALLQTMEDQGNQR	1798	sp|O00410|IPO5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	16-UNIMOD:267	ms_run[1]:scan=10741	63.3155	2	1795.913016	1795.912602	K	V	442	458
PSM	AAFLGCLTDVR	1799	sp|Q9UID3-2|VPS51_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	6-UNIMOD:4	ms_run[2]:scan=9709	57.042	2	1221.6176	1221.6176	R	Q	292	303
PSM	AALQELLSK	1800	sp|P62851|RS25_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:188	ms_run[2]:scan=7891	46.446	2	977.58528	977.5853	R	G	86	95
PSM	AAPDILIATPGR	1801	sp|Q96GQ7|DDX27_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:267	ms_run[2]:scan=7492	44.251	2	1203.6851	1203.6851	R	L	338	350
PSM	AAQLFLCSLGLK	1802	sp|Q9UPY3-3|DICER_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	7-UNIMOD:4,12-UNIMOD:188	ms_run[2]:scan=12086	71.733	2	1325.7473	1325.7473	R	V	476	488
PSM	AEDPPWFEGLESR	1803	sp|O76075-2|DFFB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	13-UNIMOD:267	ms_run[2]:scan=11027	65.082	2	1541.7026	1541.7026	R	F	136	149
PSM	AEFPSKVSTR	1804	sp|Q9Y342|PLLP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:1	ms_run[2]:scan=4537	28.425	2	1162.5982	1162.5982	M	T	2	12
PSM	AELGAGGDGHR	1805	sp|Q14244-3|MAP7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:1,11-UNIMOD:267	ms_run[2]:scan=1680	13.052	2	1090.5031	1090.5031	M	G	2	13
PSM	AFNSSSFNSNTFLTR	1806	sp|P46060|RAGP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	15-UNIMOD:267	ms_run[2]:scan=9263	54.392	2	1701.7986	1701.7986	K	L	501	516
PSM	AFSPTTVNTGR	1807	sp|P61619-3|S61A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3391	22.321	2	1149.5778	1149.5778	K	G	75	86
PSM	ALAAAGYDVEK	1808	sp|P10412|H14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4094	26.112	2	1106.5608	1106.5608	K	N	65	76
PSM	ALDLADMITR	1809	sp|P49916-4|DNLI3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10724	63.208	2	1117.5801	1117.5801	K	V	552	562
PSM	ALDPADQHLR	1810	sp|Q7Z7K0|COXM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:1,10-UNIMOD:267	ms_run[2]:scan=5210	31.929	2	1186.597	1186.5970	M	H	2	12
PSM	ALINSPEGAVGR	1811	sp|O00115-2|DNS2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5092	31.308	2	1182.6357	1182.6357	R	S	66	78
PSM	ALLANALTSALR	1812	sp|P57088|TMM33_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11209	66.202	2	1212.719	1212.7190	R	L	58	70
PSM	ALQGASQIIAEIR	1813	sp|O00429-4|DNM1L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	13-UNIMOD:267	ms_run[2]:scan=10224	60.147	2	1378.7808	1378.7808	K	E	682	695
PSM	ALTVPELTQQVFDAK	1814	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11974	71.018	2	1658.8879	1658.8879	R	N	283	298
PSM	ALTVPELTQQVFDAK	1815	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	15-UNIMOD:188	ms_run[2]:scan=11975	71.024	2	1664.9081	1664.9081	R	N	283	298
PSM	ALWQSVQEQSAR	1816	sp|Q96IR7|HPDL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6515	38.95	2	1401.7001	1401.7001	R	S	356	368
PSM	AQFAQPEILIGTIPGAGGTQR	1817	sp|P30084|ECHM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11314	66.861	2	2124.1328	2124.1328	K	L	158	179
PSM	AQTEWNTGTWR	1818	sp|Q969E2-2|SCAM4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:267	ms_run[2]:scan=6441	38.544	2	1358.6243	1358.6243	K	N	152	163
PSM	AVCLLTGASR	1819	sp|P35270|SPRE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:4	ms_run[2]:scan=5036	31.009	2	1046.5543	1046.5543	R	G	8	18
PSM	AVDSLVPIGR	1820	sp|P25705-2|ATPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:267	ms_run[2]:scan=6933	41.168	2	1035.5952	1035.5952	K	G	145	155
PSM	AVSDWLIASVEGR	1821	sp|Q969V3-2|NCLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	13-UNIMOD:267	ms_run[2]:scan=12360	73.469	2	1411.7335	1411.7335	K	L	195	208
PSM	CIESLIAVFQK	1822	sp|P31949|S10AB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:4	ms_run[2]:scan=12372	73.548	2	1306.6955	1306.6955	R	Y	13	24
PSM	CIPALDSLTPANEDQK	1823	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=8538	50.133	2	1776.8659	1776.8659	R	I	447	463
PSM	CPLCQQDWVVQR	1824	sp|Q9UBF6-4|RBX2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:4,4-UNIMOD:4	ms_run[2]:scan=7318	43.291	2	1587.7286	1587.7286	R	I	83	95
PSM	CTPACISFGPK	1825	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:4,5-UNIMOD:4,11-UNIMOD:188	ms_run[2]:scan=5935	35.802	2	1242.5832	1242.5832	R	N	34	45
PSM	CVLNEGMPIYR	1826	sp|P31689-2|DNJA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:4,11-UNIMOD:267	ms_run[2]:scan=7738	45.594	2	1360.6507	1360.6507	K	R	302	313
PSM	DGPNALTPPPTTPEWIK	1827	sp|P05023-3|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9592	56.338	2	1832.9309	1832.9309	R	F	44	61
PSM	DLSLLQIQMR	1828	sp|Q9BXJ9|NAA15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11164	65.932	2	1215.6645	1215.6645	R	D	119	129
PSM	DSTLIMQLLR	1829	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	6-UNIMOD:35	ms_run[2]:scan=12079	71.687	2	1204.6486	1204.6486	K	D	218	228
PSM	EAELLEPLMPAIR	1830	sp|P53618|COPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	13-UNIMOD:267	ms_run[2]:scan=12101	71.831	2	1490.8042	1490.8042	K	A	129	142
PSM	EAGGGGVGGPGAK	1831	sp|Q8NC51-4|PAIRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	13-UNIMOD:188	ms_run[2]:scan=629	7.174	2	1018.5139	1018.5139	K	S	40	53
PSM	EAINVEQAFQTIAR	1832	sp|P51149|RAB7A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11738	69.526	2	1588.8209	1588.8209	K	N	158	172
PSM	EAIVAALLTR	1833	sp|Q96GQ7|DDX27_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:267	ms_run[2]:scan=10814	63.765	2	1065.6422	1065.6422	R	T	451	461
PSM	EAIVAALLTR	1834	sp|Q96GQ7|DDX27_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10819	63.799	2	1055.6339	1055.6339	R	T	451	461
PSM	EEIFGPVQPILK	1835	sp|P47895|AL1A3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:188	ms_run[2]:scan=10594	62.415	2	1374.7854	1374.7854	K	F	410	422
PSM	EFSPFGTITSAK	1836	sp|P11940-2|PABP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9371	55.027	2	1283.6398	1283.6398	K	V	313	325
PSM	ELCAQPGQVVAPGAVLVR	1837	sp|Q9Y5B0-4|CTDP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:4	ms_run[2]:scan=8720	51.177	2	1863.0037	1863.0037	R	L	93	111
PSM	ELLLQPVTISR	1838	sp|P59998|ARPC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9453	55.515	2	1267.75	1267.7500	K	N	45	56
PSM	ELLLTGPGLEER	1839	sp|Q8N1G4|LRC47_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8840	51.875	2	1325.7191	1325.7191	R	V	23	35
PSM	ELQLPSMSMLTSK	1840	sp|Q7Z6Z7-2|HUWE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11552	68.369	2	1463.7364	1463.7364	R	T	3688	3701
PSM	FFDDPMLLELAK	1841	sp|Q15029-2|U5S1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:188	ms_run[2]:scan=13054	78.801	2	1443.7415	1443.7415	K	Q	917	929
PSM	FFTEEVDSR	1842	sp|Q9H845|ACAD9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267	ms_run[2]:scan=5465	33.27	2	1138.517	1138.5170	K	K	77	86
PSM	FVELPGAEMGK	1843	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7512	44.349	2	1176.5849	1176.5849	K	V	187	198
PSM	FVMQEEFSR	1844	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:35,9-UNIMOD:267	ms_run[2]:scan=4102	26.158	2	1197.5364	1197.5364	K	D	336	345
PSM	FVMQEEFSR	1845	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267	ms_run[2]:scan=6929	41.144	2	1181.5415	1181.5415	K	D	336	345
PSM	FYNELTEILVR	1846	sp|Q8WUM4|PDC6I_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:267	ms_run[2]:scan=12413	73.817	2	1405.7481	1405.7481	K	F	676	687
PSM	GAVLFGLDPAVIK	1847	sp|O43301|HS12A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=12139	72.068	2	1298.7598	1298.7598	K	V	517	530
PSM	GDLGIEIPAEK	1848	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:188	ms_run[2]:scan=7520	44.391	2	1146.6228	1146.6228	R	V	295	306
PSM	GLAGLGDVAEVR	1849	sp|P11216|PYGB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7780	45.841	2	1155.6248	1155.6248	R	K	18	30
PSM	GLGTDEDSLIEIICSR	1850	sp|P07355|ANXA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	14-UNIMOD:4	ms_run[2]:scan=12757	76.288	2	1776.8564	1776.8564	K	T	120	136
PSM	GMEDLIPLVNR	1851	sp|Q05193-5|DYN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11052	65.24	2	1255.6595	1255.6595	R	L	5	16
PSM	GVDEVTIVNILTNR	1852	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	14-UNIMOD:267	ms_run[2]:scan=12683	75.748	2	1551.8496	1551.8496	K	S	50	64
PSM	GVDEVTIVNILTNR	1853	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	14-UNIMOD:267	ms_run[2]:scan=12689	75.789	3	1551.8496	1551.8496	K	S	50	64
PSM	GVIDMGNSLIER	1854	sp|Q13813-3|SPTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9058	53.142	2	1302.6602	1302.6602	R	G	1588	1600
PSM	GVLVVGIGSGTK	1855	sp|Q8WWH5|TRUB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6570	39.231	2	1085.6445	1085.6445	R	M	126	138
PSM	GYDAPLCNLLLFK	1856	sp|O60488-2|ACSL4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	7-UNIMOD:4	ms_run[2]:scan=13332	81.895	2	1522.7854	1522.7854	K	K	373	386
PSM	GYSFTTTAER	1857	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:267	ms_run[2]:scan=4325	27.318	2	1141.5279	1141.5279	R	E	197	207
PSM	IAFAITAIK	1858	sp|P62269|RS18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9447	55.479	2	946.58515	946.5852	K	G	26	35
PSM	IAPLEEGTLPFNLAEAQR	1859	sp|Q9UJS0|CMC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	18-UNIMOD:267	ms_run[2]:scan=11898	70.529	3	1978.0399	1978.0399	R	Q	293	311
PSM	IEYQFFEDR	1860	sp|Q9NYU2-2|UGGG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267	ms_run[2]:scan=8868	52.04	2	1255.5749	1255.5749	R	H	940	949
PSM	IFQNLNGALDEVVLK	1861	sp|O60568|PLOD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	15-UNIMOD:188	ms_run[2]:scan=12028	71.367	2	1677.9397	1677.9397	R	F	218	233
PSM	IGDFGLVTSLK	1862	sp|P19525-2|E2AK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:188	ms_run[2]:scan=10210	60.064	2	1154.6643	1154.6643	K	N	389	400
PSM	IGDPLLEDTR	1863	sp|P49189-2|AL9A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6796	40.443	2	1127.5823	1127.5823	K	M	247	257
PSM	ILDLSNFEILAK	1864	sp|Q9NR09|BIRC6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:188	ms_run[2]:scan=12905	77.509	2	1380.796	1380.7960	K	V	914	926
PSM	ILDPEGLALGAVIASSK	1865	sp|Q8IY81|SPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=12814	76.722	2	1652.9349	1652.9349	R	K	662	679
PSM	ILETWGELLSK	1866	sp|Q9Y3P9-2|RBGP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:188	ms_run[2]:scan=11805	69.936	2	1293.7276	1293.7276	K	W	469	480
PSM	ILLTEPPMNPTK	1867	sp|P61160|ARP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:188	ms_run[2]:scan=7444	43.994	2	1358.7575	1358.7575	K	N	107	119
PSM	ILNDLSSDAPGVPR	1868	sp|P16220-3|CREB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	14-UNIMOD:267	ms_run[2]:scan=7081	41.996	2	1462.7655	1462.7655	K	I	137	151
PSM	ILQEAWTEGR	1869	sp|Q9UI10-3|EI2BD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6014	36.195	2	1201.6091	1201.6091	R	R	344	354
PSM	ILQNEPLPER	1870	sp|O95793-2|STAU1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4510	28.282	2	1207.6561	1207.6561	R	L	78	88
PSM	ILTDILEVR	1871	sp|Q6ICG6-3|K0930_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10339	60.846	2	1070.6336	1070.6336	R	Q	355	364
PSM	ILTFDQLALDSPK	1872	sp|Q07020-2|RL18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11331	66.969	2	1459.7922	1459.7922	K	G	91	104
PSM	ILVLQNELER	1873	sp|Q9P2Y5|UVRAG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:267	ms_run[2]:scan=8422	49.451	2	1235.7113	1235.7113	K	Q	244	254
PSM	INFDSNSAYR	1874	sp|Q9P2R7-2|SUCB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4733	29.417	2	1185.5415	1185.5415	K	Q	253	263
PSM	INKTEICSQL	1875	sp|Q9UHE8|STEA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:188,7-UNIMOD:4	ms_run[2]:scan=5202	31.888	2	1210.6323	1210.6323	K	-	330	340
PSM	IVEIPFNSTNK	1876	sp|P05023-3|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7222	42.748	2	1260.6714	1260.6714	K	Y	446	457
PSM	IVLQIDNAR	1877	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267	ms_run[2]:scan=5700	34.483	2	1050.6061	1050.6061	R	L	150	159
PSM	IVLQIDNAR	1878	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267	ms_run[2]:scan=5884	35.524	2	1050.6061	1050.6061	R	L	150	159
PSM	IVLQIDNAR	1879	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5848	35.318	2	1040.5978	1040.5978	R	L	150	159
PSM	IVVVTAGVR	1880	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267	ms_run[2]:scan=4494	28.205	2	922.58392	922.5839	K	Q	92	101
PSM	KLASQADSTEQVDDTILT	1881	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6816	40.557	2	1933.948	1933.9480	K	-	2654	2672
PSM	KPVTVSPTTPTSPTEGEAS	1882	sp|Q9Y6G9|DC1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3854	24.774	2	1884.9317	1884.9317	R	-	505	524
PSM	KQNDVFGEAEQ	1883	sp|P31150|GDIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3690	23.912	2	1263.5731	1263.5731	R	-	437	448
PSM	LAAIGEATR	1884	sp|Q15149|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267	ms_run[2]:scan=2548	17.734	2	910.51115	910.5111	K	L	1976	1985
PSM	LAALNPESNTAGLDIFAK	1885	sp|O00299|CLIC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11418	67.508	2	1843.968	1843.9680	K	F	96	114
PSM	LADALQELR	1886	sp|P02545|LMNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267	ms_run[2]:scan=6987	41.467	2	1037.5745	1037.5745	R	A	241	250
PSM	LAQFEPSQR	1887	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267	ms_run[2]:scan=3155	21.076	2	1084.5541	1084.5541	K	Q	315	324
PSM	LDDDGLPFIGAK	1888	sp|Q9H9Y6-4|RPA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:188	ms_run[2]:scan=10080	59.283	2	1265.6599	1265.6599	K	L	596	608
PSM	LDDIFEPVLIPEPK	1889	sp|Q14008-2|CKAP5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=12574	74.967	2	1623.876	1623.8760	K	I	1510	1524
PSM	LDQLIYIPLPDEK	1890	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=12042	71.458	2	1555.8498	1555.8498	R	S	639	652
PSM	LEDVLPLAFTR	1891	sp|Q5SSJ5-3|HP1B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11791	69.851	2	1272.7078	1272.7078	K	L	107	118
PSM	LFDDVPQVR	1892	sp|Q86Y56-2|DAAF5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267	ms_run[2]:scan=7204	42.655	2	1097.5745	1097.5745	R	R	254	263
PSM	LFEMDAQGR	1893	sp|Q8TE67-2|ES8L3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5588	33.93	2	1065.4913	1065.4913	K	V	54	63
PSM	LFLESSDANPVR	1894	sp|Q9NU22|MDN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:267	ms_run[2]:scan=7244	42.863	2	1356.6913	1356.6913	R	Y	126	138
PSM	LGMLSPEGTCK	1895	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:4	ms_run[2]:scan=5026	30.955	2	1191.5628	1191.5628	R	A	203	214
PSM	LIDPQTQVTR	1896	sp|Q9UKG1|DP13A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4013	25.66	2	1169.6404	1169.6404	K	L	554	564
PSM	LISWYDNEFGYSNR	1897	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10751	63.377	3	1762.7951	1762.7951	K	V	268	282
PSM	LIVENLSSR	1898	sp|Q13247-3|SRSF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5411	32.975	2	1029.5819	1029.5819	R	C	112	121
PSM	LLALNSLYSPK	1899	sp|P78527-2|PRKDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:188	ms_run[2]:scan=9782	57.485	2	1223.7221	1223.7221	R	I	2539	2550
PSM	LNDFASTVR	1900	sp|P20674|COX5A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267	ms_run[2]:scan=4479	28.124	2	1031.5275	1031.5275	R	I	99	108
PSM	LPDGTSLTQTFR	1901	sp|Q04323|UBXN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:267	ms_run[2]:scan=7838	46.167	2	1344.6913	1344.6913	R	A	220	232
PSM	LQPSSSPENSLDPFPPR	1902	sp|Q8WWM7-6|ATX2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	17-UNIMOD:267	ms_run[2]:scan=8673	50.903	2	1876.9195	1876.9195	K	I	554	571
PSM	LSDGVAVLK	1903	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:188	ms_run[2]:scan=4764	29.573	2	906.54816	906.5482	K	V	397	406
PSM	LSDGVAVLK	1904	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4765	29.576	2	900.52803	900.5280	K	V	397	406
PSM	LSNIFVIGK	1905	sp|P62701|RS4X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:188	ms_run[2]:scan=9281	54.502	2	995.6111	995.6111	R	G	222	231
PSM	LSNIFVIGK	1906	sp|P62701|RS4X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9126	53.556	2	989.59097	989.5910	R	G	222	231
PSM	LTEQSNTPLLLPLAAR	1907	sp|Q9NYL2-2|M3K20_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11075	65.379	2	1735.9832	1735.9832	K	M	322	338
PSM	LVEGFYPAPGLK	1908	sp|O60244|MED14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:188	ms_run[2]:scan=8827	51.797	2	1295.7221	1295.7221	K	T	949	961
PSM	LVLVGDGGTGK	1909	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:188	ms_run[2]:scan=4503	28.253	2	1020.5911	1020.5911	K	T	13	24
PSM	LVVPASQCGSLIGK	1910	sp|Q15366-7|PCBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	8-UNIMOD:4	ms_run[2]:scan=6855	40.751	2	1427.7806	1427.7806	R	G	102	116
PSM	LWDTAGQER	1911	sp|Q9H0N0|RAB6C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267	ms_run[2]:scan=2849	19.385	2	1084.5177	1084.5177	R	L	66	75
PSM	LWDTAGQER	1912	sp|Q9H0N0|RAB6C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2850	19.389	2	1074.5094	1074.5094	R	L	66	75
PSM	MAPALSGANLTSPR	1913	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6242	37.434	2	1384.7133	1384.7133	R	V	2371	2385
PSM	MGESDDSILR	1914	sp|P63220|RS21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:35	ms_run[2]:scan=3326	21.989	2	1137.4972	1137.4972	R	L	62	72
PSM	MGPGATAGGAEK	1915	sp|P62820-2|RAB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:35	ms_run[2]:scan=541	6.6526	2	1061.4812	1061.4812	R	S	112	124
PSM	MGPGATAGGAEK	1916	sp|P62820-2|RAB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=871	8.5387	2	1045.4862	1045.4862	R	S	112	124
PSM	MGPGATAGGAEK	1917	sp|P62820-2|RAB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:35,12-UNIMOD:188	ms_run[2]:scan=539	6.6423	2	1067.5013	1067.5013	R	S	112	124
PSM	MIEEAGAIISTR	1918	sp|O00154-2|BACH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:35,12-UNIMOD:267	ms_run[2]:scan=5744	34.72	2	1315.6681	1315.6681	K	H	37	49
PSM	MIEEAGAIISTR	1919	sp|O00154-2|BACH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:35	ms_run[2]:scan=5747	34.737	2	1305.6599	1305.6599	K	H	37	49
PSM	MMGLEVLGEK	1920	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9645	56.656	2	1105.5512	1105.5512	R	K	701	711
PSM	NAGVEGSLIVEK	1921	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:188	ms_run[2]:scan=5351	32.658	2	1220.6708	1220.6708	K	I	482	494
PSM	NCIISLVTQR	1922	sp|Q13868-3|EXOS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:4,10-UNIMOD:267	ms_run[2]:scan=8935	52.424	2	1212.6524	1212.6524	R	M	209	219
PSM	NGAQIADGFR	1923	sp|P42696|RBM34_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:267	ms_run[2]:scan=4461	28.031	2	1057.518	1057.5180	R	I	263	273
PSM	NIQGTITGDILPR	1924	sp|O75691|UTP20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	13-UNIMOD:267	ms_run[2]:scan=9375	55.049	2	1406.7757	1406.7757	K	L	1778	1791
PSM	NLCSDDTPMVR	1925	sp|P30153|2AAA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:4	ms_run[2]:scan=4411	27.778	2	1306.5646	1306.5646	R	R	172	183
PSM	NLGLEELGIELDPR	1926	sp|P09622|DLDH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	14-UNIMOD:267	ms_run[2]:scan=12401	73.736	2	1576.8336	1576.8336	K	G	321	335
PSM	NLLDEELQR	1927	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7573	44.683	2	1128.5775	1128.5775	K	L	2340	2349
PSM	NLLSAYGEVGR	1928	sp|Q9ULW3|ABT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:267	ms_run[2]:scan=7882	46.4	2	1187.6174	1187.6174	R	V	64	75
PSM	NLQDAMQVCR	1929	sp|P49368-2|TCPG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:4,10-UNIMOD:267	ms_run[2]:scan=5124	31.477	2	1243.5677	1243.5677	R	N	352	362
PSM	NMVPQQALVIR	1930	sp|P05023-3|AT1A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7582	44.73	2	1267.7071	1267.7071	K	N	132	143
PSM	NPAGSVVMER	1931	sp|O00764-3|PDXK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:267	ms_run[2]:scan=2738	18.814	2	1068.5261	1068.5261	R	I	136	146
PSM	NPEQEPIPIVLR	1932	sp|Q07960|RHG01_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8987	52.712	2	1403.7773	1403.7773	K	E	253	265
PSM	NPPDVDGVIGEIR	1933	sp|O60487|MPZL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	13-UNIMOD:267	ms_run[2]:scan=9095	53.364	2	1389.7128	1389.7128	K	L	127	140
PSM	NSSYFVEWIPNNVK	1934	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	14-UNIMOD:188	ms_run[2]:scan=11575	68.517	2	1701.8458	1701.8458	K	T	337	351
PSM	NVGLCEAIVQFTR	1935	sp|P86791|CCZ1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	5-UNIMOD:4	ms_run[2]:scan=11828	70.085	2	1505.766	1505.7660	R	T	61	74
PSM	NYPATFWVNPQFK	1936	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	13-UNIMOD:188	ms_run[2]:scan=11231	66.339	2	1616.8083	1616.8083	R	I	386	399
PSM	QIDQFLVVAR	1937	sp|Q13330-2|MTA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:267	ms_run[2]:scan=9111	53.463	2	1197.6745	1197.6745	K	S	209	219
PSM	QIGENLIVPGGVK	1938	sp|Q16555-2|DPYL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	13-UNIMOD:188	ms_run[2]:scan=7896	46.473	2	1328.7759	1328.7759	K	T	8	21
PSM	QNINLSAPIMSR	1939	sp|Q14566|MCM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:267	ms_run[2]:scan=7664	45.188	2	1352.711	1352.7110	K	F	518	530
PSM	QVLALELPEALCR	1940	sp|Q9HBH1|DEFM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:4	ms_run[2]:scan=11938	70.785	2	1510.8177	1510.8177	R	E	121	134
PSM	QYSLQNWEAR	1941	sp|P48637-2|GSHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:267	ms_run[2]:scan=7158	42.405	2	1303.6185	1303.6185	R	L	163	173
PSM	SACGVCPGR	1942	sp|P49207|RL34_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:4,6-UNIMOD:4,9-UNIMOD:267	ms_run[2]:scan=793	8.1427	2	972.41449	972.4145	K	L	44	53
PSM	SACGVCPGR	1943	sp|P49207|RL34_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:4,6-UNIMOD:4	ms_run[2]:scan=794	8.1465	2	962.40622	962.4062	K	L	44	53
PSM	SEDLLDYGPFR	1944	sp|P04843|RPN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11125	65.697	2	1310.6143	1310.6143	R	D	194	205
PSM	SFFDNISSELK	1945	sp|Q9BX40-2|LS14B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:188	ms_run[2]:scan=11323	66.918	2	1291.6392	1291.6392	K	T	317	328
PSM	SGFGEISSPVIR	1946	sp|P57740|NU107_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8014	47.104	2	1247.651	1247.6510	R	E	4	16
PSM	SGFGEISSPVIR	1947	sp|P57740|NU107_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:267	ms_run[2]:scan=8022	47.151	2	1257.6593	1257.6593	R	E	4	16
PSM	SGLSSPIYIDLR	1948	sp|P11172|UMPS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:267	ms_run[2]:scan=10365	61.002	2	1329.7168	1329.7168	K	G	30	42
PSM	SGTNMGEGLLGEFR	1949	sp|P52429|DGKE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	14-UNIMOD:267	ms_run[2]:scan=10651	62.764	2	1476.6906	1476.6906	R	I	228	242
PSM	SHTILLVQPTK	1950	sp|P84090|ERH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:1,11-UNIMOD:188	ms_run[2]:scan=6990	41.481	2	1283.7545	1283.7545	M	R	2	13
PSM	SIQEELQQLR	1951	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:267	ms_run[2]:scan=8619	50.586	2	1252.6651	1252.6651	R	Q	1554	1564
PSM	SLAEANNLSFPLEPLSR	1952	sp|Q8ND76-3|CCNY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11626	68.834	2	1856.9632	1856.9632	R	E	226	243
PSM	SLAEANNLSFPLEPLSR	1953	sp|Q8ND76-3|CCNY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	17-UNIMOD:267	ms_run[2]:scan=11634	68.884	2	1866.9715	1866.9715	R	E	226	243
PSM	SPQENLVPCDVLLLR	1954	sp|Q9HD20-2|AT131_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:4	ms_run[2]:scan=12070	71.63	3	1751.924	1751.9240	R	G	210	225
PSM	SPQIFDDER	1955	sp|O94832|MYO1D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267	ms_run[2]:scan=4570	28.587	2	1115.5123	1115.5123	K	C	597	606
PSM	SPVPSAFSDQSR	1956	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4582	28.645	2	1276.6048	1276.6048	R	C	2449	2461
PSM	SQWSPALTISK	1957	sp|P62837-2|UB2D2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:188	ms_run[2]:scan=7511	44.344	2	1222.6653	1222.6653	R	V	62	73
PSM	SSVLESLVGR	1958	sp|O00429-4|DNM1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:267	ms_run[2]:scan=9354	54.925	2	1055.585	1055.5850	K	D	39	49
PSM	SVGEVMGIGR	1959	sp|P27708|PYR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:267	ms_run[2]:scan=5648	34.233	2	1013.5203	1013.5203	K	S	761	771
PSM	SWNETLTSR	1960	sp|O75947-2|ATP5H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4952	30.559	2	1092.52	1092.5200	K	L	33	42
PSM	TALFEEISR	1961	sp|Q14683|SMC1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7918	46.58	2	1064.5502	1064.5502	R	S	152	161
PSM	TAVCDIPPR	1962	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	4-UNIMOD:4,9-UNIMOD:267	ms_run[2]:scan=2370	16.804	2	1037.5203	1037.5203	K	G	351	360
PSM	TAVCDIPPR	1963	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	4-UNIMOD:4,9-UNIMOD:267	ms_run[2]:scan=2766	18.975	2	1037.5203	1037.5203	K	G	351	360
PSM	TAVCDIPPR	1964	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	4-UNIMOD:4,9-UNIMOD:267	ms_run[2]:scan=4009	25.64	2	1037.5203	1037.5203	K	G	351	360
PSM	TAVCDIPPR	1965	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	4-UNIMOD:4	ms_run[2]:scan=3120	20.896	2	1027.5121	1027.5121	K	G	351	360
PSM	TENLLGSYFPK	1966	sp|Q06323-3|PSME1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10394	61.174	2	1267.6449	1267.6449	K	K	25	36
PSM	TFAPEEISAMVLTK	1967	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	14-UNIMOD:188	ms_run[2]:scan=11979	71.055	2	1541.8107	1541.8107	K	M	139	153
PSM	TGFFEFQAAK	1968	sp|Q9P2J5|SYLC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:188	ms_run[2]:scan=9431	55.385	2	1150.5754	1150.5754	K	D	823	833
PSM	TIISYIDEQFER	1969	sp|Q15019|SEPT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:267	ms_run[2]:scan=12497	74.391	2	1522.7543	1522.7543	K	Y	117	129
PSM	TLAAEMQELR	1970	sp|Q8N163-2|CCAR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:267	ms_run[2]:scan=7674	45.239	2	1170.5942	1170.5942	K	V	856	866
PSM	TLEEILLER	1971	sp|O75152|ZC11A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10452	61.537	2	1114.6234	1114.6234	K	A	360	369
PSM	TLEEILLER	1972	sp|O75152|ZC11A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267	ms_run[2]:scan=10459	61.581	2	1124.6317	1124.6317	K	A	360	369
PSM	TLQIFNIEMK	1973	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:188	ms_run[2]:scan=11522	68.184	2	1241.6785	1241.6785	K	S	87	97
PSM	TNQELQEINR	1974	sp|P07355|ANXA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:267	ms_run[2]:scan=3038	20.474	2	1253.6239	1253.6239	R	V	136	146
PSM	TPAQFDADELR	1975	sp|P04083|ANXA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:267	ms_run[2]:scan=5907	35.645	2	1271.6021	1271.6021	K	A	114	125
PSM	VDLPLAVLSK	1976	sp|Q9H773|DCTP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10784	63.582	2	1053.6434	1053.6434	R	M	112	122
PSM	VDLPLAVLSK	1977	sp|Q9H773|DCTP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:188	ms_run[2]:scan=10786	63.594	2	1059.6635	1059.6635	R	M	112	122
PSM	VFNQEGEFMLK	1978	sp|Q9C040|TRIM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:188	ms_run[2]:scan=8586	50.405	2	1346.6636	1346.6636	K	F	648	659
PSM	VFNYNTLER	1979	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6359	38.095	2	1154.572	1154.5720	R	V	54	63
PSM	VGEFSGANK	1980	sp|P10599-2|THIO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:188	ms_run[2]:scan=1176	10.153	2	913.46007	913.4601	K	E	66	75
PSM	VGEFSGANK	1981	sp|P10599-2|THIO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=1177	10.157	2	907.43995	907.4399	K	E	66	75
PSM	VGIENFELLK	1982	sp|O75582-2|KS6A5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:188	ms_run[2]:scan=10903	64.311	2	1166.6643	1166.6643	K	V	44	54
PSM	VGPDVVTDPAFLVTR	1983	sp|Q9NV31|IMP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	15-UNIMOD:267	ms_run[2]:scan=10686	62.973	2	1594.8594	1594.8594	R	S	138	153
PSM	VITCGWDGLIK	1984	sp|O60508|PRP17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	4-UNIMOD:4,11-UNIMOD:188	ms_run[2]:scan=9843	57.857	2	1266.6738	1266.6738	K	L	566	577
PSM	VLDASWYSPGTR	1985	sp|Q16762|THTR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7518	44.382	2	1350.6568	1350.6568	R	E	31	43
PSM	VLEVPPVVYSR	1986	sp|O00154-2|BACH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:267	ms_run[2]:scan=8572	50.329	2	1266.7211	1266.7211	K	Q	131	142
PSM	VLGMDPLPSK	1987	sp|Q12906-4|ILF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:188	ms_run[2]:scan=7060	41.877	2	1061.5886	1061.5886	K	M	333	343
PSM	VLLPEYGGTK	1988	sp|P61604|CH10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:188	ms_run[2]:scan=5983	36.052	2	1081.6115	1081.6115	K	V	71	81
PSM	VLSVPESTPFTAVLK	1989	sp|P61960|UFM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11520	68.172	2	1586.892	1586.8920	K	F	20	35
PSM	VNFAMNVGK	1990	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:188	ms_run[2]:scan=5665	34.317	2	984.51582	984.5158	R	A	490	499
PSM	VNFTVDQIR	1991	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6826	40.611	2	1090.5771	1090.5771	M	A	2	11
PSM	VNILEVASGAVLR	1992	sp|Q12788|TBL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=12703	75.881	2	1339.7823	1339.7823	R	S	47	60
PSM	VNPVTLETVLR	1993	sp|Q96H55-2|MYO19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9941	58.448	2	1239.7187	1239.7187	R	C	43	54
PSM	VPDVQDGVR	1994	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267	ms_run[2]:scan=2670	18.415	2	993.51188	993.5119	R	A	402	411
PSM	VQQTVQDLFGR	1995	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7927	46.626	2	1289.6728	1289.6728	K	A	395	406
PSM	VTPLGAGQDVGR	1996	sp|Q5TA45-2|INT11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3664	23.772	2	1168.62	1168.6200	R	S	6	18
PSM	VVLIGDSGVGK	1997	sp|P62491-2|RB11A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:188	ms_run[2]:scan=5546	33.705	2	1048.6224	1048.6224	K	S	14	25
PSM	VVTDLISLIR	1998	sp|P38432|COIL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=12200	72.453	2	1127.6914	1127.6914	R	Q	37	47
PSM	VVTYGMANLLTGPK	1999	sp|Q99536-2|VAT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	14-UNIMOD:188	ms_run[2]:scan=10446	61.499	2	1468.8055	1468.8055	K	R	148	162
PSM	WINATDPSAR	2000	sp|P08243-3|ASNS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:267	ms_run[2]:scan=4359	27.51	2	1139.5599	1139.5599	K	T	458	468
PSM	YDWDLLAAR	2001	sp|Q15029-2|U5S1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267	ms_run[2]:scan=10838	63.913	2	1131.5588	1131.5588	K	S	687	696
PSM	YGGDEIPFSPYR	2002	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8783	51.54	2	1399.6408	1399.6408	K	V	1622	1634
PSM	YGPPPSYPNLK	2003	sp|Q13435|SF3B2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5490	33.404	2	1231.6237	1231.6237	R	I	639	650
PSM	YGVNPGPIVGTTR	2004	sp|P42166|LAP2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5736	34.674	2	1329.7041	1329.7041	K	K	127	140
PSM	YMACCLLYR	2005	sp|P68363-2|TBA1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	4-UNIMOD:4,5-UNIMOD:4,9-UNIMOD:267	ms_run[2]:scan=7855	46.261	2	1258.5536	1258.5536	K	G	196	205
PSM	YPVNSVNILK	2006	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:188	ms_run[2]:scan=7235	42.812	2	1151.6646	1151.6646	R	A	190	200
PSM	YPVNSVNILK	2007	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7236	42.817	2	1145.6445	1145.6445	R	A	190	200
PSM	YWLEEAECR	2008	sp|P55884|EIF3B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	8-UNIMOD:4,9-UNIMOD:267	ms_run[2]:scan=7412	43.822	2	1264.5422	1264.5422	R	D	295	304
PSM	SYTSGPGSR	2009	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=752	7.875521666666666	2	910.413218	910.414459	R	I	24	33
PSM	SLDMDSIIAEVK	2010	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:35	ms_run[1]:scan=8112	47.66269833333333	2	1335.660183	1335.659183	R	A	253	265
PSM	QLREYQELMNVK	2011	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28,9-UNIMOD:35	ms_run[1]:scan=7920	46.58831166666666	2	1548.7629	1548.7601	R	L	370	382
PSM	DGKLVSESSDVLPK	2012	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=6146	36.886626666666665	2	1472.774466	1472.772239	R	-	470	484
PSM	QSVENDIHGLR	2013	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28	ms_run[1]:scan=6011	36.18295166666667	2	1249.6051	1249.6046	R	K	176	187
PSM	QSVENDIHGLR	2014	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28,11-UNIMOD:267	ms_run[1]:scan=6198	37.18094	2	1259.6130	1259.6129	R	K	176	187
PSM	QSVENDIHGLR	2015	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28,11-UNIMOD:267	ms_run[1]:scan=6004	36.14723	2	1259.6130	1259.6129	R	K	176	187
PSM	ALEAANGELEVK	2016	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	12-UNIMOD:188	ms_run[1]:scan=5120	31.454073333333334	2	1248.665908	1248.665711	R	I	100	112
PSM	VLDELTLAR	2017	sp|P02533|K1C14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=7504	44.308616666666666	2	1028.585861	1028.586610	R	A	224	233
PSM	VLDELTLAR	2018	sp|P02533|K1C14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	9-UNIMOD:267	ms_run[1]:scan=7497	44.273556666666664	2	1038.593725	1038.594879	R	A	224	233
PSM	QNGDDPLLTYRFPPK	2019	sp|P02545|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28,11-UNIMOD:267,15-UNIMOD:188	ms_run[1]:scan=11015	65.00915333333333	2	1758.8934	1758.8907	R	F	472	487
PSM	QNGDDPLLTYRFPPK	2020	sp|P02545|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28	ms_run[1]:scan=11388	67.32466666666666	2	1742.8655	1742.8623	R	F	472	487
PSM	QNGDDPLLTYRFPPK	2021	sp|P02545|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28,11-UNIMOD:267,15-UNIMOD:188	ms_run[1]:scan=10849	63.98000666666667	2	1758.8934	1758.8907	R	F	472	487
PSM	QRYEILTPNSIPK	2022	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28,2-UNIMOD:267,13-UNIMOD:188	ms_run[1]:scan=8727	51.217713333333336	2	1556.8573	1556.8528	R	G	719	732
PSM	LWDLTTGTTTR	2023	sp|P63244|RACK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=7897	46.477	2	1263.646755	1263.645916	R	R	89	100
PSM	QKLDILDQER	2024	sp|Q13813|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28,2-UNIMOD:188,10-UNIMOD:267	ms_run[1]:scan=7681	45.27779	2	1255.6748	1255.6738	K	A	1418	1428
PSM	QKLDILDQER	2025	sp|Q13813|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28	ms_run[1]:scan=7678	45.258065	2	1239.6463	1239.6454	K	A	1418	1428
PSM	QITVNDLPVGR	2026	sp|Q06830|PRDX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	11-UNIMOD:267	ms_run[1]:scan=6934	41.17178166666667	2	1221.694966	1220.675255	R	S	141	152
PSM	FVEGLPINDFSR	2027	sp|P40925|MDHC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	12-UNIMOD:267	ms_run[1]:scan=10726	63.21852833333333	2	1403.694513	1402.712034	K	E	299	311
PSM	ICDDELILIK	2028	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	2-UNIMOD:4	ms_run[1]:scan=9700	56.98586666666666	2	1230.655637	1230.652976	R	N	356	366
PSM	CVELVHEEMQR	2029	sp|O00429|DNM1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:385,1-UNIMOD:4,11-UNIMOD:267	ms_run[1]:scan=9264	54.39808000000001	2	1421.6330	1421.6302	R	I	431	442
PSM	CEFAVGYQR	2030	sp|Q9P2J5|SYLC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:4,9-UNIMOD:267	ms_run[1]:scan=4867	30.098245000000002	2	1138.513291	1138.510498	K	L	70	79
PSM	CLEKEVAALCR	2031	sp|P12956|XRCC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:385,1-UNIMOD:4,4-UNIMOD:188,10-UNIMOD:4,11-UNIMOD:267	ms_run[1]:scan=10266	60.40196666666666	2	1346.6606	1346.6652	K	Y	389	400
PSM	CLEKEVAALCR	2032	sp|P12956|XRCC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:385,1-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=10273	60.44492333333333	2	1330.6321	1330.6368	K	Y	389	400
PSM	LVIDQIDNGFFSPK	2033	sp|P06737|PYGL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	14-UNIMOD:188	ms_run[1]:scan=11827	70.07930166666667	2	1597.845449	1597.844738	K	Q	741	755
PSM	CGEEGHLSPYCR	2034	sp|Q9NUD5|ZCHC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:385,1-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=4732	29.41144166666667	2	1446.5683	1446.5651	R	K	356	368
PSM	NEGNIFPNPEATFVK	2035	sp|Q9Y5B9|SP16H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	15-UNIMOD:188	ms_run[1]:scan=10178	59.869515	2	1682.849232	1681.840715	R	E	582	597
PSM	QITQLLPEDLRK	2036	sp|Q7Z4H3|HDDC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28,11-UNIMOD:267,12-UNIMOD:188	ms_run[1]:scan=11174	65.994395	2	1451.8295	1451.8314	K	E	108	120
PSM	CYSCGEFGHIQK	2037	sp|P62633|CNBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:385,1-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=6749	40.201406666666664	2	1467.5919	1467.5906	K	D	119	131
PSM	SINGLGQILETQR	2038	sp|Q9BRT8|CBWD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	13-UNIMOD:267	ms_run[1]:scan=9565	56.174753333333335	2	1438.772071	1437.781511	R	S	222	235
PSM	QEELEAALQR	2039	sp|P08729|K2C7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0		ms_run[1]:scan=7673	45.23506	2	1186.6182	1185.5982	K	G	354	364
PSM	QGLQTTQAHLER	2040	sp|Q14C86|GAPD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28,12-UNIMOD:267	ms_run[1]:scan=4344	27.422128333333333	2	1374.6982	1373.6922	R	L	1222	1234
PSM	NLGLEELGIELDPR	2041	sp|P09622|DLDH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	14-UNIMOD:267	ms_run[1]:scan=12465	74.17219666666666	2	1576.837439	1576.833606	K	G	321	335
PSM	QIFQPSVQQQPTKPVK	2042	sp|Q9UBW7|ZMYM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28,13-UNIMOD:188,16-UNIMOD:188	ms_run[1]:scan=6633	39.585190000000004	2	1849.0442	1847.0342	K	V	313	329
PSM	IYVGNLPPDIR	2043	sp|Q07955|SRSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	11-UNIMOD:267	ms_run[1]:scan=7991	46.973695	2	1265.702091	1265.700741	R	T	18	29
PSM	LMVEFPLDPALSK	2044	sp|Q92620|PRP16_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=12449	74.05335500000001	2	1459.779661	1458.779239	R	M	945	958
PSM	QQHVIETLIGK	2045	sp|P48643|TCPE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28	ms_run[1]:scan=9744	57.25545166666667	2	1247.6886	1247.6869	K	K	503	514
PSM	EEAEGAEDRQPASR	2046	sp|Q6NTF9-2|RHBD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:27,14-UNIMOD:267	ms_run[1]:scan=5278	32.286368333333336	2	1537.6712	1535.6832	R	R	24	38
PSM	IAVAGDLFQPER	2047	sp|Q14393|GAS6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	12-UNIMOD:267	ms_run[1]:scan=8869	52.04472833333333	2	1325.6872	1324.7012	K	G	403	415
PSM	IDPSSLSFNMWK	2048	sp|Q8WTV0|SCRB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	12-UNIMOD:188	ms_run[1]:scan=11777	69.76061166666668	2	1430.721010	1429.700716	R	E	46	58
PSM	HGQSFVDSSSMWGPR	2049	sp|Q9P2D1|CHD7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	15-UNIMOD:267	ms_run[1]:scan=12354	73.43552666666668	2	1686.767854	1686.744808	R	A	134	149
PSM	GAPNPWLFEEPEETR	2050	sp|Q9UNK0|STX8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=10570	62.264831666666666	2	1772.859930	1770.821314	R	G	119	134
PSM	AALEALGSCLNNK	2051	sp|P34897|GLYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	9-UNIMOD:4	ms_run[1]:scan=6910	41.042535	2	1359.682125	1359.681650	R	Y	83	96
PSM	ANLPQSFQVDTSK	2052	sp|P21333|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	13-UNIMOD:188	ms_run[1]:scan=6304	37.78476	2	1439.741504	1439.735187	R	A	1465	1478
PSM	VDGMDILCVR	2053	sp|P08559|ODPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	8-UNIMOD:4,10-UNIMOD:267	ms_run[1]:scan=9596	56.36579166666666	2	1186.570661	1186.571384	R	E	254	264
PSM	AALSALESFLK	2054	sp|P78527-2|PRKDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:188	ms_run[2]:scan=12729	76.074	2	1154.6643	1154.6643	K	Q	311	322
PSM	ACGLVASNLNLKPGECLR	2055	sp|P09382|LEG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:1,2-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=10066	59.2	3	2013.0136	2013.0136	M	V	2	20
PSM	ADFQGISPER	2056	sp|P61803|DAD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=4613	28.801	2	1128.5439	1128.5439	K	A	83	93
PSM	ADLINNLGTIAK	2057	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	12-UNIMOD:188	ms_run[2]:scan=8867	52.035	2	1247.7181	1247.7181	K	S	96	108
PSM	ADMQNLVERLER	2058	sp|Q01518-2|CAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:1,9-UNIMOD:267,12-UNIMOD:267	ms_run[2]:scan=12056	71.546	2	1534.7677	1534.7677	M	A	2	14
PSM	AELNEFLTR	2059	sp|P23396|RS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7871	46.343	2	1091.5611	1091.5611	K	E	19	28
PSM	AEVLWLMGAK	2060	sp|O94906-2|PRP6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11306	66.811	2	1116.6002	1116.6002	K	S	607	617
PSM	AFDSGIIPMEFVNK	2061	sp|P53396-3|ACLY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11927	70.716	2	1566.7752	1566.7752	K	M	678	692
PSM	AFLFDVVSK	2062	sp|Q9NQL2-2|RRAGD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:188	ms_run[2]:scan=10829	63.859	2	1030.5795	1030.5795	K	I	109	118
PSM	AGFAGDQIPK	2063	sp|P61163|ACTZ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=4485	28.156	2	1002.5134	1002.5134	K	Y	23	33
PSM	AISSDMFFGR	2064	sp|Q8N6H7-3|ARFG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=9345	54.872	2	1139.5309	1139.5309	K	E	161	171
PSM	AKPQVVVAPVLMSK	2065	sp|Q9H074-3|PAIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:1,2-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=8836	51.849	2	1519.9199	1519.9199	M	L	2	16
PSM	ALELNMLSLK	2066	sp|Q9Y617|SERC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:188	ms_run[2]:scan=11128	65.714	2	1136.6571	1136.6571	K	G	324	334
PSM	ALQFLEEVK	2067	sp|P40227-2|TCPZ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9359	54.951	2	1075.5914	1075.5914	K	V	85	94
PSM	AQLLELPYAR	2068	sp|P50453|SPB9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9615	56.48	2	1172.6554	1172.6554	R	K	214	224
PSM	AQLLQPTLEINPR	2069	sp|Q12931-2|TRAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9114	53.479	2	1491.8409	1491.8409	R	H	582	595
PSM	AQVFSCPACR	2070	sp|Q96T88|UHRF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	6-UNIMOD:4,9-UNIMOD:4,10-UNIMOD:267	ms_run[2]:scan=3311	21.911	2	1204.5357	1204.5357	R	Y	754	764
PSM	ATALIEDIFAR	2071	sp|Q9H3H1-4|MOD5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:267	ms_run[2]:scan=12148	72.124	2	1228.6691	1228.6691	R	D	102	113
PSM	ATNFLAHEK	2072	sp|P29692-3|EF1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:1,9-UNIMOD:188	ms_run[2]:scan=6047	36.368	2	1077.555	1077.5550	M	I	2	11
PSM	ATNFLAHEK	2073	sp|P29692-3|EF1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:1	ms_run[2]:scan=6048	36.372	2	1071.5349	1071.5349	M	I	2	11
PSM	AVAVGRPSNEELR	2074	sp|Q9NVA2|SEP11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:1	ms_run[2]:scan=4863	30.078	2	1438.7528	1438.7528	M	N	2	15
PSM	AVLIAGQPGTGK	2075	sp|Q9Y230|RUVB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	12-UNIMOD:188	ms_run[2]:scan=3505	22.9	2	1116.6598	1116.6598	R	T	72	84
PSM	AVSDWLIASVEGR	2076	sp|Q969V3-2|NCLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=12365	73.503	2	1401.7252	1401.7252	K	L	195	208
PSM	AWVGGVGNYK	2077	sp|O15382-2|BCAT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:188	ms_run[2]:scan=5494	33.429	2	1055.5496	1055.5496	R	L	128	138
PSM	CEFAVGYQR	2078	sp|Q9P2J5|SYLC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:4,9-UNIMOD:267	ms_run[2]:scan=4888	30.206	2	1138.5105	1138.5105	K	L	70	79
PSM	CLQNPSSDIR	2079	sp|Q92616|GCN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:4	ms_run[2]:scan=3068	20.629	2	1188.5557	1188.5557	K	L	2558	2568
PSM	CMTNTPVVVR	2080	sp|P32322-2|P5CR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:4	ms_run[2]:scan=4080	26.038	2	1175.5791	1175.5791	R	E	120	130
PSM	CNSLLPLDDIVR	2081	sp|Q14643-4|ITPR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:4	ms_run[2]:scan=11392	67.348	2	1413.7286	1413.7286	K	V	1382	1394
PSM	CNSLLPLDDIVR	2082	sp|Q14643-4|ITPR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:4	ms_run[2]:scan=11395	67.37	2	1413.7286	1413.7286	K	V	1382	1394
PSM	DGPNALTPPPTTPEWIK	2083	sp|P05023-3|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	17-UNIMOD:188	ms_run[2]:scan=9589	56.321	2	1838.951	1838.9510	R	F	44	61
PSM	DLQNVNITLR	2084	sp|P35232|PHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=7523	44.405	2	1194.6596	1194.6596	K	I	84	94
PSM	DLVLPTQALPASPALK	2085	sp|Q15554|TERF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	16-UNIMOD:188	ms_run[2]:scan=10762	63.444	2	1638.9652	1638.9652	K	N	354	370
PSM	DPWYSWDQPGLR	2086	sp|O95169-3|NDUB8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=10787	63.599	2	1518.6892	1518.6892	R	L	56	68
PSM	DPWYSWDQPGLR	2087	sp|O95169-3|NDUB8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	12-UNIMOD:267	ms_run[2]:scan=10799	63.673	2	1528.6974	1528.6974	R	L	56	68
PSM	DSTLIMQLLR	2088	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=12971	78.077	2	1198.6619	1198.6619	K	D	218	228
PSM	EDGMVPFVFVGTK	2089	sp|P51114-3|FXR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	13-UNIMOD:188	ms_run[2]:scan=11777	69.761	2	1430.7211	1430.7211	R	E	244	257
PSM	EGDVLTLLESER	2090	sp|P62857|RS28_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11423	67.542	2	1359.6882	1359.6882	R	E	52	64
PSM	ELDSITPEVLPGWK	2091	sp|Q16891-3|MIC60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11326	66.934	2	1582.8243	1582.8243	R	G	340	354
PSM	ELPPDQAEYCIAR	2092	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=6238	37.409	2	1570.7325	1570.7325	R	M	870	883
PSM	ELSAVTFPDIIR	2093	sp|P42224-2|STAT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	12-UNIMOD:267	ms_run[2]:scan=11620	68.801	2	1369.7481	1369.7481	K	N	638	650
PSM	ELSDFISYLQR	2094	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:267	ms_run[2]:scan=12147	72.118	2	1379.696	1379.6960	R	E	472	483
PSM	FASLEFSPGSK	2095	sp|Q8N766-3|EMC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7434	43.939	2	1168.5764	1168.5764	K	K	42	53
PSM	FEDENFILK	2096	sp|P62937-2|PPIA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:188	ms_run[2]:scan=8591	50.435	2	1159.5857	1159.5857	K	H	23	32
PSM	FEELNADLFR	2097	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=10289	60.543	2	1262.6171	1262.6171	R	G	302	312
PSM	FEELNMDLFR	2098	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11930	70.733	2	1312.6122	1312.6122	K	S	327	337
PSM	FEWELPLDEAQR	2099	sp|Q9BSJ8|ESYT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11966	70.966	2	1531.7307	1531.7307	R	R	1041	1053
PSM	FFDDPMLLELAK	2100	sp|Q15029-2|U5S1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=13053	78.796	2	1437.7214	1437.7214	K	Q	917	929
PSM	FGISEPGNQEK	2101	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:188	ms_run[2]:scan=4000	25.588	2	1210.5925	1210.5925	K	K	1900	1911
PSM	FGISEPGNQEK	2102	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=4002	25.599	2	1204.5724	1204.5724	K	K	1900	1911
PSM	FGISSVPTK	2103	sp|P82979|SARNP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5206	31.91	2	934.51238	934.5124	R	G	127	136
PSM	FLAEEGFYK	2104	sp|P46977|STT3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7426	43.895	2	1102.5335	1102.5335	R	F	59	68
PSM	FLAEEGFYK	2105	sp|P46977|STT3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:188	ms_run[2]:scan=7437	43.959	2	1108.5536	1108.5536	R	F	59	68
PSM	FLIPNASQAESK	2106	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	12-UNIMOD:188	ms_run[2]:scan=6537	39.061	2	1309.6973	1309.6973	K	V	104	116
PSM	FLNAENAQK	2107	sp|P43487-2|RANG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:188	ms_run[2]:scan=2025	15.077	2	1039.5394	1039.5394	R	F	142	151
PSM	FLNAENAQK	2108	sp|P43487-2|RANG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=2026	15.081	2	1033.5193	1033.5193	R	F	142	151
PSM	FNVWDVGGQDK	2109	sp|P62330|ARF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8874	52.072	2	1263.5884	1263.5884	K	I	59	70
PSM	GATQQILDEAER	2110	sp|P78371-2|TCPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6191	37.139	2	1329.6525	1329.6525	R	S	330	342
PSM	GFALVGVGSEASSK	2111	sp|Q16630-3|CPSF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7480	44.182	2	1307.6721	1307.6721	K	K	125	139
PSM	GFEGSFEELCR	2112	sp|P33121-2|ACSL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:4,11-UNIMOD:267	ms_run[2]:scan=8427	49.484	2	1339.5742	1339.5742	R	N	606	617
PSM	GGGQIIPTAR	2113	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=3268	21.692	2	978.5486	978.5486	R	R	717	727
PSM	GGPTPQEAIQR	2114	sp|Q9H444|CHM4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=2402	16.955	2	1152.5887	1152.5887	K	L	18	29
PSM	GLAAGSAETLPANFR	2115	sp|Q13136-2|LIPA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7462	44.089	2	1473.7576	1473.7576	R	V	1151	1166
PSM	GLGTDDNTLIR	2116	sp|P09525-2|ANXA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5519	33.565	2	1173.599	1173.5990	K	V	178	189
PSM	GLPWSCSADEVQR	2117	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	6-UNIMOD:4	ms_run[2]:scan=7181	42.529	2	1503.6776	1503.6776	R	F	17	30
PSM	GPATLVAPASVITIVK	2118	sp|Q9ULX9-2|MAFF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11127	65.708	2	1535.9287	1535.9287	R	S	97	113
PSM	GTLSGWILSK	2119	sp|P27824-2|CALX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:188	ms_run[2]:scan=10023	58.941	2	1066.6118	1066.6118	R	A	113	123
PSM	GTPLISPLIK	2120	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:188	ms_run[2]:scan=8786	51.561	2	1043.6686	1043.6686	R	W	826	836
PSM	GVLVVGIGSGTK	2121	sp|Q8WWH5|TRUB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	12-UNIMOD:188	ms_run[2]:scan=6573	39.252	2	1091.6646	1091.6646	R	M	126	138
PSM	GWDEALLTMSK	2122	sp|Q00688|FKBP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=10627	62.616	2	1249.6013	1249.6013	R	G	174	185
PSM	GYAFITFCGK	2123	sp|O43390-4|HNRPR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	8-UNIMOD:4	ms_run[2]:scan=9710	57.047	2	1162.5481	1162.5481	R	E	106	116
PSM	GYFEYIEENK	2124	sp|Q00839-2|HNRPU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:188	ms_run[2]:scan=8236	48.367	2	1296.597	1296.5970	R	Y	237	247
PSM	IAEESNFPFIK	2125	sp|P46459-2|NSF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9727	57.149	2	1293.6605	1293.6605	K	I	462	473
PSM	IAFAITAIK	2126	sp|P62269|RS18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:188	ms_run[2]:scan=9445	55.468	2	952.60528	952.6053	K	G	26	35
PSM	IAQITGPPDR	2127	sp|Q96AE4|FUBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=3272	21.707	2	1076.5854	1076.5854	R	C	322	332
PSM	IDIIPNPQER	2128	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6807	40.507	2	1193.6404	1193.6404	K	T	73	83
PSM	IGDPLLEDTR	2129	sp|P49189-2|AL9A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=6792	40.424	2	1137.5905	1137.5905	K	M	247	257
PSM	IGETPELCALTGPFER	2130	sp|O60294|TYW4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	8-UNIMOD:4	ms_run[2]:scan=11439	67.645	2	1788.8716	1788.8716	R	G	126	142
PSM	IIDEDGLLNLIR	2131	sp|P35251-2|RFC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	12-UNIMOD:267	ms_run[2]:scan=12889	77.384	2	1392.7852	1392.7852	K	T	469	481
PSM	IIGLDQVAGMSETALPGAFK	2132	sp|P35579-2|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	20-UNIMOD:188	ms_run[2]:scan=12809	76.681	2	2023.0755	2023.0755	R	T	482	502
PSM	IIPYLSFGEVEK	2133	sp|Q5T4S7-3|UBR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11408	67.447	2	1393.7493	1393.7493	R	M	4595	4607
PSM	ILDVLEEIPK	2134	sp|Q16718-2|NDUA5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:188	ms_run[2]:scan=11570	68.484	2	1173.6952	1173.6952	K	N	31	41
PSM	ILETWGELLSK	2135	sp|Q9Y3P9-2|RBGP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11809	69.964	2	1287.7075	1287.7075	K	W	469	480
PSM	ILIGNPGCTYK	2136	sp|Q9C0B1|FTO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	8-UNIMOD:4	ms_run[2]:scan=5595	33.968	2	1234.638	1234.6380	R	Y	97	108
PSM	INDFVLSPGPQPYK	2137	sp|Q9BY44-4|EIF2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	14-UNIMOD:188	ms_run[2]:scan=8555	50.232	2	1579.8342	1579.8342	K	V	109	123
PSM	INFDSNSAYR	2138	sp|Q9P2R7-2|SUCB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=4735	29.428	2	1195.5497	1195.5497	K	Q	253	263
PSM	INISEGNCPER	2139	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	8-UNIMOD:4,11-UNIMOD:267	ms_run[2]:scan=2807	19.179	2	1297.596	1297.5960	R	I	47	58
PSM	ISFLCDDLTR	2140	sp|Q9H5V8|CDCP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	5-UNIMOD:4,10-UNIMOD:267	ms_run[2]:scan=9509	55.844	2	1248.6048	1248.6048	K	L	397	407
PSM	ISFLCDDLTR	2141	sp|Q9H5V8|CDCP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	5-UNIMOD:4	ms_run[2]:scan=9518	55.897	2	1238.5965	1238.5965	K	L	397	407
PSM	ISFSNIISDMK	2142	sp|Q92665|RT31_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:188	ms_run[2]:scan=11913	70.621	2	1259.6527	1259.6527	K	V	199	210
PSM	ISGLIYEETR	2143	sp|P62805|H4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6314	37.841	2	1179.6136	1179.6136	R	G	47	57
PSM	ITLDNAYMEK	2144	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6349	38.041	2	1196.5747	1196.5747	K	C	142	152
PSM	IYVGNLPTDVR	2145	sp|Q13242|SRSF9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:267	ms_run[2]:scan=7349	43.477	2	1255.68	1255.6800	R	E	16	27
PSM	IYVISLAEPR	2146	sp|P14868-2|SYDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9309	54.666	2	1159.6601	1159.6601	K	L	42	52
PSM	IYYPDFIVPDPK	2147	sp|P49916-4|DNLI3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11072	65.363	2	1465.7493	1465.7493	K	K	679	691
PSM	KQNDVFGEAEQ	2148	sp|P31150|GDIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:188	ms_run[2]:scan=3697	23.951	2	1269.5933	1269.5933	R	-	437	448
PSM	LADIQIEQLNR	2149	sp|O60925|PFD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:267	ms_run[2]:scan=7584	44.739	2	1321.7229	1321.7229	K	T	29	40
PSM	LDDLVNWAR	2150	sp|O75251-2|NDUS7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8964	52.583	2	1100.5615	1100.5615	K	R	67	76
PSM	LDQLIYIPLPDEK	2151	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	13-UNIMOD:188	ms_run[2]:scan=12040	71.447	2	1561.8699	1561.8699	R	S	639	652
PSM	LEVAPISDIIAIK	2152	sp|P13804-2|ETFA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=12283	72.978	2	1380.8228	1380.8228	K	S	78	91
PSM	LFGETDYDAFQR	2153	sp|Q99633|PRP18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8981	52.676	2	1460.6572	1460.6572	R	L	97	109
PSM	LFQSNDPTLR	2154	sp|Q9Y678|COPG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5136	31.539	2	1189.6091	1189.6091	K	R	76	86
PSM	LFQSNDPTLR	2155	sp|Q9Y678|COPG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=5138	31.548	2	1199.6174	1199.6174	K	R	76	86
PSM	LGLSTLGELK	2156	sp|O43399-6|TPD54_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:188	ms_run[2]:scan=9042	53.046	2	1035.6271	1035.6271	R	Q	58	68
PSM	LGMLSPEGTCK	2157	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	3-UNIMOD:35,10-UNIMOD:4,11-UNIMOD:188	ms_run[2]:scan=2753	18.9	2	1213.5778	1213.5778	R	A	203	214
PSM	LGMLSPEGTCK	2158	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	3-UNIMOD:35,10-UNIMOD:4	ms_run[2]:scan=2759	18.935	2	1207.5577	1207.5577	R	A	203	214
PSM	LGMLSPEGTCK	2159	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:4,11-UNIMOD:188	ms_run[2]:scan=5025	30.95	2	1197.5829	1197.5829	R	A	203	214
PSM	LGTPQQIAIAR	2160	sp|Q7L576-2|CYFP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5484	33.376	2	1166.6772	1166.6772	R	E	635	646
PSM	LGTPVLQALGDGDFVK	2161	sp|Q16822|PCKGM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	16-UNIMOD:188	ms_run[2]:scan=11774	69.743	2	1634.8975	1634.8975	R	C	194	210
PSM	LIDFLECGK	2162	sp|P17844-2|DDX5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	7-UNIMOD:4,9-UNIMOD:188	ms_run[2]:scan=9551	56.094	2	1099.5679	1099.5679	R	T	149	158
PSM	LIDFLESGK	2163	sp|Q92841-1|DDX17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9209	54.054	2	1020.5492	1020.5492	R	T	226	235
PSM	LLLDPSSPPTK	2164	sp|Q6IAA8|LTOR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6059	36.424	2	1166.6547	1166.6547	K	A	21	32
PSM	LLSFSPEEFPTLK	2165	sp|Q5JSZ5-5|PRC2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	13-UNIMOD:188	ms_run[2]:scan=12129	72.005	2	1512.8171	1512.8171	R	A	164	177
PSM	LLSFSPEEFPTLK	2166	sp|Q5JSZ5-5|PRC2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=12131	72.016	2	1506.797	1506.7970	R	A	164	177
PSM	LLYEANLPENFR	2167	sp|Q8IYB5-3|SMAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9635	56.598	2	1477.7565	1477.7565	R	R	96	108
PSM	LMDEAVLALR	2168	sp|Q92616|GCN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=9531	55.972	2	1139.6248	1139.6248	R	N	314	324
PSM	LNILDTLSK	2169	sp|Q13200-2|PSMD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:188	ms_run[2]:scan=9950	58.5	2	1021.6115	1021.6115	R	F	545	554
PSM	LNILDTLSK	2170	sp|Q13200-2|PSMD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9965	58.591	2	1015.5914	1015.5914	R	F	545	554
PSM	LNIPVSQVNPR	2171	sp|P05023-3|AT1A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:267	ms_run[2]:scan=6250	37.479	2	1245.7069	1245.7069	R	D	617	628
PSM	LNPADAPNPVVFVATK	2172	sp|O94776-2|MTA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	16-UNIMOD:188	ms_run[2]:scan=9765	57.381	2	1657.9135	1657.9135	K	D	423	439
PSM	LPDGTSLTQTFR	2173	sp|Q04323|UBXN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7846	46.213	2	1334.683	1334.6830	R	A	220	232
PSM	LQFAYLENFKTK	2174	sp|Q9P232|CNTN3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=10148	59.695	2	1500.7977	1500.7977	K	M	116	128
PSM	LSNIFVIGK	2175	sp|P62701|RS4X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9300	54.617	2	989.59097	989.5910	R	G	222	231
PSM	LTMLDIASNR	2176	sp|Q15435-2|PP1R7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=8420	49.441	2	1142.5993	1142.5993	K	I	233	243
PSM	LTSFITVFK	2177	sp|Q13617|CUL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:188	ms_run[2]:scan=11152	65.86	2	1060.6264	1060.6264	R	Y	415	424
PSM	LTSLGVIGALVK	2178	sp|Q92600-3|CNOT9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11990	71.126	2	1169.7384	1169.7384	R	T	137	149
PSM	LVGEIMQETGTR	2179	sp|Q00341|VIGLN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6310	37.817	2	1332.6708	1332.6708	R	I	244	256
PSM	LVGSEVGDR	2180	sp|Q14653|IRF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:267	ms_run[2]:scan=1511	12.169	2	940.48533	940.4853	R	T	228	237
PSM	LVLDWDSVR	2181	sp|Q68EM7-4|RHG17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9990	58.735	2	1101.5819	1101.5819	R	A	144	153
PSM	LVLTNNQLTTLPR	2182	sp|Q9UQ13-2|SHOC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8667	50.867	2	1481.8566	1481.8566	K	G	430	443
PSM	LVQAFQFTDK	2183	sp|Q06830|PRDX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7824	46.088	2	1195.6237	1195.6237	R	H	159	169
PSM	LVVVGAGGVGK	2184	sp|P01111|RASN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=4509	28.277	2	954.58622	954.5862	K	S	6	17
PSM	MAPALSGANLTSPR	2185	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	14-UNIMOD:267	ms_run[2]:scan=6252	37.488	2	1394.7216	1394.7216	R	V	2371	2385
PSM	MAQYLEEER	2186	sp|Q16204|CCDC6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:35	ms_run[2]:scan=2722	18.72	2	1183.5179	1183.5179	K	H	287	296
PSM	MFESFIESVPLLK	2187	sp|P13861-2|KAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:35,13-UNIMOD:188	ms_run[2]:scan=13026	78.585	2	1560.8205	1560.8205	K	S	251	264
PSM	MGSQVIIPYR	2188	sp|Q16795|NDUA9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6836	40.658	2	1162.6169	1162.6169	R	C	76	86
PSM	MLPTLGGEEGVSR	2189	sp|Q9Y5Q8-2|TF3C5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:35,13-UNIMOD:267	ms_run[2]:scan=5913	35.682	2	1370.6739	1370.6739	K	I	39	52
PSM	MLQPCGPPADKPEEN	2190	sp|Q9BWJ5|SF3B5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	5-UNIMOD:4,11-UNIMOD:188	ms_run[2]:scan=3726	24.107	2	1687.7641	1687.7641	K	-	72	87
PSM	MNLSAIQDR	2191	sp|Q9NVJ2|ARL8B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:267	ms_run[2]:scan=5310	32.45	2	1056.5261	1056.5261	K	E	147	156
PSM	MTDQEAIQDLWQWR	2192	sp|P06748|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:35	ms_run[2]:scan=12474	74.23	2	1834.8308	1834.8308	R	K	278	292
PSM	MVEFLQCTVPCR	2193	sp|Q96D46|NMD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:35,7-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=7767	45.762	2	1554.6993	1554.6993	K	Y	208	220
PSM	MVEGYQGLR	2194	sp|Q15149|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:267	ms_run[2]:scan=4372	27.572	2	1061.5203	1061.5203	R	C	308	317
PSM	MVGGVLVER	2195	sp|Q9UHV9|PFD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:35	ms_run[2]:scan=3921	25.156	2	974.5219	974.5219	R	T	73	82
PSM	NEGVATYAAAVLFR	2196	sp|P35222|CTNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=12350	73.408	2	1480.7674	1480.7674	R	M	648	662
PSM	NEGVATYAAAVLFR	2197	sp|P35222|CTNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	14-UNIMOD:267	ms_run[2]:scan=12355	73.441	2	1490.7757	1490.7757	R	M	648	662
PSM	NFGDQPDIR	2198	sp|Q15393|SF3B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:267	ms_run[2]:scan=3970	25.417	2	1070.502	1070.5020	K	C	260	269
PSM	NGQDLGVAFK	2199	sp|Q00839-2|HNRPU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:188	ms_run[2]:scan=5358	32.695	2	1053.555	1053.5550	K	I	405	415
PSM	NICFTVWDVGGQDR	2200	sp|P18085|ARF4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	3-UNIMOD:4	ms_run[2]:scan=11320	66.895	2	1665.7569	1665.7569	K	I	60	74
PSM	NLANTVTEEILEK	2201	sp|O60506-4|HNRPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11180	66.031	2	1472.7722	1472.7722	R	A	309	322
PSM	NLFEDQNTLTSICEK	2202	sp|P55060-4|XPO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	13-UNIMOD:4	ms_run[2]:scan=9347	54.882	2	1810.8407	1810.8407	K	V	276	291
PSM	NLFNVVDCK	2203	sp|P55884|EIF3B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	8-UNIMOD:4	ms_run[2]:scan=8197	48.152	2	1107.5383	1107.5383	R	L	508	517
PSM	NLLDEELQR	2204	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:267	ms_run[2]:scan=7581	44.726	2	1138.5858	1138.5858	K	L	2340	2349
PSM	NLQSVVLSK	2205	sp|P43246-2|MSH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5523	33.583	2	986.57605	986.5760	K	M	8	17
PSM	NLVCTDLFTR	2206	sp|P26196|DDX6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	4-UNIMOD:4,10-UNIMOD:267	ms_run[2]:scan=9330	54.783	2	1247.6208	1247.6208	R	G	387	397
PSM	NLVEELPQPR	2207	sp|Q9BYD1|RM13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7179	42.519	2	1193.6404	1193.6404	K	K	140	150
PSM	NMQDLVEDFK	2208	sp|P13647|K2C5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:188	ms_run[2]:scan=10104	59.43	2	1243.585	1243.5850	R	N	246	256
PSM	NNSFVNEIISR	2209	sp|P43246-2|MSH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9257	54.354	2	1291.6521	1291.6521	K	I	853	864
PSM	NPETVMQFLEK	2210	sp|Q99797|MIPEP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11100	65.538	2	1334.654	1334.6540	K	L	313	324
PSM	NQEDIILFR	2211	sp|Q9BZI7-2|REN3B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9217	54.103	2	1146.6033	1146.6033	K	D	103	112
PSM	NVEDFTGPR	2212	sp|P61009|SPCS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3920	25.152	2	1033.4829	1033.4829	K	E	50	59
PSM	NVGLCEAIVQFTR	2213	sp|P86791|CCZ1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	5-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=11814	69.992	2	1515.7743	1515.7743	R	T	61	74
PSM	NVIVLQTVLQEVR	2214	sp|Q9Y2L1|RRP44_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	13-UNIMOD:267	ms_run[2]:scan=12737	76.148	2	1519.8961	1519.8961	R	N	87	100
PSM	NVQGIIEILK	2215	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:188	ms_run[2]:scan=10981	64.798	2	1131.6959	1131.6959	K	G	454	464
PSM	NVQGIIEILK	2216	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=10988	64.842	2	1125.6758	1125.6758	K	G	454	464
PSM	PVTALEYTFSR	2217	sp|P54709|AT1B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:267	ms_run[2]:scan=8756	51.386	2	1292.664	1292.6640	K	S	87	98
PSM	QAQAAVLAVLPR	2218	sp|Q99848|EBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8865	52.019	2	1235.735	1235.7350	R	L	111	123
PSM	QGAAIGIPYFTAYR	2219	sp|Q08257-3|QOR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	14-UNIMOD:267	ms_run[2]:scan=11416	67.497	2	1536.7964	1536.7964	K	A	125	139
PSM	QGNVLPLWGNEK	2220	sp|Q5VTL8-2|PR38B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9332	54.793	2	1353.7041	1353.7041	K	T	43	55
PSM	QIIVDPLSFSEER	2221	sp|P35221-2|CTNA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11068	65.34	2	1531.7882	1531.7882	K	F	288	301
PSM	QLFLDVLDGTK	2222	sp|Q5SRE5-2|NU188_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11876	70.388	2	1247.6762	1247.6762	R	A	1020	1031
PSM	QLGDAFADLSLK	2223	sp|P53367-2|ARFP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=10745	63.339	2	1276.6663	1276.6663	R	S	163	175
PSM	QVVQTPNTVLSTPFR	2224	sp|Q99459|CDC5L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	15-UNIMOD:267	ms_run[2]:scan=9181	53.89	2	1695.9183	1695.9183	R	T	400	415
PSM	SAIGEGMTR	2225	sp|P21281|VATB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:267	ms_run[2]:scan=2008	14.99	2	930.44683	930.4468	K	K	404	413
PSM	SANGVILTPGNTDGFLLPK	2226	sp|Q86TN4-2|TRPT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11333	66.98	2	1913.0258	1913.0258	R	Y	145	164
PSM	SFNVDLLAGK	2227	sp|O00214|LEG8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:188	ms_run[2]:scan=9432	55.39	2	1068.5911	1068.5911	K	S	213	223
PSM	SGELPPNINIKEPR	2228	sp|Q9H9B4|SFXN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:1	ms_run[2]:scan=7443	43.988	2	1604.8522	1604.8522	M	W	2	16
PSM	SGGNLEVMGLMLGK	2229	sp|Q92905|CSN5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11835	70.132	2	1404.7105	1404.7105	R	V	71	85
PSM	SGIQQIIECFR	2230	sp|Q2TB10|ZN800_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:4,11-UNIMOD:267	ms_run[2]:scan=11944	70.827	2	1359.6844	1359.6844	K	S	41	52
PSM	SGLELEPEEPPGWR	2231	sp|Q92888-2|ARHG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	14-UNIMOD:267	ms_run[2]:scan=9283	54.511	2	1604.771	1604.7710	R	E	353	367
PSM	SGVGNIFIK	2232	sp|P11940-2|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:188	ms_run[2]:scan=7230	42.792	2	939.5485	939.5485	K	N	96	105
PSM	SGVGNIFIK	2233	sp|P11940-2|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7232	42.8	2	933.52837	933.5284	K	N	96	105
PSM	SILAETEGMLR	2234	sp|Q9P2E9-3|RRBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:267	ms_run[2]:scan=10366	61.007	2	1228.6361	1228.6361	R	D	700	711
PSM	SIQEELQQLR	2235	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8620	50.59	2	1242.6568	1242.6568	R	Q	1554	1564
PSM	SIQFVDWCPTGFK	2236	sp|P68363-2|TBA1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	8-UNIMOD:4	ms_run[2]:scan=11902	70.552	2	1583.7442	1583.7443	R	V	224	237
PSM	SIVVSPILIPENQR	2237	sp|P55290-3|CAD13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	14-UNIMOD:267	ms_run[2]:scan=10074	59.25	2	1573.9067	1573.9067	R	Q	139	153
PSM	SLADGILLCK	2238	sp|Q14651|PLSI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:4	ms_run[2]:scan=8732	51.249	2	1088.59	1088.5900	K	M	158	168
PSM	SLEDQVEMLR	2239	sp|P14314-2|GLU2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8475	49.773	2	1218.5914	1218.5914	K	T	168	178
PSM	SLLNQCIEER	2240	sp|Q96GM8|TOE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	6-UNIMOD:4,10-UNIMOD:267	ms_run[2]:scan=5952	35.897	2	1270.6215	1270.6215	K	Y	75	85
PSM	SLLQALNEVK	2241	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:188	ms_run[2]:scan=9976	58.654	2	1119.6595	1119.6595	K	G	3748	3758
PSM	SLLQALNEVK	2242	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9978	58.665	2	1113.6394	1113.6394	K	G	3748	3758
PSM	SSNPMMVLQLPER	2243	sp|P78406|RAE1L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	13-UNIMOD:267	ms_run[2]:scan=10631	62.644	2	1510.7511	1510.7511	R	C	160	173
PSM	SSVLENFVGR	2244	sp|Q05193-5|DYN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=8672	50.898	2	1116.5803	1116.5803	K	D	45	55
PSM	SSVLESLVGR	2245	sp|O00429-4|DNM1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9356	54.935	2	1045.5768	1045.5768	K	D	39	49
PSM	SSWWIINPDGGK	2246	sp|O43524-2|FOXO3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	12-UNIMOD:188	ms_run[2]:scan=11361	67.156	2	1364.682	1364.6820	K	S	11	23
PSM	STGSIVGQQPFGGAR	2247	sp|P30038|AL4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	15-UNIMOD:267	ms_run[2]:scan=5817	35.138	2	1470.7455	1470.7455	K	A	510	525
PSM	SVFILGASGETGR	2248	sp|Q9BUP3-2|HTAI2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	13-UNIMOD:267	ms_run[2]:scan=7894	46.458	2	1302.6807	1302.6807	K	V	20	33
PSM	SVLIGEFLEK	2249	sp|O43148|MCES_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:188	ms_run[2]:scan=10876	64.146	2	1139.6534	1139.6534	K	V	181	191
PSM	SVLIGEFLEK	2250	sp|O43148|MCES_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=10886	64.206	2	1133.6332	1133.6332	K	V	181	191
PSM	SVVTSIFGVK	2251	sp|P41252|SYIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=10379	61.086	2	1035.5964	1035.5964	K	N	1116	1126
PSM	SWQGLDEVVR	2252	sp|Q9H267-2|VP33B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8367	49.134	2	1187.5935	1187.5935	R	L	442	452
PSM	TAVCDIPPR	2253	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	4-UNIMOD:4,9-UNIMOD:267	ms_run[2]:scan=2960	20.02	2	1037.5203	1037.5203	K	G	351	360
PSM	TAVCDIPPR	2254	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	4-UNIMOD:4	ms_run[2]:scan=2742	18.84	2	1027.5121	1027.5121	K	G	351	360
PSM	TDAQAPLPGGPR	2255	sp|Q96BI1|S22AI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=2967	20.054	2	1178.6044	1178.6044	K	A	211	223
PSM	TFANFPSGSPVSASTLAR	2256	sp|P98170|XIAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9347	54.882	2	1808.9057	1808.9057	K	A	32	50
PSM	TFEMSDFIVDTR	2257	sp|O75369-6|FLNB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	12-UNIMOD:267	ms_run[2]:scan=11494	68.005	2	1469.6736	1469.6736	R	D	1993	2005
PSM	TGEAIVDAALSALR	2258	sp|Q15084-3|PDIA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	14-UNIMOD:267	ms_run[2]:scan=12949	77.858	2	1395.7597	1395.7597	R	Q	116	130
PSM	TGMILLAGEITSR	2259	sp|P31153|METK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=10610	62.511	2	1360.7384	1360.7384	K	A	62	75
PSM	TLDLPIYVTR	2260	sp|P53621|COPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=10175	59.853	2	1199.6789	1199.6789	R	V	563	573
PSM	TLQIFNIEMK	2261	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:35,10-UNIMOD:188	ms_run[2]:scan=9788	57.524	2	1257.6734	1257.6734	K	S	87	97
PSM	TLQIFNIEMK	2262	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11526	68.206	2	1235.6584	1235.6584	K	S	87	97
PSM	TPVEVPVGGFK	2263	sp|Q15149|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:188	ms_run[2]:scan=6852	40.739	2	1134.638	1134.6380	K	G	3374	3385
PSM	TSESTGSLPSPFLR	2264	sp|O95456-2|PSMG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8565	50.291	2	1477.7413	1477.7413	K	A	156	170
PSM	TSFLDDAFR	2265	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:267	ms_run[2]:scan=9693	56.942	2	1080.5115	1080.5115	R	K	3612	3621
PSM	TSVLEMIAQAR	2266	sp|O60313-13|OPA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11514	68.131	2	1217.6438	1217.6438	K	I	266	277
PSM	TTELPAADPFALAPFPSK	2267	sp|Q6ZSR9|YJ005_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	18-UNIMOD:188	ms_run[2]:scan=12444	74.018	2	1877.987	1877.9870	R	S	333	351
PSM	TVQDALESLVAR	2268	sp|Q14694|UBP10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	12-UNIMOD:267	ms_run[2]:scan=11125	65.697	2	1310.7069	1310.7069	R	E	642	654
PSM	TVQGPPTSDDIFER	2269	sp|P04181|OAT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7254	42.923	2	1560.742	1560.7420	K	E	33	47
PSM	VAAAESMPLLLECAR	2270	sp|O00410-2|IPO5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	13-UNIMOD:4	ms_run[2]:scan=10775	63.526	2	1629.8218	1629.8218	R	V	661	676
PSM	VAIPASVLPGPEEPGGQR	2271	sp|P48681|NEST_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8440	49.56	2	1772.9421	1772.9421	R	Q	434	452
PSM	VCCEGMLIQLR	2272	sp|Q96A33-2|CCD47_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	2-UNIMOD:4,3-UNIMOD:4,11-UNIMOD:267	ms_run[2]:scan=8952	52.521	2	1387.665	1387.6650	R	F	213	224
PSM	VEFILEQMR	2273	sp|O00232-2|PSD12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:267	ms_run[2]:scan=10278	60.472	2	1173.6091	1173.6091	R	L	163	172
PSM	VFDFAGEEVR	2274	sp|Q9UEE9-2|CFDP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=8047	47.287	2	1177.5643	1177.5643	K	V	168	178
PSM	VFDFAGEEVR	2275	sp|Q9UEE9-2|CFDP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8050	47.308	2	1167.556	1167.5560	K	V	168	178
PSM	VFNYNTLER	2276	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:267	ms_run[2]:scan=6354	38.065	2	1164.5803	1164.5803	R	V	54	63
PSM	VGIENFELLK	2277	sp|O75582-2|KS6A5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=10906	64.327	2	1160.6441	1160.6441	K	V	44	54
PSM	VIDDTNITR	2278	sp|P05783|K1C18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:267	ms_run[2]:scan=2725	18.739	2	1055.5487	1055.5487	K	L	188	197
PSM	VILDLTPNYR	2279	sp|P08195-2|4F2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=8599	50.48	2	1212.6742	1212.6742	R	G	203	213
PSM	VLAALPAAELVQACR	2280	sp|Q9UK22|FBX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	14-UNIMOD:4	ms_run[2]:scan=10311	60.674	3	1580.8708	1580.8708	R	L	58	73
PSM	VLEGMEVVR	2281	sp|P23284|PPIB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:267	ms_run[2]:scan=6030	36.278	2	1040.5564	1040.5564	K	K	172	181
PSM	VLELDPALAPVVSR	2282	sp|O00170|AIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	14-UNIMOD:267	ms_run[2]:scan=10505	61.861	2	1487.8587	1487.8587	K	E	291	305
PSM	VLELDPALAPVVSR	2283	sp|O00170|AIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=10506	61.867	2	1477.8504	1477.8504	K	E	291	305
PSM	VLIEILCTR	2284	sp|P20073-2|ANXA7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	7-UNIMOD:4	ms_run[2]:scan=10140	59.648	2	1115.6373	1115.6373	R	T	257	266
PSM	VLLGVGDPK	2285	sp|O00567|NOP56_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5143	31.575	2	896.53312	896.5331	K	I	91	100
PSM	VLNTNIDGR	2286	sp|P62269|RS18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:267	ms_run[2]:scan=2945	19.939	2	1010.5384	1010.5384	R	R	15	24
PSM	VLQALEGLK	2287	sp|P39019|RS19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7365	43.57	2	969.58588	969.5859	R	M	103	112
PSM	VLSIGDGIAR	2288	sp|P25705-2|ATPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=6451	38.598	2	1009.5796	1009.5796	R	V	24	34
PSM	VNFAMNVGK	2289	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5666	34.321	2	978.49569	978.4957	R	A	490	499
PSM	VNFTVDQIR	2290	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:267	ms_run[2]:scan=6825	40.607	2	1100.5854	1100.5854	M	A	2	11
PSM	VNPVTALTLLEK	2291	sp|Q9Y2D4|EXC6B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=12013	71.271	2	1296.7653	1296.7653	R	M	759	771
PSM	VPDVQDGVR	2292	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:267	ms_run[2]:scan=2743	18.845	2	993.51188	993.5119	R	A	402	411
PSM	VPEVPTAPATDAAPK	2293	sp|Q9UHD8-7|SEPT9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	15-UNIMOD:188	ms_run[2]:scan=4977	30.695	2	1468.7869	1468.7869	K	R	153	168
PSM	VPEWVDTVK	2294	sp|P39019|RS19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6872	40.839	2	1071.5601	1071.5601	K	L	30	39
PSM	VPLDVACAR	2295	sp|Q15149|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	7-UNIMOD:4,9-UNIMOD:267	ms_run[2]:scan=4182	26.56	2	1009.5254	1009.5254	R	G	3289	3298
PSM	VSEEIFFGR	2296	sp|Q9Y4W6|AFG32_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:267	ms_run[2]:scan=8582	50.384	2	1092.5479	1092.5479	R	I	633	642
PSM	VSEEIFFGR	2297	sp|Q9Y4W6|AFG32_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8585	50.4	2	1082.5397	1082.5397	R	I	633	642
PSM	VSFELFADK	2298	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:188	ms_run[2]:scan=10183	59.902	2	1060.5536	1060.5536	R	V	20	29
PSM	VSFELFADK	2299	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=10193	59.961	2	1054.5335	1054.5335	R	V	20	29
PSM	VSGGPSLEQR	2300	sp|Q9Y262|EIF3L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=1636	12.825	2	1038.5333	1038.5333	K	F	144	154
PSM	VTLNPPGTFLEGVAK	2301	sp|Q86Y39|NDUAB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	15-UNIMOD:188	ms_run[2]:scan=10542	62.094	2	1547.8655	1547.8655	R	V	41	56
PSM	VVPCLVTPVTGR	2302	sp|O75369-6|FLNB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	4-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=7347	43.468	2	1306.7307	1306.7307	K	E	988	1000
PSM	WTLLQEQGTK	2303	sp|P13647|K2C5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:188	ms_run[2]:scan=7212	42.7	2	1208.6497	1208.6497	K	T	200	210
PSM	YGDGIQLTR	2304	sp|P15924-2|DESP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:267	ms_run[2]:scan=4737	29.443	2	1031.5275	1031.5275	K	S	95	104
PSM	YGEPGEVFINK	2305	sp|P23246-2|SFPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:188	ms_run[2]:scan=6496	38.852	2	1257.6337	1257.6337	K	G	320	331
PSM	YGPLSGVNVVYDQR	2306	sp|Q13595-2|TRA2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	14-UNIMOD:267	ms_run[2]:scan=8735	51.263	2	1575.7921	1575.7921	R	T	41	55
PSM	YIDQEELNK	2307	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3032	20.439	2	1150.5506	1150.5506	K	T	276	285
PSM	YWLEEAECR	2308	sp|P55884|EIF3B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	8-UNIMOD:4	ms_run[2]:scan=7408	43.799	2	1254.5339	1254.5339	R	D	295	304
PSM	LSELEAALQR	2309	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	10-UNIMOD:267	ms_run[1]:scan=7275	43.05024166666667	2	1138.623986	1138.622157	K	A	353	363
PSM	QSVENDIHGLR	2310	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28,11-UNIMOD:267	ms_run[1]:scan=2771	18.997988333333332	2	1259.6160	1259.6129	R	K	176	187
PSM	QSVENDIHGLR	2311	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28	ms_run[1]:scan=6204	37.21422333333334	2	1249.6051	1249.6046	R	K	176	187
PSM	TAVCDIPPR	2312	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:4,9-UNIMOD:267	ms_run[1]:scan=3358	22.158866666666665	2	1038.523360	1037.520334	K	G	351	360
PSM	ITMQNLNDR	2313	sp|P13646|K1C13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=4199	26.652193333333337	2	1103.539301	1103.539342	K	L	106	115
PSM	ITMQNLNDR	2314	sp|P13646|K1C13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	9-UNIMOD:267	ms_run[1]:scan=4251	26.914551666666668	2	1113.547316	1113.547611	K	L	106	115
PSM	ITMQNLNDR	2315	sp|P13646|K1C13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	9-UNIMOD:267	ms_run[1]:scan=4055	25.899063333333334	2	1113.549222	1113.547611	K	L	106	115
PSM	ILGATIENSR	2316	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=4330	27.345321666666667	2	1072.588515	1072.587673	K	I	141	151
PSM	QGNLSSQVPLKR	2317	sp|P78527|PRKDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28,11-UNIMOD:188,12-UNIMOD:267	ms_run[1]:scan=5163	31.680784999999997	2	1324.7440	1324.7429	K	L	3148	3160
PSM	AFLASPEYVNLPINGNGKQ	2318	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=10640	62.69902	3	2033.040353	2031.042541	K	-	192	211
PSM	QNISPDKIPWSALK	2319	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28,7-UNIMOD:188,14-UNIMOD:188	ms_run[1]:scan=10770	63.492828333333335	2	1590.8762	1590.8803	R	T	4231	4245
PSM	SIQFVDWCPTGFK	2320	sp|P68363|TBA1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	8-UNIMOD:4,13-UNIMOD:188	ms_run[1]:scan=12166	72.237165	2	1590.752456	1589.764379	R	V	340	353
PSM	GEGQLGPAER	2321	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1260	10.752065	2	1012.495989	1012.493772	K	A	240	250
PSM	QNGDDPLLTYRFPPK	2322	sp|P02545|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28	ms_run[1]:scan=9860	57.96285666666667	2	1743.8692	1742.8622	R	F	472	487
PSM	QNGDDPLLTYRFPPK	2323	sp|P02545|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28	ms_run[1]:scan=10215	60.091315	2	1744.8632	1742.8622	R	F	472	487
PSM	QNGDDPLLTYRFPPK	2324	sp|P02545|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28,11-UNIMOD:267,15-UNIMOD:188	ms_run[1]:scan=11343	67.042535	2	1758.8934	1758.8907	R	F	472	487
PSM	IMGIPEEEQMGLLR	2325	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	14-UNIMOD:267	ms_run[1]:scan=10962	64.680245	2	1624.817132	1624.819218	R	V	328	342
PSM	QPAEHLQLLEEAAK	2326	sp|P33992|MCM5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28,14-UNIMOD:188	ms_run[1]:scan=9504	55.81192166666667	2	1564.8253	1564.8187	K	E	91	105
PSM	QPAIISQLDPVNER	2327	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28	ms_run[1]:scan=11606	68.71198666666668	2	1561.8123	1561.8095	K	M	1117	1131
PSM	DIDAFWLQR	2328	sp|O75643|U520_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	9-UNIMOD:267	ms_run[1]:scan=11570	68.484155	2	1172.583943	1172.585377	R	Q	262	271
PSM	QITVNDLPVGR	2329	sp|Q06830|PRDX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28,11-UNIMOD:267	ms_run[1]:scan=9579	56.26263	2	1203.6500	1203.6482	R	S	141	152
PSM	KGQGGAGAGDDEEED	2330	sp|P46781|RS9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:188	ms_run[1]:scan=521	6.52794	2	1440.559204	1439.574389	K	-	180	195
PSM	QIWQNLGLDDTK	2331	sp|P49588|SYAC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28,12-UNIMOD:188	ms_run[1]:scan=12132	72.02200166666667	2	1418.7124	1418.7132	K	I	154	166
PSM	GNLGAGNGNLQGPR	2332	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	14-UNIMOD:267	ms_run[1]:scan=3224	21.448141666666665	2	1334.660030	1333.672629	R	H	374	388
PSM	QVHPDTGISSK	2333	sp|P33778|H2B1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28	ms_run[1]:scan=2167	15.785423333333334	2	1150.5644	1150.5613	K	A	48	59
PSM	GNRGMEELIPLVNK	2334	sp|P50570|DYN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1	ms_run[1]:scan=10911	64.36075166666667	2	1610.8582	1610.8442	M	L	2	16
PSM	LQVWDTAGQER	2335	sp|P51153|RAB13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=5922	35.73666666666667	2	1301.640548	1301.636414	K	F	59	70
PSM	MIDMLAANSGR	2336	sp|Q7L014|DDX46_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:35,11-UNIMOD:267	ms_run[1]:scan=4976	30.689906666666666	2	1203.562312	1203.561547	R	V	506	517
PSM	AQFEQLCASLLAR	2337	sp|O95757|HS74L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	7-UNIMOD:4,13-UNIMOD:267	ms_run[1]:scan=10529	62.008383333333335	2	1516.777529	1515.774317	R	V	304	317
PSM	SIDLPIQSSLCR	2338	sp|O95757|HS74L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	11-UNIMOD:4,12-UNIMOD:267	ms_run[1]:scan=9176	53.85904	2	1398.7272	1397.7202	K	Q	579	591
PSM	QQPGPSEHIER	2339	sp|P50552|VASP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28	ms_run[1]:scan=2040	15.152331666666669	2	1259.5922	1259.5889	R	R	144	155
PSM	CYSCGEFGHIQK	2340	sp|P62633|CNBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:385,1-UNIMOD:4,4-UNIMOD:4,12-UNIMOD:188	ms_run[1]:scan=6745	40.1826	2	1473.6116	1473.6107	K	D	119	131
PSM	NFSGAELEGLVR	2341	sp|P46459|NSF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=9858	57.95205333333333	2	1290.659780	1290.656815	K	A	435	447
PSM	QVHEIQSCMGR	2342	sp|O14653|GOSR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28,8-UNIMOD:4	ms_run[1]:scan=4959	30.59534166666667	2	1326.5812	1326.5804	K	L	11	22
PSM	LLTQYILNLGK	2343	sp|O00203|AP3B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	11-UNIMOD:188	ms_run[1]:scan=12123	71.96639499999999	2	1280.778440	1280.779953	K	Y	553	564
PSM	LVLVGDGGTGK	2344	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=4504	28.256423333333334	2	1014.570309	1014.570960	K	T	13	24
PSM	DPENFPFVVLGNK	2345	sp|P51149|RAB7A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	13-UNIMOD:188	ms_run[1]:scan=12047	71.49003499999999	2	1480.766261	1480.765759	R	I	114	127
PSM	TALFEEISR	2346	sp|Q14683|SMC1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	9-UNIMOD:267	ms_run[1]:scan=7926	46.621853333333334	2	1075.564723	1074.558494	R	S	152	161
PSM	AATTGSGVKVPR	2347	sp|Q13404|UB2V1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1,9-UNIMOD:188,12-UNIMOD:267	ms_run[1]:scan=3263	21.662183333333335	2	1200.6805	1200.6792	M	N	2	14
PSM	MDQAIIFCR	2348	sp|Q92499|DDX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:35,8-UNIMOD:4,9-UNIMOD:267	ms_run[1]:scan=6314	37.84129	2	1178.548015	1178.545169	K	T	506	515
PSM	SGELPPNINIKEPR	2349	sp|Q9H9B4|SFXN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1	ms_run[1]:scan=7304	43.21434333333333	2	1604.8576	1604.8517	M	W	2	16
PSM	NLIDAGVDALR	2350	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=9859	57.957480000000004	2	1155.627075	1155.624787	K	V	312	323
PSM	CFSEENHEPLR	2351	sp|Q96QK1|VPS35_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:385,1-UNIMOD:4,11-UNIMOD:267	ms_run[1]:scan=6469	38.70098	2	1409.5925	1409.5904	K	T	640	651
PSM	QLLTPATGAPKPQGTK	2352	sp|O95602|RPA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28,11-UNIMOD:188,16-UNIMOD:188	ms_run[1]:scan=5846	35.302485	2	1601.9249	1601.9174	K	I	521	537
PSM	QHGDVVSAIR	2353	sp|O14745|NHRF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28,10-UNIMOD:267	ms_run[1]:scan=4108	26.19249333333333	2	1073.5482	1073.5488	K	A	211	221
PSM	QHGDVVSAIR	2354	sp|O14745|NHRF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28	ms_run[1]:scan=4110	26.20155666666667	2	1064.5422	1063.5402	K	A	211	221
PSM	NLVEELPQPR	2355	sp|Q9BYD1|RM13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=7186	42.558105	2	1193.641661	1193.640437	K	K	140	150
PSM	VLGGSFADQK	2356	sp|Q93008|USP9X_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=3811	24.552645000000002	2	1020.524689	1020.524010	K	I	1713	1723
PSM	AINIADELPR	2357	sp|Q8NFV4|ABHDB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	10-UNIMOD:267	ms_run[1]:scan=8356	49.0692	2	1120.611896	1120.611592	R	S	186	196
PSM	LALLQEQWAGGK	2358	sp|Q9HD15|SRA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	12-UNIMOD:188	ms_run[1]:scan=9348	54.888380000000005	2	1318.736461	1318.734065	R	L	141	153
PSM	QHLEITGGQVR	2359	sp|P47897|SYQ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28	ms_run[1]:scan=5351	32.657745	2	1219.6314	1219.6304	K	T	255	266
PSM	LTFNNPTTEFR	2360	sp|Q03111|ENL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=8139	47.82713333333333	2	1338.658704	1338.656815	K	Y	122	133
PSM	QMSCLMEALEDKR	2361	sp|Q92896|GSLG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28,4-UNIMOD:4	ms_run[1]:scan=12529	74.65082333333332	2	1592.7051	1592.6992	R	V	1089	1102
PSM	SIFASPESVTGK	2362	sp|O75940|SPF30_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	12-UNIMOD:188	ms_run[1]:scan=6629	39.56681833333334	2	1228.650090	1227.644247	R	V	197	209
PSM	QCEKEFSISR	2363	sp|Q96T51|RUFY1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28,2-UNIMOD:4,10-UNIMOD:267	ms_run[1]:scan=7892	46.450493333333334	2	1275.5542	1275.5792	R	R	650	660
PSM	TLNINGQIPTGEGPPLVK	2364	sp|P11171|41_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=9378	55.066068333333334	2	1848.009369	1847.015263	R	T	716	734
PSM	IYVGNLPPDIR	2365	sp|Q07955|SRSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	11-UNIMOD:267	ms_run[1]:scan=8572	50.32861333333334	2	1265.702091	1265.700741	R	T	18	29
PSM	MITDIHANGKTINK	2366	sp|P12757|SKIL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:35,10-UNIMOD:188	ms_run[1]:scan=10271	60.433856666666664	2	1576.812077	1576.833856	K	V	32	46
PSM	IFLLTNNNLLLADQK	2367	sp|O43795|MYO1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=12445	74.02380166666667	2	1728.982454	1728.977421	R	S	1007	1022
PSM	MMAQKSQGSDNLQEGQEK	2368	sp|Q6ZRS4|ITPI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:1,5-UNIMOD:188,18-UNIMOD:188	ms_run[1]:scan=10197	59.98319166666666	2	2061.911857	2061.949812	-	S	1	19