MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000208 -- new
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220618\20220618002634800212^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\111222_HL04.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220618\20220618002634800212^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\111222_HL04.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Acetyl (Protein N-term),Label:13C(6) (K),Label:13C(6)15N(4) (R),Oxidation (M)
MTD	software[1]-setting	maxMissedCleavages=1
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=40
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Label:13C(6) (K),Label:13C(6)15N(4) (R),Acetyl (Protein N-term)
MTD	software[2]-setting	TOL(-)=20
MTD	software[2]-setting	TOL(+)=20
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=1000
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=1
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Acetyl (Protein N-term),Label:13C(6) (K),Label:13C(6)15N(4) (R),Oxidation (M)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=1
MTD	software[3]-setting	peptide_mass_tolerance=20
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:1, Acetyl,]
MTD	variable_mod[1]-site	N-term
MTD	variable_mod[1]-position	Protein N-term
MTD	variable_mod[2]	[UNIMOD, UNIMOD:188, Label:13C(6),]
MTD	variable_mod[2]-site	K
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:267, Label:13C(6)15N(4),]
MTD	variable_mod[3]-site	R
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[4]-site	M
MTD	variable_mod[4]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P22626-2|ROA2_HUMAN	Isoform A2 of Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	55.0	null	315-UNIMOD:35,338-UNIMOD:267,201-UNIMOD:267	0.14	55.0	8	3	2
PRT	sp|O14579-3|COPE_HUMAN	Isoform 3 of Coatomer subunit epsilon OS=Homo sapiens OX=9606 GN=COPE	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	23-UNIMOD:188	0.09	48.0	2	1	0
PRT	sp|P22626|ROA2_HUMAN	Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0	null	266-UNIMOD:267	0.08	46.0	2	1	0
PRT	sp|Q9BST9-3|RTKN_HUMAN	Isoform 3 of Rhotekin OS=Homo sapiens OX=9606 GN=RTKN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	205-UNIMOD:267	0.05	44.0	2	1	0
PRT	sp|P54578-2|UBP14_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 14 OS=Homo sapiens OX=9606 GN=USP14	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	189-UNIMOD:188,203-UNIMOD:188,43-UNIMOD:267,449-UNIMOD:267,453-UNIMOD:35	0.11	44.0	8	3	0
PRT	sp|Q9Y2X3|NOP58_HUMAN	Nucleolar protein 58 OS=Homo sapiens OX=9606 GN=NOP58 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	475-UNIMOD:188,485-UNIMOD:188	0.04	44.0	4	1	0
PRT	sp|Q8TAD4|ZNT5_HUMAN	Zinc transporter 5 OS=Homo sapiens OX=9606 GN=SLC30A5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.03	44.0	1	1	1
PRT	sp|P09211|GSTP1_HUMAN	Glutathione S-transferase P OS=Homo sapiens OX=9606 GN=GSTP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.18	43.0	2	2	2
PRT	sp|Q7L266|ASGL1_HUMAN	Isoaspartyl peptidase/L-asparaginase OS=Homo sapiens OX=9606 GN=ASRGL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	1-UNIMOD:1,17-UNIMOD:188	0.06	43.0	2	1	0
PRT	sp|P30084|ECHM_HUMAN	Enoyl-CoA hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=ECHS1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	178-UNIMOD:267	0.08	42.0	3	1	0
PRT	sp|P52209-2|6PGD_HUMAN	Isoform 2 of 6-phosphogluconate dehydrogenase, decarboxylating OS=Homo sapiens OX=9606 GN=PGD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	123-UNIMOD:267,134-UNIMOD:188,150-UNIMOD:188	0.08	42.0	6	3	0
PRT	sp|Q9UHB9-4|SRP68_HUMAN	Isoform 4 of Signal recognition particle subunit SRP68 OS=Homo sapiens OX=9606 GN=SRP68	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	31-UNIMOD:267	0.05	42.0	3	1	0
PRT	sp|Q5T4S7-3|UBR4_HUMAN	Isoform 3 of E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	366-UNIMOD:188,380-UNIMOD:188,2373-UNIMOD:267,4998-UNIMOD:188,1349-UNIMOD:267,3228-UNIMOD:267,4191-UNIMOD:188	0.02	42.0	8	6	4
PRT	sp|P68363-2|TBA1B_HUMAN	Isoform 2 of Tubulin alpha-1B chain OS=Homo sapiens OX=9606 GN=TUBA1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	60-UNIMOD:188,79-UNIMOD:267,231-UNIMOD:4,236-UNIMOD:188,254-UNIMOD:188	0.21	42.0	8	4	0
PRT	sp|P13647|K2C5_HUMAN	Keratin, type II cytoskeletal 5 OS=Homo sapiens OX=9606 GN=KRT5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	41.0	null	576-UNIMOD:188,84-UNIMOD:267,229-UNIMOD:28,237-UNIMOD:267,239-UNIMOD:267	0.09	41.0	4	4	4
PRT	sp|P04406-2|G3P_HUMAN	Isoform 2 of Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	110-UNIMOD:4,114-UNIMOD:4,120-UNIMOD:188,281-UNIMOD:267,173-UNIMOD:188,205-UNIMOD:4,206-UNIMOD:267	0.22	41.0	6	4	2
PRT	sp|O43707|ACTN4_HUMAN	Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	883-UNIMOD:35,899-UNIMOD:188,668-UNIMOD:188,757-UNIMOD:267,173-UNIMOD:4,771-UNIMOD:267	0.08	41.0	7	5	3
PRT	sp|O43815-2|STRN_HUMAN	Isoform 2 of Striatin OS=Homo sapiens OX=9606 GN=STRN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	1-UNIMOD:1,22-UNIMOD:188	0.03	41.0	2	1	0
PRT	sp|P00558|PGK1_HUMAN	Phosphoglycerate kinase 1 OS=Homo sapiens OX=9606 GN=PGK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	367-UNIMOD:4,379-UNIMOD:4,380-UNIMOD:4	0.04	41.0	1	1	0
PRT	sp|P35250-2|RFC2_HUMAN	Isoform 2 of Replication factor C subunit 2 OS=Homo sapiens OX=9606 GN=RFC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	82-UNIMOD:188	0.06	40.0	2	1	0
PRT	sp|P31153-2|METK2_HUMAN	Isoform 2 of S-adenosylmethionine synthase isoform type-2 OS=Homo sapiens OX=9606 GN=MAT2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	201-UNIMOD:267	0.05	40.0	2	1	0
PRT	sp|P14618|KPYM_HUMAN	Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	206-UNIMOD:188,423-UNIMOD:4,424-UNIMOD:4,433-UNIMOD:188,49-UNIMOD:4,56-UNIMOD:267,152-UNIMOD:4,162-UNIMOD:188,43-UNIMOD:267	0.13	40.0	11	5	0
PRT	sp|Q9Y6I3-3|EPN1_HUMAN	Isoform 3 of Epsin-1 OS=Homo sapiens OX=9606 GN=EPN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	442-UNIMOD:267	0.04	40.0	2	1	0
PRT	sp|Q8N163-2|CCAR2_HUMAN	Isoform 2 of Cell cycle and apoptosis regulator protein 2 OS=Homo sapiens OX=9606 GN=CCAR2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.07	40.0	3	2	1
PRT	sp|Q14149|MORC3_HUMAN	MORC family CW-type zinc finger protein 3 OS=Homo sapiens OX=9606 GN=MORC3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	446-UNIMOD:4,464-UNIMOD:188	0.02	40.0	2	1	0
PRT	sp|Q01844-2|EWS_HUMAN	Isoform EWS-B of RNA-binding protein EWS OS=Homo sapiens OX=9606 GN=EWSR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	451-UNIMOD:4,456-UNIMOD:4,464-UNIMOD:267	0.03	39.0	2	1	0
PRT	sp|P22314-2|UBA1_HUMAN	Isoform 2 of Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	344-UNIMOD:267,653-UNIMOD:267	0.03	39.0	4	2	0
PRT	sp|P48634-2|PRC2A_HUMAN	Isoform 2 of Protein PRRC2A OS=Homo sapiens OX=9606 GN=PRRC2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1357-UNIMOD:267	0.01	39.0	2	1	0
PRT	sp|P40939|ECHA_HUMAN	Trifunctional enzyme subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=HADHA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	625-UNIMOD:188,506-UNIMOD:35,550-UNIMOD:4,554-UNIMOD:35,560-UNIMOD:267,516-UNIMOD:188	0.05	39.0	6	3	0
PRT	sp|Q8NHP1|ARK74_HUMAN	Aflatoxin B1 aldehyde reductase member 4 OS=Homo sapiens OX=9606 GN=AKR7L PE=2 SV=7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	208-UNIMOD:188	0.05	39.0	2	1	0
PRT	sp|P52272-2|HNRPM_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein M OS=Homo sapiens OX=9606 GN=HNRNPM	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	568-UNIMOD:35,582-UNIMOD:267,504-UNIMOD:267,364-UNIMOD:267,493-UNIMOD:35	0.08	39.0	9	4	1
PRT	sp|Q9Y5J6|T10B_HUMAN	Mitochondrial import inner membrane translocase subunit Tim10 B OS=Homo sapiens OX=9606 GN=TIMM10B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.26	39.0	1	1	1
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	254-UNIMOD:267,28-UNIMOD:267	0.10	39.0	5	3	1
PRT	sp|Q9Y6M9|NDUB9_HUMAN	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 OS=Homo sapiens OX=9606 GN=NDUFB9 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	39.0	null	75-UNIMOD:28,2-UNIMOD:1,15-UNIMOD:188	0.20	39.0	3	2	1
PRT	sp|O94776|MTA2_HUMAN	Metastasis-associated protein MTA2 OS=Homo sapiens OX=9606 GN=MTA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	null	594-UNIMOD:28,595-UNIMOD:188,611-UNIMOD:188	0.03	39.0	2	1	0
PRT	sp|O75175|CNOT3_HUMAN	CCR4-NOT transcription complex subunit 3 OS=Homo sapiens OX=9606 GN=CNOT3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	535-UNIMOD:188	0.03	38.0	2	1	0
PRT	sp|Q15149|PLEC_HUMAN	Plectin OS=Homo sapiens OX=9606 GN=PLEC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	38.0	null	3462-UNIMOD:267,1604-UNIMOD:28,1605-UNIMOD:267,1616-UNIMOD:267,3336-UNIMOD:385,3336-UNIMOD:4,3127-UNIMOD:267,3337-UNIMOD:267,3352-UNIMOD:188,597-UNIMOD:188,4447-UNIMOD:267	0.02	38.0	12	6	2
PRT	sp|P10321-2|HLAC_HUMAN	Isoform 2 of HLA class I histocompatibility antigen, C alpha chain OS=Homo sapiens OX=9606 GN=HLA-C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	258-UNIMOD:267,267-UNIMOD:188	0.08	38.0	3	1	0
PRT	sp|P40121-2|CAPG_HUMAN	Isoform 2 of Macrophage-capping protein OS=Homo sapiens OX=9606 GN=CAPG	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	228-UNIMOD:188,238-UNIMOD:188	0.07	38.0	3	1	0
PRT	sp|P13796|PLSL_HUMAN	Plastin-2 OS=Homo sapiens OX=9606 GN=LCP1 PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.03	38.0	2	1	0
PRT	sp|P00367|DHE3_HUMAN	Glutamate dehydrogenase 1, mitochondrial OS=Homo sapiens OX=9606 GN=GLUD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	231-UNIMOD:267,226-UNIMOD:35	0.04	38.0	4	1	0
PRT	sp|Q13011|ECH1_HUMAN	Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial OS=Homo sapiens OX=9606 GN=ECH1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	232-UNIMOD:35	0.05	38.0	1	1	1
PRT	sp|P08727|K1C19_HUMAN	Keratin, type I cytoskeletal 19 OS=Homo sapiens OX=9606 GN=KRT19 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null	24-UNIMOD:267,111-UNIMOD:188	0.08	38.0	4	2	0
PRT	sp|Q8ND24-2|RN214_HUMAN	Isoform 2 of RING finger protein 214 OS=Homo sapiens OX=9606 GN=RNF214	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.03	38.0	1	1	1
PRT	sp|P00558-2|PGK1_HUMAN	Isoform 2 of Phosphoglycerate kinase 1 OS=Homo sapiens OX=9606 GN=PGK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	339-UNIMOD:4,351-UNIMOD:4,352-UNIMOD:4,354-UNIMOD:188,80-UNIMOD:4	0.09	37.0	2	2	1
PRT	sp|Q7Z6Z7-2|HUWE1_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	1733-UNIMOD:188,1741-UNIMOD:188,624-UNIMOD:4,629-UNIMOD:267	0.01	37.0	6	4	2
PRT	sp|P53396|ACLY_HUMAN	ATP-citrate synthase OS=Homo sapiens OX=9606 GN=ACLY PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	650-UNIMOD:188,944-UNIMOD:188	0.02	37.0	2	2	2
PRT	sp|Q9NZJ6|COQ3_HUMAN	Ubiquinone biosynthesis O-methyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=COQ3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	155-UNIMOD:4	0.05	37.0	1	1	1
PRT	sp|Q14839|CHD4_HUMAN	Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	1419-UNIMOD:267,1899-UNIMOD:267	0.02	37.0	4	2	0
PRT	sp|Q3LXA3|TKFC_HUMAN	Triokinase/FMN cyclase OS=Homo sapiens OX=9606 GN=TKFC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	567-UNIMOD:267,522-UNIMOD:188	0.05	37.0	4	2	0
PRT	sp|P26640|SYVC_HUMAN	Valine--tRNA ligase OS=Homo sapiens OX=9606 GN=VARS1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	2-UNIMOD:1,17-UNIMOD:267	0.01	37.0	2	1	0
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	284-UNIMOD:267	0.03	37.0	2	1	0
PRT	sp|Q8NEW0|ZNT7_HUMAN	Zinc transporter 7 OS=Homo sapiens OX=9606 GN=SLC30A7 PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	308-UNIMOD:4,311-UNIMOD:267	0.04	37.0	2	1	0
PRT	sp|P46013-2|KI67_HUMAN	Isoform Short of Proliferation marker protein Ki-67 OS=Homo sapiens OX=9606 GN=MKI67	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	2160-UNIMOD:188,1578-UNIMOD:188	0.02	37.0	5	3	1
PRT	sp|P06733-2|ENOA_HUMAN	Isoform MBP-1 of Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	264-UNIMOD:4,188-UNIMOD:188	0.09	37.0	3	2	0
PRT	sp|P14927|QCR7_HUMAN	Cytochrome b-c1 complex subunit 7 OS=Homo sapiens OX=9606 GN=UQCRB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.14	36.0	2	1	0
PRT	sp|P08865|RSSA_HUMAN	40S ribosomal protein SA OS=Homo sapiens OX=9606 GN=RPSA PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	102-UNIMOD:267	0.05	36.0	3	1	0
PRT	sp|Q12905|ILF2_HUMAN	Interleukin enhancer-binding factor 2 OS=Homo sapiens OX=9606 GN=ILF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	141-UNIMOD:188,185-UNIMOD:267	0.07	36.0	3	2	1
PRT	sp|Q13505-3|MTX1_HUMAN	Isoform 3 of Metaxin-1 OS=Homo sapiens OX=9606 GN=MTX1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	57-UNIMOD:267	0.05	36.0	2	1	0
PRT	sp|O95630|STABP_HUMAN	STAM-binding protein OS=Homo sapiens OX=9606 GN=STAMBP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	264-UNIMOD:4,277-UNIMOD:267	0.04	36.0	2	1	0
PRT	sp|Q5VV41|ARHGG_HUMAN	Rho guanine nucleotide exchange factor 16 OS=Homo sapiens OX=9606 GN=ARHGEF16 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	39-UNIMOD:267	0.02	36.0	1	1	1
PRT	sp|Q06830|PRDX1_HUMAN	Peroxiredoxin-1 OS=Homo sapiens OX=9606 GN=PRDX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	36.0	null	109-UNIMOD:188,94-UNIMOD:28,168-UNIMOD:188	0.14	36.0	4	2	1
PRT	sp|P11166|GTR1_HUMAN	Solute carrier family 2, facilitated glucose transporter member 1 OS=Homo sapiens OX=9606 GN=SLC2A1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	468-UNIMOD:267	0.05	36.0	3	2	1
PRT	sp|Q9Y2T7|YBOX2_HUMAN	Y-box-binding protein 2 OS=Homo sapiens OX=9606 GN=YBX2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	82-UNIMOD:267	0.05	36.0	1	1	1
PRT	sp|P62888|RL30_HUMAN	60S ribosomal protein L30 OS=Homo sapiens OX=9606 GN=RPL30 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	92-UNIMOD:4,106-UNIMOD:267,52-UNIMOD:4,56-UNIMOD:267	0.26	36.0	4	2	0
PRT	sp|Q14126|DSG2_HUMAN	Desmoglein-2 OS=Homo sapiens OX=9606 GN=DSG2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	684-UNIMOD:267	0.02	36.0	2	1	0
PRT	sp|O75208-2|COQ9_HUMAN	Isoform 2 of Ubiquinone biosynthesis protein COQ9, mitochondrial OS=Homo sapiens OX=9606 GN=COQ9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.16	36.0	2	1	0
PRT	sp|P50991-2|TCPD_HUMAN	Isoform 2 of T-complex protein 1 subunit delta OS=Homo sapiens OX=9606 GN=CCT4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	405-UNIMOD:267	0.03	35.0	2	1	0
PRT	sp|P25786|PSA1_HUMAN	Proteasome subunit alpha type-1 OS=Homo sapiens OX=9606 GN=PSMA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	256-UNIMOD:188,261-UNIMOD:35	0.08	35.0	4	1	0
PRT	sp|Q9NUP7-2|TRM13_HUMAN	Isoform 2 of tRNA:m(4)X modification enzyme TRM13 homolog OS=Homo sapiens OX=9606 GN=TRMT13	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	2-UNIMOD:1,18-UNIMOD:267	0.10	35.0	3	1	0
PRT	sp|Q8NI22-2|MCFD2_HUMAN	Isoform 2 of Multiple coagulation factor deficiency protein 2 OS=Homo sapiens OX=9606 GN=MCFD2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	78-UNIMOD:188,91-UNIMOD:188	0.19	35.0	2	1	0
PRT	sp|Q9UKV3-5|ACINU_HUMAN	Isoform 4 of Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	691-UNIMOD:4	0.02	35.0	1	1	1
PRT	sp|Q99805|TM9S2_HUMAN	Transmembrane 9 superfamily member 2 OS=Homo sapiens OX=9606 GN=TM9SF2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	174-UNIMOD:4,182-UNIMOD:4,187-UNIMOD:188,104-UNIMOD:267	0.05	35.0	4	2	0
PRT	sp|Q9NPJ6|MED4_HUMAN	Mediator of RNA polymerase II transcription subunit 4 OS=Homo sapiens OX=9606 GN=MED4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	27-UNIMOD:267	0.06	35.0	2	1	0
PRT	sp|Q15365|PCBP1_HUMAN	Poly(rC)-binding protein 1 OS=Homo sapiens OX=9606 GN=PCBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	109-UNIMOD:4,115-UNIMOD:188,54-UNIMOD:4,158-UNIMOD:4,160-UNIMOD:188,70-UNIMOD:188	0.16	35.0	6	4	2
PRT	sp|Q9P035-2|HACD3_HUMAN	Isoform 2 of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3 OS=Homo sapiens OX=9606 GN=HACD3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	1-UNIMOD:1,1-UNIMOD:35,15-UNIMOD:267	0.05	35.0	3	1	0
PRT	sp|P60842|IF4A1_HUMAN	Eukaryotic initiation factor 4A-I OS=Homo sapiens OX=9606 GN=EIF4A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	178-UNIMOD:35,190-UNIMOD:267,187-UNIMOD:35,334-UNIMOD:267	0.06	35.0	8	2	0
PRT	sp|P24928|RPB1_HUMAN	DNA-directed RNA polymerase II subunit RPB1 OS=Homo sapiens OX=9606 GN=POLR2A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	1-UNIMOD:1,13-UNIMOD:4,16-UNIMOD:267	0.01	35.0	1	1	1
PRT	sp|P42704|LPPRC_HUMAN	Leucine-rich PPR motif-containing protein, mitochondrial OS=Homo sapiens OX=9606 GN=LRPPRC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	1164-UNIMOD:35,1176-UNIMOD:188,463-UNIMOD:188	0.02	35.0	4	2	0
PRT	sp|Q15393|SF3B3_HUMAN	Splicing factor 3B subunit 3 OS=Homo sapiens OX=9606 GN=SF3B3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	706-UNIMOD:35,615-UNIMOD:267,718-UNIMOD:267	0.02	35.0	5	2	0
PRT	sp|Q9Y5B9|SP16H_HUMAN	FACT complex subunit SPT16 OS=Homo sapiens OX=9606 GN=SUPT16H PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	623-UNIMOD:267	0.04	35.0	4	2	0
PRT	sp|O75886-2|STAM2_HUMAN	Isoform 2 of Signal transducing adapter molecule 2 OS=Homo sapiens OX=9606 GN=STAM2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	15-UNIMOD:188	0.04	35.0	2	1	0
PRT	sp|P10412|H14_HUMAN	Histone H1.4 OS=Homo sapiens OX=9606 GN=H1-4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	2-UNIMOD:1	0.10	35.0	1	1	1
PRT	sp|P33993-3|MCM7_HUMAN	Isoform 3 of DNA replication licensing factor MCM7 OS=Homo sapiens OX=9606 GN=MCM7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	338-UNIMOD:267	0.03	35.0	2	1	0
PRT	sp|P12956|XRCC6_HUMAN	X-ray repair cross-complementing protein 6 OS=Homo sapiens OX=9606 GN=XRCC6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	114-UNIMOD:188	0.07	35.0	4	2	0
PRT	sp|P35658-2|NU214_HUMAN	Isoform 2 of Nuclear pore complex protein Nup214 OS=Homo sapiens OX=9606 GN=NUP214	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	1371-UNIMOD:188	0.01	35.0	2	1	0
PRT	sp|P61604|CH10_HUMAN	10 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPE1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	54-UNIMOD:188	0.15	35.0	2	1	0
PRT	sp|Q9BZF1|OSBL8_HUMAN	Oxysterol-binding protein-related protein 8 OS=Homo sapiens OX=9606 GN=OSBPL8 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|O75717-2|WDHD1_HUMAN	Isoform 2 of WD repeat and HMG-box DNA-binding protein 1 OS=Homo sapiens OX=9606 GN=WDHD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|P83731|RL24_HUMAN	60S ribosomal protein L24 OS=Homo sapiens OX=9606 GN=RPL24 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	93-UNIMOD:188	0.09	34.0	2	1	0
PRT	sp|Q86Y56|DAAF5_HUMAN	Dynein assembly factor 5, axonemal OS=Homo sapiens OX=9606 GN=DNAAF5 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	75-UNIMOD:267,826-UNIMOD:267	0.04	34.0	4	2	0
PRT	sp|O43172-2|PRP4_HUMAN	Isoform 2 of U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens OX=9606 GN=PRPF4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	128-UNIMOD:267	0.03	34.0	2	1	0
PRT	sp|Q13243-2|SRSF5_HUMAN	Isoform SRP40-2 of Serine/arginine-rich splicing factor 5 OS=Homo sapiens OX=9606 GN=SRSF5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	63-UNIMOD:4	0.18	34.0	2	1	0
PRT	sp|P05787|K2C8_HUMAN	Keratin, type II cytoskeletal 8 OS=Homo sapiens OX=9606 GN=KRT8 PE=1 SV=7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	34.0	null	225-UNIMOD:267,264-UNIMOD:188,341-UNIMOD:267,370-UNIMOD:28,472-UNIMOD:188,483-UNIMOD:188,362-UNIMOD:267,256-UNIMOD:35	0.16	34.0	14	7	2
PRT	sp|Q13895|BYST_HUMAN	Bystin OS=Homo sapiens OX=9606 GN=BYSL PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	295-UNIMOD:4,300-UNIMOD:4,303-UNIMOD:267	0.04	34.0	2	1	0
PRT	sp|Q9C0B5-2|ZDHC5_HUMAN	Isoform 2 of Palmitoyltransferase ZDHHC5 OS=Homo sapiens OX=9606 GN=ZDHHC5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	580-UNIMOD:267	0.03	34.0	2	1	0
PRT	sp|P12814-2|ACTN1_HUMAN	Isoform 2 of Alpha-actinin-1 OS=Homo sapiens OX=9606 GN=ACTN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	480-UNIMOD:4,492-UNIMOD:188,649-UNIMOD:188	0.04	34.0	2	2	2
PRT	sp|Q96AE4|FUBP1_HUMAN	Far upstream element-binding protein 1 OS=Homo sapiens OX=9606 GN=FUBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	284-UNIMOD:267,146-UNIMOD:267,64-UNIMOD:188,331-UNIMOD:267	0.09	34.0	6	4	2
PRT	sp|Q9HC38-2|GLOD4_HUMAN	Isoform 2 of Glyoxalase domain-containing protein 4 OS=Homo sapiens OX=9606 GN=GLOD4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	237-UNIMOD:188	0.05	34.0	2	1	0
PRT	sp|P49368-2|TCPG_HUMAN	Isoform 2 of T-complex protein 1 subunit gamma OS=Homo sapiens OX=9606 GN=CCT3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	175-UNIMOD:4,178-UNIMOD:267,411-UNIMOD:267	0.07	34.0	6	3	2
PRT	sp|Q14764|MVP_HUMAN	Major vault protein OS=Homo sapiens OX=9606 GN=MVP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	572-UNIMOD:4	0.02	34.0	1	1	1
PRT	sp|Q9UHX1-4|PUF60_HUMAN	Isoform 4 of Poly(U)-binding-splicing factor PUF60 OS=Homo sapiens OX=9606 GN=PUF60	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	26-UNIMOD:188	0.03	34.0	4	1	0
PRT	sp|P27708|PYR1_HUMAN	CAD protein OS=Homo sapiens OX=9606 GN=CAD PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	1066-UNIMOD:267,1240-UNIMOD:267	0.01	34.0	4	2	0
PRT	sp|Q5H9R7-3|PP6R3_HUMAN	Isoform 3 of Serine/threonine-protein phosphatase 6 regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PPP6R3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	750-UNIMOD:4,756-UNIMOD:4,751-UNIMOD:188,763-UNIMOD:188	0.03	34.0	2	1	0
PRT	sp|P35579|MYH9_HUMAN	Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	34.0	null	29-UNIMOD:188,694-UNIMOD:4,702-UNIMOD:267,719-UNIMOD:28	0.02	34.0	5	3	1
PRT	sp|Q8IWZ3-5|ANKH1_HUMAN	Isoform 5 of Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ANKHD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	42-UNIMOD:267	0.04	34.0	1	1	1
PRT	sp|P16403|H12_HUMAN	Histone H1.2 OS=Homo sapiens OX=9606 GN=H1-2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	2-UNIMOD:1	0.10	34.0	1	1	1
PRT	sp|Q96EP5-2|DAZP1_HUMAN	Isoform 2 of DAZ-associated protein 1 OS=Homo sapiens OX=9606 GN=DAZAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	209-UNIMOD:267	0.04	34.0	1	1	1
PRT	sp|Q9Y666|S12A7_HUMAN	Solute carrier family 12 member 7 OS=Homo sapiens OX=9606 GN=SLC12A7 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|Q9Y265|RUVB1_HUMAN	RuvB-like 1 OS=Homo sapiens OX=9606 GN=RUVBL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	90-UNIMOD:188,76-UNIMOD:188,333-UNIMOD:267	0.10	34.0	5	3	1
PRT	sp|P80188-2|NGAL_HUMAN	Isoform 2 of Neutrophil gelatinase-associated lipocalin OS=Homo sapiens OX=9606 GN=LCN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	107-UNIMOD:4,118-UNIMOD:188	0.09	34.0	1	1	1
PRT	sp|P40925-2|MDHC_HUMAN	Isoform 2 of Malate dehydrogenase, cytoplasmic OS=Homo sapiens OX=9606 GN=MDH1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	48-UNIMOD:4,53-UNIMOD:188,221-UNIMOD:267	0.13	34.0	3	2	1
PRT	sp|Q14498-3|RBM39_HUMAN	Isoform 3 of RNA-binding protein 39 OS=Homo sapiens OX=9606 GN=RBM39	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	210-UNIMOD:188,156-UNIMOD:188	0.06	34.0	3	2	1
PRT	sp|Q8IY17-5|PLPL6_HUMAN	Isoform 5 of Neuropathy target esterase OS=Homo sapiens OX=9606 GN=PNPLA6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	914-UNIMOD:267	0.01	34.0	2	1	0
PRT	sp|P52272|HNRPM_HUMAN	Heterogeneous nuclear ribonucleoprotein M OS=Homo sapiens OX=9606 GN=HNRNPM PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	607-UNIMOD:35,611-UNIMOD:35,621-UNIMOD:267	0.02	34.0	2	1	0
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	34.0	null	357-UNIMOD:4,358-UNIMOD:188	0.07	34.0	2	2	1
PRT	sp|Q5RKV6|EXOS6_HUMAN	Exosome complex component MTR3 OS=Homo sapiens OX=9606 GN=EXOSC6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	93-UNIMOD:267	0.06	34.0	2	1	0
PRT	sp|Q13112|CAF1B_HUMAN	Chromatin assembly factor 1 subunit B OS=Homo sapiens OX=9606 GN=CHAF1B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	34.0	null	439-UNIMOD:28,447-UNIMOD:267,457-UNIMOD:188	0.06	34.0	3	2	1
PRT	sp|Q8TD30|ALAT2_HUMAN	Alanine aminotransferase 2 OS=Homo sapiens OX=9606 GN=GPT2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	265-UNIMOD:4	0.03	34.0	1	1	1
PRT	sp|O95400|CD2B2_HUMAN	CD2 antigen cytoplasmic tail-binding protein 2 OS=Homo sapiens OX=9606 GN=CD2BP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	40-UNIMOD:267	0.04	34.0	2	1	0
PRT	sp|Q9BUJ2|HNRL1_HUMAN	Heterogeneous nuclear ribonucleoprotein U-like protein 1 OS=Homo sapiens OX=9606 GN=HNRNPUL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	null	147-UNIMOD:28,162-UNIMOD:188,165-UNIMOD:267	0.02	34.0	2	1	0
PRT	sp|P06454-2|PTMA_HUMAN	Isoform 2 of Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	102-UNIMOD:188,103-UNIMOD:188	0.14	33.0	4	1	0
PRT	sp|Q9UPN3|MACF1_HUMAN	Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.00	33.0	1	1	1
PRT	sp|P0CW20|LIMS4_HUMAN	LIM and senescent cell antigen-like-containing domain protein 4 OS=Homo sapiens OX=9606 GN=LIMS4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	72-UNIMOD:4,74-UNIMOD:267	0.13	33.0	1	1	1
PRT	sp|Q99447|PCY2_HUMAN	Ethanolamine-phosphate cytidylyltransferase OS=Homo sapiens OX=9606 GN=PCYT2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	20-UNIMOD:267	0.04	33.0	2	1	0
PRT	sp|Q5JPE7-2|NOMO2_HUMAN	Isoform 2 of Nodal modulator 2 OS=Homo sapiens OX=9606 GN=NOMO2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	152-UNIMOD:267	0.01	33.0	2	1	0
PRT	sp|P08237-2|PFKAM_HUMAN	Isoform 2 of ATP-dependent 6-phosphofructokinase, muscle type OS=Homo sapiens OX=9606 GN=PFKM	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	678-UNIMOD:4,683-UNIMOD:267	0.02	33.0	2	1	0
PRT	sp|Q96CW1-2|AP2M1_HUMAN	Isoform 2 of AP-2 complex subunit mu OS=Homo sapiens OX=9606 GN=AP2M1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	335-UNIMOD:4,337-UNIMOD:188	0.04	33.0	2	1	0
PRT	sp|P46087-3|NOP2_HUMAN	Isoform 3 of Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase OS=Homo sapiens OX=9606 GN=NOP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	549-UNIMOD:267,247-UNIMOD:267	0.04	33.0	4	2	0
PRT	sp|Q96I24-2|FUBP3_HUMAN	Isoform 2 of Far upstream element-binding protein 3 OS=Homo sapiens OX=9606 GN=FUBP3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	191-UNIMOD:35,202-UNIMOD:267	0.05	33.0	2	1	0
PRT	sp|O00625|PIR_HUMAN	Pirin OS=Homo sapiens OX=9606 GN=PIR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	85-UNIMOD:35	0.05	33.0	2	1	0
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	33.0	null	1159-UNIMOD:35,1171-UNIMOD:267,1828-UNIMOD:385,1828-UNIMOD:4,1423-UNIMOD:267,1841-UNIMOD:267,235-UNIMOD:188,2233-UNIMOD:267,384-UNIMOD:267,2232-UNIMOD:35	0.03	33.0	16	6	0
PRT	sp|Q13418-3|ILK_HUMAN	Isoform 3 of Integrin-linked protein kinase OS=Homo sapiens OX=9606 GN=ILK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	216-UNIMOD:35,229-UNIMOD:188	0.05	33.0	2	1	0
PRT	sp|Q16555-2|DPYL2_HUMAN	Isoform 2 of Dihydropyrimidinase-related protein 2 OS=Homo sapiens OX=9606 GN=DPYSL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	20-UNIMOD:188,468-UNIMOD:4	0.06	33.0	3	2	1
PRT	sp|Q14738-3|2A5D_HUMAN	Isoform Delta-3 of Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform OS=Homo sapiens OX=9606 GN=PPP2R5D	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|Q96GK7|FAH2A_HUMAN	Fumarylacetoacetate hydrolase domain-containing protein 2A OS=Homo sapiens OX=9606 GN=FAHD2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	215-UNIMOD:4,224-UNIMOD:188	0.05	33.0	2	1	0
PRT	sp|Q92598-4|HS105_HUMAN	Isoform 4 of Heat shock protein 105 kDa OS=Homo sapiens OX=9606 GN=HSPH1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	236-UNIMOD:188	0.02	33.0	2	1	0
PRT	sp|Q9NZL9-5|MAT2B_HUMAN	Isoform 5 of Methionine adenosyltransferase 2 subunit beta OS=Homo sapiens OX=9606 GN=MAT2B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	32-UNIMOD:267	0.16	33.0	2	1	0
PRT	sp|Q96EY1-3|DNJA3_HUMAN	Isoform 3 of DnaJ homolog subfamily A member 3, mitochondrial OS=Homo sapiens OX=9606 GN=DNAJA3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	166-UNIMOD:267	0.06	33.0	2	1	0
PRT	sp|Q9H4L5-8|OSBL3_HUMAN	Isoform 2d of Oxysterol-binding protein-related protein 3 OS=Homo sapiens OX=9606 GN=OSBPL3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	221-UNIMOD:188	0.02	33.0	2	1	0
PRT	sp|Q9NWT1|PK1IP_HUMAN	p21-activated protein kinase-interacting protein 1 OS=Homo sapiens OX=9606 GN=PAK1IP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	288-UNIMOD:4,295-UNIMOD:267	0.04	33.0	2	1	0
PRT	sp|Q14331|FRG1_HUMAN	Protein FRG1 OS=Homo sapiens OX=9606 GN=FRG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	128-UNIMOD:267	0.05	33.0	2	1	0
PRT	sp|P06576|ATPB_HUMAN	ATP synthase subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	33.0	null	324-UNIMOD:267	0.03	33.0	2	1	0
PRT	sp|P41091|IF2G_HUMAN	Eukaryotic translation initiation factor 2 subunit 3 OS=Homo sapiens OX=9606 GN=EIF2S3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	2-UNIMOD:1,17-UNIMOD:267,434-UNIMOD:4,440-UNIMOD:188	0.07	32.0	4	2	0
PRT	sp|O60814|H2B1K_HUMAN	Histone H2B type 1-K OS=Homo sapiens OX=9606 GN=H2BC12 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	60-UNIMOD:35,63-UNIMOD:35,73-UNIMOD:267	0.13	32.0	3	1	0
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	447-UNIMOD:4,462-UNIMOD:188,237-UNIMOD:4,249-UNIMOD:188,233-UNIMOD:188,493-UNIMOD:188,72-UNIMOD:188	0.12	32.0	8	5	2
PRT	sp|P35637-2|FUS_HUMAN	Isoform Short of RNA-binding protein FUS OS=Homo sapiens OX=9606 GN=FUS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	427-UNIMOD:4,432-UNIMOD:4,440-UNIMOD:267	0.03	32.0	2	1	0
PRT	sp|P11142|HSP7C_HUMAN	Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	171-UNIMOD:267,311-UNIMOD:267	0.04	32.0	3	2	1
PRT	sp|Q9NZN8-2|CNOT2_HUMAN	Isoform 2 of CCR4-NOT transcription complex subunit 2 OS=Homo sapiens OX=9606 GN=CNOT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	80-UNIMOD:267	0.05	32.0	2	1	0
PRT	sp|Q92890-1|UFD1_HUMAN	Isoform Long of Ubiquitin recognition factor in ER-associated degradation protein 1 OS=Homo sapiens OX=9606 GN=UFD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	337-UNIMOD:267	0.04	32.0	2	1	0
PRT	sp|P40926|MDHM_HUMAN	Malate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=MDH2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	266-UNIMOD:35,269-UNIMOD:188,93-UNIMOD:4,212-UNIMOD:4,215-UNIMOD:188,229-UNIMOD:267,285-UNIMOD:4,296-UNIMOD:188,315-UNIMOD:35,324-UNIMOD:188,176-UNIMOD:267	0.28	32.0	15	7	1
PRT	sp|Q9NZB2-4|F120A_HUMAN	Isoform D of Constitutive coactivator of PPAR-gamma-like protein 1 OS=Homo sapiens OX=9606 GN=FAM120A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	665-UNIMOD:267	0.04	32.0	2	2	1
PRT	sp|P19338|NUCL_HUMAN	Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	624-UNIMOD:188	0.02	32.0	1	1	1
PRT	sp|Q96GQ7|DDX27_HUMAN	Probable ATP-dependent RNA helicase DDX27 OS=Homo sapiens OX=9606 GN=DDX27 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	436-UNIMOD:267,279-UNIMOD:267,349-UNIMOD:267	0.05	32.0	5	3	1
PRT	sp|P78332-2|RBM6_HUMAN	Isoform 2 of RNA-binding protein 6 OS=Homo sapiens OX=9606 GN=RBM6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	209-UNIMOD:188	0.02	32.0	2	1	0
PRT	sp|P68371|TBB4B_HUMAN	Tubulin beta-4B chain OS=Homo sapiens OX=9606 GN=TUBB4B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	58-UNIMOD:188	0.03	32.0	1	1	1
PRT	sp|Q9NRL2-2|BAZ1A_HUMAN	Isoform 2 of Bromodomain adjacent to zinc finger domain protein 1A OS=Homo sapiens OX=9606 GN=BAZ1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	767-UNIMOD:4,775-UNIMOD:267	0.01	32.0	2	1	0
PRT	sp|O75083|WDR1_HUMAN	WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=WDR1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	170-UNIMOD:4,180-UNIMOD:188,17-UNIMOD:267	0.05	32.0	3	2	1
PRT	sp|P26373|RL13_HUMAN	60S ribosomal protein L13 OS=Homo sapiens OX=9606 GN=RPL13 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	158-UNIMOD:267,155-UNIMOD:35	0.12	32.0	5	2	1
PRT	sp|Q08209-5|PP2BA_HUMAN	Isoform 5 of Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform OS=Homo sapiens OX=9606 GN=PPP3CA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	45-UNIMOD:267	0.03	32.0	2	1	0
PRT	sp|P50479|PDLI4_HUMAN	PDZ and LIM domain protein 4 OS=Homo sapiens OX=9606 GN=PDLIM4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	255-UNIMOD:4,257-UNIMOD:267	0.05	32.0	2	1	0
PRT	sp|Q9BSU1|CP070_HUMAN	UPF0183 protein C16orf70 OS=Homo sapiens OX=9606 GN=C16orf70 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	222-UNIMOD:4	0.04	32.0	1	1	1
PRT	sp|Q99623-2|PHB2_HUMAN	Isoform 2 of Prohibitin-2 OS=Homo sapiens OX=9606 GN=PHB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	37-UNIMOD:267,157-UNIMOD:267	0.10	32.0	4	2	0
PRT	sp|Q92696|PGTA_HUMAN	Geranylgeranyl transferase type-2 subunit alpha OS=Homo sapiens OX=9606 GN=RABGGTA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	532-UNIMOD:4,534-UNIMOD:267	0.03	32.0	2	1	0
PRT	sp|Q9NYL2-2|M3K20_HUMAN	Isoform 2 of Mitogen-activated protein kinase kinase kinase 20 OS=Homo sapiens OX=9606 GN=MAP3K20	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	337-UNIMOD:267	0.04	32.0	3	1	0
PRT	sp|P18206|VINC_HUMAN	Vinculin OS=Homo sapiens OX=9606 GN=VCL PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	327-UNIMOD:35,339-UNIMOD:267	0.01	32.0	2	1	0
PRT	sp|Q9BT73|PSMG3_HUMAN	Proteasome assembly chaperone 3 OS=Homo sapiens OX=9606 GN=PSMG3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	93-UNIMOD:267	0.11	32.0	2	1	0
PRT	sp|P49790-2|NU153_HUMAN	Isoform 2 of Nuclear pore complex protein Nup153 OS=Homo sapiens OX=9606 GN=NUP153	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	214-UNIMOD:267,1423-UNIMOD:267	0.02	32.0	4	2	0
PRT	sp|Q07955-3|SRSF1_HUMAN	Isoform ASF-3 of Serine/arginine-rich splicing factor 1 OS=Homo sapiens OX=9606 GN=SRSF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	2-UNIMOD:1,16-UNIMOD:4,8-UNIMOD:267,17-UNIMOD:267,28-UNIMOD:267	0.14	32.0	15	2	0
PRT	sp|O75369-6|FLNB_HUMAN	Isoform 6 of Filamin-B OS=Homo sapiens OX=9606 GN=FLNB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	551-UNIMOD:188,49-UNIMOD:267,946-UNIMOD:188,439-UNIMOD:188,991-UNIMOD:4,999-UNIMOD:267	0.03	32.0	10	5	2
PRT	sp|Q7L0Y3|TM10C_HUMAN	tRNA methyltransferase 10 homolog C OS=Homo sapiens OX=9606 GN=TRMT10C PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	78-UNIMOD:4	0.06	32.0	1	1	1
PRT	sp|P37802|TAGL2_HUMAN	Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	139-UNIMOD:267,182-UNIMOD:267	0.20	32.0	6	3	1
PRT	sp|P56192-2|SYMC_HUMAN	Isoform 2 of Methionine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=MARS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	483-UNIMOD:267	0.03	32.0	1	1	1
PRT	sp|P50851-2|LRBA_HUMAN	Isoform 2 of Lipopolysaccharide-responsive and beige-like anchor protein OS=Homo sapiens OX=9606 GN=LRBA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	2184-UNIMOD:267,1882-UNIMOD:267,2808-UNIMOD:4	0.02	32.0	5	3	1
PRT	sp|P02545|LMNA_HUMAN	Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	296-UNIMOD:267,472-UNIMOD:28,482-UNIMOD:267,486-UNIMOD:188	0.05	32.0	7	2	0
PRT	sp|P56556|NDUA6_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 OS=Homo sapiens OX=9606 GN=NDUFA6 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	null	8-UNIMOD:28,18-UNIMOD:188,23-UNIMOD:267	0.13	32.0	2	1	0
PRT	sp|Q9H2M9|RBGPR_HUMAN	Rab3 GTPase-activating protein non-catalytic subunit OS=Homo sapiens OX=9606 GN=RAB3GAP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.01	31.0	1	1	1
PRT	sp|O75182-3|SIN3B_HUMAN	Isoform 3 of Paired amphipathic helix protein Sin3b OS=Homo sapiens OX=9606 GN=SIN3B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	2-UNIMOD:1,19-UNIMOD:267	0.05	31.0	1	1	1
PRT	sp|Q9GZR7-2|DDX24_HUMAN	Isoform 2 of ATP-dependent RNA helicase DDX24 OS=Homo sapiens OX=9606 GN=DDX24	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	91-UNIMOD:188,96-UNIMOD:188	0.02	31.0	1	1	1
PRT	sp|Q8NFH5-3|NUP35_HUMAN	Isoform 3 of Nucleoporin NUP35 OS=Homo sapiens OX=9606 GN=NUP35	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	120-UNIMOD:4,134-UNIMOD:188	0.08	31.0	2	1	0
PRT	sp|P18754|RCC1_HUMAN	Regulator of chromosome condensation OS=Homo sapiens OX=9606 GN=RCC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.05	31.0	1	1	1
PRT	sp|Q13200-2|PSMD2_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PSMD2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|P86791|CCZ1_HUMAN	Vacuolar fusion protein CCZ1 homolog OS=Homo sapiens OX=9606 GN=CCZ1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	295-UNIMOD:188	0.03	31.0	2	1	0
PRT	sp|P26639|SYTC_HUMAN	Threonine--tRNA ligase 1, cytoplasmic OS=Homo sapiens OX=9606 GN=TARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	381-UNIMOD:267,306-UNIMOD:188	0.04	31.0	4	2	0
PRT	sp|P23381-2|SYWC_HUMAN	Isoform 2 of Tryptophan--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=WARS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	233-UNIMOD:4,236-UNIMOD:188	0.03	31.0	2	1	0
PRT	sp|P11387|TOP1_HUMAN	DNA topoisomerase 1 OS=Homo sapiens OX=9606 GN=TOP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	239-UNIMOD:188	0.02	31.0	2	1	0
PRT	sp|Q9C0C2|TB182_HUMAN	182 kDa tankyrase-1-binding protein OS=Homo sapiens OX=9606 GN=TNKS1BP1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	1288-UNIMOD:267	0.01	31.0	3	1	0
PRT	sp|Q9H0S4-2|DDX47_HUMAN	Isoform 2 of Probable ATP-dependent RNA helicase DDX47 OS=Homo sapiens OX=9606 GN=DDX47	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	62-UNIMOD:267	0.03	31.0	1	1	0
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	58-UNIMOD:188,350-UNIMOD:188,164-UNIMOD:35	0.09	31.0	5	3	0
PRT	sp|O43597|SPY2_HUMAN	Protein sprouty homolog 2 OS=Homo sapiens OX=9606 GN=SPRY2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.06	31.0	1	1	1
PRT	sp|P15586-2|GNS_HUMAN	Isoform 2 of N-acetylglucosamine-6-sulfatase OS=Homo sapiens OX=9606 GN=GNS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	493-UNIMOD:4,498-UNIMOD:4,117-UNIMOD:267	0.05	31.0	3	2	1
PRT	sp|P61019-2|RAB2A_HUMAN	Isoform 2 of Ras-related protein Rab-2A OS=Homo sapiens OX=9606 GN=RAB2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	45-UNIMOD:267	0.07	31.0	2	1	0
PRT	sp|Q15366-7|PCBP2_HUMAN	Isoform 7 of Poly(rC)-binding protein 2 OS=Homo sapiens OX=9606 GN=PCBP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	109-UNIMOD:4,115-UNIMOD:188,70-UNIMOD:188	0.09	31.0	4	2	0
PRT	sp|P20936-2|RASA1_HUMAN	Isoform 2 of Ras GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RASA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	737-UNIMOD:35	0.02	31.0	1	1	1
PRT	sp|Q15233-2|NONO_HUMAN	Isoform 2 of Non-POU domain-containing octamer-binding protein OS=Homo sapiens OX=9606 GN=NONO	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	295-UNIMOD:35,309-UNIMOD:267	0.04	31.0	2	1	0
PRT	sp|Q9UQE7|SMC3_HUMAN	Structural maintenance of chromosomes protein 3 OS=Homo sapiens OX=9606 GN=SMC3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	579-UNIMOD:35,592-UNIMOD:188	0.01	31.0	3	1	0
PRT	sp|P23193|TCEA1_HUMAN	Transcription elongation factor A protein 1 OS=Homo sapiens OX=9606 GN=TCEA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	45-UNIMOD:267,212-UNIMOD:4,36-UNIMOD:35	0.10	31.0	5	2	0
PRT	sp|P33897|ABCD1_HUMAN	ATP-binding cassette sub-family D member 1 OS=Homo sapiens OX=9606 GN=ABCD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	401-UNIMOD:267	0.02	31.0	2	1	0
PRT	sp|P60468|SC61B_HUMAN	Protein transport protein Sec61 subunit beta OS=Homo sapiens OX=9606 GN=SEC61B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	16-UNIMOD:267	0.17	31.0	2	1	0
PRT	sp|Q92783-2|STAM1_HUMAN	Isoform 2 of Signal transducing adapter molecule 1 OS=Homo sapiens OX=9606 GN=STAM	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	15-UNIMOD:188	0.04	31.0	1	1	1
PRT	sp|P05783|K1C18_HUMAN	Keratin, type I cytoskeletal 18 OS=Homo sapiens OX=9606 GN=KRT18 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	370-UNIMOD:188,314-UNIMOD:267,196-UNIMOD:267,176-UNIMOD:28,186-UNIMOD:267,158-UNIMOD:267	0.14	31.0	10	5	0
PRT	sp|Q9Y2X7|GIT1_HUMAN	ARF GTPase-activating protein GIT1 OS=Homo sapiens OX=9606 GN=GIT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	325-UNIMOD:267	0.02	31.0	3	1	0
PRT	sp|Q9NRN9|METL5_HUMAN	Methyltransferase-like protein 5 OS=Homo sapiens OX=9606 GN=METTL5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.07	31.0	1	1	1
PRT	sp|Q8WUF5|IASPP_HUMAN	RelA-associated inhibitor OS=Homo sapiens OX=9606 GN=PPP1R13L PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	344-UNIMOD:267	0.02	31.0	2	1	0
PRT	sp|P51610-2|HCFC1_HUMAN	Isoform 2 of Host cell factor 1 OS=Homo sapiens OX=9606 GN=HCFC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	2	2	1
PRT	sp|P02545-5|LMNA_HUMAN	Isoform 5 of Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	2260-UNIMOD:267,2342-UNIMOD:267,2301-UNIMOD:267	0.02	31.0	6	3	0
PRT	sp|P46782|RS5_HUMAN	40S ribosomal protein S5 OS=Homo sapiens OX=9606 GN=RPS5 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	155-UNIMOD:4,159-UNIMOD:267	0.07	31.0	5	1	0
PRT	sp|Q58FG1|HS904_HUMAN	Putative heat shock protein HSP 90-alpha A4 OS=Homo sapiens OX=9606 GN=HSP90AA4P PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	40-UNIMOD:188	0.03	31.0	1	1	1
PRT	sp|Q14498|RBM39_HUMAN	RNA-binding protein 39 OS=Homo sapiens OX=9606 GN=RBM39 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	232-UNIMOD:188	0.03	31.0	1	1	0
PRT	sp|P49790|NU153_HUMAN	Nuclear pore complex protein Nup153 OS=Homo sapiens OX=9606 GN=NUP153 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.01	31.0	1	1	0
PRT	sp|P06454|PTMA_HUMAN	Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	103-UNIMOD:188,104-UNIMOD:188	0.14	31.0	1	1	0
PRT	sp|P04637|P53_HUMAN	Cellular tumor antigen p53 OS=Homo sapiens OX=9606 GN=TP53 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	null	182-UNIMOD:385,182-UNIMOD:4,196-UNIMOD:267	0.04	31.0	2	1	0
PRT	sp|Q9Y6E0-2|STK24_HUMAN	Isoform A of Serine/threonine-protein kinase 24 OS=Homo sapiens OX=9606 GN=STK24	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:1,17-UNIMOD:188	0.04	30.0	2	1	0
PRT	sp|Q9BPX5|ARP5L_HUMAN	Actin-related protein 2/3 complex subunit 5-like protein OS=Homo sapiens OX=9606 GN=ARPC5L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	145-UNIMOD:267	0.08	30.0	2	1	0
PRT	sp|P57088|TMM33_HUMAN	Transmembrane protein 33 OS=Homo sapiens OX=9606 GN=TMEM33 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	69-UNIMOD:267	0.05	30.0	3	1	0
PRT	sp|O75874|IDHC_HUMAN	Isocitrate dehydrogenase [NADP] cytoplasmic OS=Homo sapiens OX=9606 GN=IDH1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	58-UNIMOD:188,65-UNIMOD:188,269-UNIMOD:4,270-UNIMOD:188	0.07	30.0	2	2	2
PRT	sp|P05023-3|AT1A1_HUMAN	Isoform 3 of Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	60-UNIMOD:188,209-UNIMOD:267,627-UNIMOD:267	0.04	30.0	7	3	0
PRT	sp|P53985|MOT1_HUMAN	Monocarboxylate transporter 1 OS=Homo sapiens OX=9606 GN=SLC16A1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	473-UNIMOD:188,479-UNIMOD:188	0.04	30.0	1	1	1
PRT	sp|P20585|MSH3_HUMAN	DNA mismatch repair protein Msh3 OS=Homo sapiens OX=9606 GN=MSH3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|O00116|ADAS_HUMAN	Alkyldihydroxyacetonephosphate synthase, peroxisomal OS=Homo sapiens OX=9606 GN=AGPS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|Q99661-2|KIF2C_HUMAN	Isoform 2 of Kinesin-like protein KIF2C OS=Homo sapiens OX=9606 GN=KIF2C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	444-UNIMOD:267	0.02	30.0	3	1	0
PRT	sp|Q14683|SMC1A_HUMAN	Structural maintenance of chromosomes protein 1A OS=Homo sapiens OX=9606 GN=SMC1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	38-UNIMOD:188	0.01	30.0	2	1	0
PRT	sp|P31943|HNRH1_HUMAN	Heterogeneous nuclear ribonucleoprotein H OS=Homo sapiens OX=9606 GN=HNRNPH1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	22-UNIMOD:4,29-UNIMOD:267	0.03	30.0	3	1	0
PRT	sp|Q9Y570-3|PPME1_HUMAN	Isoform 3 of Protein phosphatase methylesterase 1 OS=Homo sapiens OX=9606 GN=PPME1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	36-UNIMOD:4,40-UNIMOD:188	0.09	30.0	2	1	0
PRT	sp|P48681|NEST_HUMAN	Nestin OS=Homo sapiens OX=9606 GN=NES PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	2	2	2
PRT	sp|Q9UI30-2|TR112_HUMAN	Isoform 2 of Multifunctional methyltransferase subunit TRM112-like protein OS=Homo sapiens OX=9606 GN=TRMT112	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	33-UNIMOD:4,44-UNIMOD:267	0.12	30.0	2	1	0
PRT	sp|Q9BTC0-2|DIDO1_HUMAN	Isoform 2 of Death-inducer obliterator 1 OS=Homo sapiens OX=9606 GN=DIDO1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	396-UNIMOD:188	0.03	30.0	2	1	0
PRT	sp|Q5VTE0|EF1A3_HUMAN	Putative elongation factor 1-alpha-like 3 OS=Homo sapiens OX=9606 GN=EEF1A1P5 PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	4	1	0
PRT	sp|Q96CN7|ISOC1_HUMAN	Isochorismatase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ISOC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	162-UNIMOD:188	0.05	30.0	2	1	0
PRT	sp|P18084|ITB5_HUMAN	Integrin beta-5 OS=Homo sapiens OX=9606 GN=ITGB5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	548-UNIMOD:4,550-UNIMOD:4,555-UNIMOD:4,557-UNIMOD:267	0.02	30.0	2	1	0
PRT	sp|O75436|VP26A_HUMAN	Vacuolar protein sorting-associated protein 26A OS=Homo sapiens OX=9606 GN=VPS26A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.04	30.0	1	1	1
PRT	sp|P49411|EFTU_HUMAN	Elongation factor Tu, mitochondrial OS=Homo sapiens OX=9606 GN=TUFM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	252-UNIMOD:267	0.03	30.0	1	1	1
PRT	sp|O60934|NBN_HUMAN	Nibrin OS=Homo sapiens OX=9606 GN=NBN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|Q00610-2|CLH1_HUMAN	Isoform 2 of Clathrin heavy chain 1 OS=Homo sapiens OX=9606 GN=CLTC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	1226-UNIMOD:267,366-UNIMOD:267,96-UNIMOD:188	0.02	30.0	5	3	1
PRT	sp|Q04323|UBXN1_HUMAN	UBX domain-containing protein 1 OS=Homo sapiens OX=9606 GN=UBXN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	231-UNIMOD:267,136-UNIMOD:28,137-UNIMOD:267,144-UNIMOD:267	0.08	30.0	3	2	1
PRT	sp|Q14566|MCM6_HUMAN	DNA replication licensing factor MCM6 OS=Homo sapiens OX=9606 GN=MCM6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	301-UNIMOD:4,302-UNIMOD:4,309-UNIMOD:267	0.02	30.0	2	1	0
PRT	sp|P09455|RET1_HUMAN	Retinol-binding protein 1 OS=Homo sapiens OX=9606 GN=RBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	11-UNIMOD:35,22-UNIMOD:267	0.10	30.0	1	1	1
PRT	sp|Q53GQ0|DHB12_HUMAN	Very-long-chain 3-oxoacyl-CoA reductase OS=Homo sapiens OX=9606 GN=HSD17B12 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	179-UNIMOD:267,168-UNIMOD:35,176-UNIMOD:35	0.04	30.0	5	1	0
PRT	sp|Q9NR30-2|DDX21_HUMAN	Isoform 2 of Nucleolar RNA helicase 2 OS=Homo sapiens OX=9606 GN=DDX21	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	250-UNIMOD:267	0.06	30.0	4	3	2
PRT	sp|O43390-4|HNRPR_HUMAN	Isoform 4 of Heterogeneous nuclear ribonucleoprotein R OS=Homo sapiens OX=9606 GN=HNRNPR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	261-UNIMOD:188,105-UNIMOD:267	0.05	30.0	4	2	0
PRT	sp|Q96EK9|KTI12_HUMAN	Protein KTI12 homolog OS=Homo sapiens OX=9606 GN=KTI12 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	7-UNIMOD:4,14-UNIMOD:188	0.04	30.0	2	1	0
PRT	sp|Q9H9B4|SFXN1_HUMAN	Sideroflexin-1 OS=Homo sapiens OX=9606 GN=SFXN1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	70-UNIMOD:267,24-UNIMOD:267	0.08	30.0	3	2	1
PRT	sp|P46821|MAP1B_HUMAN	Microtubule-associated protein 1B OS=Homo sapiens OX=9606 GN=MAP1B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	1457-UNIMOD:188,1461-UNIMOD:188,414-UNIMOD:188	0.02	30.0	3	2	1
PRT	sp|Q1KMD3|HNRL2_HUMAN	Heterogeneous nuclear ribonucleoprotein U-like protein 2 OS=Homo sapiens OX=9606 GN=HNRNPUL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	174-UNIMOD:188,187-UNIMOD:188	0.04	30.0	3	1	0
PRT	sp|P07737|PROF1_HUMAN	Profilin-1 OS=Homo sapiens OX=9606 GN=PFN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	105-UNIMOD:188	0.11	30.0	2	1	0
PRT	sp|Q5C9Z4|NOM1_HUMAN	Nucleolar MIF4G domain-containing protein 1 OS=Homo sapiens OX=9606 GN=NOM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	113-UNIMOD:267	0.02	30.0	1	1	1
PRT	sp|Q16401-2|PSMD5_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 5 OS=Homo sapiens OX=9606 GN=PSMD5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	437-UNIMOD:267	0.03	30.0	2	1	0
PRT	sp|Q71U36-2|TBA1A_HUMAN	Isoform 2 of Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	312-UNIMOD:4,317-UNIMOD:188	0.03	30.0	2	1	0
PRT	sp|A0MZ66-7|SHOT1_HUMAN	Isoform 7 of Shootin-1 OS=Homo sapiens OX=9606 GN=SHTN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	153-UNIMOD:4	0.16	30.0	2	2	2
PRT	sp|P30520|PURA2_HUMAN	Adenylosuccinate synthetase isozyme 2 OS=Homo sapiens OX=9606 GN=ADSS2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	416-UNIMOD:267	0.03	30.0	2	1	0
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	95-UNIMOD:188,82-UNIMOD:267	0.03	30.0	5	2	0
PRT	sp|P07910-4|HNRPC_HUMAN	Isoform 4 of Heterogeneous nuclear ribonucleoproteins C1/C2 OS=Homo sapiens OX=9606 GN=HNRNPC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	29-UNIMOD:188,61-UNIMOD:267	0.10	30.0	4	2	0
PRT	sp|P00338|LDHA_HUMAN	L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	163-UNIMOD:4,169-UNIMOD:267,99-UNIMOD:267	0.10	30.0	4	3	1
PRT	sp|Q12906|ILF3_HUMAN	Interleukin enhancer-binding factor 3 OS=Homo sapiens OX=9606 GN=ILF3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	255-UNIMOD:4,257-UNIMOD:188	0.03	30.0	3	2	1
PRT	sp|Q16822-2|PCKGM_HUMAN	Isoform 2 of Phosphoenolpyruvate carboxykinase [GTP], mitochondrial OS=Homo sapiens OX=9606 GN=PCK2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|Q14247-3|SRC8_HUMAN	Isoform 3 of Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	512-UNIMOD:267	0.03	30.0	2	1	0
PRT	sp|O00571|DDX3X_HUMAN	ATP-dependent RNA helicase DDX3X OS=Homo sapiens OX=9606 GN=DDX3X PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null		0.02	30.0	1	1	0
PRT	sp|P68104|EF1A1_HUMAN	Elongation factor 1-alpha 1 OS=Homo sapiens OX=9606 GN=EEF1A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	266-UNIMOD:267	0.03	30.0	5	1	0
PRT	sp|Q08426|ECHP_HUMAN	Peroxisomal bifunctional enzyme OS=Homo sapiens OX=9606 GN=EHHADH PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	null	223-UNIMOD:28,227-UNIMOD:4,233-UNIMOD:4,235-UNIMOD:267	0.02	30.0	2	1	0
PRT	sp|Q9NUM4|T106B_HUMAN	Transmembrane protein 106B OS=Homo sapiens OX=9606 GN=TMEM106B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	41-UNIMOD:267	0.05	30.0	2	1	0
PRT	sp|P62256|UBE2H_HUMAN	Ubiquitin-conjugating enzyme E2 H OS=Homo sapiens OX=9606 GN=UBE2H PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null		0.09	30.0	1	1	1
PRT	sp|O14744-3|ANM5_HUMAN	Isoform 3 of Protein arginine N-methyltransferase 5 OS=Homo sapiens OX=9606 GN=PRMT5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	179-UNIMOD:188	0.02	29.0	2	1	0
PRT	sp|P63313|TYB10_HUMAN	Thymosin beta-10 OS=Homo sapiens OX=9606 GN=TMSB10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1,4-UNIMOD:188,15-UNIMOD:188	0.34	29.0	2	1	0
PRT	sp|O76003|GLRX3_HUMAN	Glutaredoxin-3 OS=Homo sapiens OX=9606 GN=GLRX3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	332-UNIMOD:267	0.04	29.0	4	2	0
PRT	sp|Q08945|SSRP1_HUMAN	FACT complex subunit SSRP1 OS=Homo sapiens OX=9606 GN=SSRP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	381-UNIMOD:267	0.02	29.0	2	1	0
PRT	sp|Q8WW12-2|PCNP_HUMAN	Isoform 2 of PEST proteolytic signal-containing nuclear protein OS=Homo sapiens OX=9606 GN=PCNP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	81-UNIMOD:188	0.09	29.0	2	1	0
PRT	sp|P34932|HSP74_HUMAN	Heat shock 70 kDa protein 4 OS=Homo sapiens OX=9606 GN=HSPA4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	310-UNIMOD:4	0.01	29.0	1	1	1
PRT	sp|O00139-2|KIF2A_HUMAN	Isoform 2 of Kinesin-like protein KIF2A OS=Homo sapiens OX=9606 GN=KIF2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	417-UNIMOD:267,374-UNIMOD:4,375-UNIMOD:267	0.03	29.0	4	2	0
PRT	sp|P52735-3|VAV2_HUMAN	Isoform 3 of Guanine nucleotide exchange factor VAV2 OS=Homo sapiens OX=9606 GN=VAV2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|Q7Z7A3|CTU1_HUMAN	Cytoplasmic tRNA 2-thiolation protein 1 OS=Homo sapiens OX=9606 GN=CTU1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	209-UNIMOD:267	0.05	29.0	2	1	0
PRT	sp|Q99714-2|HCD2_HUMAN	Isoform 2 of 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Homo sapiens OX=9606 GN=HSD17B10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	178-UNIMOD:35,184-UNIMOD:267	0.05	29.0	4	1	0
PRT	sp|P49736|MCM2_HUMAN	DNA replication licensing factor MCM2 OS=Homo sapiens OX=9606 GN=MCM2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	505-UNIMOD:188	0.01	29.0	2	1	0
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	112-UNIMOD:188,292-UNIMOD:188,400-UNIMOD:267	0.05	29.0	5	3	1
PRT	sp|Q04941|PLP2_HUMAN	Proteolipid protein 2 OS=Homo sapiens OX=9606 GN=PLP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.09	29.0	1	1	1
PRT	sp|Q15435-5|PP1R7_HUMAN	Isoform 5 of Protein phosphatase 1 regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PPP1R7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	196-UNIMOD:267	0.05	29.0	1	1	0
PRT	sp|P35232|PHB_HUMAN	Prohibitin OS=Homo sapiens OX=9606 GN=PHB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	117-UNIMOD:267,143-UNIMOD:267	0.09	29.0	3	2	1
PRT	sp|Q14103-4|HNRPD_HUMAN	Isoform 4 of Heterogeneous nuclear ribonucleoprotein D0 OS=Homo sapiens OX=9606 GN=HNRNPD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	178-UNIMOD:188	0.05	29.0	2	1	0
PRT	sp|Q12756|KIF1A_HUMAN	Kinesin-like protein KIF1A OS=Homo sapiens OX=9606 GN=KIF1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	436-UNIMOD:267,1571-UNIMOD:267	0.01	29.0	2	2	2
PRT	sp|P40616-2|ARL1_HUMAN	Isoform 2 of ADP-ribosylation factor-like protein 1 OS=Homo sapiens OX=9606 GN=ARL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	13-UNIMOD:188	0.07	29.0	2	1	0
PRT	sp|P36405|ARL3_HUMAN	ADP-ribosylation factor-like protein 3 OS=Homo sapiens OX=9606 GN=ARL3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	30-UNIMOD:188,72-UNIMOD:267	0.13	29.0	5	2	0
PRT	sp|P62330|ARF6_HUMAN	ADP-ribosylation factor 6 OS=Homo sapiens OX=9606 GN=ARF6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	26-UNIMOD:188	0.07	29.0	2	1	0
PRT	sp|Q86TP1-2|PRUN1_HUMAN	Isoform 2 of Exopolyphosphatase PRUNE1 OS=Homo sapiens OX=9606 GN=PRUNE1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|Q9Y5L0-5|TNPO3_HUMAN	Isoform 4 of Transportin-3 OS=Homo sapiens OX=9606 GN=TNPO3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	312-UNIMOD:4,322-UNIMOD:267	0.02	29.0	2	1	0
PRT	sp|Q92544|TM9S4_HUMAN	Transmembrane 9 superfamily member 4 OS=Homo sapiens OX=9606 GN=TM9SF4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	98-UNIMOD:188	0.02	29.0	2	1	0
PRT	sp|Q9NTM9|CUTC_HUMAN	Copper homeostasis protein cutC homolog OS=Homo sapiens OX=9606 GN=CUTC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.05	29.0	1	1	1
PRT	sp|Q6RFH5-2|WDR74_HUMAN	Isoform 2 of WD repeat-containing protein 74 OS=Homo sapiens OX=9606 GN=WDR74	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	169-UNIMOD:267	0.04	29.0	2	1	0
PRT	sp|Q9UMS4|PRP19_HUMAN	Pre-mRNA-processing factor 19 OS=Homo sapiens OX=9606 GN=PRPF19 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	298-UNIMOD:4,303-UNIMOD:267	0.03	29.0	2	1	0
PRT	sp|Q7Z5G4-3|GOGA7_HUMAN	Isoform 2 of Golgin subfamily A member 7 OS=Homo sapiens OX=9606 GN=GOLGA7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	118-UNIMOD:267	0.12	29.0	2	1	0
PRT	sp|Q5SSJ5-3|HP1B3_HUMAN	Isoform 3 of Heterochromatin protein 1-binding protein 3 OS=Homo sapiens OX=9606 GN=HP1BP3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	117-UNIMOD:267	0.03	29.0	1	1	1
PRT	sp|P53597|SUCA_HUMAN	Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=SUCLG1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	172-UNIMOD:4,181-UNIMOD:4,182-UNIMOD:188	0.05	29.0	2	1	0
PRT	sp|P05091-2|ALDH2_HUMAN	Isoform 2 of Aldehyde dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ALDH2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	339-UNIMOD:4,347-UNIMOD:267	0.09	29.0	4	3	2
PRT	sp|P37837|TALDO_HUMAN	Transaldolase OS=Homo sapiens OX=9606 GN=TALDO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	269-UNIMOD:188	0.04	29.0	2	1	0
PRT	sp|P62820-2|RAB1A_HUMAN	Isoform 2 of Ras-related protein Rab-1A OS=Homo sapiens OX=9606 GN=RAB1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	112-UNIMOD:35,123-UNIMOD:188	0.18	29.0	3	2	0
PRT	sp|P04899|GNAI2_HUMAN	Guanine nucleotide-binding protein G(i) subunit alpha-2 OS=Homo sapiens OX=9606 GN=GNAI2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|P36404-2|ARL2_HUMAN	Isoform 2 of ADP-ribosylation factor-like protein 2 OS=Homo sapiens OX=9606 GN=ARL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	29-UNIMOD:188	0.08	29.0	2	1	0
PRT	sp|O60506-5|HNRPQ_HUMAN	Isoform 5 of Heterogeneous nuclear ribonucleoprotein Q OS=Homo sapiens OX=9606 GN=SYNCRIP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	51-UNIMOD:267,43-UNIMOD:35,42-UNIMOD:35	0.03	29.0	5	1	0
PRT	sp|O14966|RAB7L_HUMAN	Ras-related protein Rab-7L1 OS=Homo sapiens OX=9606 GN=RAB29 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	69-UNIMOD:267	0.06	29.0	2	1	0
PRT	sp|P50895|BCAM_HUMAN	Basal cell adhesion molecule OS=Homo sapiens OX=9606 GN=BCAM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	499-UNIMOD:267	0.03	29.0	1	1	1
PRT	sp|Q13185|CBX3_HUMAN	Chromobox protein homolog 3 OS=Homo sapiens OX=9606 GN=CBX3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	177-UNIMOD:4	0.07	29.0	1	1	1
PRT	sp|P50914|RL14_HUMAN	60S ribosomal protein L14 OS=Homo sapiens OX=9606 GN=RPL14 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	35-UNIMOD:267	0.06	29.0	2	1	0
PRT	sp|Q9NR31|SAR1A_HUMAN	GTP-binding protein SAR1a OS=Homo sapiens OX=9606 GN=SAR1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	38-UNIMOD:188	0.06	29.0	2	1	0
PRT	sp|P17844-2|DDX5_HUMAN	Isoform 2 of Probable ATP-dependent RNA helicase DDX5 OS=Homo sapiens OX=9606 GN=DDX5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	174-UNIMOD:35,177-UNIMOD:35,184-UNIMOD:267,91-UNIMOD:4,98-UNIMOD:267,155-UNIMOD:4,157-UNIMOD:188	0.07	29.0	11	3	0
PRT	sp|Q9BXS4|TMM59_HUMAN	Transmembrane protein 59 OS=Homo sapiens OX=9606 GN=TMEM59 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	232-UNIMOD:267	0.04	29.0	2	1	0
PRT	sp|P54920|SNAA_HUMAN	Alpha-soluble NSF attachment protein OS=Homo sapiens OX=9606 GN=NAPA PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	37-UNIMOD:188	0.05	29.0	2	1	0
PRT	sp|Q86VN1-2|VPS36_HUMAN	Isoform 2 of Vacuolar protein-sorting-associated protein 36 OS=Homo sapiens OX=9606 GN=VPS36	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	202-UNIMOD:267	0.04	29.0	2	1	0
PRT	sp|Q13085-3|ACACA_HUMAN	Isoform 3 of Acetyl-CoA carboxylase 1 OS=Homo sapiens OX=9606 GN=ACACA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	257-UNIMOD:267	0.01	29.0	2	2	1
PRT	sp|Q9BRF8-3|CPPED_HUMAN	Isoform 3 of Serine/threonine-protein phosphatase CPPED1 OS=Homo sapiens OX=9606 GN=CPPED1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1	0.10	29.0	1	1	1
PRT	sp|P16402|H13_HUMAN	Histone H1.3 OS=Homo sapiens OX=9606 GN=H1-3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1	0.10	29.0	1	1	1
PRT	sp|P55290-3|CAD13_HUMAN	Isoform 3 of Cadherin-13 OS=Homo sapiens OX=9606 GN=CDH13	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.09	29.0	1	1	1
PRT	sp|Q02880-2|TOP2B_HUMAN	Isoform Beta-1 of DNA topoisomerase 2-beta OS=Homo sapiens OX=9606 GN=TOP2B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	1	1	0
PRT	sp|P42695|CNDD3_HUMAN	Condensin-2 complex subunit D3 OS=Homo sapiens OX=9606 GN=NCAPD3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	1387-UNIMOD:188	0.01	29.0	2	1	0
PRT	sp|Q5T9A4-2|ATD3B_HUMAN	Isoform 2 of ATPase family AAA domain-containing protein 3B OS=Homo sapiens OX=9606 GN=ATAD3B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	120-UNIMOD:267	0.07	29.0	1	1	1
PRT	sp|Q07020-2|RL18_HUMAN	Isoform 2 of 60S ribosomal protein L18 OS=Homo sapiens OX=9606 GN=RPL18	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	62-UNIMOD:267,103-UNIMOD:188	0.18	29.0	3	2	1
PRT	sp|Q13685|AAMP_HUMAN	Angio-associated migratory cell protein OS=Homo sapiens OX=9606 GN=AAMP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	216-UNIMOD:4,220-UNIMOD:4,222-UNIMOD:267	0.03	29.0	2	1	0
PRT	sp|Q9Y6V7|DDX49_HUMAN	Probable ATP-dependent RNA helicase DDX49 OS=Homo sapiens OX=9606 GN=DDX49 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	1	1	1
PRT	sp|P23284|PPIB_HUMAN	Peptidyl-prolyl cis-trans isomerase B OS=Homo sapiens OX=9606 GN=PPIB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	84-UNIMOD:188	0.06	29.0	2	1	0
PRT	sp|Q7L576-3|CYFP1_HUMAN	Isoform 3 of Cytoplasmic FMR1-interacting protein 1 OS=Homo sapiens OX=9606 GN=CYFIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	71-UNIMOD:267	0.05	29.0	3	2	1
PRT	sp|Q9ULH0-2|KDIS_HUMAN	Isoform 2 of Kinase D-interacting substrate of 220 kDa OS=Homo sapiens OX=9606 GN=KIDINS220	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	1008-UNIMOD:4	0.01	29.0	1	1	1
PRT	sp|P62913-2|RL11_HUMAN	Isoform 2 of 60S ribosomal protein L11 OS=Homo sapiens OX=9606 GN=RPL11	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	51-UNIMOD:188	0.08	29.0	2	1	0
PRT	sp|Q9C0E2|XPO4_HUMAN	Exportin-4 OS=Homo sapiens OX=9606 GN=XPO4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	34-UNIMOD:267	0.01	29.0	2	1	0
PRT	sp|Q8TBC4-2|UBA3_HUMAN	Isoform 2 of NEDD8-activating enzyme E1 catalytic subunit OS=Homo sapiens OX=9606 GN=UBA3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	68-UNIMOD:4,72-UNIMOD:188	0.04	29.0	2	1	0
PRT	sp|P13489|RINI_HUMAN	Ribonuclease inhibitor OS=Homo sapiens OX=9606 GN=RNH1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	64-UNIMOD:267,362-UNIMOD:4,373-UNIMOD:267	0.06	29.0	3	2	1
PRT	sp|Q9BQ52-4|RNZ2_HUMAN	Isoform 4 of Zinc phosphodiesterase ELAC protein 2 OS=Homo sapiens OX=9606 GN=ELAC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	87-UNIMOD:4,93-UNIMOD:267,713-UNIMOD:4,136-UNIMOD:4,146-UNIMOD:188	0.05	29.0	5	3	1
PRT	sp|Q9NZN3-2|EHD3_HUMAN	Isoform 2 of EH domain-containing protein 3 OS=Homo sapiens OX=9606 GN=EHD3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	87-UNIMOD:267	0.07	29.0	2	1	0
PRT	sp|P21399|ACOC_HUMAN	Cytoplasmic aconitate hydratase OS=Homo sapiens OX=9606 GN=ACO1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	772-UNIMOD:188	0.02	29.0	3	1	0
PRT	sp|P67775-2|PP2AA_HUMAN	Isoform 2 of Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Homo sapiens OX=9606 GN=PPP2CA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	240-UNIMOD:267	0.05	29.0	2	1	0
PRT	sp|P61026|RAB10_HUMAN	Ras-related protein Rab-10 OS=Homo sapiens OX=9606 GN=RAB10 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	22-UNIMOD:188,70-UNIMOD:267	0.12	29.0	4	2	0
PRT	sp|Q99623|PHB2_HUMAN	Prohibitin-2 OS=Homo sapiens OX=9606 GN=PHB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	37-UNIMOD:267	0.05	29.0	1	1	0
PRT	sp|P50395|GDIB_HUMAN	Rab GDP dissociation inhibitor beta OS=Homo sapiens OX=9606 GN=GDI2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	29.0	null	390-UNIMOD:188,89-UNIMOD:188	0.05	29.0	5	2	0
PRT	sp|Q02880|TOP2B_HUMAN	DNA topoisomerase 2-beta OS=Homo sapiens OX=9606 GN=TOP2B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null		0.01	29.0	1	1	0
PRT	sp|Q8NFV4|ABHDB_HUMAN	Protein ABHD11 OS=Homo sapiens OX=9606 GN=ABHD11 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	null	217-UNIMOD:28,229-UNIMOD:267	0.04	29.0	2	1	0
PRT	sp|Q6FI81|CPIN1_HUMAN	Anamorsin OS=Homo sapiens OX=9606 GN=CIAPIN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	null	285-UNIMOD:385,285-UNIMOD:4,288-UNIMOD:4,297-UNIMOD:188,301-UNIMOD:188	0.06	29.0	2	1	0
PRT	sp|Q15435|PP1R7_HUMAN	Protein phosphatase 1 regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PPP1R7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null		0.03	29.0	1	1	0
PRT	sp|Q03113|GNA12_HUMAN	Guanine nucleotide-binding protein subunit alpha-12 OS=Homo sapiens OX=9606 GN=GNA12 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	70-UNIMOD:188	0.03	29.0	1	1	1
PRT	sp|P43243|MATR3_HUMAN	Matrin-3 OS=Homo sapiens OX=9606 GN=MATR3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	29.0	null	387-UNIMOD:267	0.02	29.0	3	1	0
PRT	sp|Q32P44|EMAL3_HUMAN	Echinoderm microtubule-associated protein-like 3 OS=Homo sapiens OX=9606 GN=EML3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	29.0	null	360-UNIMOD:267	0.01	29.0	2	1	0
PRT	sp|Q9Y2Q3|GSTK1_HUMAN	Glutathione S-transferase kappa 1 OS=Homo sapiens OX=9606 GN=GSTK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null		0.07	29.0	1	1	1
PRT	sp|O43159|RRP8_HUMAN	Ribosomal RNA-processing protein 8 OS=Homo sapiens OX=9606 GN=RRP8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	null	305-UNIMOD:28,306-UNIMOD:267,317-UNIMOD:4,320-UNIMOD:4,321-UNIMOD:267	0.04	29.0	1	1	1
PRT	sp|Q9H7E9|CH033_HUMAN	UPF0488 protein C8orf33 OS=Homo sapiens OX=9606 GN=C8orf33 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1,21-UNIMOD:4,24-UNIMOD:267	0.10	28.0	1	1	1
PRT	sp|Q99536|VAT1_HUMAN	Synaptic vesicle membrane protein VAT-1 homolog OS=Homo sapiens OX=9606 GN=VAT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	86-UNIMOD:4,96-UNIMOD:267	0.06	28.0	3	2	1
PRT	sp|P22234|PUR6_HUMAN	Multifunctional protein ADE2 OS=Homo sapiens OX=9606 GN=PAICS PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	288-UNIMOD:4,295-UNIMOD:4,298-UNIMOD:267	0.03	28.0	2	1	0
PRT	sp|Q8NBX0|SCPDL_HUMAN	Saccharopine dehydrogenase-like oxidoreductase OS=Homo sapiens OX=9606 GN=SCCPDH PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|Q07864|DPOE1_HUMAN	DNA polymerase epsilon catalytic subunit A OS=Homo sapiens OX=9606 GN=POLE PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	1106-UNIMOD:267	0.01	28.0	3	1	0
PRT	sp|Q9H6R4-2|NOL6_HUMAN	Isoform 2 of Nucleolar protein 6 OS=Homo sapiens OX=9606 GN=NOL6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	955-UNIMOD:267	0.01	28.0	1	1	1
PRT	sp|Q8IY81|SPB1_HUMAN	pre-rRNA 2'-O-ribose RNA methyltransferase FTSJ3 OS=Homo sapiens OX=9606 GN=FTSJ3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|P21912|SDHB_HUMAN	Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Homo sapiens OX=9606 GN=SDHB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	68-UNIMOD:4	0.04	28.0	1	1	1
PRT	sp|P33992|MCM5_HUMAN	DNA replication licensing factor MCM5 OS=Homo sapiens OX=9606 GN=MCM5 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	482-UNIMOD:4,494-UNIMOD:267	0.02	28.0	1	1	1
PRT	sp|Q86Y82|STX12_HUMAN	Syntaxin-12 OS=Homo sapiens OX=9606 GN=STX12 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	97-UNIMOD:267	0.06	28.0	2	1	0
PRT	sp|Q96HE7|ERO1A_HUMAN	ERO1-like protein alpha OS=Homo sapiens OX=9606 GN=ERO1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	299-UNIMOD:267	0.03	28.0	2	1	0
PRT	sp|Q01082-3|SPTB2_HUMAN	Isoform 2 of Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	1464-UNIMOD:267,1455-UNIMOD:35	0.01	28.0	3	1	0
PRT	sp|P38571-2|LICH_HUMAN	Isoform 2 of Lysosomal acid lipase/cholesteryl ester hydrolase OS=Homo sapiens OX=9606 GN=LIPA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	2	1	0
PRT	sp|Q9ULC4-2|MCTS1_HUMAN	Isoform 2 of Malignant T-cell-amplified sequence 1 OS=Homo sapiens OX=9606 GN=MCTS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	101-UNIMOD:4,110-UNIMOD:188	0.12	28.0	1	1	1
PRT	sp|P18124|RL7_HUMAN	60S ribosomal protein L7 OS=Homo sapiens OX=9606 GN=RPL7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	177-UNIMOD:267	0.05	28.0	1	1	1
PRT	sp|P48147|PPCE_HUMAN	Prolyl endopeptidase OS=Homo sapiens OX=9606 GN=PREP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null	57-UNIMOD:4,60-UNIMOD:267	0.02	28.0	3	1	0
PRT	sp|P62937-2|PPIA_HUMAN	Isoform 2 of Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	101-UNIMOD:4,95-UNIMOD:188	0.11	28.0	2	1	0
PRT	sp|Q8TC12-2|RDH11_HUMAN	Isoform 2 of Retinol dehydrogenase 11 OS=Homo sapiens OX=9606 GN=RDH11	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	1	1	1
PRT	sp|O95336|6PGL_HUMAN	6-phosphogluconolactonase OS=Homo sapiens OX=9606 GN=PGLS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	237-UNIMOD:4,246-UNIMOD:267	0.10	28.0	3	2	1
PRT	sp|Q5RI15|COX20_HUMAN	Cytochrome c oxidase assembly protein COX20, mitochondrial OS=Homo sapiens OX=9606 GN=COX20 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	29-UNIMOD:4,31-UNIMOD:267	0.13	28.0	1	1	1
PRT	sp|Q9NP81|SYSM_HUMAN	Serine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=SARS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null	471-UNIMOD:188	0.03	28.0	3	1	0
PRT	sp|P35270|SPRE_HUMAN	Sepiapterin reductase OS=Homo sapiens OX=9606 GN=SPR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.06	28.0	1	1	1
PRT	sp|Q7L2H7-2|EIF3M_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit M OS=Homo sapiens OX=9606 GN=EIF3M	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	158-UNIMOD:188	0.05	28.0	2	1	0
PRT	sp|Q04726-2|TLE3_HUMAN	Isoform 2 of Transducin-like enhancer protein 3 OS=Homo sapiens OX=9606 GN=TLE3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	631-UNIMOD:267	0.03	28.0	3	2	1
PRT	sp|Q9BWJ5|SF3B5_HUMAN	Splicing factor 3B subunit 5 OS=Homo sapiens OX=9606 GN=SF3B5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	72-UNIMOD:35,76-UNIMOD:4,82-UNIMOD:188	0.19	28.0	2	1	0
PRT	sp|Q08AM6|VAC14_HUMAN	Protein VAC14 homolog OS=Homo sapiens OX=9606 GN=VAC14 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	1-UNIMOD:1	0.02	28.0	1	1	1
PRT	sp|P78527-2|PRKDC_HUMAN	Isoform 2 of DNA-dependent protein kinase catalytic subunit OS=Homo sapiens OX=9606 GN=PRKDC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	3859-UNIMOD:35,2950-UNIMOD:188,232-UNIMOD:4,236-UNIMOD:188	0.01	28.0	4	3	2
PRT	sp|Q9NZI8|IF2B1_HUMAN	Insulin-like growth factor 2 mRNA-binding protein 1 OS=Homo sapiens OX=9606 GN=IGF2BP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	453-UNIMOD:35,465-UNIMOD:188	0.02	28.0	4	1	0
PRT	sp|Q15424-2|SAFB1_HUMAN	Isoform 2 of Scaffold attachment factor B1 OS=Homo sapiens OX=9606 GN=SAFB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	349-UNIMOD:267	0.02	28.0	2	1	0
PRT	sp|P36578|RL4_HUMAN	60S ribosomal protein L4 OS=Homo sapiens OX=9606 GN=RPL4 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	96-UNIMOD:4,97-UNIMOD:267,234-UNIMOD:188	0.06	28.0	4	2	0
PRT	sp|P52948-4|NUP98_HUMAN	Isoform 4 of Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens OX=9606 GN=NUP98	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	599-UNIMOD:267	0.02	28.0	2	1	0
PRT	sp|O14737|PDCD5_HUMAN	Programmed cell death protein 5 OS=Homo sapiens OX=9606 GN=PDCD5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	53-UNIMOD:267	0.11	28.0	2	1	0
PRT	sp|P32119|PRDX2_HUMAN	Peroxiredoxin-2 OS=Homo sapiens OX=9606 GN=PRDX2 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	150-UNIMOD:267	0.06	28.0	2	1	0
PRT	sp|Q96QK1|VPS35_HUMAN	Vacuolar protein sorting-associated protein 35 OS=Homo sapiens OX=9606 GN=VPS35 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	781-UNIMOD:267,226-UNIMOD:267	0.03	28.0	3	2	1
PRT	sp|Q16851-2|UGPA_HUMAN	Isoform 2 of UTP--glucose-1-phosphate uridylyltransferase OS=Homo sapiens OX=9606 GN=UGP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	378-UNIMOD:267	0.03	28.0	2	1	0
PRT	sp|Q16774|KGUA_HUMAN	Guanylate kinase OS=Homo sapiens OX=9606 GN=GUK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1	0.09	28.0	1	1	1
PRT	sp|O94763-2|RMP_HUMAN	Isoform 2 of Unconventional prefoldin RPB5 interactor 1 OS=Homo sapiens OX=9606 GN=URI1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	367-UNIMOD:4,372-UNIMOD:4	0.06	28.0	1	1	1
PRT	sp|Q8NC51-4|PAIRB_HUMAN	Isoform 4 of Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.06	28.0	1	1	1
PRT	sp|Q07812-5|BAX_HUMAN	Isoform Epsilon of Apoptosis regulator BAX OS=Homo sapiens OX=9606 GN=BAX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	34-UNIMOD:267	0.09	28.0	2	1	0
PRT	sp|P29558-2|RBMS1_HUMAN	Isoform 2 of RNA-binding motif, single-stranded-interacting protein 1 OS=Homo sapiens OX=9606 GN=RBMS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	221-UNIMOD:4,222-UNIMOD:188	0.04	28.0	2	1	0
PRT	sp|P09874|PARP1_HUMAN	Poly [ADP-ribose] polymerase 1 OS=Homo sapiens OX=9606 GN=PARP1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	878-UNIMOD:267	0.01	28.0	1	1	1
PRT	sp|P62805|H4_HUMAN	Histone H4 OS=Homo sapiens OX=9606 GN=H4C1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	92-UNIMOD:188,56-UNIMOD:267	0.23	28.0	4	2	0
PRT	sp|P23526|SAHH_HUMAN	Adenosylhomocysteinase OS=Homo sapiens OX=9606 GN=AHCY PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	19-UNIMOD:267	0.03	28.0	2	1	0
PRT	sp|Q12965|MYO1E_HUMAN	Unconventional myosin-Ie OS=Homo sapiens OX=9606 GN=MYO1E PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	373-UNIMOD:188	0.01	28.0	2	1	0
PRT	sp|Q13045-2|FLII_HUMAN	Isoform 2 of Protein flightless-1 homolog OS=Homo sapiens OX=9606 GN=FLII	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	187-UNIMOD:4,829-UNIMOD:267,195-UNIMOD:267	0.02	28.0	3	2	1
PRT	sp|P55072|TERA_HUMAN	Transitional endoplasmic reticulum ATPase OS=Homo sapiens OX=9606 GN=VCP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	465-UNIMOD:267,105-UNIMOD:4,109-UNIMOD:188	0.05	28.0	3	3	3
PRT	sp|Q9UG63|ABCF2_HUMAN	ATP-binding cassette sub-family F member 2 OS=Homo sapiens OX=9606 GN=ABCF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	124-UNIMOD:188	0.02	28.0	2	1	0
PRT	sp|Q6ZMR3|LDH6A_HUMAN	L-lactate dehydrogenase A-like 6A OS=Homo sapiens OX=9606 GN=LDHAL6A PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	163-UNIMOD:4	0.04	28.0	1	1	0
PRT	sp|Q9NR61|DLL4_HUMAN	Delta-like protein 4 OS=Homo sapiens OX=9606 GN=DLL4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	null	608-UNIMOD:28	0.03	28.0	1	1	1
PRT	sp|O95831|AIFM1_HUMAN	Apoptosis-inducing factor 1, mitochondrial OS=Homo sapiens OX=9606 GN=AIFM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	256-UNIMOD:4,265-UNIMOD:267	0.04	28.0	3	2	1
PRT	sp|P01023|A2MG_HUMAN	Alpha-2-macroglobulin OS=Homo sapiens OX=9606 GN=A2M PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.01	28.0	2	1	0
PRT	sp|Q13416|ORC2_HUMAN	Origin recognition complex subunit 2 OS=Homo sapiens OX=9606 GN=ORC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	null	468-UNIMOD:28	0.03	28.0	1	1	1
PRT	sp|P19404|NDUV2_HUMAN	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFV2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	88-UNIMOD:267	0.06	27.0	2	1	0
PRT	sp|Q14146|URB2_HUMAN	Unhealthy ribosome biogenesis protein 2 homolog OS=Homo sapiens OX=9606 GN=URB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	1294-UNIMOD:4,1306-UNIMOD:267	0.01	27.0	2	1	0
PRT	sp|Q13907|IDI1_HUMAN	Isopentenyl-diphosphate Delta-isomerase 1 OS=Homo sapiens OX=9606 GN=IDI1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	64-UNIMOD:188	0.06	27.0	2	1	0
PRT	sp|Q9P0V3-2|SH3B4_HUMAN	Isoform 2 of SH3 domain-binding protein 4 OS=Homo sapiens OX=9606 GN=SH3BP4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	370-UNIMOD:267	0.03	27.0	1	1	1
PRT	sp|Q8IV50|LYSM2_HUMAN	LysM and putative peptidoglycan-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=LYSMD2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	69-UNIMOD:267	0.05	27.0	2	1	0
PRT	sp|Q9H1A4|APC1_HUMAN	Anaphase-promoting complex subunit 1 OS=Homo sapiens OX=9606 GN=ANAPC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	25-UNIMOD:267	0.01	27.0	2	1	0
PRT	sp|P51149|RAB7A_HUMAN	Ras-related protein Rab-7a OS=Homo sapiens OX=9606 GN=RAB7A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	171-UNIMOD:267,126-UNIMOD:188	0.14	27.0	4	2	1
PRT	sp|P50990-3|TCPQ_HUMAN	Isoform 3 of T-complex protein 1 subunit theta OS=Homo sapiens OX=9606 GN=CCT8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	377-UNIMOD:267	0.02	27.0	2	1	0
PRT	sp|O15031|PLXB2_HUMAN	Plexin-B2 OS=Homo sapiens OX=9606 GN=PLXNB2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	948-UNIMOD:4,956-UNIMOD:267	0.01	27.0	1	1	1
PRT	sp|O60220|TIM8A_HUMAN	Mitochondrial import inner membrane translocase subunit Tim8 A OS=Homo sapiens OX=9606 GN=TIMM8A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.12	27.0	1	1	1
PRT	sp|Q9BZJ0-2|CRNL1_HUMAN	Isoform 2 of Crooked neck-like protein 1 OS=Homo sapiens OX=9606 GN=CRNKL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	479-UNIMOD:4,484-UNIMOD:188	0.02	27.0	2	1	0
PRT	sp|Q6P2E9|EDC4_HUMAN	Enhancer of mRNA-decapping protein 4 OS=Homo sapiens OX=9606 GN=EDC4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null	378-UNIMOD:267	0.01	27.0	3	1	0
PRT	sp|O75170-6|PP6R2_HUMAN	Isoform 6 of Serine/threonine-protein phosphatase 6 regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PPP6R2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	707-UNIMOD:4,708-UNIMOD:4,714-UNIMOD:267	0.02	27.0	2	1	0
PRT	sp|O60341|KDM1A_HUMAN	Lysine-specific histone demethylase 1A OS=Homo sapiens OX=9606 GN=KDM1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	744-UNIMOD:188,226-UNIMOD:188	0.03	27.0	3	2	1
PRT	sp|Q92934|BAD_HUMAN	Bcl2-associated agonist of cell death OS=Homo sapiens OX=9606 GN=BAD PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	36-UNIMOD:188	0.10	27.0	1	1	1
PRT	sp|P33316-2|DUT_HUMAN	Isoform 2 of Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=DUT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	118-UNIMOD:188	0.08	27.0	2	1	0
PRT	sp|P54886-2|P5CS_HUMAN	Isoform Short of Delta-1-pyrroline-5-carboxylate synthase OS=Homo sapiens OX=9606 GN=ALDH18A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	759-UNIMOD:188,374-UNIMOD:35,383-UNIMOD:267	0.03	27.0	4	2	1
PRT	sp|P29692-3|EF1D_HUMAN	Isoform 3 of Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	83-UNIMOD:188	0.05	27.0	2	1	0
PRT	sp|P27695|APEX1_HUMAN	DNA-(apurinic or apyrimidinic site) lyase OS=Homo sapiens OX=9606 GN=APEX1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	65-UNIMOD:4,73-UNIMOD:267	0.03	27.0	2	1	0
PRT	sp|P09651-3|ROA1_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.04	27.0	1	1	1
PRT	sp|Q9UP83-3|COG5_HUMAN	Isoform 3 of Conserved oligomeric Golgi complex subunit 5 OS=Homo sapiens OX=9606 GN=COG5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	147-UNIMOD:267	0.01	27.0	2	1	0
PRT	sp|Q9NR19|ACSA_HUMAN	Acetyl-coenzyme A synthetase, cytoplasmic OS=Homo sapiens OX=9606 GN=ACSS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	656-UNIMOD:188	0.03	27.0	2	1	0
PRT	sp|Q96JA1-2|LRIG1_HUMAN	Isoform 2 of Leucine-rich repeats and immunoglobulin-like domains protein 1 OS=Homo sapiens OX=9606 GN=LRIG1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|Q92945|FUBP2_HUMAN	Far upstream element-binding protein 2 OS=Homo sapiens OX=9606 GN=KHSRP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	394-UNIMOD:267	0.02	27.0	2	1	0
PRT	sp|Q92621|NU205_HUMAN	Nuclear pore complex protein Nup205 OS=Homo sapiens OX=9606 GN=NUP205 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	1575-UNIMOD:267	0.01	27.0	2	1	0
PRT	sp|O00299|CLIC1_HUMAN	Chloride intracellular channel protein 1 OS=Homo sapiens OX=9606 GN=CLIC1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	113-UNIMOD:188	0.08	27.0	1	1	1
PRT	sp|P16422|EPCAM_HUMAN	Epithelial cell adhesion molecule OS=Homo sapiens OX=9606 GN=EPCAM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	38-UNIMOD:4,44-UNIMOD:267	0.04	27.0	1	1	1
PRT	sp|Q9Y3D9|RT23_HUMAN	28S ribosomal protein S23, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS23 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	15-UNIMOD:267	0.06	27.0	2	1	0
PRT	sp|Q05519-2|SRS11_HUMAN	Isoform 2 of Serine/arginine-rich splicing factor 11 OS=Homo sapiens OX=9606 GN=SRSF11	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|Q6ZSR9|YJ005_HUMAN	Uncharacterized protein FLJ45252 OS=Homo sapiens OX=9606 PE=2 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	98-UNIMOD:188	0.05	27.0	2	1	0
PRT	sp|P49903-2|SPS1_HUMAN	Isoform 2 of Selenide, water dikinase 1 OS=Homo sapiens OX=9606 GN=SEPHS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	68-UNIMOD:35,71-UNIMOD:4	0.04	27.0	1	1	1
PRT	sp|P47755-2|CAZA2_HUMAN	Isoform 2 of F-actin-capping protein subunit alpha-2 OS=Homo sapiens OX=9606 GN=CAPZA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	47-UNIMOD:267	0.06	27.0	2	1	0
PRT	sp|Q9H0E9-4|BRD8_HUMAN	Isoform 4 of Bromodomain-containing protein 8 OS=Homo sapiens OX=9606 GN=BRD8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|P29317|EPHA2_HUMAN	Ephrin type-A receptor 2 OS=Homo sapiens OX=9606 GN=EPHA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	907-UNIMOD:267	0.01	27.0	2	1	0
PRT	sp|Q15645|PCH2_HUMAN	Pachytene checkpoint protein 2 homolog OS=Homo sapiens OX=9606 GN=TRIP13 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	378-UNIMOD:267	0.03	27.0	2	1	0
PRT	sp|Q02978-2|M2OM_HUMAN	Isoform 2 of Mitochondrial 2-oxoglutarate/malate carrier protein OS=Homo sapiens OX=9606 GN=SLC25A11	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.06	27.0	1	1	1
PRT	sp|O95989|NUDT3_HUMAN	Diphosphoinositol polyphosphate phosphohydrolase 1 OS=Homo sapiens OX=9606 GN=NUDT3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.06	27.0	1	1	1
PRT	sp|P46776|RL27A_HUMAN	60S ribosomal protein L27a OS=Homo sapiens OX=9606 GN=RPL27A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	87-UNIMOD:267	0.07	27.0	2	1	0
PRT	sp|P55327-2|TPD52_HUMAN	Isoform 2 of Tumor protein D52 OS=Homo sapiens OX=9606 GN=TPD52	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	1-UNIMOD:1	0.06	27.0	1	1	1
PRT	sp|P42285|MTREX_HUMAN	Exosome RNA helicase MTR4 OS=Homo sapiens OX=9606 GN=MTREX PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	985-UNIMOD:35	0.01	27.0	1	1	1
PRT	sp|Q9H3P2|NELFA_HUMAN	Negative elongation factor A OS=Homo sapiens OX=9606 GN=NELFA PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|P61106|RAB14_HUMAN	Ras-related protein Rab-14 OS=Homo sapiens OX=9606 GN=RAB14 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	125-UNIMOD:188	0.07	27.0	1	1	1
PRT	sp|Q9H1E3|NUCKS_HUMAN	Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 OS=Homo sapiens OX=9606 GN=NUCKS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	64-UNIMOD:188,67-UNIMOD:188	0.07	27.0	2	1	0
PRT	sp|Q9UHR4|BI2L1_HUMAN	Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 1 OS=Homo sapiens OX=9606 GN=BAIAP2L1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	28-UNIMOD:267	0.02	27.0	2	1	0
PRT	sp|Q9NR45|SIAS_HUMAN	Sialic acid synthase OS=Homo sapiens OX=9606 GN=NANS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	8-UNIMOD:4,11-UNIMOD:267	0.03	27.0	2	1	0
PRT	sp|P49458-2|SRP09_HUMAN	Isoform 2 of Signal recognition particle 9 kDa protein OS=Homo sapiens OX=9606 GN=SRP9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	12-UNIMOD:267	0.15	27.0	2	1	0
PRT	sp|Q9Y237|PIN4_HUMAN	Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 OS=Homo sapiens OX=9606 GN=PIN4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	27.0	null	87-UNIMOD:267,78-UNIMOD:28	0.08	27.0	2	1	0
PRT	sp|A3KN83-3|SBNO1_HUMAN	Isoform 3 of Protein strawberry notch homolog 1 OS=Homo sapiens OX=9606 GN=SBNO1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|P51858-2|HDGF_HUMAN	Isoform 2 of Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	101-UNIMOD:4,118-UNIMOD:188,119-UNIMOD:188	0.09	27.0	2	1	0
PRT	sp|Q6P1N0-2|C2D1A_HUMAN	Isoform 2 of Coiled-coil and C2 domain-containing protein 1A OS=Homo sapiens OX=9606 GN=CC2D1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	355-UNIMOD:267	0.02	27.0	3	2	1
PRT	sp|Q9UBF2-2|COPG2_HUMAN	Isoform 2 of Coatomer subunit gamma-2 OS=Homo sapiens OX=9606 GN=COPG2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	590-UNIMOD:188	0.02	27.0	2	1	0
PRT	sp|Q15717|ELAV1_HUMAN	ELAV-like protein 1 OS=Homo sapiens OX=9606 GN=ELAVL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null	50-UNIMOD:188	0.04	27.0	2	1	0
PRT	sp|O95571|ETHE1_HUMAN	Persulfide dioxygenase ETHE1, mitochondrial OS=Homo sapiens OX=9606 GN=ETHE1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	98-UNIMOD:4,104-UNIMOD:267	0.05	27.0	2	1	0
PRT	sp|O00499-9|BIN1_HUMAN	Isoform BIN1-10-13 of Myc box-dependent-interacting protein 1 OS=Homo sapiens OX=9606 GN=BIN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.04	27.0	1	1	1
PRT	sp|Q9BW83-2|IFT27_HUMAN	Isoform 2 of Intraflagellar transport protein 27 homolog OS=Homo sapiens OX=9606 GN=IFT27	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	123-UNIMOD:188	0.09	27.0	2	1	0
PRT	sp|O43765|SGTA_HUMAN	Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Homo sapiens OX=9606 GN=SGTA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	302-UNIMOD:267	0.04	27.0	2	1	0
PRT	sp|O43493-4|TGON2_HUMAN	Isoform 4 of Trans-Golgi network integral membrane protein 2 OS=Homo sapiens OX=9606 GN=TGOLN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.06	27.0	1	1	1
PRT	sp|Q00839-2|HNRPU_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	204-UNIMOD:267	0.02	27.0	3	1	0
PRT	sp|Q9H3U1-2|UN45A_HUMAN	Isoform 2 of Protein unc-45 homolog A OS=Homo sapiens OX=9606 GN=UNC45A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|P53621|COPA_HUMAN	Coatomer subunit alpha OS=Homo sapiens OX=9606 GN=COPA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	572-UNIMOD:267,825-UNIMOD:188	0.02	27.0	4	2	0
PRT	sp|P05388-2|RLA0_HUMAN	Isoform 2 of 60S acidic ribosomal protein P0 OS=Homo sapiens OX=9606 GN=RPLP0	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	146-UNIMOD:188,27-UNIMOD:4	0.10	27.0	3	2	1
PRT	sp|Q6WCQ1-3|MPRIP_HUMAN	Isoform 3 of Myosin phosphatase Rho-interacting protein OS=Homo sapiens OX=9606 GN=MPRIP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|Q08257|QOR_HUMAN	Quinone oxidoreductase OS=Homo sapiens OX=9606 GN=CRYZ PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	23-UNIMOD:188	0.04	27.0	2	1	0
PRT	sp|Q9P2T1-3|GMPR2_HUMAN	Isoform 3 of GMP reductase 2 OS=Homo sapiens OX=9606 GN=GMPR2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	158-UNIMOD:4,161-UNIMOD:267	0.04	27.0	2	1	0
PRT	sp|Q9H1Z4-2|WDR13_HUMAN	Isoform 2 of WD repeat-containing protein 13 OS=Homo sapiens OX=9606 GN=WDR13	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	225-UNIMOD:267	0.03	27.0	1	1	0
PRT	sp|P19623|SPEE_HUMAN	Spermidine synthase OS=Homo sapiens OX=9606 GN=SRM PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.05	27.0	1	1	1
PRT	sp|P25705-2|ATPA_HUMAN	Isoform 2 of ATP synthase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	33-UNIMOD:267	0.02	27.0	2	1	0
PRT	sp|Q5JTV8-3|TOIP1_HUMAN	Isoform 3 of Torsin-1A-interacting protein 1 OS=Homo sapiens OX=9606 GN=TOR1AIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	417-UNIMOD:267,237-UNIMOD:188	0.07	27.0	3	2	1
PRT	sp|P21333-2|FLNA_HUMAN	Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	1246-UNIMOD:188,1399-UNIMOD:188,593-UNIMOD:188,2256-UNIMOD:267	0.02	27.0	6	4	2
PRT	sp|Q6P158|DHX57_HUMAN	Putative ATP-dependent RNA helicase DHX57 OS=Homo sapiens OX=9606 GN=DHX57 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	445-UNIMOD:267	0.01	27.0	2	1	0
PRT	sp|P42166|LAP2A_HUMAN	Lamina-associated polypeptide 2, isoform alpha OS=Homo sapiens OX=9606 GN=TMPO PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	27.0	null	13-UNIMOD:188,139-UNIMOD:267	0.04	27.0	3	2	1
PRT	sp|Q7Z406|MYH14_HUMAN	Myosin-14 OS=Homo sapiens OX=9606 GN=MYH14 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	null	743-UNIMOD:28,744-UNIMOD:267,755-UNIMOD:188	0.01	27.0	2	1	0
PRT	sp|Q15233|NONO_HUMAN	Non-POU domain-containing octamer-binding protein OS=Homo sapiens OX=9606 GN=NONO PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	null	366-UNIMOD:28	0.03	27.0	1	1	1
PRT	sp|Q8NI27|THOC2_HUMAN	THO complex subunit 2 OS=Homo sapiens OX=9606 GN=THOC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	1146-UNIMOD:267	0.01	27.0	3	1	0
PRT	sp|P04908|H2A1B_HUMAN	Histone H2A type 1-B/E OS=Homo sapiens OX=9606 GN=H2AC4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	27.0	null	96-UNIMOD:188,100-UNIMOD:267	0.09	27.0	2	1	0
PRT	sp|P51610|HCFC1_HUMAN	Host cell factor 1 OS=Homo sapiens OX=9606 GN=HCFC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.01	27.0	1	1	0
PRT	sp|Q00839|HNRPU_HUMAN	Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	null	545-UNIMOD:28	0.02	27.0	1	1	1
PRT	sp|Q14738|2A5D_HUMAN	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform OS=Homo sapiens OX=9606 GN=PPP2R5D PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	null	410-UNIMOD:385,410-UNIMOD:4,421-UNIMOD:267	0.02	27.0	2	1	0
PRT	sp|Q14168|MPP2_HUMAN	MAGUK p55 subfamily member 2 OS=Homo sapiens OX=9606 GN=MPP2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|P50990|TCPQ_HUMAN	T-complex protein 1 subunit theta OS=Homo sapiens OX=9606 GN=CCT8 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	27.0	null	450-UNIMOD:267	0.02	27.0	2	1	0
PRT	sp|P54577|SYYC_HUMAN	Tyrosine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=YARS1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	null	451-UNIMOD:28	0.04	27.0	1	1	1
PRT	sp|P46379|BAG6_HUMAN	Large proline-rich protein BAG6 OS=Homo sapiens OX=9606 GN=BAG6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	331-UNIMOD:267	0.01	27.0	1	1	0
PRT	sp|Q92900|RENT1_HUMAN	Regulator of nonsense transcripts 1 OS=Homo sapiens OX=9606 GN=UPF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	918-UNIMOD:267	0.01	27.0	1	1	1
PRT	sp|Q13404-8|UB2V1_HUMAN	Isoform 6 of Ubiquitin-conjugating enzyme E2 variant 1 OS=Homo sapiens OX=9606 GN=UBE2V1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1	0.12	26.0	1	1	1
PRT	sp|Q9UNI6|DUS12_HUMAN	Dual specificity protein phosphatase 12 OS=Homo sapiens OX=9606 GN=DUSP12 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	307-UNIMOD:4,309-UNIMOD:4,77-UNIMOD:267	0.08	26.0	3	2	1
PRT	sp|P09327|VILI_HUMAN	Villin-1 OS=Homo sapiens OX=9606 GN=VIL1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	2	2	2
PRT	sp|P62917|RL8_HUMAN	60S ribosomal protein L8 OS=Homo sapiens OX=9606 GN=RPL8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.05	26.0	1	1	1
PRT	sp|Q9BY44-4|EIF2A_HUMAN	Isoform 4 of Eukaryotic translation initiation factor 2A OS=Homo sapiens OX=9606 GN=EIF2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	245-UNIMOD:4,256-UNIMOD:267	0.02	26.0	2	1	0
PRT	sp|P31949|S10AB_HUMAN	Protein S100-A11 OS=Homo sapiens OX=9606 GN=S100A11 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	13-UNIMOD:4	0.11	26.0	1	1	1
PRT	sp|P62280|RS11_HUMAN	40S ribosomal protein S11 OS=Homo sapiens OX=9606 GN=RPS11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	60-UNIMOD:4,69-UNIMOD:267	0.07	26.0	2	1	0
PRT	sp|O95163|ELP1_HUMAN	Elongator complex protein 1 OS=Homo sapiens OX=9606 GN=ELP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	23-UNIMOD:4,27-UNIMOD:267	0.01	26.0	2	1	0
PRT	sp|P59998|ARPC4_HUMAN	Actin-related protein 2/3 complex subunit 4 OS=Homo sapiens OX=9606 GN=ARPC4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.07	26.0	1	1	1
PRT	sp|Q9BZZ5-3|API5_HUMAN	Isoform 3 of Apoptosis inhibitor 5 OS=Homo sapiens OX=9606 GN=API5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	97-UNIMOD:267	0.03	26.0	2	1	0
PRT	sp|Q9NRP2|COXM2_HUMAN	COX assembly mitochondrial protein 2 homolog OS=Homo sapiens OX=9606 GN=CMC2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	37-UNIMOD:4	0.14	26.0	1	1	1
PRT	sp|P28340|DPOD1_HUMAN	DNA polymerase delta catalytic subunit OS=Homo sapiens OX=9606 GN=POLD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	549-UNIMOD:267	0.03	26.0	2	2	2
PRT	sp|O43760|SNG2_HUMAN	Synaptogyrin-2 OS=Homo sapiens OX=9606 GN=SYNGR2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	29-UNIMOD:267	0.05	26.0	2	1	0
PRT	sp|Q8IWT0-2|ARCH_HUMAN	Isoform 2 of Protein archease OS=Homo sapiens OX=9606 GN=ZBTB8OS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	109-UNIMOD:267	0.08	26.0	2	1	0
PRT	sp|O96008-2|TOM40_HUMAN	Isoform 2 of Mitochondrial import receptor subunit TOM40 homolog OS=Homo sapiens OX=9606 GN=TOMM40	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	195-UNIMOD:267	0.04	26.0	2	1	0
PRT	sp|P11413|G6PD_HUMAN	Glucose-6-phosphate 1-dehydrogenase OS=Homo sapiens OX=9606 GN=G6PD PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	257-UNIMOD:267	0.02	26.0	2	1	0
PRT	sp|Q9Y490|TLN1_HUMAN	Talin-1 OS=Homo sapiens OX=9606 GN=TLN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	624-UNIMOD:267,1199-UNIMOD:4,1202-UNIMOD:4,1207-UNIMOD:267	0.01	26.0	3	2	1
PRT	sp|P30048-2|PRDX3_HUMAN	Isoform 2 of Thioredoxin-dependent peroxide reductase, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.05	26.0	1	1	0
PRT	sp|P62277|RS13_HUMAN	40S ribosomal protein S13 OS=Homo sapiens OX=9606 GN=RPS13 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	55-UNIMOD:267	0.09	26.0	2	1	0
PRT	sp|P08195-2|4F2_HUMAN	Isoform 2 of 4F2 cell-surface antigen heavy chain OS=Homo sapiens OX=9606 GN=SLC3A2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	423-UNIMOD:267	0.03	26.0	1	1	1
PRT	sp|Q15084-3|PDIA6_HUMAN	Isoform 3 of Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	383-UNIMOD:267	0.03	26.0	1	1	1
PRT	sp|P62491-2|RB11A_HUMAN	Isoform 2 of Ras-related protein Rab-11A OS=Homo sapiens OX=9606 GN=RAB11A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1	0.08	26.0	1	1	1
PRT	sp|P17987|TCPA_HUMAN	T-complex protein 1 subunit alpha OS=Homo sapiens OX=9606 GN=TCP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	357-UNIMOD:4,365-UNIMOD:188	0.02	26.0	2	1	0
PRT	sp|O00165-5|HAX1_HUMAN	Isoform 5 of HCLS1-associated protein X-1 OS=Homo sapiens OX=9606 GN=HAX1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	102-UNIMOD:267	0.05	26.0	2	1	0
PRT	sp|P50750|CDK9_HUMAN	Cyclin-dependent kinase 9 OS=Homo sapiens OX=9606 GN=CDK9 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|Q8TED1|GPX8_HUMAN	Probable glutathione peroxidase 8 OS=Homo sapiens OX=9606 GN=GPX8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	152-UNIMOD:267	0.06	26.0	1	1	1
PRT	sp|Q9NZM1-5|MYOF_HUMAN	Isoform 5 of Myoferlin OS=Homo sapiens OX=9606 GN=MYOF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	1363-UNIMOD:267	0.02	26.0	3	2	1
PRT	sp|O96019-2|ACL6A_HUMAN	Isoform 2 of Actin-like protein 6A OS=Homo sapiens OX=9606 GN=ACTL6A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	273-UNIMOD:188,164-UNIMOD:4	0.07	26.0	3	2	1
PRT	sp|Q7Z6V5-2|ADAT2_HUMAN	Isoform 2 of tRNA-specific adenosine deaminase 2 OS=Homo sapiens OX=9606 GN=ADAT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	79-UNIMOD:4	0.09	26.0	1	1	1
PRT	sp|P20700|LMNB1_HUMAN	Lamin-B1 OS=Homo sapiens OX=9606 GN=LMNB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	330-UNIMOD:188	0.02	26.0	2	1	0
PRT	sp|O60763|USO1_HUMAN	General vesicular transport factor p115 OS=Homo sapiens OX=9606 GN=USO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	212-UNIMOD:267,195-UNIMOD:267	0.02	26.0	3	2	1
PRT	sp|P46781|RS9_HUMAN	40S ribosomal protein S9 OS=Homo sapiens OX=9606 GN=RPS9 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	180-UNIMOD:188	0.08	26.0	2	1	0
PRT	sp|Q14974|IMB1_HUMAN	Importin subunit beta-1 OS=Homo sapiens OX=9606 GN=KPNB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	206-UNIMOD:188,181-UNIMOD:35,182-UNIMOD:267	0.03	26.0	3	2	1
PRT	sp|Q9Y262-2|EIF3L_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit L OS=Homo sapiens OX=9606 GN=EIF3L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|P30154-4|2AAB_HUMAN	Isoform 4 of Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform OS=Homo sapiens OX=9606 GN=PPP2R1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|P31948-3|STIP1_HUMAN	Isoform 3 of Stress-induced-phosphoprotein 1 OS=Homo sapiens OX=9606 GN=STIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	340-UNIMOD:188	0.03	26.0	1	1	1
PRT	sp|O14929-2|HAT1_HUMAN	Isoform B of Histone acetyltransferase type B catalytic subunit OS=Homo sapiens OX=9606 GN=HAT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	209-UNIMOD:4,214-UNIMOD:4,217-UNIMOD:267	0.03	26.0	1	1	1
PRT	sp|P38159-2|RBMX_HUMAN	Isoform 2 of RNA-binding motif protein, X chromosome OS=Homo sapiens OX=9606 GN=RBMX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.07	26.0	2	2	2
PRT	sp|Q12800-2|TFCP2_HUMAN	Isoform 2 of Alpha-globin transcription factor CP2 OS=Homo sapiens OX=9606 GN=TFCP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	308-UNIMOD:188	0.03	26.0	2	1	0
PRT	sp|P30740-2|ILEU_HUMAN	Isoform 2 of Leukocyte elastase inhibitor OS=Homo sapiens OX=9606 GN=SERPINB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	150-UNIMOD:188	0.05	26.0	2	1	0
PRT	sp|Q12792-4|TWF1_HUMAN	Isoform 4 of Twinfilin-1 OS=Homo sapiens OX=9606 GN=TWF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	242-UNIMOD:267	0.06	26.0	2	1	0
PRT	sp|P62851|RS25_HUMAN	40S ribosomal protein S25 OS=Homo sapiens OX=9606 GN=RPS25 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	76-UNIMOD:267	0.09	26.0	2	1	0
PRT	sp|P49821-2|NDUV1_HUMAN	Isoform 2 of NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFV1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	133-UNIMOD:4	0.02	26.0	1	1	1
PRT	sp|O00159-2|MYO1C_HUMAN	Isoform 2 of Unconventional myosin-Ic OS=Homo sapiens OX=9606 GN=MYO1C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	153-UNIMOD:188	0.02	26.0	1	1	1
PRT	sp|Q92876-2|KLK6_HUMAN	Isoform 2 of Kallikrein-6 OS=Homo sapiens OX=9606 GN=KLK6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.09	26.0	1	1	1
PRT	sp|Q15185-2|TEBP_HUMAN	Isoform 2 of Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	40-UNIMOD:4,48-UNIMOD:188	0.11	26.0	2	1	0
PRT	sp|Q9BYT8|NEUL_HUMAN	Neurolysin, mitochondrial OS=Homo sapiens OX=9606 GN=NLN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	577-UNIMOD:267	0.02	26.0	2	1	0
PRT	sp|Q6NZY4-2|ZCHC8_HUMAN	Isoform 2 of Zinc finger CCHC domain-containing protein 8 OS=Homo sapiens OX=9606 GN=ZCCHC8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	138-UNIMOD:267	0.03	26.0	2	1	0
PRT	sp|Q01469|FABP5_HUMAN	Fatty acid-binding protein 5 OS=Homo sapiens OX=9606 GN=FABP5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	120-UNIMOD:4,127-UNIMOD:4,129-UNIMOD:267	0.11	26.0	2	1	0
PRT	sp|P30153|2AAA_HUMAN	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R1A PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	528-UNIMOD:35	0.02	26.0	1	1	1
PRT	sp|O15067|PUR4_HUMAN	Phosphoribosylformylglycinamidine synthase OS=Homo sapiens OX=9606 GN=PFAS PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null	1039-UNIMOD:35,1044-UNIMOD:4	0.02	26.0	3	2	1
PRT	sp|P53990-2|IST1_HUMAN	Isoform 2 of IST1 homolog OS=Homo sapiens OX=9606 GN=IST1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	1-UNIMOD:1	0.03	26.0	1	1	1
PRT	sp|Q14676-4|MDC1_HUMAN	Isoform 4 of Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	59-UNIMOD:35,62-UNIMOD:4	0.02	26.0	1	1	1
PRT	sp|P42785|PCP_HUMAN	Lysosomal Pro-X carboxypeptidase OS=Homo sapiens OX=9606 GN=PRCP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	474-UNIMOD:267	0.03	26.0	2	1	0
PRT	sp|Q9Y2R9|RT07_HUMAN	28S ribosomal protein S7, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	152-UNIMOD:4,155-UNIMOD:35	0.06	26.0	2	1	0
PRT	sp|P46459-2|NSF_HUMAN	Isoform 2 of Vesicle-fusing ATPase OS=Homo sapiens OX=9606 GN=NSF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|O15305|PMM2_HUMAN	Phosphomannomutase 2 OS=Homo sapiens OX=9606 GN=PMM2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.05	26.0	1	1	1
PRT	sp|Q53H47-3|SETMR_HUMAN	Isoform 3 of Histone-lysine N-methyltransferase SETMAR OS=Homo sapiens OX=9606 GN=SETMAR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|P12268|IMDH2_HUMAN	Inosine-5'-monophosphate dehydrogenase 2 OS=Homo sapiens OX=9606 GN=IMPDH2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	322-UNIMOD:267	0.02	26.0	1	1	1
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null	96-UNIMOD:188,113-UNIMOD:188,60-UNIMOD:267,152-UNIMOD:188,74-UNIMOD:267	0.11	26.0	6	5	4
PRT	sp|Q16630-3|CPSF6_HUMAN	Isoform 3 of Cleavage and polyadenylation specificity factor subunit 6 OS=Homo sapiens OX=9606 GN=CPSF6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	172-UNIMOD:267	0.03	26.0	1	1	1
PRT	sp|P26196|DDX6_HUMAN	Probable ATP-dependent RNA helicase DDX6 OS=Homo sapiens OX=9606 GN=DDX6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	157-UNIMOD:267,390-UNIMOD:4,396-UNIMOD:267	0.05	26.0	2	2	2
PRT	sp|Q2M3G4-2|SHRM1_HUMAN	Isoform 2 of Protein Shroom1 OS=Homo sapiens OX=9606 GN=SHROOM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	109-UNIMOD:267	0.02	26.0	1	1	1
PRT	sp|Q14204|DYHC1_HUMAN	Cytoplasmic dynein 1 heavy chain 1 OS=Homo sapiens OX=9606 GN=DYNC1H1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	3757-UNIMOD:188	0.00	26.0	2	1	0
PRT	sp|O95602|RPA1_HUMAN	DNA-directed RNA polymerase I subunit RPA1 OS=Homo sapiens OX=9606 GN=POLR1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	937-UNIMOD:4	0.01	26.0	1	1	1
PRT	sp|Q9Y223-4|GLCNE_HUMAN	Isoform 4 of Bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase OS=Homo sapiens OX=9606 GN=GNE	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	259-UNIMOD:188	0.02	26.0	2	1	0
PRT	sp|O60313-13|OPA1_HUMAN	Isoform 7 of Dynamin-like 120 kDa protein, mitochondrial OS=Homo sapiens OX=9606 GN=OPA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	276-UNIMOD:267	0.01	26.0	1	1	0
PRT	sp|Q8NI60-2|COQ8A_HUMAN	Isoform 2 of Atypical kinase COQ8A, mitochondrial OS=Homo sapiens OX=9606 GN=COQ8A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.07	26.0	1	1	0
PRT	sp|O95478|NSA2_HUMAN	Ribosome biogenesis protein NSA2 homolog OS=Homo sapiens OX=9606 GN=NSA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	154-UNIMOD:4,162-UNIMOD:267	0.04	26.0	2	1	0
PRT	sp|Q9Y4W6|AFG32_HUMAN	AFG3-like protein 2 OS=Homo sapiens OX=9606 GN=AFG3L2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	679-UNIMOD:267	0.01	26.0	2	1	0
PRT	sp|P60891|PRPS1_HUMAN	Ribose-phosphate pyrophosphokinase 1 OS=Homo sapiens OX=9606 GN=PRPS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	91-UNIMOD:4,96-UNIMOD:267	0.04	26.0	2	1	0
PRT	sp|P49792|RBP2_HUMAN	E3 SUMO-protein ligase RanBP2 OS=Homo sapiens OX=9606 GN=RANBP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null	2407-UNIMOD:4,2414-UNIMOD:267,1398-UNIMOD:188,1860-UNIMOD:188	0.02	26.0	8	4	1
PRT	sp|O15533-2|TPSN_HUMAN	Isoform 2 of Tapasin OS=Homo sapiens OX=9606 GN=TAPBP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	115-UNIMOD:4,117-UNIMOD:267	0.03	26.0	1	1	1
PRT	sp|P63244|RACK1_HUMAN	Receptor of activated protein C kinase 1 OS=Homo sapiens OX=9606 GN=RACK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	249-UNIMOD:4,99-UNIMOD:267,317-UNIMOD:267	0.11	26.0	4	3	2
PRT	sp|P05023|AT1A1_HUMAN	Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	1019-UNIMOD:188	0.01	26.0	1	1	1
PRT	sp|Q16555|DPYL2_HUMAN	Dihydropyrimidinase-related protein 2 OS=Homo sapiens OX=9606 GN=DPYSL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	248-UNIMOD:4	0.03	26.0	1	1	1
PRT	sp|Q8NHW5|RLA0L_HUMAN	60S acidic ribosomal protein P0-like OS=Homo sapiens OX=9606 GN=RPLP0P6 PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|Q8NC51|PAIRB_HUMAN	Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|P54886|P5CS_HUMAN	Delta-1-pyrroline-5-carboxylate synthase OS=Homo sapiens OX=9606 GN=ALDH18A1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.02	26.0	1	1	0
PRT	sp|P49915|GUAA_HUMAN	GMP synthase [glutamine-hydrolyzing] OS=Homo sapiens OX=9606 GN=GMPS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	null	590-UNIMOD:28,600-UNIMOD:267	0.02	26.0	2	1	0
PRT	sp|Q6RFH5|WDR74_HUMAN	WD repeat-containing protein 74 OS=Homo sapiens OX=9606 GN=WDR74 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.04	26.0	1	1	0
PRT	sp|P55036|PSMD4_HUMAN	26S proteasome non-ATPase regulatory subunit 4 OS=Homo sapiens OX=9606 GN=PSMD4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	263-UNIMOD:35,272-UNIMOD:267	0.03	26.0	2	1	0
PRT	sp|Q9NZL9|MAT2B_HUMAN	Methionine adenosyltransferase 2 subunit beta OS=Homo sapiens OX=9606 GN=MAT2B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.04	26.0	1	1	0
PRT	sp|P46063|RECQ1_HUMAN	ATP-dependent DNA helicase Q1 OS=Homo sapiens OX=9606 GN=RECQL PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	null	292-UNIMOD:28	0.02	26.0	1	1	1
PRT	sp|P62847|RS24_HUMAN	40S ribosomal protein S24 OS=Homo sapiens OX=9606 GN=RPS24 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	null	22-UNIMOD:28,23-UNIMOD:35,32-UNIMOD:188	0.09	26.0	6	1	0
PRT	sp|Q04828|AK1C1_HUMAN	Aldo-keto reductase family 1 member C1 OS=Homo sapiens OX=9606 GN=AKR1C1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	null	172-UNIMOD:28,175-UNIMOD:35	0.04	26.0	2	1	0
PRT	sp|Q6NUK1|SCMC1_HUMAN	Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Homo sapiens OX=9606 GN=SLC25A24 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|Q9NWB1|RFOX1_HUMAN	RNA binding protein fox-1 homolog 1 OS=Homo sapiens OX=9606 GN=RBFOX1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|Q9NW13|RBM28_HUMAN	RNA-binding protein 28 OS=Homo sapiens OX=9606 GN=RBM28 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	571-UNIMOD:188	0.02	26.0	1	1	1
PRT	sp|P39687|AN32A_HUMAN	Acidic leucine-rich nuclear phosphoprotein 32 family member A OS=Homo sapiens OX=9606 GN=ANP32A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.05	26.0	1	1	1
PRT	sp|Q3ZAQ7|VMA21_HUMAN	Vacuolar ATPase assembly integral membrane protein VMA21 OS=Homo sapiens OX=9606 GN=VMA21 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.13	25.0	2	1	0
PRT	sp|Q86XP3-2|DDX42_HUMAN	Isoform 2 of ATP-dependent RNA helicase DDX42 OS=Homo sapiens OX=9606 GN=DDX42	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|Q15785|TOM34_HUMAN	Mitochondrial import receptor subunit TOM34 OS=Homo sapiens OX=9606 GN=TOMM34 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	141-UNIMOD:267	0.04	25.0	1	1	1
PRT	sp|Q7L5Y1-7|ENOF1_HUMAN	Isoform 7 of Mitochondrial enolase superfamily member 1 OS=Homo sapiens OX=9606 GN=ENOSF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	100-UNIMOD:4,101-UNIMOD:267	0.06	25.0	2	1	0
PRT	sp|Q15819|UB2V2_HUMAN	Ubiquitin-conjugating enzyme E2 variant 2 OS=Homo sapiens OX=9606 GN=UBE2V2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null	2-UNIMOD:1,81-UNIMOD:267	0.14	25.0	2	2	2
PRT	sp|Q9UNF0-2|PACN2_HUMAN	Isoform 2 of Protein kinase C and casein kinase substrate in neurons protein 2 OS=Homo sapiens OX=9606 GN=PACSIN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	92-UNIMOD:267	0.03	25.0	1	1	1
PRT	sp|Q9BUH6|PAXX_HUMAN	Protein PAXX OS=Homo sapiens OX=9606 GN=PAXX PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	180-UNIMOD:4,191-UNIMOD:188	0.06	25.0	1	1	1
PRT	sp|Q14CX7-2|NAA25_HUMAN	Isoform 2 of N-alpha-acetyltransferase 25, NatB auxiliary subunit OS=Homo sapiens OX=9606 GN=NAA25	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	760-UNIMOD:267	0.02	25.0	1	1	1
PRT	sp|Q92888-2|ARHG1_HUMAN	Isoform 2 of Rho guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=ARHGEF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	0
PRT	sp|O94874-3|UFL1_HUMAN	Isoform 3 of E3 UFM1-protein ligase 1 OS=Homo sapiens OX=9606 GN=UFL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	372-UNIMOD:4	0.02	25.0	1	1	1
PRT	sp|Q16831|UPP1_HUMAN	Uridine phosphorylase 1 OS=Homo sapiens OX=9606 GN=UPP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	57-UNIMOD:4,64-UNIMOD:267	0.04	25.0	2	1	0
PRT	sp|Q96QC0|PP1RA_HUMAN	Serine/threonine-protein phosphatase 1 regulatory subunit 10 OS=Homo sapiens OX=9606 GN=PPP1R10 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|P12429|ANXA3_HUMAN	Annexin A3 OS=Homo sapiens OX=9606 GN=ANXA3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	274-UNIMOD:267,40-UNIMOD:35,48-UNIMOD:267	0.07	25.0	4	2	1
PRT	sp|P49748-2|ACADV_HUMAN	Isoform 2 of Very long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADVL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	545-UNIMOD:267	0.02	25.0	2	1	0
PRT	sp|Q8WZA9|IRGQ_HUMAN	Immunity-related GTPase family Q protein OS=Homo sapiens OX=9606 GN=IRGQ PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	529-UNIMOD:267	0.02	25.0	2	1	0
PRT	sp|P15924-2|DESP_HUMAN	Isoform DPII of Desmoplakin OS=Homo sapiens OX=9606 GN=DSP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	2	2	2
PRT	sp|Q96MG7|NSE3_HUMAN	Non-structural maintenance of chromosomes element 3 homolog OS=Homo sapiens OX=9606 GN=NSMCE3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.06	25.0	1	1	1
PRT	sp|P55011-3|S12A2_HUMAN	Isoform 2 of Solute carrier family 12 member 2 OS=Homo sapiens OX=9606 GN=SLC12A2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|P16278-2|BGAL_HUMAN	Isoform 2 of Beta-galactosidase OS=Homo sapiens OX=9606 GN=GLB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	459-UNIMOD:267	0.02	25.0	1	1	1
PRT	sp|P03928|ATP8_HUMAN	ATP synthase protein 8 OS=Homo sapiens OX=9606 GN=MT-ATP8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	59-UNIMOD:4	0.18	25.0	1	1	1
PRT	sp|P01730|CD4_HUMAN	T-cell surface glycoprotein CD4 OS=Homo sapiens OX=9606 GN=CD4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q13838-2|DX39B_HUMAN	Isoform 2 of Spliceosome RNA helicase DDX39B OS=Homo sapiens OX=9606 GN=DDX39B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	170-UNIMOD:188	0.05	25.0	2	2	2
PRT	sp|O95219|SNX4_HUMAN	Sorting nexin-4 OS=Homo sapiens OX=9606 GN=SNX4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	371-UNIMOD:267	0.02	25.0	2	1	0
PRT	sp|P02792|FRIL_HUMAN	Ferritin light chain OS=Homo sapiens OX=9606 GN=FTL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null	169-UNIMOD:267	0.09	25.0	2	1	0
PRT	sp|Q15758-3|AAAT_HUMAN	Isoform 3 of Neutral amino acid transporter B(0) OS=Homo sapiens OX=9606 GN=SLC1A5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	29-UNIMOD:267	0.04	25.0	2	1	0
PRT	sp|P22570-4|ADRO_HUMAN	Isoform 4 of NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Homo sapiens OX=9606 GN=FDXR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	334-UNIMOD:267	0.03	25.0	2	1	0
PRT	sp|Q7L9B9|EEPD1_HUMAN	Endonuclease/exonuclease/phosphatase family domain-containing protein 1 OS=Homo sapiens OX=9606 GN=EEPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	305-UNIMOD:267	0.02	25.0	2	1	0
PRT	sp|Q8IYB8|SUV3_HUMAN	ATP-dependent RNA helicase SUPV3L1, mitochondrial OS=Homo sapiens OX=9606 GN=SUPV3L1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|P55786-2|PSA_HUMAN	Isoform 2 of Puromycin-sensitive aminopeptidase OS=Homo sapiens OX=9606 GN=NPEPPS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	510-UNIMOD:267,714-UNIMOD:188	0.03	25.0	3	2	1
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	4915-UNIMOD:188,5366-UNIMOD:267	0.01	25.0	3	3	3
PRT	sp|P20340-2|RAB6A_HUMAN	Isoform 2 of Ras-related protein Rab-6A OS=Homo sapiens OX=9606 GN=RAB6A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.06	25.0	1	1	1
PRT	sp|P13010|XRCC5_HUMAN	X-ray repair cross-complementing protein 5 OS=Homo sapiens OX=9606 GN=XRCC5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	260-UNIMOD:267	0.02	25.0	2	1	0
PRT	sp|Q8TCT9-5|HM13_HUMAN	Isoform 5 of Minor histocompatibility antigen H13 OS=Homo sapiens OX=9606 GN=HM13	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	209-UNIMOD:188	0.03	25.0	2	1	0
PRT	sp|Q8NBN7-2|RDH13_HUMAN	Isoform 2 of Retinol dehydrogenase 13 OS=Homo sapiens OX=9606 GN=RDH13	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	254-UNIMOD:267	0.04	25.0	2	1	0
PRT	sp|Q9P2K6|KLH42_HUMAN	Kelch-like protein 42 OS=Homo sapiens OX=9606 GN=KLHL42 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	75-UNIMOD:267	0.03	25.0	2	1	0
PRT	sp|Q9UI09-2|NDUAC_HUMAN	Isoform 2 of NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 OS=Homo sapiens OX=9606 GN=NDUFA12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	1-UNIMOD:1	0.16	25.0	1	1	0
PRT	sp|O14735-3|CDIPT_HUMAN	Isoform 3 of CDP-diacylglycerol--inositol 3-phosphatidyltransferase OS=Homo sapiens OX=9606 GN=CDIPT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	77-UNIMOD:35,87-UNIMOD:267	0.07	25.0	4	1	0
PRT	sp|Q8WUX1|S38A5_HUMAN	Sodium-coupled neutral amino acid transporter 5 OS=Homo sapiens OX=9606 GN=SLC38A5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	8-UNIMOD:35,20-UNIMOD:267	0.03	25.0	2	1	0
PRT	sp|P62424|RL7A_HUMAN	60S ribosomal protein L7a OS=Homo sapiens OX=9606 GN=RPL7A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	48-UNIMOD:188	0.05	25.0	2	1	0
PRT	sp|Q5VYK3|ECM29_HUMAN	Proteasome adapter and scaffold protein ECM29 OS=Homo sapiens OX=9606 GN=ECPAS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q9HAV7|GRPE1_HUMAN	GrpE protein homolog 1, mitochondrial OS=Homo sapiens OX=9606 GN=GRPEL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.17	25.0	2	2	2
PRT	sp|P15941-12|MUC1_HUMAN	Isoform S2 of Mucin-1 OS=Homo sapiens OX=9606 GN=MUC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.08	25.0	1	1	1
PRT	sp|P51812|KS6A3_HUMAN	Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens OX=9606 GN=RPS6KA3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	12-UNIMOD:188	0.02	25.0	2	1	0
PRT	sp|Q9C0C9|UBE2O_HUMAN	(E3-independent) E2 ubiquitin-conjugating enzyme OS=Homo sapiens OX=9606 GN=UBE2O PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q969E2-3|SCAM4_HUMAN	Isoform 3 of Secretory carrier-associated membrane protein 4 OS=Homo sapiens OX=9606 GN=SCAMP4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1,4-UNIMOD:188,13-UNIMOD:188	0.10	25.0	2	1	0
PRT	sp|Q9BRP4-3|PAAF1_HUMAN	Isoform 3 of Proteasomal ATPase-associated factor 1 OS=Homo sapiens OX=9606 GN=PAAF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	217-UNIMOD:267	0.05	25.0	2	1	0
PRT	sp|Q4KMQ2-3|ANO6_HUMAN	Isoform 3 of Anoctamin-6 OS=Homo sapiens OX=9606 GN=ANO6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	148-UNIMOD:188	0.01	25.0	1	1	1
PRT	sp|Q9H773|DCTP1_HUMAN	dCTP pyrophosphatase 1 OS=Homo sapiens OX=9606 GN=DCTPP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	121-UNIMOD:188	0.15	25.0	2	2	2
PRT	sp|Q9Y4L1|HYOU1_HUMAN	Hypoxia up-regulated protein 1 OS=Homo sapiens OX=9606 GN=HYOU1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	278-UNIMOD:267,275-UNIMOD:35	0.01	25.0	3	1	0
PRT	sp|Q92673|SORL_HUMAN	Sortilin-related receptor OS=Homo sapiens OX=9606 GN=SORL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.00	25.0	1	1	1
PRT	sp|P55039|DRG2_HUMAN	Developmentally-regulated GTP-binding protein 2 OS=Homo sapiens OX=9606 GN=DRG2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	75-UNIMOD:188	0.03	25.0	1	1	1
PRT	sp|P17066|HSP76_HUMAN	Heat shock 70 kDa protein 6 OS=Homo sapiens OX=9606 GN=HSPA6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	359-UNIMOD:188	0.03	25.0	2	2	2
PRT	sp|Q86XX4|FRAS1_HUMAN	Extracellular matrix protein FRAS1 OS=Homo sapiens OX=9606 GN=FRAS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.00	25.0	1	1	1
PRT	sp|Q6ZV29-3|PLPL7_HUMAN	Isoform 3 of Patatin-like phospholipase domain-containing protein 7 OS=Homo sapiens OX=9606 GN=PNPLA7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	936-UNIMOD:267	0.01	25.0	1	1	1
PRT	sp|P42694-2|HELZ_HUMAN	Isoform 2 of Probable helicase with zinc finger domain OS=Homo sapiens OX=9606 GN=HELZ	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|P55809|SCOT1_HUMAN	Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=OXCT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q04726|TLE3_HUMAN	Transducin-like enhancer protein 3 OS=Homo sapiens OX=9606 GN=TLE3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	528-UNIMOD:4	0.02	25.0	1	1	1
PRT	sp|O75131|CPNE3_HUMAN	Copine-3 OS=Homo sapiens OX=9606 GN=CPNE3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	null	168-UNIMOD:28	0.02	25.0	1	1	1
PRT	sp|P48449|ERG7_HUMAN	Lanosterol synthase OS=Homo sapiens OX=9606 GN=LSS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.02	25.0	1	1	0
PRT	sp|Q9UI09|NDUAC_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 OS=Homo sapiens OX=9606 GN=NDUFA12 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	1-UNIMOD:1	0.07	25.0	1	1	0
PRT	sp|P13645|K1C10_HUMAN	Keratin, type I cytoskeletal 10 OS=Homo sapiens OX=9606 GN=KRT10 PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|Q04446|GLGB_HUMAN	1,4-alpha-glucan-branching enzyme OS=Homo sapiens OX=9606 GN=GBE1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	null	566-UNIMOD:28,576-UNIMOD:267	0.02	25.0	2	1	0
PRT	sp|O60313|OPA1_HUMAN	Dynamin-like 120 kDa protein, mitochondrial OS=Homo sapiens OX=9606 GN=OPA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	312-UNIMOD:267	0.01	25.0	2	1	0
PRT	sp|Q92979|NEP1_HUMAN	Ribosomal RNA small subunit methyltransferase NEP1 OS=Homo sapiens OX=9606 GN=EMG1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	null	2-UNIMOD:1,9-UNIMOD:188,11-UNIMOD:267	0.05	25.0	1	1	1
PRT	sp|P14324|FPPS_HUMAN	Farnesyl pyrophosphate synthase OS=Homo sapiens OX=9606 GN=FDPS PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	null	81-UNIMOD:28,92-UNIMOD:267	0.03	25.0	1	1	1
PRT	sp|P08138|TNR16_HUMAN	Tumor necrosis factor receptor superfamily member 16 OS=Homo sapiens OX=9606 GN=NGFR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	360-UNIMOD:267	0.03	25.0	1	1	1
PRT	sp|Q01082|SPTB2_HUMAN	Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	1477-UNIMOD:267	0.01	25.0	1	1	0
PRT	sp|P18669|PGAM1_HUMAN	Phosphoglycerate mutase 1 OS=Homo sapiens OX=9606 GN=PGAM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.04	24.0	1	1	1
PRT	sp|Q6UN15-4|FIP1_HUMAN	Isoform 4 of Pre-mRNA 3'-end-processing factor FIP1 OS=Homo sapiens OX=9606 GN=FIP1L1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	250-UNIMOD:188	0.03	24.0	1	1	1
PRT	sp|Q9H4A4|AMPB_HUMAN	Aminopeptidase B OS=Homo sapiens OX=9606 GN=RNPEP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	181-UNIMOD:4,188-UNIMOD:188	0.02	24.0	2	1	0
PRT	sp|O43264-2|ZW10_HUMAN	Isoform 2 of Centromere/kinetochore protein zw10 homolog OS=Homo sapiens OX=9606 GN=ZW10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1,14-UNIMOD:267	0.02	24.0	2	1	0
PRT	sp|Q8IWB7|WDFY1_HUMAN	WD repeat and FYVE domain-containing protein 1 OS=Homo sapiens OX=9606 GN=WDFY1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	290-UNIMOD:4,299-UNIMOD:188	0.03	24.0	1	1	1
PRT	sp|Q8WXA9|SREK1_HUMAN	Splicing regulatory glutamine/lysine-rich protein 1 OS=Homo sapiens OX=9606 GN=SREK1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q8N766-4|EMC1_HUMAN	Isoform 4 of ER membrane protein complex subunit 1 OS=Homo sapiens OX=9606 GN=EMC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q5T0F9-3|C2D1B_HUMAN	Isoform 3 of Coiled-coil and C2 domain-containing protein 1B OS=Homo sapiens OX=9606 GN=CC2D1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q69YN2-3|C19L1_HUMAN	Isoform 3 of CWF19-like protein 1 OS=Homo sapiens OX=9606 GN=CWF19L1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	97-UNIMOD:188	0.03	24.0	2	1	0
PRT	sp|P51159-2|RB27A_HUMAN	Isoform Short of Ras-related protein Rab-27A OS=Homo sapiens OX=9606 GN=RAB27A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.06	24.0	1	1	1
PRT	sp|P63104-2|1433Z_HUMAN	Isoform 2 of 14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.08	24.0	1	1	1
PRT	sp|Q9UL26|RB22A_HUMAN	Ras-related protein Rab-22A OS=Homo sapiens OX=9606 GN=RAB22A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	66-UNIMOD:267	0.06	24.0	2	1	0
PRT	sp|P19367-4|HXK1_HUMAN	Isoform 4 of Hexokinase-1 OS=Homo sapiens OX=9606 GN=HK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|P20338|RAB4A_HUMAN	Ras-related protein Rab-4A OS=Homo sapiens OX=9606 GN=RAB4A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.06	24.0	1	1	1
PRT	sp|P07814|SYEP_HUMAN	Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|P19823|ITIH2_HUMAN	Inter-alpha-trypsin inhibitor heavy chain H2 OS=Homo sapiens OX=9606 GN=ITIH2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|P62333|PRS10_HUMAN	26S proteasome regulatory subunit 10B OS=Homo sapiens OX=9606 GN=PSMC6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	170-UNIMOD:4,180-UNIMOD:188	0.03	24.0	2	1	0
PRT	sp|Q9NR46|SHLB2_HUMAN	Endophilin-B2 OS=Homo sapiens OX=9606 GN=SH3GLB2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	385-UNIMOD:188	0.03	24.0	2	1	0
PRT	sp|Q05193-5|DYN1_HUMAN	Isoform 4 of Dynamin-1 OS=Homo sapiens OX=9606 GN=DNM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.02	24.0	1	1	1
PRT	sp|Q8NE71-2|ABCF1_HUMAN	Isoform 2 of ATP-binding cassette sub-family F member 1 OS=Homo sapiens OX=9606 GN=ABCF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	617-UNIMOD:4,626-UNIMOD:188	0.01	24.0	1	1	1
PRT	sp|Q14157-4|UBP2L_HUMAN	Isoform 4 of Ubiquitin-associated protein 2-like OS=Homo sapiens OX=9606 GN=UBAP2L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	283-UNIMOD:188	0.01	24.0	2	1	0
PRT	sp|Q16877-2|F264_HUMAN	Isoform 2 of 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Homo sapiens OX=9606 GN=PFKFB4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	277-UNIMOD:267	0.03	24.0	1	1	1
PRT	sp|P48449-2|ERG7_HUMAN	Isoform 2 of Lanosterol synthase OS=Homo sapiens OX=9606 GN=LSS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	0
PRT	sp|Q9Y5Q9-2|TF3C3_HUMAN	Isoform 2 of General transcription factor 3C polypeptide 3 OS=Homo sapiens OX=9606 GN=GTF3C3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	288-UNIMOD:267	0.03	24.0	1	1	1
PRT	sp|Q9Y3E7-2|CHMP3_HUMAN	Isoform 2 of Charged multivesicular body protein 3 OS=Homo sapiens OX=9606 GN=CHMP3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	62-UNIMOD:267	0.06	24.0	2	1	0
PRT	sp|Q9Y289|SC5A6_HUMAN	Sodium-dependent multivitamin transporter OS=Homo sapiens OX=9606 GN=SLC5A6 PE=2 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	253-UNIMOD:267	0.02	24.0	1	1	1
PRT	sp|Q9NVM9|INT13_HUMAN	Integrator complex subunit 13 OS=Homo sapiens OX=9606 GN=INTS13 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	423-UNIMOD:267	0.01	24.0	2	1	0
PRT	sp|Q14152-2|EIF3A_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens OX=9606 GN=EIF3A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	333-UNIMOD:267,342-UNIMOD:267	0.02	24.0	2	2	2
PRT	sp|P42685-2|FRK_HUMAN	Isoform 2 of Tyrosine-protein kinase FRK OS=Homo sapiens OX=9606 GN=FRK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|P25398|RS12_HUMAN	40S ribosomal protein S12 OS=Homo sapiens OX=9606 GN=RPS12 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	24.0	null	92-UNIMOD:4,93-UNIMOD:188	0.08	24.0	3	1	0
PRT	sp|Q969G3-2|SMCE1_HUMAN	Isoform 2 of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 OS=Homo sapiens OX=9606 GN=SMARCE1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q9BZF3-6|OSBL6_HUMAN	Isoform 6 of Oxysterol-binding protein-related protein 6 OS=Homo sapiens OX=9606 GN=OSBPL6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	287-UNIMOD:267	0.02	24.0	1	1	1
PRT	sp|O60610-2|DIAP1_HUMAN	Isoform 2 of Protein diaphanous homolog 1 OS=Homo sapiens OX=9606 GN=DIAPH1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	258-UNIMOD:4,266-UNIMOD:35	0.01	24.0	1	1	1
PRT	sp|P62136-3|PP1A_HUMAN	Isoform 3 of Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Homo sapiens OX=9606 GN=PPP1CA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	15-UNIMOD:267	0.03	24.0	1	1	1
PRT	sp|P62701|RS4X_HUMAN	40S ribosomal protein S4, X isoform OS=Homo sapiens OX=9606 GN=RPS4X PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	230-UNIMOD:188	0.04	24.0	1	1	1
PRT	sp|P38117|ETFB_HUMAN	Electron transfer flavoprotein subunit beta OS=Homo sapiens OX=9606 GN=ETFB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.05	24.0	1	1	1
PRT	sp|Q03252|LMNB2_HUMAN	Lamin-B2 OS=Homo sapiens OX=9606 GN=LMNB2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	256-UNIMOD:35,264-UNIMOD:267	0.02	24.0	2	1	0
PRT	sp|Q96G03|PGM2_HUMAN	Phosphoglucomutase-2 OS=Homo sapiens OX=9606 GN=PGM2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	55-UNIMOD:35	0.02	24.0	1	1	1
PRT	sp|P60228|EIF3E_HUMAN	Eukaryotic translation initiation factor 3 subunit E OS=Homo sapiens OX=9606 GN=EIF3E PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	94-UNIMOD:35,102-UNIMOD:267,172-UNIMOD:188	0.04	24.0	3	2	1
PRT	sp|Q9BWM7|SFXN3_HUMAN	Sideroflexin-3 OS=Homo sapiens OX=9606 GN=SFXN3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	1-UNIMOD:35	0.07	24.0	2	2	2
PRT	sp|O15144|ARPC2_HUMAN	Actin-related protein 2/3 complex subunit 2 OS=Homo sapiens OX=9606 GN=ARPC2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	1-UNIMOD:35	0.03	24.0	1	1	1
PRT	sp|Q9UHV9|PFD2_HUMAN	Prefoldin subunit 2 OS=Homo sapiens OX=9606 GN=PFDN2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	73-UNIMOD:35,81-UNIMOD:267	0.06	24.0	3	1	0
PRT	sp|A0AVT1-2|UBA6_HUMAN	Isoform 2 of Ubiquitin-like modifier-activating enzyme 6 OS=Homo sapiens OX=9606 GN=UBA6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P06239-2|LCK_HUMAN	Isoform Short of Tyrosine-protein kinase Lck OS=Homo sapiens OX=9606 GN=LCK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|O60437|PEPL_HUMAN	Periplakin OS=Homo sapiens OX=9606 GN=PPL PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q05397-6|FAK1_HUMAN	Isoform 6 of Focal adhesion kinase 1 OS=Homo sapiens OX=9606 GN=PTK2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	350-UNIMOD:267	0.03	24.0	2	1	0
PRT	sp|Q9NXR7-4|BABA2_HUMAN	Isoform 4 of BRISC and BRCA1-A complex member 2 OS=Homo sapiens OX=9606 GN=BABAM2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	172-UNIMOD:267	0.03	24.0	2	1	0
PRT	sp|P07384|CAN1_HUMAN	Calpain-1 catalytic subunit OS=Homo sapiens OX=9606 GN=CAPN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	398-UNIMOD:188	0.02	24.0	1	1	1
PRT	sp|Q4G0N4-3|NAKD2_HUMAN	Isoform 3 of NAD kinase 2, mitochondrial OS=Homo sapiens OX=9606 GN=NADK2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	187-UNIMOD:267	0.04	24.0	1	1	1
PRT	sp|O00442|RTCA_HUMAN	RNA 3'-terminal phosphate cyclase OS=Homo sapiens OX=9606 GN=RTCA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	186-UNIMOD:267	0.03	24.0	2	1	0
PRT	sp|O43617-2|TPPC3_HUMAN	Isoform 2 of Trafficking protein particle complex subunit 3 OS=Homo sapiens OX=9606 GN=TRAPPC3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	124-UNIMOD:267	0.09	24.0	2	1	0
PRT	sp|Q9UIG0-2|BAZ1B_HUMAN	Isoform 2 of Tyrosine-protein kinase BAZ1B OS=Homo sapiens OX=9606 GN=BAZ1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	1041-UNIMOD:4,1052-UNIMOD:267	0.01	24.0	2	1	0
PRT	sp|P31939-2|PUR9_HUMAN	Isoform 2 of Bifunctional purine biosynthesis protein PURH OS=Homo sapiens OX=9606 GN=ATIC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	405-UNIMOD:188	0.02	24.0	1	1	1
PRT	sp|Q9NY93-2|DDX56_HUMAN	Isoform 2 of Probable ATP-dependent RNA helicase DDX56 OS=Homo sapiens OX=9606 GN=DDX56	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	270-UNIMOD:267	0.02	24.0	2	1	0
PRT	sp|Q9UHB6|LIMA1_HUMAN	LIM domain and actin-binding protein 1 OS=Homo sapiens OX=9606 GN=LIMA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	24.0	null	141-UNIMOD:267	0.01	24.0	2	1	0
PRT	sp|O43524-2|FOXO3_HUMAN	Isoform 2 of Forkhead box protein O3 OS=Homo sapiens OX=9606 GN=FOXO3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	22-UNIMOD:188	0.03	24.0	1	1	1
PRT	sp|P39656|OST48_HUMAN	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Homo sapiens OX=9606 GN=DDOST PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|P00492|HPRT_HUMAN	Hypoxanthine-guanine phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=HPRT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	151-UNIMOD:267	0.05	24.0	2	1	0
PRT	sp|P07355|ANXA2_HUMAN	Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	145-UNIMOD:267,2-UNIMOD:1,9-UNIMOD:4,10-UNIMOD:188	0.06	24.0	3	2	1
PRT	sp|Q08211|DHX9_HUMAN	ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	708-UNIMOD:188	0.01	24.0	2	1	0
PRT	sp|Q8TEA1|NSUN6_HUMAN	tRNA (cytosine(72)-C(5))-methyltransferase NSUN6 OS=Homo sapiens OX=9606 GN=NSUN6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|O00571-2|DDX3X_HUMAN	Isoform 2 of ATP-dependent RNA helicase DDX3X OS=Homo sapiens OX=9606 GN=DDX3X	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	532-UNIMOD:267	0.02	24.0	1	1	0
PRT	sp|P62269|RS18_HUMAN	40S ribosomal protein S18 OS=Homo sapiens OX=9606 GN=RPS18 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	75-UNIMOD:267	0.07	24.0	1	1	1
PRT	sp|P55884|EIF3B_HUMAN	Eukaryotic translation initiation factor 3 subunit B OS=Homo sapiens OX=9606 GN=EIF3B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	501-UNIMOD:267	0.01	24.0	2	1	0
PRT	sp|P60174-4|TPIS_HUMAN	Isoform 4 of Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.10	24.0	1	1	1
PRT	sp|Q9BTC8-2|MTA3_HUMAN	Isoform 2 of Metastasis-associated protein MTA3 OS=Homo sapiens OX=9606 GN=MTA3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	191-UNIMOD:267	0.02	24.0	2	1	0
PRT	sp|Q00610|CLH1_HUMAN	Clathrin heavy chain 1 OS=Homo sapiens OX=9606 GN=CLTC PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	1226-UNIMOD:267	0.01	24.0	1	1	0
PRT	sp|Q13045|FLII_HUMAN	Protein flightless-1 homolog OS=Homo sapiens OX=9606 GN=FLII PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	773-UNIMOD:267	0.01	24.0	1	1	1
PRT	sp|Q9BZZ5|API5_HUMAN	Apoptosis inhibitor 5 OS=Homo sapiens OX=9606 GN=API5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	81-UNIMOD:28	0.03	24.0	1	1	1
PRT	sp|Q9Y3I0|RTCB_HUMAN	RNA-splicing ligase RtcB homolog OS=Homo sapiens OX=9606 GN=RTCB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	24.0	null	67-UNIMOD:188	0.03	24.0	2	1	0
PRT	sp|P20340|RAB6A_HUMAN	Ras-related protein Rab-6A OS=Homo sapiens OX=9606 GN=RAB6A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	2-UNIMOD:1	0.06	24.0	1	1	1
PRT	sp|A5YKK6|CNOT1_HUMAN	CCR4-NOT transcription complex subunit 1 OS=Homo sapiens OX=9606 GN=CNOT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	50-UNIMOD:385,50-UNIMOD:4	0.01	24.0	1	1	1
PRT	sp|Q9H0N0|RAB6C_HUMAN	Ras-related protein Rab-6C OS=Homo sapiens OX=9606 GN=RAB6C PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|P06753-2|TPM3_HUMAN	Isoform 2 of Tropomyosin alpha-3 chain OS=Homo sapiens OX=9606 GN=TPM3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	154-UNIMOD:385,154-UNIMOD:4	0.04	24.0	1	1	1
PRT	sp|Q6IQ22|RAB12_HUMAN	Ras-related protein Rab-12 OS=Homo sapiens OX=9606 GN=RAB12 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	181-UNIMOD:267	0.04	24.0	1	1	1
PRT	sp|Q9NZB2|F120A_HUMAN	Constitutive coactivator of PPAR-gamma-like protein 1 OS=Homo sapiens OX=9606 GN=FAM120A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.01	24.0	1	1	0
PRT	sp|Q96KR1|ZFR_HUMAN	Zinc finger RNA-binding protein OS=Homo sapiens OX=9606 GN=ZFR PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	1041-UNIMOD:267	0.01	24.0	1	1	1
PRT	sp|Q92888|ARHG1_HUMAN	Rho guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=ARHGEF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.01	24.0	1	1	0
PRT	sp|P21964|COMT_HUMAN	Catechol O-methyltransferase OS=Homo sapiens OX=9606 GN=COMT PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	263-UNIMOD:188	0.05	24.0	3	1	0
PRT	sp|P30048|PRDX3_HUMAN	Thioredoxin-dependent peroxide reductase, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	24.0	null	196-UNIMOD:188	0.05	24.0	2	1	0
PRT	sp|Q96PD2|DCBD2_HUMAN	Discoidin, CUB and LCCL domain-containing protein 2 OS=Homo sapiens OX=9606 GN=DCBLD2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	141-UNIMOD:267	0.01	24.0	1	1	1
PRT	sp|P62241|RS8_HUMAN	40S ribosomal protein S8 OS=Homo sapiens OX=9606 GN=RPS8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	111-UNIMOD:28,123-UNIMOD:267	0.07	24.0	1	1	1
PRT	sp|P05556|ITB1_HUMAN	Integrin beta-1 OS=Homo sapiens OX=9606 GN=ITGB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	190-UNIMOD:188	0.01	24.0	1	1	1
PRT	sp|Q13177|PAK2_HUMAN	Serine/threonine-protein kinase PAK 2 OS=Homo sapiens OX=9606 GN=PAK2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1,10-UNIMOD:188,17-UNIMOD:267	0.03	24.0	3	1	0
PRT	sp|Q00653|NFKB2_HUMAN	Nuclear factor NF-kappa-B p100 subunit OS=Homo sapiens OX=9606 GN=NFKB2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	579-UNIMOD:267	0.01	24.0	1	1	1
PRT	sp|Q13636|RAB31_HUMAN	Ras-related protein Rab-31 OS=Homo sapiens OX=9606 GN=RAB31 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.06	24.0	1	1	0
PRT	sp|Q9Y5Q8|TF3C5_HUMAN	General transcription factor 3C polypeptide 5 OS=Homo sapiens OX=9606 GN=GTF3C5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	24-UNIMOD:35,26-UNIMOD:4,34-UNIMOD:267	0.02	24.0	1	1	1
PRT	sp|P62826|RAN_HUMAN	GTP-binding nuclear protein Ran OS=Homo sapiens OX=9606 GN=RAN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	23-UNIMOD:188	0.06	24.0	1	1	1
PRT	sp|P14314|GLU2B_HUMAN	Glucosidase 2 subunit beta OS=Homo sapiens OX=9606 GN=PRKCSH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q9Y5W7|SNX14_HUMAN	Sorting nexin-14 OS=Homo sapiens OX=9606 GN=SNX14 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|P0C0S8|H2A1_HUMAN	Histone H2A type 1 OS=Homo sapiens OX=9606 GN=H2AC11 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	30-UNIMOD:267	0.08	23.0	1	1	1
PRT	sp|Q96SI9-2|STRBP_HUMAN	Isoform 2 of Spermatid perinuclear RNA-binding protein OS=Homo sapiens OX=9606 GN=STRBP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|P43490|NAMPT_HUMAN	Nicotinamide phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=NAMPT PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	127-UNIMOD:267	0.02	23.0	1	1	1
PRT	sp|Q96EK7-3|F120B_HUMAN	Isoform 3 of Constitutive coactivator of peroxisome proliferator-activated receptor gamma OS=Homo sapiens OX=9606 GN=FAM120B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	110-UNIMOD:267	0.05	23.0	1	1	1
PRT	sp|P58546|MTPN_HUMAN	Myotrophin OS=Homo sapiens OX=9606 GN=MTPN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1,2-UNIMOD:4,4-UNIMOD:188,11-UNIMOD:188	0.09	23.0	1	1	1
PRT	sp|Q8TEQ6|GEMI5_HUMAN	Gem-associated protein 5 OS=Homo sapiens OX=9606 GN=GEMIN5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	19-UNIMOD:4,33-UNIMOD:267	0.01	23.0	1	1	1
PRT	sp|P08621-3|RU17_HUMAN	Isoform 3 of U1 small nuclear ribonucleoprotein 70 kDa OS=Homo sapiens OX=9606 GN=SNRNP70	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	27-UNIMOD:188	0.07	23.0	1	1	1
PRT	sp|Q9NWS8-2|RMND1_HUMAN	Isoform 2 of Required for meiotic nuclear division protein 1 homolog OS=Homo sapiens OX=9606 GN=RMND1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	19-UNIMOD:267	0.05	23.0	1	1	1
PRT	sp|Q8WXF1-2|PSPC1_HUMAN	Isoform 2 of Paraspeckle component 1 OS=Homo sapiens OX=9606 GN=PSPC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|P82979|SARNP_HUMAN	SAP domain-containing ribonucleoprotein OS=Homo sapiens OX=9606 GN=SARNP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.05	23.0	1	1	1
PRT	sp|Q9HCU5|PREB_HUMAN	Prolactin regulatory element-binding protein OS=Homo sapiens OX=9606 GN=PREB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	263-UNIMOD:267	0.03	23.0	1	1	1
PRT	sp|Q96TA1-2|NIBA2_HUMAN	Isoform 2 of Protein Niban 2 OS=Homo sapiens OX=9606 GN=NIBAN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	516-UNIMOD:267	0.02	23.0	1	1	1
PRT	sp|O43396|TXNL1_HUMAN	Thioredoxin-like protein 1 OS=Homo sapiens OX=9606 GN=TXNL1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|Q9BYD6|RM01_HUMAN	39S ribosomal protein L1, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|A7KAX9|RHG32_HUMAN	Rho GTPase-activating protein 32 OS=Homo sapiens OX=9606 GN=ARHGAP32 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.00	23.0	1	1	1
PRT	sp|P35998-2|PRS7_HUMAN	Isoform 2 of 26S proteasome regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PSMC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.08	23.0	2	2	1
PRT	sp|O75116|ROCK2_HUMAN	Rho-associated protein kinase 2 OS=Homo sapiens OX=9606 GN=ROCK2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	110-UNIMOD:267,26-UNIMOD:267	0.02	23.0	3	2	1
PRT	sp|P17812|PYRG1_HUMAN	CTP synthase 1 OS=Homo sapiens OX=9606 GN=CTPS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	216-UNIMOD:4	0.02	23.0	1	1	1
PRT	sp|Q9H0E2|TOLIP_HUMAN	Toll-interacting protein OS=Homo sapiens OX=9606 GN=TOLLIP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	23-UNIMOD:267	0.05	23.0	2	1	0
PRT	sp|Q99729-3|ROAA_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein A/B OS=Homo sapiens OX=9606 GN=HNRNPAB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	169-UNIMOD:188	0.05	23.0	1	1	1
PRT	sp|P06865|HEXA_HUMAN	Beta-hexosaminidase subunit alpha OS=Homo sapiens OX=9606 GN=HEXA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	393-UNIMOD:267	0.02	23.0	1	1	1
PRT	sp|O75390|CISY_HUMAN	Citrate synthase, mitochondrial OS=Homo sapiens OX=9606 GN=CS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	393-UNIMOD:188	0.03	23.0	1	1	1
PRT	sp|Q9UN37|VPS4A_HUMAN	Vacuolar protein sorting-associated protein 4A OS=Homo sapiens OX=9606 GN=VPS4A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	299-UNIMOD:267	0.05	23.0	2	2	2
PRT	sp|Q49AR2|CE022_HUMAN	UPF0489 protein C5orf22 OS=Homo sapiens OX=9606 GN=C5orf22 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	195-UNIMOD:4	0.07	23.0	1	1	1
PRT	sp|P08243|ASNS_HUMAN	Asparagine synthetase [glutamine-hydrolyzing] OS=Homo sapiens OX=9606 GN=ASNS PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	59-UNIMOD:35,63-UNIMOD:267	0.03	23.0	1	1	1
PRT	sp|P14406|CX7A2_HUMAN	Cytochrome c oxidase subunit 7A2, mitochondrial OS=Homo sapiens OX=9606 GN=COX7A2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.17	23.0	1	1	1
PRT	sp|Q14244-5|MAP7_HUMAN	Isoform 5 of Ensconsin OS=Homo sapiens OX=9606 GN=MAP7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	138-UNIMOD:267	0.02	23.0	1	1	1
PRT	sp|P18564-2|ITB6_HUMAN	Isoform 2 of Integrin beta-6 OS=Homo sapiens OX=9606 GN=ITGB6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|P46379-4|BAG6_HUMAN	Isoform 4 of Large proline-rich protein BAG6 OS=Homo sapiens OX=9606 GN=BAG6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	0
PRT	sp|Q13057|COASY_HUMAN	Bifunctional coenzyme A synthase OS=Homo sapiens OX=9606 GN=COASY PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	247-UNIMOD:267	0.02	23.0	1	1	1
PRT	sp|P53992|SC24C_HUMAN	Protein transport protein Sec24C OS=Homo sapiens OX=9606 GN=SEC24C PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	910-UNIMOD:4	0.01	23.0	1	1	1
PRT	sp|Q9Y4B5-2|MTCL1_HUMAN	Isoform 2 of Microtubule cross-linking factor 1 OS=Homo sapiens OX=9606 GN=MTCL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q9UNE7-2|CHIP_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase CHIP OS=Homo sapiens OX=9606 GN=STUB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	68-UNIMOD:267	0.06	23.0	1	1	1
PRT	sp|P23229-7|ITA6_HUMAN	Isoform 7 of Integrin alpha-6 OS=Homo sapiens OX=9606 GN=ITGA6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	856-UNIMOD:35	0.01	23.0	1	1	1
PRT	sp|Q9BPW8|NIPS1_HUMAN	Protein NipSnap homolog 1 OS=Homo sapiens OX=9606 GN=NIPSNAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	180-UNIMOD:35,188-UNIMOD:267	0.04	23.0	4	1	0
PRT	sp|P11172-2|UMPS_HUMAN	Isoform 2 of Uridine 5'-monophosphate synthase OS=Homo sapiens OX=9606 GN=UMPS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	1-UNIMOD:35,9-UNIMOD:188	0.03	23.0	1	1	1
PRT	sp|Q9NUQ2|PLCE_HUMAN	1-acyl-sn-glycerol-3-phosphate acyltransferase epsilon OS=Homo sapiens OX=9606 GN=AGPAT5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	291-UNIMOD:35	0.04	23.0	1	1	1
PRT	sp|Q01581|HMCS1_HUMAN	Hydroxymethylglutaryl-CoA synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=HMGCS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	278-UNIMOD:35	0.03	23.0	1	1	1
PRT	sp|P22307-6|NLTP_HUMAN	Isoform 6 of Non-specific lipid-transfer protein OS=Homo sapiens OX=9606 GN=SCP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.09	23.0	1	1	1
PRT	sp|Q14151|SAFB2_HUMAN	Scaffold attachment factor B2 OS=Homo sapiens OX=9606 GN=SAFB2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	419-UNIMOD:267	0.01	23.0	2	1	0
PRT	sp|Q9NX20|RM16_HUMAN	39S ribosomal protein L16, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL16 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	217-UNIMOD:267	0.04	23.0	1	1	1
PRT	sp|Q86T03|PP4P1_HUMAN	Type 1 phosphatidylinositol 4,5-bisphosphate 4-phosphatase OS=Homo sapiens OX=9606 GN=PIP4P1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|P52888-2|THOP1_HUMAN	Isoform 2 of Thimet oligopeptidase OS=Homo sapiens OX=9606 GN=THOP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	64-UNIMOD:267	0.04	23.0	1	1	1
PRT	sp|P30050|RL12_HUMAN	60S ribosomal protein L12 OS=Homo sapiens OX=9606 GN=RPL12 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	83-UNIMOD:188	0.10	23.0	1	1	1
PRT	sp|Q9Y4E8-2|UBP15_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 15 OS=Homo sapiens OX=9606 GN=USP15	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	917-UNIMOD:267	0.02	23.0	1	1	1
PRT	sp|P98171|RHG04_HUMAN	Rho GTPase-activating protein 4 OS=Homo sapiens OX=9606 GN=ARHGAP4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|P02786|TFR1_HUMAN	Transferrin receptor protein 1 OS=Homo sapiens OX=9606 GN=TFRC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	22-UNIMOD:267	0.02	23.0	1	1	1
PRT	sp|Q9NRK6|ABCBA_HUMAN	ATP-binding cassette sub-family B member 10, mitochondrial OS=Homo sapiens OX=9606 GN=ABCB10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q9UNZ2-4|NSF1C_HUMAN	Isoform 2 of NSFL1 cofactor p47 OS=Homo sapiens OX=9606 GN=NSFL1C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	111-UNIMOD:267	0.03	23.0	1	1	1
PRT	sp|Q8IYQ7|THNS1_HUMAN	Threonine synthase-like 1 OS=Homo sapiens OX=9606 GN=THNSL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q9HD20-2|AT131_HUMAN	Isoform B of Manganese-transporting ATPase 13A1 OS=Homo sapiens OX=9606 GN=ATP13A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	679-UNIMOD:267	0.01	23.0	2	1	0
PRT	sp|Q6KB66-2|K2C80_HUMAN	Isoform 2 of Keratin, type II cytoskeletal 80 OS=Homo sapiens OX=9606 GN=KRT80	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	217-UNIMOD:188	0.03	23.0	2	1	0
PRT	sp|Q14697|GANAB_HUMAN	Neutral alpha-glucosidase AB OS=Homo sapiens OX=9606 GN=GANAB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q9UPN9-2|TRI33_HUMAN	Isoform Beta of E3 ubiquitin-protein ligase TRIM33 OS=Homo sapiens OX=9606 GN=TRIM33	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	389-UNIMOD:188	0.01	23.0	2	1	0
PRT	sp|P30040|ERP29_HUMAN	Endoplasmic reticulum resident protein 29 OS=Homo sapiens OX=9606 GN=ERP29 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	253-UNIMOD:188	0.04	23.0	1	1	1
PRT	sp|O94832|MYO1D_HUMAN	Unconventional myosin-Id OS=Homo sapiens OX=9606 GN=MYO1D PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	143-UNIMOD:4,152-UNIMOD:188	0.01	23.0	1	1	1
PRT	sp|Q6PGP7|TTC37_HUMAN	Tetratricopeptide repeat protein 37 OS=Homo sapiens OX=9606 GN=TTC37 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	1367-UNIMOD:267	0.01	23.0	1	1	1
PRT	sp|P48029-4|SC6A8_HUMAN	Isoform 4 of Sodium- and chloride-dependent creatine transporter 1 OS=Homo sapiens OX=9606 GN=SLC6A8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	102-UNIMOD:188	0.02	23.0	2	1	0
PRT	sp|O60318|GANP_HUMAN	Germinal-center associated nuclear protein OS=Homo sapiens OX=9606 GN=MCM3AP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	906-UNIMOD:267	0.01	23.0	1	1	1
PRT	sp|P35606-2|COPB2_HUMAN	Isoform 2 of Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	27-UNIMOD:4,32-UNIMOD:267	0.01	23.0	1	1	1
PRT	sp|Q00013-2|EM55_HUMAN	Isoform 2 of 55 kDa erythrocyte membrane protein OS=Homo sapiens OX=9606 GN=MPP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	265-UNIMOD:267	0.03	23.0	1	1	1
PRT	sp|O75608-2|LYPA1_HUMAN	Isoform 2 of Acyl-protein thioesterase 1 OS=Homo sapiens OX=9606 GN=LYPLA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	185-UNIMOD:188	0.06	23.0	2	1	0
PRT	sp|Q15633-2|TRBP2_HUMAN	Isoform 2 of RISC-loading complex subunit TARBP2 OS=Homo sapiens OX=9606 GN=TARBP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|P11388|TOP2A_HUMAN	DNA topoisomerase 2-alpha OS=Homo sapiens OX=9606 GN=TOP2A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q7Z6M1-2|RABEK_HUMAN	Isoform 2 of Rab9 effector protein with kelch motifs OS=Homo sapiens OX=9606 GN=RABEPK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	88-UNIMOD:267	0.05	23.0	1	1	1
PRT	sp|P17980|PRS6A_HUMAN	26S proteasome regulatory subunit 6A OS=Homo sapiens OX=9606 GN=PSMC3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	344-UNIMOD:267	0.03	23.0	1	1	1
PRT	sp|Q16656-2|NRF1_HUMAN	Isoform Short of Nuclear respiratory factor 1 OS=Homo sapiens OX=9606 GN=NRF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|P10599-2|THIO_HUMAN	Isoform 2 of Thioredoxin OS=Homo sapiens OX=9606 GN=TXN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	74-UNIMOD:188	0.12	23.0	1	1	1
PRT	sp|P55060-4|XPO2_HUMAN	Isoform 4 of Exportin-2 OS=Homo sapiens OX=9606 GN=CSE1L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	299-UNIMOD:267	0.01	23.0	1	1	1
PRT	sp|Q5JTH9-2|RRP12_HUMAN	Isoform 2 of RRP12-like protein OS=Homo sapiens OX=9606 GN=RRP12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q9Y676|RT18B_HUMAN	28S ribosomal protein S18b, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS18B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	105-UNIMOD:4,108-UNIMOD:4,109-UNIMOD:267	0.04	23.0	1	1	1
PRT	sp|P48506|GSH1_HUMAN	Glutamate--cysteine ligase catalytic subunit OS=Homo sapiens OX=9606 GN=GCLC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|P49591|SYSC_HUMAN	Serine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=SARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	300-UNIMOD:4,302-UNIMOD:267	0.02	23.0	1	1	1
PRT	sp|P11216|PYGB_HUMAN	Glycogen phosphorylase, brain form OS=Homo sapiens OX=9606 GN=PYGB PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	23.0	null	170-UNIMOD:188,29-UNIMOD:267	0.03	23.0	3	2	1
PRT	sp|Q8NCN5|PDPR_HUMAN	Pyruvate dehydrogenase phosphatase regulatory subunit, mitochondrial OS=Homo sapiens OX=9606 GN=PDPR PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	630-UNIMOD:267	0.01	23.0	2	1	0
PRT	sp|P68363|TBA1B_HUMAN	Tubulin alpha-1B chain OS=Homo sapiens OX=9606 GN=TUBA1B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	null	85-UNIMOD:28,96-UNIMOD:188	0.03	23.0	2	1	0
PRT	sp|Q13509|TBB3_HUMAN	Tubulin beta-3 chain OS=Homo sapiens OX=9606 GN=TUBB3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	174-UNIMOD:188	0.03	23.0	1	1	0
PRT	sp|Q13085|ACACA_HUMAN	Acetyl-CoA carboxylase 1 OS=Homo sapiens OX=9606 GN=ACACA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	23.0	null	1083-UNIMOD:28,1096-UNIMOD:267,350-UNIMOD:267	0.01	23.0	2	2	1
PRT	sp|Q9H0S4|DDX47_HUMAN	Probable ATP-dependent RNA helicase DDX47 OS=Homo sapiens OX=9606 GN=DDX47 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	62-UNIMOD:267	0.03	23.0	1	1	0
PRT	sp|P07996|TSP1_HUMAN	Thrombospondin-1 OS=Homo sapiens OX=9606 GN=THBS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|O95456|PSMG1_HUMAN	Proteasome assembly chaperone 1 OS=Homo sapiens OX=9606 GN=PSMG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	null	2-UNIMOD:1,11-UNIMOD:188,14-UNIMOD:4,15-UNIMOD:267	0.05	23.0	1	1	1
PRT	sp|P55265|DSRAD_HUMAN	Double-stranded RNA-specific adenosine deaminase OS=Homo sapiens OX=9606 GN=ADAR PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	null	346-UNIMOD:28,358-UNIMOD:188	0.01	23.0	1	1	1
PRT	sp|Q13283|G3BP1_HUMAN	Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens OX=9606 GN=G3BP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	null	3-UNIMOD:1,5-UNIMOD:188,13-UNIMOD:267	0.03	23.0	2	1	0
PRT	sp|P78417|GSTO1_HUMAN	Glutathione S-transferase omega-1 OS=Homo sapiens OX=9606 GN=GSTO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.06	23.0	1	1	0
PRT	sp|P82933|RT09_HUMAN	28S ribosomal protein S9, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	null	77-UNIMOD:28	0.03	23.0	1	1	1
PRT	sp|P49748|ACADV_HUMAN	Very long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADVL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	1	1	0
PRT	sp|P50552|VASP_HUMAN	Vasodilator-stimulated phosphoprotein OS=Homo sapiens OX=9606 GN=VASP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	null	144-UNIMOD:28,154-UNIMOD:267	0.03	23.0	1	1	1
PRT	sp|Q8NB90|AFG2H_HUMAN	ATPase family protein 2 homolog OS=Homo sapiens OX=9606 GN=SPATA5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	400-UNIMOD:188	0.01	23.0	2	1	0
PRT	sp|Q8NI60|COQ8A_HUMAN	Atypical kinase COQ8A, mitochondrial OS=Homo sapiens OX=9606 GN=COQ8A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	1	1	0
PRT	sp|P04264|K2C1_HUMAN	Keratin, type II cytoskeletal 1 OS=Homo sapiens OX=9606 GN=KRT1 PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|O00541|PESC_HUMAN	Pescadillo homolog OS=Homo sapiens OX=9606 GN=PES1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	null	153-UNIMOD:385,153-UNIMOD:4,161-UNIMOD:4,162-UNIMOD:267	0.02	23.0	2	1	0
PRT	sp|Q15059|BRD3_HUMAN	Bromodomain-containing protein 3 OS=Homo sapiens OX=9606 GN=BRD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	null	579-UNIMOD:28	0.02	23.0	1	1	1
PRT	sp|P02649|APOE_HUMAN	Apolipoprotein E OS=Homo sapiens OX=9606 GN=APOE PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	290-UNIMOD:35	0.04	23.0	1	1	1
PRT	sp|O14974|MYPT1_HUMAN	Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens OX=9606 GN=PPP1R12A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	null	183-UNIMOD:28,194-UNIMOD:267	0.01	23.0	1	1	1
PRT	sp|Q68DK2|ZFY26_HUMAN	Zinc finger FYVE domain-containing protein 26 OS=Homo sapiens OX=9606 GN=ZFYVE26 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	2393-UNIMOD:267	0.00	23.0	1	1	1
PRT	sp|Q15738|NSDHL_HUMAN	Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Homo sapiens OX=9606 GN=NSDHL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	220-UNIMOD:267	0.04	23.0	1	1	1
PRT	sp|Q2TBC4-2|PRIC4_HUMAN	Isoform 2 of Prickle-like protein 4 OS=Homo sapiens OX=9606 GN=PRICKLE4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	293-UNIMOD:267	0.07	23.0	1	1	1
PRT	sp|Q14746|COG2_HUMAN	Conserved oligomeric Golgi complex subunit 2 OS=Homo sapiens OX=9606 GN=COG2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	672-UNIMOD:188,685-UNIMOD:35,690-UNIMOD:188	0.03	23.0	1	1	1
PRT	sp|Q8NBN7|RDH13_HUMAN	Retinol dehydrogenase 13 OS=Homo sapiens OX=9606 GN=RDH13 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	325-UNIMOD:267	0.03	23.0	1	1	0
PRT	sp|Q13428|TCOF_HUMAN	Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	1327-UNIMOD:267	0.01	23.0	1	1	1
PRT	sp|Q92598-2|HS105_HUMAN	Isoform Beta of Heat shock protein 105 kDa OS=Homo sapiens OX=9606 GN=HSPH1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|P35268|RL22_HUMAN	60S ribosomal protein L22 OS=Homo sapiens OX=9606 GN=RPL22 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.11	22.0	1	1	1
PRT	sp|Q96SZ5|AEDO_HUMAN	2-aminoethanethiol dioxygenase OS=Homo sapiens OX=9606 GN=ADO PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	160-UNIMOD:267	0.06	22.0	1	1	1
PRT	sp|P04424-3|ARLY_HUMAN	Isoform 3 of Argininosuccinate lyase OS=Homo sapiens OX=9606 GN=ASL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.03	22.0	1	1	1
PRT	sp|Q96HW7-2|INT4_HUMAN	Isoform 2 of Integrator complex subunit 4 OS=Homo sapiens OX=9606 GN=INTS4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	170-UNIMOD:4	0.03	22.0	1	1	1
PRT	sp|Q96JM3|CHAP1_HUMAN	Chromosome alignment-maintaining phosphoprotein 1 OS=Homo sapiens OX=9606 GN=CHAMP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	770-UNIMOD:4	0.01	22.0	1	1	1
PRT	sp|O43502-2|RA51C_HUMAN	Isoform 2 of DNA repair protein RAD51 homolog 3 OS=Homo sapiens OX=9606 GN=RAD51C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.10	22.0	1	1	1
PRT	sp|Q04637-6|IF4G1_HUMAN	Isoform E of Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q8IX12-2|CCAR1_HUMAN	Isoform 2 of Cell division cycle and apoptosis regulator protein 1 OS=Homo sapiens OX=9606 GN=CCAR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q9UHA4-2|LTOR3_HUMAN	Isoform 2 of Ragulator complex protein LAMTOR3 OS=Homo sapiens OX=9606 GN=LAMTOR3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	111-UNIMOD:267	0.09	22.0	1	1	1
PRT	sp|Q13395|TARB1_HUMAN	Probable methyltransferase TARBP1 OS=Homo sapiens OX=9606 GN=TARBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|P08670|VIME_HUMAN	Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|P00491|PNPH_HUMAN	Purine nucleoside phosphorylase OS=Homo sapiens OX=9606 GN=PNP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	133-UNIMOD:267	0.04	22.0	1	1	1
PRT	sp|Q6P996-3|PDXD1_HUMAN	Isoform 3 of Pyridoxal-dependent decarboxylase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PDXDC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	315-UNIMOD:188	0.02	22.0	1	1	1
PRT	sp|P22102-2|PUR2_HUMAN	Isoform Short of Trifunctional purine biosynthetic protein adenosine-3 OS=Homo sapiens OX=9606 GN=GART	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	298-UNIMOD:4	0.03	22.0	1	1	1
PRT	sp|Q9H4A3-4|WNK1_HUMAN	Isoform 3 of Serine/threonine-protein kinase WNK1 OS=Homo sapiens OX=9606 GN=WNK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q14790-6|CASP8_HUMAN	Isoform 6 of Caspase-8 OS=Homo sapiens OX=9606 GN=CASP8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	33-UNIMOD:267	0.05	22.0	1	1	1
PRT	sp|Q5VTB9-3|RN220_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase RNF220 OS=Homo sapiens OX=9606 GN=RNF220	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|P40227-2|TCPZ_HUMAN	Isoform 2 of T-complex protein 1 subunit zeta OS=Homo sapiens OX=9606 GN=CCT6A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	262-UNIMOD:188,46-UNIMOD:35,55-UNIMOD:188	0.05	22.0	3	2	1
PRT	sp|P04181|OAT_HUMAN	Ornithine aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=OAT PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	76-UNIMOD:267	0.03	22.0	2	1	0
PRT	sp|Q9Y371-3|SHLB1_HUMAN	Isoform 3 of Endophilin-B1 OS=Homo sapiens OX=9606 GN=SH3GLB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.05	22.0	1	1	1
PRT	sp|Q562E7-4|WDR81_HUMAN	Isoform 4 of WD repeat-containing protein 81 OS=Homo sapiens OX=9606 GN=WDR81	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q86XK2-6|FBX11_HUMAN	Isoform 6 of F-box only protein 11 OS=Homo sapiens OX=9606 GN=FBXO11	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	668-UNIMOD:267	0.01	22.0	2	1	0
PRT	sp|P78417-2|GSTO1_HUMAN	Isoform 2 of Glutathione S-transferase omega-1 OS=Homo sapiens OX=9606 GN=GSTO1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	25-UNIMOD:267	0.07	22.0	1	1	0
PRT	sp|P27824-2|CALX_HUMAN	Isoform 2 of Calnexin OS=Homo sapiens OX=9606 GN=CANX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	122-UNIMOD:188	0.02	22.0	2	1	0
PRT	sp|Q8NFH3-2|NUP43_HUMAN	Isoform 2 of Nucleoporin Nup43 OS=Homo sapiens OX=9606 GN=NUP43	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	253-UNIMOD:267	0.04	22.0	1	1	1
PRT	sp|Q9Y3Z3-3|SAMH1_HUMAN	Isoform 3 of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 OS=Homo sapiens OX=9606 GN=SAMHD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	143-UNIMOD:267	0.02	22.0	1	1	1
PRT	sp|P52429|DGKE_HUMAN	Diacylglycerol kinase epsilon OS=Homo sapiens OX=9606 GN=DGKE PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	254-UNIMOD:188	0.02	22.0	1	1	1
PRT	sp|Q08J23-3|NSUN2_HUMAN	Isoform 3 of RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q96AC1-2|FERM2_HUMAN	Isoform 2 of Fermitin family homolog 2 OS=Homo sapiens OX=9606 GN=FERMT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|O60701-3|UGDH_HUMAN	Isoform 3 of UDP-glucose 6-dehydrogenase OS=Homo sapiens OX=9606 GN=UGDH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|O00483|NDUA4_HUMAN	Cytochrome c oxidase subunit NDUFA4 OS=Homo sapiens OX=9606 GN=NDUFA4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	44-UNIMOD:4	0.16	22.0	1	1	1
PRT	sp|P48444|COPD_HUMAN	Coatomer subunit delta OS=Homo sapiens OX=9606 GN=ARCN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	347-UNIMOD:188	0.05	22.0	2	2	2
PRT	sp|A1A4S6|RHG10_HUMAN	Rho GTPase-activating protein 10 OS=Homo sapiens OX=9606 GN=ARHGAP10 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q86UY6-3|NAA40_HUMAN	Isoform 2 of N-alpha-acetyltransferase 40 OS=Homo sapiens OX=9606 GN=NAA40	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	25-UNIMOD:188	0.06	22.0	1	1	1
PRT	sp|Q96FQ6|S10AG_HUMAN	Protein S100-A16 OS=Homo sapiens OX=9606 GN=S100A16 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.12	22.0	1	1	1
PRT	sp|Q08379-2|GOGA2_HUMAN	Isoform 2 of Golgin subfamily A member 2 OS=Homo sapiens OX=9606 GN=GOLGA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|P05362|ICAM1_HUMAN	Intercellular adhesion molecule 1 OS=Homo sapiens OX=9606 GN=ICAM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	66-UNIMOD:188	0.02	22.0	1	1	1
PRT	sp|P35221-3|CTNA1_HUMAN	Isoform 3 of Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	216-UNIMOD:267	0.02	22.0	1	1	1
PRT	sp|Q99504-2|EYA3_HUMAN	Isoform 2 of Eyes absent homolog 3 OS=Homo sapiens OX=9606 GN=EYA3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.06	22.0	1	1	1
PRT	sp|P21796|VDAC1_HUMAN	Voltage-dependent anion-selective channel protein 1 OS=Homo sapiens OX=9606 GN=VDAC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|P45880-2|VDAC2_HUMAN	Isoform 2 of Voltage-dependent anion-selective channel protein 2 OS=Homo sapiens OX=9606 GN=VDAC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	266-UNIMOD:188	0.04	22.0	1	1	1
PRT	sp|P41252|SYIC_HUMAN	Isoleucine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=IARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	634-UNIMOD:267	0.01	22.0	2	1	0
PRT	sp|P30519-2|HMOX2_HUMAN	Isoform 2 of Heme oxygenase 2 OS=Homo sapiens OX=9606 GN=HMOX2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	1-UNIMOD:35	0.03	22.0	1	1	1
PRT	sp|Q9Y2R4|DDX52_HUMAN	Probable ATP-dependent RNA helicase DDX52 OS=Homo sapiens OX=9606 GN=DDX52 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	1-UNIMOD:1,8-UNIMOD:267	0.02	22.0	2	1	0
PRT	sp|Q16795|NDUA9_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFA9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	76-UNIMOD:35	0.03	22.0	1	1	1
PRT	sp|Q9BZL1|UBL5_HUMAN	Ubiquitin-like protein 5 OS=Homo sapiens OX=9606 GN=UBL5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	1-UNIMOD:35,6-UNIMOD:4,9-UNIMOD:267	0.14	22.0	2	1	0
PRT	sp|P49773|HINT1_HUMAN	Histidine triad nucleotide-binding protein 1 OS=Homo sapiens OX=9606 GN=HINT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	21-UNIMOD:188	0.08	22.0	1	1	1
PRT	sp|P30101|PDIA3_HUMAN	Protein disulfide-isomerase A3 OS=Homo sapiens OX=9606 GN=PDIA3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	140-UNIMOD:267	0.02	22.0	1	1	1
PRT	sp|P51570|GALK1_HUMAN	Galactokinase OS=Homo sapiens OX=9606 GN=GALK1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|P48200|IREB2_HUMAN	Iron-responsive element-binding protein 2 OS=Homo sapiens OX=9606 GN=IREB2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	84-UNIMOD:267	0.01	22.0	1	1	1
PRT	sp|P04843|RPN1_HUMAN	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Homo sapiens OX=9606 GN=RPN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	204-UNIMOD:267	0.02	22.0	1	1	1
PRT	sp|P11940-2|PABP1_HUMAN	Isoform 2 of Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	104-UNIMOD:188	0.02	22.0	1	1	1
PRT	sp|A5YKK6-4|CNOT1_HUMAN	Isoform 4 of CCR4-NOT transcription complex subunit 1 OS=Homo sapiens OX=9606 GN=CNOT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	459-UNIMOD:267	0.01	22.0	1	1	1
PRT	sp|O60749|SNX2_HUMAN	Sorting nexin-2 OS=Homo sapiens OX=9606 GN=SNX2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	126-UNIMOD:267	0.02	22.0	1	1	1
PRT	sp|Q9BRA2|TXD17_HUMAN	Thioredoxin domain-containing protein 17 OS=Homo sapiens OX=9606 GN=TXNDC17 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.09	22.0	1	1	1
PRT	sp|Q8IZH2-2|XRN1_HUMAN	Isoform 2 of 5'-3' exoribonuclease 1 OS=Homo sapiens OX=9606 GN=XRN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|O76031|CLPX_HUMAN	ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial OS=Homo sapiens OX=9606 GN=CLPX PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	522-UNIMOD:267	0.02	22.0	1	1	1
PRT	sp|O96000-2|NDUBA_HUMAN	Isoform 2 of NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 OS=Homo sapiens OX=9606 GN=NDUFB10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.08	22.0	1	1	1
PRT	sp|Q6P4A8|PLBL1_HUMAN	Phospholipase B-like 1 OS=Homo sapiens OX=9606 GN=PLBD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	85-UNIMOD:267	0.02	22.0	1	1	1
PRT	sp|Q99460-2|PSMD1_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PSMD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|P05026-2|AT1B1_HUMAN	Isoform 2 of Sodium/potassium-transporting ATPase subunit beta-1 OS=Homo sapiens OX=9606 GN=ATP1B1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.05	22.0	1	1	1
PRT	sp|Q13509-2|TBB3_HUMAN	Isoform 2 of Tubulin beta-3 chain OS=Homo sapiens OX=9606 GN=TUBB3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	282-UNIMOD:4,287-UNIMOD:267	0.03	22.0	1	1	1
PRT	sp|Q9Y383-3|LC7L2_HUMAN	Isoform 3 of Putative RNA-binding protein Luc7-like 2 OS=Homo sapiens OX=9606 GN=LUC7L2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	153-UNIMOD:35	0.06	22.0	1	1	1
PRT	sp|Q9Y678|COPG1_HUMAN	Coatomer subunit gamma-1 OS=Homo sapiens OX=9606 GN=COPG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	42-UNIMOD:267	0.01	22.0	2	1	0
PRT	sp|P46109|CRKL_HUMAN	Crk-like protein OS=Homo sapiens OX=9606 GN=CRKL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|Q6P1Q0-4|LTMD1_HUMAN	Isoform 4 of LETM1 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=LETMD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.06	22.0	1	1	1
PRT	sp|P49916-3|DNLI3_HUMAN	Isoform 3 of DNA ligase 3 OS=Homo sapiens OX=9606 GN=LIG3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	855-UNIMOD:267	0.01	22.0	1	1	1
PRT	sp|Q14203-5|DCTN1_HUMAN	Isoform 5 of Dynactin subunit 1 OS=Homo sapiens OX=9606 GN=DCTN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	1113-UNIMOD:4,1120-UNIMOD:267	0.01	22.0	1	1	1
PRT	sp|P61009|SPCS3_HUMAN	Signal peptidase complex subunit 3 OS=Homo sapiens OX=9606 GN=SPCS3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.07	22.0	1	1	1
PRT	sp|O75340-2|PDCD6_HUMAN	Isoform 2 of Programmed cell death protein 6 OS=Homo sapiens OX=9606 GN=PDCD6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.06	22.0	1	1	1
PRT	sp|Q8IUX4|ABC3F_HUMAN	DNA dC->dU-editing enzyme APOBEC-3F OS=Homo sapiens OX=9606 GN=APOBEC3F PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	367-UNIMOD:188	0.03	22.0	1	1	1
PRT	sp|Q96J01-2|THOC3_HUMAN	Isoform 2 of THO complex subunit 3 OS=Homo sapiens OX=9606 GN=THOC3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	43-UNIMOD:267	0.03	22.0	1	1	1
PRT	sp|Q9NZM1|MYOF_HUMAN	Myoferlin OS=Homo sapiens OX=9606 GN=MYOF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	null	210-UNIMOD:28	0.01	22.0	1	1	1
PRT	sp|O14979|HNRDL_HUMAN	Heterogeneous nuclear ribonucleoprotein D-like OS=Homo sapiens OX=9606 GN=HNRNPDL PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	177-UNIMOD:4,180-UNIMOD:188	0.03	22.0	1	1	1
PRT	sp|Q9BY44|EIF2A_HUMAN	Eukaryotic translation initiation factor 2A OS=Homo sapiens OX=9606 GN=EIF2A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	null	306-UNIMOD:385,306-UNIMOD:4,317-UNIMOD:267	0.02	22.0	1	1	0
PRT	sp|P33240|CSTF2_HUMAN	Cleavage stimulation factor subunit 2 OS=Homo sapiens OX=9606 GN=CSTF2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	319-UNIMOD:267	0.02	22.0	1	1	1
PRT	sp|P35998|PRS7_HUMAN	26S proteasome regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PSMC2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	210-UNIMOD:188	0.03	22.0	1	1	0
PRT	sp|O43143|DHX15_HUMAN	Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 OS=Homo sapiens OX=9606 GN=DHX15 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|O43324|MCA3_HUMAN	Eukaryotic translation elongation factor 1 epsilon-1 OS=Homo sapiens OX=9606 GN=EEF1E1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	null	157-UNIMOD:28	0.06	22.0	2	1	0
PRT	sp|O14735|CDIPT_HUMAN	CDP-diacylglycerol--inositol 3-phosphatidyltransferase OS=Homo sapiens OX=9606 GN=CDIPT PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	132-UNIMOD:267	0.06	22.0	1	1	0
PRT	sp|O00165|HAX1_HUMAN	HCLS1-associated protein X-1 OS=Homo sapiens OX=9606 GN=HAX1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.04	22.0	1	1	0
PRT	sp|P15529|MCP_HUMAN	Membrane cofactor protein OS=Homo sapiens OX=9606 GN=CD46 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	null	228-UNIMOD:385,228-UNIMOD:4	0.03	22.0	1	1	1
PRT	sp|Q16643|DREB_HUMAN	Drebrin OS=Homo sapiens OX=9606 GN=DBN1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	null	2-UNIMOD:1,10-UNIMOD:267	0.02	22.0	2	1	0
PRT	sp|Q9UJU6|DBNL_HUMAN	Drebrin-like protein OS=Homo sapiens OX=9606 GN=DBNL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	null	289-UNIMOD:28,299-UNIMOD:267	0.03	22.0	1	1	1
PRT	sp|Q9H1Z4|WDR13_HUMAN	WD repeat-containing protein 13 OS=Homo sapiens OX=9606 GN=WDR13 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	null		0.02	22.0	1	1	0
PRT	sp|Q86UK7|ZN598_HUMAN	E3 ubiquitin-protein ligase ZNF598 OS=Homo sapiens OX=9606 GN=ZNF598 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	null	2-UNIMOD:1	0.01	22.0	1	1	1
PRT	sp|A8MT69|CENPX_HUMAN	Centromere protein X OS=Homo sapiens OX=9606 GN=CENPX PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	1-UNIMOD:1	0.16	22.0	1	1	1
PRT	sp|Q96I25|SPF45_HUMAN	Splicing factor 45 OS=Homo sapiens OX=9606 GN=RBM17 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	null	47-UNIMOD:28,58-UNIMOD:188,59-UNIMOD:267	0.03	22.0	1	1	1
PRT	sp|Q7Z2T5|TRM1L_HUMAN	TRMT1-like protein OS=Homo sapiens OX=9606 GN=TRMT1L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	null	510-UNIMOD:28,513-UNIMOD:4,515-UNIMOD:4,522-UNIMOD:188	0.02	22.0	1	1	1
PRT	sp|P46926|GNPI1_HUMAN	Glucosamine-6-phosphate isomerase 1 OS=Homo sapiens OX=9606 GN=GNPDA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|O94903|PLPHP_HUMAN	Pyridoxal phosphate homeostasis protein OS=Homo sapiens OX=9606 GN=PLPBP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	250-UNIMOD:267	0.04	22.0	1	1	1
PRT	sp|Q92963|RIT1_HUMAN	GTP-binding protein Rit1 OS=Homo sapiens OX=9606 GN=RIT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	null	143-UNIMOD:28,154-UNIMOD:267	0.06	22.0	1	1	1
PRT	sp|Q96C36|P5CR2_HUMAN	Pyrroline-5-carboxylate reductase 2 OS=Homo sapiens OX=9606 GN=PYCR2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|Q03188|CENPC_HUMAN	Centromere protein C OS=Homo sapiens OX=9606 GN=CENPC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q66K14|TBC9B_HUMAN	TBC1 domain family member 9B OS=Homo sapiens OX=9606 GN=TBC1D9B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	218-UNIMOD:267	0.01	22.0	1	1	1
PRT	sp|Q13601|KRR1_HUMAN	KRR1 small subunit processome component homolog OS=Homo sapiens OX=9606 GN=KRR1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	142-UNIMOD:4	0.03	22.0	1	1	1
PRT	sp|Q93009|UBP7_HUMAN	Ubiquitin carboxyl-terminal hydrolase 7 OS=Homo sapiens OX=9606 GN=USP7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	90-UNIMOD:4	0.01	22.0	1	1	1
PRT	sp|Q969V6|MRTFA_HUMAN	Myocardin-related transcription factor A OS=Homo sapiens OX=9606 GN=MRTFA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.02	22.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	NMGGPYGGGNYGPGGSGGSGGYGGR	1	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	55.0	2-UNIMOD:35,25-UNIMOD:267	ms_run[2]:scan=3750	25.789	2	2214.9013	2214.9013	R	S	314	339
PSM	NMGGPYGGGNYGPGGSGGSGGYGGR	2	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	53.0	2-UNIMOD:35	ms_run[2]:scan=3742	25.742	2	2204.893	2204.8930	R	S	314	339
PSM	NMGGPYGGGNYGPGGSGGSGGYGGR	3	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0		ms_run[2]:scan=4738	31.221	2	2188.8981	2188.8981	R	S	314	339
PSM	NMGGPYGGGNYGPGGSGGSGGYGGR	4	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	25-UNIMOD:267	ms_run[2]:scan=4739	31.227	2	2198.9063	2198.9063	R	S	314	339
PSM	APPAPGPASGGSGEVDELFDVK	5	sp|O14579-3|COPE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0		ms_run[2]:scan=9723	60.568	2	2096.0062	2096.0062	M	N	2	24
PSM	APPAPGPASGGSGEVDELFDVK	6	sp|O14579-3|COPE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	22-UNIMOD:188	ms_run[2]:scan=9730	60.612	2	2102.0263	2102.0263	M	N	2	24
PSM	GFGDGYNGYGGGPGGGNFGGSPGYGGGR	7	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0		ms_run[1]:scan=7312	46.16520833333333	2	2495.019360	2494.032263	R	G	239	267
PSM	ASLDSAGGSGSSPILLPTPVVGGPR	8	sp|Q9BST9-3|RTKN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	25-UNIMOD:267	ms_run[2]:scan=9934	61.857	2	2301.2204	2301.2204	R	Y	181	206
PSM	LEAIEDDSVKETDSSSASAATPSK	9	sp|P54578-2|UBP14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=3986	27.071	2	2437.1344	2437.1344	K	K	180	204
PSM	VEEEEEEKVAEEEETSVK	10	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=5116	33.409	2	2120.9485	2120.9485	K	K	468	486
PSM	YGGDVLAGPGGGGGLGPVDVPSAR	11	sp|Q8TAD4|ZNT5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=8853	55.305	2	2124.06	2124.0600	K	L	5	29
PSM	AFLASPEYVNLPINGNGKQ	12	sp|P09211|GSTP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=10072	62.698	2	2031.0425	2031.0425	K	-	192	211
PSM	MNPIVVVHGGGAGPISK	13	sp|Q7L266|ASGL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:1,17-UNIMOD:188	ms_run[2]:scan=8830	55.17	2	1679.9124	1679.9124	-	D	1	18
PSM	VEEEEEEKVAEEEETSVK	14	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	8-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=5113	33.388	2	2132.9887	2132.9887	K	K	468	486
PSM	AQFAQPEILIGTIPGAGGTQR	15	sp|P30084|ECHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=10725	66.755	2	2124.1328	2124.1328	K	L	158	179
PSM	ASLDSAGGSGSSPILLPTPVVGGPR	16	sp|Q9BST9-3|RTKN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=9933	61.851	2	2291.2121	2291.2121	R	Y	181	206
PSM	GILFVGSGVSGGEEGAR	17	sp|P52209-2|6PGD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=8026	50.278	2	1590.8002	1590.8002	K	Y	107	124
PSM	QVPGGGGGGGSGGGGGSGGGGSGGGR	18	sp|Q9UHB9-4|SRP68_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=485	6.3957	2	1842.7953	1842.7953	K	G	6	32
PSM	TGSTSSKEDDYESDAATIVQK	19	sp|Q5T4S7-3|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=5378	35.164	2	2231.0077	2231.0077	R	C	360	381
PSM	TIGGGDDSFNTFFSETGAGK	20	sp|P68363-2|TBA1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=10376	64.584	2	2006.8858	2006.8858	K	H	41	61
PSM	GLGVGFGSGGGSSSSVK	21	sp|P13647|K2C5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	17-UNIMOD:188	ms_run[2]:scan=4966	32.418	2	1444.7254	1444.7254	R	F	560	577
PSM	IISNASCTTNCLAPLAK	22	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	7-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=6383	40.892	2	1832.9125	1832.9125	K	V	104	121
PSM	MAPYQGPDAVPGALDYK	23	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:35,17-UNIMOD:188	ms_run[2]:scan=7094	44.899	2	1813.8652	1813.8652	R	S	883	900
PSM	MDEQAGPGVFFSNNHPGAGGAK	24	sp|O43815-2|STRN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:1,22-UNIMOD:188	ms_run[2]:scan=9118	56.893	2	2235.011	2235.0110	-	G	1	23
PSM	MDEQAGPGVFFSNNHPGAGGAK	25	sp|O43815-2|STRN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:1	ms_run[2]:scan=9133	56.985	2	2228.9909	2228.9909	-	G	1	23
PSM	QVPGGGGGGGSGGGGGSGGGGSGGGR	26	sp|Q9UHB9-4|SRP68_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	26-UNIMOD:267	ms_run[2]:scan=494	6.4538	2	1852.8036	1852.8036	K	G	6	32
PSM	GCITIIGGGDTATCCAK	27	sp|P00558|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	2-UNIMOD:4,14-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=5783	37.483293333333336	2	1754.780622	1753.779726	R	W	366	383
PSM	EGNVPNIIIAGPPGTGK	28	sp|P35250-2|RFC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=7837	49.178	2	1632.8835	1632.8835	R	T	66	83
PSM	FVIGGPQGDAGLTGR	29	sp|P31153-2|METK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=7061	44.701	2	1443.747	1443.7470	R	K	187	202
PSM	GADFLVTEVENGGSLGSK	30	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	18-UNIMOD:188	ms_run[2]:scan=9901	61.653	2	1784.8888	1784.8888	K	K	189	207
PSM	GSLAEAVGSPPPAATPTPTPPTR	31	sp|Q9Y6I3-3|EPN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=6299	40.396	2	2171.1222	2171.1222	R	K	420	443
PSM	IQVSSEKEAAPDAGAEPITADSDPAYSSK	32	sp|Q8N163-2|CCAR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=5412	35.359	3	2933.3778	2933.3778	R	V	281	310
PSM	NCEVPEEPEDEDLVHPTYEK	33	sp|Q14149|MORC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	2-UNIMOD:4	ms_run[2]:scan=6282	40.293	2	2428.0377	2428.0377	R	T	445	465
PSM	NMGGPYGGGNYGPGGSGGSGGYGGR	34	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=4756	31.314	3	2188.8981	2188.8981	R	S	314	339
PSM	TGSTSSKEDDYESDAATIVQK	35	sp|Q5T4S7-3|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	7-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=5368	35.108	2	2243.048	2243.0480	R	C	360	381
PSM	GFGDGYNGYGGGPGGGNFGGSPGYGGGR	36	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	28-UNIMOD:267	ms_run[1]:scan=7323	46.22697	2	2505.027656	2504.040532	R	G	239	267
PSM	AGDWQCPNPGCGNQNFAWR	37	sp|Q01844-2|EWS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=8069	50.509	2	2233.917	2233.9170	R	T	446	465
PSM	ALPAVQQNNLDEDLIR	38	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=8748	54.675	2	1807.9428	1807.9428	R	K	329	345
PSM	ALPAVQQNNLDEDLIR	39	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	16-UNIMOD:267	ms_run[2]:scan=8751	54.692	2	1817.9511	1817.9511	R	K	329	345
PSM	AVGTPGGGGGGAVPGISAMSR	40	sp|P48634-2|PRC2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=6451	41.26	2	1754.8734	1754.8734	K	G	1337	1358
PSM	FGGGNPELLTQMVSK	41	sp|P40939|ECHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=9384	58.514	2	1576.7919	1576.7919	R	G	611	626
PSM	FYAYNPLAGGLLTGK	42	sp|Q8NHP1|ARK74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=11531	71.751	2	1583.8348	1583.8348	R	Y	194	209
PSM	GADFLVTEVENGGSLGSK	43	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=9905	61.682	2	1778.8687	1778.8687	K	K	189	207
PSM	GILFVGSGVSGGEEGAR	44	sp|P52209-2|6PGD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	17-UNIMOD:267	ms_run[2]:scan=8027	50.283	2	1600.8085	1600.8085	K	Y	107	124
PSM	IQVSSEKEAAPDAGAEPITADSDPAYSSK	45	sp|Q8N163-2|CCAR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=5413	35.364	2	2933.3778	2933.3778	R	V	281	310
PSM	MGLAMGGGGGASFDR	46	sp|P52272-2|HNRPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:35	ms_run[2]:scan=5465	35.674	2	1398.602	1398.6020	R	A	568	583
PSM	MGLAMGGGGGASFDR	47	sp|P52272-2|HNRPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:35,15-UNIMOD:267	ms_run[2]:scan=5466	35.678	2	1408.6103	1408.6103	R	A	568	583
PSM	NMGGPYGGGNYGPGGSGGSGGYGGR	48	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	25-UNIMOD:267	ms_run[2]:scan=4752	31.288	3	2198.9063	2198.9063	R	S	314	339
PSM	RIADYEAASAVPGVAAEQPGVSPSGS	49	sp|Q9Y5J6|T10B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=7081	44.819	2	2485.2085	2485.2085	R	-	78	104
PSM	SYELPDGQVITIGNER	50	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	16-UNIMOD:267	ms_run[2]:scan=9608	59.869	2	1799.8929	1799.8929	K	F	239	255
PSM	TIGGGDDSFNTFFSETGAGK	51	sp|P68363-2|TBA1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	20-UNIMOD:188	ms_run[2]:scan=10374	64.572	2	2012.9059	2012.9059	K	H	41	61
PSM	QHPQPYIFPDSPGGTSYER	52	sp|Q9Y6M9|NDUB9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:28	ms_run[1]:scan=7984	50.029981666666664	2	2157.9696	2157.9751	R	Y	75	94
PSM	QKLNPADAPNPVVFVATK	53	sp|O94776|MTA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:28	ms_run[1]:scan=9686	60.34038833333333	2	1891.0171	1891.0198	R	D	594	612
PSM	AAGALLNGPPQFSTAPEIK	54	sp|O75175|CNOT3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=9116	56.881	2	1880.9996	1880.9996	K	A	517	536
PSM	AGDWQCPNPGCGNQNFAWR	55	sp|Q01844-2|EWS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:4,11-UNIMOD:4,19-UNIMOD:267	ms_run[2]:scan=8078	50.56	2	2243.9253	2243.9253	R	T	446	465
PSM	APVPASELLASGVLSR	56	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=10265	63.894	2	1565.8777	1565.8777	R	A	3447	3463
PSM	DGEDQTQDTELVETRPAGDGTFQK	57	sp|P10321-2|HLAC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=5595	36.398	2	2636.1838	2636.1838	R	W	244	268
PSM	EGNPEEDLTADKANAQAAALYK	58	sp|P40121-2|CAPG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=6727	42.839	2	2318.1026	2318.1026	K	V	217	239
PSM	FSLVGIGGQDLNEGNR	59	sp|P13796|PLSL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=9194	57.357	2	1674.8325	1674.8325	K	T	473	489
PSM	GFIGPGIDVPAPDMSTGER	60	sp|P00367|DHE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	19-UNIMOD:267	ms_run[2]:scan=9849	61.33	2	1924.9228	1924.9228	K	E	213	232
PSM	MMADEALGSGLVSR	61	sp|Q13011|ECH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:35	ms_run[2]:scan=6651	42.408	2	1451.6748	1451.6749	K	V	232	246
PSM	QSSATSSFGGLGGGSVR	62	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	17-UNIMOD:267	ms_run[2]:scan=5476	35.736	2	1563.7517	1563.7517	R	F	8	25
PSM	QSSATSSFGGLGGGSVR	63	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=5477	35.742	2	1553.7434	1553.7434	R	F	8	25
PSM	TADSEVNTDQDIEKNLDK	64	sp|Q8ND24-2|RN214_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=4795	31.536	2	2033.9389	2033.9389	K	M	56	74
PSM	GCITIIGGGDTATCCAK	65	sp|P00558-2|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:4,14-UNIMOD:4,15-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=5786	37.5	2	1759.7999	1759.7999	R	W	338	355
PSM	GNDTPLALESTNTEKETSLEETK	66	sp|Q7Z6Z7-2|HUWE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=6366	40.791	2	2506.1922	2506.1922	K	I	1719	1742
PSM	GNDTPLALESTNTEKETSLEETK	67	sp|Q7Z6Z7-2|HUWE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:188,23-UNIMOD:188	ms_run[2]:scan=6378	40.86	2	2518.2325	2518.2325	K	I	1719	1742
PSM	IGNTGGMLDNILASK	68	sp|P53396|ACLY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:188	ms_run[2]:scan=9945	61.925	2	1508.7964	1508.7964	K	L	636	651
PSM	IISNASCTTNCLAPLAK	69	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:4,11-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=6374	40.838	2	1838.9326	1838.9326	K	V	104	121
PSM	ILDVGCGGGLLTEPLGR	70	sp|Q9NZJ6|COQ3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:4	ms_run[2]:scan=10503	65.373	2	1725.9084	1725.9084	K	L	150	167
PSM	LANRAPEPTPQQVAQQQ	71	sp|Q14839|CHD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=3500	24.41	2	1874.9599	1874.9599	R	-	1896	1913
PSM	LEQPDPGAVAAAAILR	72	sp|Q3LXA3|TKFC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	16-UNIMOD:267	ms_run[2]:scan=10016	62.361	2	1600.8812	1600.8812	R	A	552	568
PSM	MNPIVVVHGGGAGPISK	73	sp|Q7L266|ASGL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:1	ms_run[2]:scan=8822	55.121	2	1673.8923	1673.8923	-	D	1	18
PSM	STLYVSPHPDAFPSLR	74	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:1,16-UNIMOD:267	ms_run[2]:scan=9890	61.586	2	1837.9238	1837.9238	M	A	2	18
PSM	STNGDTFLGGEDFDQALLR	75	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=11328	70.438	2	2054.9545	2054.9545	K	H	266	285
PSM	TPPLLENSLPQCYQR	76	sp|Q8NEW0|ZNT7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	12-UNIMOD:4	ms_run[2]:scan=8157	50.982	2	1814.8985	1814.8985	R	V	297	312
PSM	TSGETTQTHTEPTGDSK	77	sp|P46013-2|KI67_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	17-UNIMOD:188	ms_run[2]:scan=495	6.4598	2	1781.8011	1781.8011	R	S	2144	2161
PSM	VNQIGSVTESLQACK	78	sp|P06733-2|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:4	ms_run[2]:scan=6492	41.5	2	1632.8141	1632.8141	K	L	251	266
PSM	APVPASELLASGVLSR	79	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	16-UNIMOD:267	ms_run[2]:scan=10203	63.51	2	1575.886	1575.8860	R	A	3447	3463
PSM	DDTIYEDEDVKEAIR	80	sp|P14927|QCR7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=6232	40.007	2	1809.8269	1809.8269	R	R	35	50
PSM	EGNVPNIIIAGPPGTGK	81	sp|P35250-2|RFC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	17-UNIMOD:188	ms_run[2]:scan=7824	49.099	2	1638.9036	1638.9036	R	T	66	83
PSM	FAAATGATPIAGR	82	sp|P08865|RSSA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=3942	26.83	2	1202.6408	1202.6408	K	F	90	103
PSM	ILPTLEAVAALGNK	83	sp|Q12905|ILF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	14-UNIMOD:188	ms_run[2]:scan=11175	69.493	2	1414.8491	1414.8491	K	V	128	142
PSM	ISNPWQSPSGTLPALR	84	sp|Q13505-3|MTX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=9674	60.269	2	1722.9053	1722.9053	K	T	42	58
PSM	LCPQFLQLASANTAR	85	sp|O95630|STABP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	2-UNIMOD:4	ms_run[2]:scan=9437	58.832	2	1688.8668	1688.8668	R	G	263	278
PSM	LDAGGNPASGLPMVR	86	sp|Q5VV41|ARHGG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	15-UNIMOD:267	ms_run[2]:scan=7125	45.075	2	1463.743	1463.7430	R	G	25	40
PSM	LEAIEDDSVKETDSSSASAATPSK	87	sp|P54578-2|UBP14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	10-UNIMOD:188,24-UNIMOD:188	ms_run[2]:scan=4024	27.272	2	2449.1746	2449.1746	K	K	180	204
PSM	QGGLGPMNIPLVSDPK	88	sp|Q06830|PRDX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=10023	62.406	2	1621.8498	1621.8498	K	R	94	110
PSM	TPEELFHPLGADSQV	89	sp|P11166|GTR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=9528	59.385	2	1638.789	1638.7890	K	-	478	493
PSM	TPGNPATAVSGTPAPPAR	90	sp|Q9Y2T7|YBOX2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	18-UNIMOD:267	ms_run[2]:scan=3914	26.68	2	1670.8616	1670.8616	R	S	65	83
PSM	VCTLAIIDPGDSDIIR	91	sp|P62888|RL30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	2-UNIMOD:4	ms_run[2]:scan=10553	65.688	2	1756.9029	1756.9029	R	S	91	107
PSM	VVPSFLPVDQGGSLVGR	92	sp|Q14126|DSG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	17-UNIMOD:267	ms_run[2]:scan=10405	64.766	2	1735.9496	1735.9496	K	N	668	685
PSM	YTDQGGEEEEDYESEEQLQHR	93	sp|O75208-2|COQ9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=4269	28.647	2	2570.0317	2570.0317	R	I	82	103
PSM	QKLNPADAPNPVVFVATK	94	sp|O94776|MTA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:28,2-UNIMOD:188,18-UNIMOD:188	ms_run[1]:scan=9709	60.48451	2	1903.0570	1903.0601	R	D	594	612
PSM	ALIAGGGAPEIELALR	95	sp|P50991-2|TCPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	16-UNIMOD:267	ms_run[2]:scan=10718	66.711	2	1559.8911	1559.8911	R	L	390	406
PSM	AQPAQPADEPAEKADEPMEH	96	sp|P25786|PSA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:188	ms_run[2]:scan=2668	19.692	2	2165.9631	2165.9631	K	-	244	264
PSM	ATSATSPHAPGFPAEGR	97	sp|Q9NUP7-2|TRM13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:1,17-UNIMOD:267	ms_run[2]:scan=5382	35.186	2	1704.8095	1704.8095	M	C	2	19
PSM	DDDKNNDGYIDYAEFAK	98	sp|Q8NI22-2|MCFD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=7698	48.35	2	1991.8385	1991.8385	R	S	75	92
PSM	DSSTSYTETKDPSSGQEVATPPVPQLQVCEPK	99	sp|Q9UKV3-5|ACINU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	29-UNIMOD:4	ms_run[2]:scan=7797	48.941	3	3461.6144	3461.6144	R	E	663	695
PSM	FCNPGFPIGCYITDK	100	sp|Q99805|TM9S2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=10600	65.986	2	1787.8011	1787.8011	R	G	173	188
PSM	FYAYNPLAGGLLTGK	101	sp|Q8NHP1|ARK74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:188	ms_run[2]:scan=11532	71.757	2	1589.8549	1589.8549	R	Y	194	209
PSM	GFIGPGIDVPAPDMSTGER	102	sp|P00367|DHE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	14-UNIMOD:35,19-UNIMOD:267	ms_run[2]:scan=8755	54.719	2	1940.9177	1940.9177	K	E	213	232
PSM	LGGGLGVAGGNSTR	103	sp|Q9NPJ6|MED4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	14-UNIMOD:267	ms_run[2]:scan=3109	22.224	2	1224.645	1224.6450	R	E	14	28
PSM	LVVPATQCGSLIGK	104	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	8-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=6934	44	2	1447.8164	1447.8164	R	G	102	116
PSM	MAPYQGPDAVPGALDYK	105	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:35	ms_run[2]:scan=7100	44.932	2	1807.8451	1807.8451	R	S	883	900
PSM	MENQVLTPHVYWAQR	106	sp|Q9P035-2|HACD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=8892	55.538	2	1928.9203	1928.9203	-	H	1	16
PSM	MENQVLTPHVYWAQR	107	sp|Q9P035-2|HACD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:1	ms_run[2]:scan=10134	63.078	2	1912.9254	1912.9254	-	H	1	16
PSM	MFVLDEADEMLSR	108	sp|P60842|IF4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:35,13-UNIMOD:267	ms_run[2]:scan=10539	65.595	2	1580.709	1580.7090	K	G	178	191
PSM	MFVLDEADEMLSR	109	sp|P60842|IF4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:35	ms_run[2]:scan=10544	65.629	2	1570.7007	1570.7007	K	G	178	191
PSM	MHGGGPPSGDSACPLR	110	sp|P24928|RPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:1,13-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=4217	28.369	2	1646.7169	1646.7169	-	T	1	17
PSM	MLNGLEDSIGLSK	111	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:35,13-UNIMOD:188	ms_run[2]:scan=7474	47.074	2	1397.7168	1397.7168	K	M	1164	1177
PSM	MQGQEAVLAMSSR	112	sp|Q15393|SF3B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:35	ms_run[2]:scan=4657	30.811	2	1422.6595	1422.6595	R	S	706	719
PSM	NEDEEEEEEEKDEAEDLLGR	113	sp|Q9Y5B9|SP16H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=7784	48.864	2	2405.983	2405.9830	K	G	434	454
PSM	PLFTANPFEQDVEK	114	sp|O75886-2|STAM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=10251	63.802	2	1633.7988	1633.7988	M	A	2	16
PSM	SETAPAAPAAPAPAEKTPVK	115	sp|P10412|H14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:1	ms_run[2]:scan=4009	27.191	2	1945.0157	1945.0157	M	K	2	22
PSM	SLEQNIQLPAALLSR	116	sp|P33993-3|MCM7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=11221	69.775	2	1651.9257	1651.9257	R	F	324	339
PSM	TEGDEEAEEEQEENLEASGDYKYSGR	117	sp|P12956|XRCC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=5619	36.535	3	2963.2064	2963.2064	K	D	10	36
PSM	TPPLLENSLPQCYQR	118	sp|Q8NEW0|ZNT7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	12-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=8156	50.976	2	1824.9068	1824.9068	R	V	297	312
PSM	TSGVPSGFNFTAPPVLGK	119	sp|P35658-2|NU214_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	18-UNIMOD:188	ms_run[2]:scan=10438	64.977	2	1780.9455	1780.9455	K	H	1354	1372
PSM	TSGVPSGFNFTAPPVLGK	120	sp|P35658-2|NU214_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=10440	64.988	2	1774.9254	1774.9254	K	H	1354	1372
PSM	VLQATVVAVGSGSK	121	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	14-UNIMOD:188	ms_run[2]:scan=4803	31.581	2	1320.7708	1320.7708	K	G	41	55
PSM	DQTEATQEKYVLEEAQR	122	sp|Q9BZF1|OSBL8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=5918	38.217528333333334	2	2036.965923	2036.965078	K	Q	698	715
PSM	AAELTATQVEEEEEEEDFRK	123	sp|O75717-2|WDHD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=6468	41.36	2	2352.0605	2352.0605	K	K	697	717
PSM	ACANPAAGSVILLENLR	124	sp|P00558-2|PGK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:4	ms_run[2]:scan=11398	70.875	2	1767.9302	1767.9302	K	F	79	96
PSM	AITGASLADIMAK	125	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:188	ms_run[2]:scan=9250	57.696	2	1266.6949	1266.6949	R	R	81	94
PSM	ALEEPGPAADPTAFQGPWAR	126	sp|Q86Y56|DAAF5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	20-UNIMOD:267	ms_run[2]:scan=9666	60.219	2	2090.0097	2090.0097	R	L	56	76
PSM	ALGEPITLFGEGPAER	127	sp|O43172-2|PRP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	16-UNIMOD:267	ms_run[2]:scan=10486	65.271	2	1665.8602	1665.8602	R	R	113	129
PSM	AQFAQPEILIGTIPGAGGTQR	128	sp|P30084|ECHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=10733	66.807	3	2124.1328	2124.1328	K	L	158	179
PSM	ATSATSPHAPGFPAEGR	129	sp|Q9NUP7-2|TRM13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:1,17-UNIMOD:267	ms_run[2]:scan=5389	35.227	2	1704.8095	1704.8095	M	C	2	19
PSM	AVFVDLEPTVIDEVR	130	sp|P68363-2|TBA1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	15-UNIMOD:267	ms_run[2]:scan=11390	70.826	2	1710.9068	1710.9068	R	T	65	80
PSM	AVGTPGGGGGGAVPGISAMSR	131	sp|P48634-2|PRC2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	21-UNIMOD:267	ms_run[2]:scan=6495	41.517	2	1764.8816	1764.8816	K	G	1337	1358
PSM	DADDAVYELDGKELCSER	132	sp|Q13243-2|SRSF5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	15-UNIMOD:4	ms_run[2]:scan=7236	45.721	2	2083.9004	2083.9004	R	V	49	67
PSM	DGKLVSESSDVLPK	133	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=5701	37.005	2	1472.7722	1472.7722	R	-	470	484
PSM	FGGGNPELLTQMVSK	134	sp|P40939|ECHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	15-UNIMOD:188	ms_run[2]:scan=9383	58.509	2	1582.8121	1582.8121	R	G	611	626
PSM	FVIGGPQGDAGLTGR	135	sp|P31153-2|METK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	15-UNIMOD:267	ms_run[2]:scan=7059	44.69	2	1453.7553	1453.7553	R	K	187	202
PSM	GILIPLCESGTCTLR	136	sp|Q13895|BYST_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	7-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=9824	61.181	2	1688.859	1688.8590	K	E	289	304
PSM	GVGSPEPGPTAPYLGR	137	sp|Q9C0B5-2|ZDHC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	16-UNIMOD:267	ms_run[2]:scan=6020	38.794	2	1563.7921	1563.7921	R	S	565	581
PSM	ICDQWDNLGALTQK	138	sp|P12814-2|ACTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=9181	57.276	2	1666.808	1666.8080	K	R	479	493
PSM	IGGNEGIDVPIPR	139	sp|Q96AE4|FUBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:267	ms_run[2]:scan=7541	47.427	2	1345.7229	1345.7229	R	F	272	285
PSM	IGGNEGIDVPIPR	140	sp|Q96AE4|FUBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7549	47.47	2	1335.7147	1335.7147	R	F	272	285
PSM	ILTPLVSLDTPGK	141	sp|Q9HC38-2|GLOD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9563	59.596	2	1352.7915	1352.7915	K	A	225	238
PSM	IPGGIIEDSCVLR	142	sp|P49368-2|TCPG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	10-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=8430	52.729	2	1437.7525	1437.7525	K	G	166	179
PSM	LEQPDPGAVAAAAILR	143	sp|Q3LXA3|TKFC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=10002	62.272	2	1590.873	1590.8730	R	A	552	568
PSM	LFSVPDFVGDACK	144	sp|Q14764|MVP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	12-UNIMOD:4	ms_run[2]:scan=10762	66.981	2	1453.6912	1453.6912	K	A	561	574
PSM	LGLPPLTPEQQEALQK	145	sp|Q9UHX1-4|PUF60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=8542	53.434	2	1760.9672	1760.9672	K	A	11	27
PSM	LLDTIGISQPQWR	146	sp|P27708|PYR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:267	ms_run[2]:scan=9520	59.337	2	1535.8335	1535.8335	R	E	1054	1067
PSM	LSTSQDAACKDAEECPETAEAK	147	sp|Q5H9R7-3|PP6R3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	9-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=2855	20.786	2	2410.0264	2410.0264	K	C	742	764
PSM	MFVLDEADEMLSR	148	sp|P60842|IF4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:35,10-UNIMOD:35,13-UNIMOD:267	ms_run[2]:scan=7936	49.747	2	1596.7039	1596.7039	K	G	178	191
PSM	NFINNPLAQADWAAK	149	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=10454	65.079	2	1671.8369	1671.8369	K	K	15	30
PSM	NIYVLQELDNPGAK	150	sp|P12956|XRCC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:188	ms_run[2]:scan=9757	60.772	2	1578.8349	1578.8349	K	R	101	115
PSM	PLFTANPFEQDVEK	151	sp|O75886-2|STAM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:188	ms_run[2]:scan=10244	63.758	2	1639.8189	1639.8189	M	A	2	16
PSM	SAPAGASEPPPPGGVGLGIR	152	sp|Q8IWZ3-5|ANKH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	20-UNIMOD:267	ms_run[2]:scan=6342	40.649	2	1795.9456	1795.9456	R	T	23	43
PSM	SETAPAAPAAAPPAEKAPVK	153	sp|P16403|H12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:1	ms_run[2]:scan=3907	26.64	2	1915.0051	1915.0051	M	K	2	22
PSM	SQAPGQPGASQWGSR	154	sp|Q96EP5-2|DAZP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	15-UNIMOD:267	ms_run[2]:scan=2808	20.493	2	1522.7152	1522.7152	K	V	195	210
PSM	SQDAQLVLLNMPGPPK	155	sp|Q9Y666|S12A7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9971	62.083	2	1706.9025	1706.9025	K	N	1031	1047
PSM	STLYVSPHPDAFPSLR	156	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:1	ms_run[2]:scan=9882	61.536	2	1827.9155	1827.9155	M	A	2	18
PSM	TALALAIAQELGSK	157	sp|Q9Y265|RUVB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=11733	73.102	2	1384.7926	1384.7926	K	V	77	91
PSM	TFVPGCQPGEFTLGNIK	158	sp|P80188-2|NGAL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=9799	61.027	2	1869.939	1869.9390	R	S	102	119
PSM	VEEEEEEKVAEEEETSVK	159	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=5109	33.361	3	2120.9485	2120.9485	K	K	468	486
PSM	VIVVGNPANTNCLTASK	160	sp|P40925-2|MDHC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	12-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=6164	39.611	2	1762.9343	1762.9343	K	S	37	54
PSM	VLGVPIIVQASQAEK	161	sp|Q14498-3|RBM39_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9592	59.769	2	1550.9032	1550.9032	R	N	196	211
PSM	VLTGNTIALVLGGGGAR	162	sp|Q8IY17-5|PLPL6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=11006	68.464	2	1567.9046	1567.9046	R	G	898	915
PSM	MGLAMGGGGGASFDR	163	sp|P52272|HNRPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	1-UNIMOD:35,5-UNIMOD:35	ms_run[1]:scan=3284	23.187260000000002	2	1414.595170	1414.596935	R	A	607	622
PSM	VNQIGSVTESLQACK	164	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	14-UNIMOD:4,15-UNIMOD:188	ms_run[1]:scan=6491	41.49406833333334	2	1638.834767	1638.834250	K	L	344	359
PSM	GGGPAGAGGEAPAALR	165	sp|Q5RKV6|EXOS6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=3234	22.904851666666666	2	1307.658205	1307.658212	R	G	78	94
PSM	QAPAPTVIRDPPSITPAVK	166	sp|Q13112|CAF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:28,9-UNIMOD:267,19-UNIMOD:188	ms_run[1]:scan=7887	49.465565000000005	2	1956.0934	1956.1010	R	S	439	458
PSM	VLCIINPGNPTGQVQSR	167	sp|Q8TD30|ALAT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	3-UNIMOD:4	ms_run[1]:scan=7389	46.59023166666667	2	1851.973176	1851.962516	K	K	263	280
PSM	LVDPVAGSGGPGSR	168	sp|O95400|CD2B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	14-UNIMOD:267	ms_run[1]:scan=3770	25.9027	2	1277.660063	1277.660333	K	F	27	41
PSM	QGAPTSFLPPEASQLKPDR	169	sp|Q9BUJ2|HNRL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:28	ms_run[1]:scan=9322	58.137834999999995	2	2021.0186	2021.0213	K	Q	147	166
PSM	AAEDDEDDDVDTKK	170	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=714	7.7928	2	1564.6377	1564.6377	R	Q	90	104
PSM	AAEDDEDDDVDTKK	171	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=778	8.1722	2	1564.6377	1564.6377	R	Q	90	104
PSM	AAGALLNGPPQFSTAPEIK	172	sp|O75175|CNOT3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	19-UNIMOD:188	ms_run[2]:scan=9117	56.887	2	1887.0197	1887.0197	K	A	517	536
PSM	AFLASGPYLTHQQK	173	sp|Q9Y6M9|NDUB9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:1	ms_run[2]:scan=9699	60.424	2	1601.8202	1601.8202	M	V	2	16
PSM	AFLASGPYLTHQQK	174	sp|Q9Y6M9|NDUB9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:1,14-UNIMOD:188	ms_run[2]:scan=9700	60.429	2	1607.8403	1607.8403	M	V	2	16
PSM	ALEEPGPAADPTAFQGPWAR	175	sp|Q86Y56|DAAF5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9667	60.225	2	2080.0014	2080.0014	R	L	56	76
PSM	AQFAQPEILIGTIPGAGGTQR	176	sp|P30084|ECHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	21-UNIMOD:267	ms_run[2]:scan=10729	66.778	2	2134.141	2134.1410	K	L	158	179
PSM	DADDAVYELDGKELCSER	177	sp|Q13243-2|SRSF5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:4	ms_run[2]:scan=7233	45.705	3	2083.9004	2083.9004	R	V	49	67
PSM	DDDKNNDGYIDYAEFAK	178	sp|Q8NI22-2|MCFD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	4-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=7717	48.463	2	2003.8787	2003.8787	R	S	75	92
PSM	DDSGSGSKTEQSVALLEQK	179	sp|Q9UPN3|MACF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=5448	35.57	2	1977.9491	1977.9491	R	W	6404	6423
PSM	FNMANALASATCER	180	sp|P0CW20|LIMS4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	12-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=9170	57.211	2	1564.7002	1564.7002	K	C	61	75
PSM	GAAGGAEQPGPGGR	181	sp|Q99447|PCY2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=668	7.5036	2	1180.5585	1180.5585	R	R	7	21
PSM	GILIPLCESGTCTLR	182	sp|Q13895|BYST_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:4,12-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=9816	61.132	2	1698.8672	1698.8672	K	E	289	304
PSM	GQPLGPAGVQVSLR	183	sp|Q5JPE7-2|NOMO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:267	ms_run[2]:scan=7114	45.011	2	1387.7811	1387.7811	K	N	139	153
PSM	IFANTPDSGCVLGMR	184	sp|P08237-2|PFKAM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	10-UNIMOD:4	ms_run[2]:scan=7976	49.982	2	1636.7701	1636.7701	R	K	669	684
PSM	ILTPLVSLDTPGK	185	sp|Q9HC38-2|GLOD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	13-UNIMOD:188	ms_run[2]:scan=9564	59.601	2	1358.8116	1358.8116	K	A	225	238
PSM	IPTPLNTSGVQVICMK	186	sp|Q96CW1-2|AP2M1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=9414	58.69	2	1762.9417	1762.9417	R	G	322	338
PSM	LCPQFLQLASANTAR	187	sp|O95630|STABP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=9425	58.755	2	1698.8751	1698.8751	R	G	263	278
PSM	LGLPPLTPEQQEALQK	188	sp|Q9UHX1-4|PUF60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=8719	54.503	2	1760.9672	1760.9672	K	A	11	27
PSM	LSTSQDAACKDAEECPETAEAK	189	sp|Q5H9R7-3|PP6R3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	9-UNIMOD:4,10-UNIMOD:188,15-UNIMOD:4,22-UNIMOD:188	ms_run[2]:scan=2852	20.765	2	2422.0667	2422.0667	K	C	742	764
PSM	LVPTGLDFGQEGFTR	190	sp|P46087-3|NOP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:267	ms_run[2]:scan=9836	61.253	2	1645.8339	1645.8339	R	F	535	550
PSM	LVVPATQCGSLIGK	191	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	8-UNIMOD:4	ms_run[2]:scan=6935	44.005	2	1441.7963	1441.7963	R	G	102	116
PSM	MGGGSIEVSVPR	192	sp|Q96I24-2|FUBP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:35,12-UNIMOD:267	ms_run[2]:scan=4783	31.469	2	1213.6	1213.6000	R	F	191	203
PSM	MLNGLEDSIGLSK	193	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:35	ms_run[2]:scan=7464	47.02	2	1391.6966	1391.6966	K	M	1164	1177
PSM	MNPGDLQWMTAGR	194	sp|O00625|PIR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:35	ms_run[2]:scan=7876	49.401	2	1491.6599	1491.6599	K	G	85	98
PSM	MVVPGLDGAQIPR	195	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=8872	55.419	2	1351.7282	1351.7282	K	D	1159	1172
PSM	MYAPAWVAPEALQK	196	sp|Q13418-3|ILK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:35	ms_run[2]:scan=8650	54.089	2	1589.7912	1589.7912	R	K	216	230
PSM	NCEVPEEPEDEDLVHPTYEK	197	sp|Q14149|MORC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:4,20-UNIMOD:188	ms_run[2]:scan=6279	40.276	2	2434.0578	2434.0578	R	T	445	465
PSM	NIYVLQELDNPGAK	198	sp|P12956|XRCC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9766	60.826	2	1572.8148	1572.8148	K	R	101	115
PSM	QIGENLIVPGGVK	199	sp|Q16555-2|DPYL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7454	46.965	2	1322.7558	1322.7558	K	T	8	21
PSM	RAEEFLTASQEAL	200	sp|Q14738-3|2A5D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7885	49.455	2	1463.7256	1463.7256	K	-	484	497
PSM	SLEQNIQLPAALLSR	201	sp|P33993-3|MCM7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:267	ms_run[2]:scan=11226	69.808	2	1661.934	1661.9340	R	F	324	339
PSM	TFDTFCPLGPALVTK	202	sp|Q96GK7|FAH2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:4	ms_run[2]:scan=10760	66.969	2	1665.8436	1665.8436	K	D	210	225
PSM	VLGTAFDPFLGGK	203	sp|Q92598-4|HS105_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	13-UNIMOD:188	ms_run[2]:scan=11056	68.772	2	1326.7279	1326.7279	K	N	224	237
PSM	VLGVPIIVQASQAEK	204	sp|Q14498-3|RBM39_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:188	ms_run[2]:scan=9591	59.764	2	1556.9233	1556.9233	R	N	196	211
PSM	VLVTGATGLLGR	205	sp|Q9NZL9-5|MAT2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7817	49.057	2	1155.6976	1155.6976	R	A	21	33
PSM	VLVTGATGLLGR	206	sp|Q9NZL9-5|MAT2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	12-UNIMOD:267	ms_run[2]:scan=7820	49.078	2	1165.7058	1165.7058	R	A	21	33
PSM	VMIPVPAGVEDGQTVR	207	sp|Q96EY1-3|DNJA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	16-UNIMOD:267	ms_run[2]:scan=8075	50.544	2	1676.8795	1676.8795	R	M	151	167
PSM	VPLWLQSSEDMEK	208	sp|Q9H4L5-8|OSBL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9343	58.265	2	1560.7494	1560.7494	R	C	209	222
PSM	VPPSLLCEINTNAR	209	sp|Q9NWT1|PK1IP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=8697	54.366	2	1592.822	1592.8220	K	L	282	296
PSM	YLGINSDGLVVGR	210	sp|Q14331|FRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	13-UNIMOD:267	ms_run[2]:scan=8915	55.68	2	1371.7386	1371.7386	K	S	116	129
PSM	GGGPAGAGGEAPAALR	211	sp|Q5RKV6|EXOS6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	16-UNIMOD:267	ms_run[1]:scan=3183	22.627841666666665	2	1317.666212	1317.666481	R	G	78	94
PSM	LVDPVAGSGGPGSR	212	sp|O95400|CD2B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=3752	25.800735	2	1267.651599	1267.652064	K	F	27	41
PSM	FTQAGSEVSALLGR	213	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	14-UNIMOD:267	ms_run[1]:scan=9165	57.17737333333333	2	1444.758982	1444.754962	R	I	311	325
PSM	AAEDDEDDDVDTKK	214	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=755	8.0406	2	1576.6779	1576.6779	R	Q	90	104
PSM	AGGEAGVTLGQPHLSR	215	sp|P41091|IF2G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:1	ms_run[2]:scan=6050	38.973	2	1590.8114	1590.8114	M	Q	2	18
PSM	AITGASLADIMAK	216	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9257	57.741	2	1260.6748	1260.6748	R	R	81	94
PSM	AMGIMNSFVNDIFER	217	sp|O60814|H2B1K_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:35,5-UNIMOD:35,15-UNIMOD:267	ms_run[2]:scan=11206	69.684	2	1784.8101	1784.8101	K	I	59	74
PSM	ATSATSPHAPGFPAEGR	218	sp|Q9NUP7-2|TRM13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:1	ms_run[2]:scan=5357	35.039	2	1694.8012	1694.8012	M	C	2	19
PSM	CIPALDSLTPANEDQK	219	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=8023	50.255	2	1776.8659	1776.8659	R	I	447	463
PSM	CPNPTCENMNFSWR	220	sp|P35637-2|FUS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:4,6-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=7925	49.678	2	1821.7261	1821.7261	K	N	427	441
PSM	DAGTIAGLNVLR	221	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:267	ms_run[2]:scan=8885	55.496	2	1208.6753	1208.6753	K	I	160	172
PSM	EGNPEEDLTADKANAQAAALYK	222	sp|P40121-2|CAPG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:188,22-UNIMOD:188	ms_run[2]:scan=6728	42.845	2	2330.1429	2330.1429	K	V	217	239
PSM	EGSGNPTPLINPLAGR	223	sp|Q9NZN8-2|CNOT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8131	50.853	2	1591.8318	1591.8318	R	A	65	81
PSM	FLAVGLVDNTVR	224	sp|Q15393|SF3B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:267	ms_run[2]:scan=9299	57.995	2	1312.7379	1312.7379	R	I	604	616
PSM	FQDGDLTLYQSNTILR	225	sp|P09211|GSTP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9804	61.056	2	1882.9425	1882.9425	K	H	56	72
PSM	FTQAGSEVSALLGR	226	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9163	57.166	2	1434.7467	1434.7467	R	I	311	325
PSM	FVAFSGEGQSLR	227	sp|Q92890-1|UFD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:267	ms_run[2]:scan=6681	42.583	2	1306.6545	1306.6545	R	K	326	338
PSM	FVAFSGEGQSLR	228	sp|Q92890-1|UFD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6682	42.588	2	1296.6463	1296.6463	R	K	326	338
PSM	FVFSLVDAMNGK	229	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	9-UNIMOD:35	ms_run[2]:scan=9708	60.479	2	1342.6591	1342.6591	R	E	258	270
PSM	FVFSLVDAMNGK	230	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:188	ms_run[2]:scan=11700	72.88	2	1332.6843	1332.6843	R	E	258	270
PSM	GDPGDQTKAEGSSTASSGSQLAEGK	231	sp|Q9NZB2-4|F120A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=2415	18.273	2	2364.0677	2364.0677	R	G	495	520
PSM	GFGFVDFNSEEDAK	232	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:188	ms_run[2]:scan=9632	60.011	2	1566.6934	1566.6934	K	A	611	625
PSM	IFVNSNTDVAPFLR	233	sp|Q96GQ7|DDX27_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=10207	63.532	2	1591.8358	1591.8358	R	Q	423	437
PSM	ILQNLDPPFSIDGK	234	sp|P78332-2|RBM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=10007	62.306	2	1555.8246	1555.8246	K	M	196	210
PSM	INVYYNEATGGK	235	sp|P68371|TBB4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:188	ms_run[2]:scan=4626	30.634	2	1333.661	1333.6610	R	Y	47	59
PSM	IPGGIIEDSCVLR	236	sp|P49368-2|TCPG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	10-UNIMOD:4	ms_run[2]:scan=8271	51.706	2	1427.7442	1427.7443	K	G	166	179
PSM	IPTPLNTSGVQVICMK	237	sp|Q96CW1-2|AP2M1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:4	ms_run[2]:scan=9428	58.777	2	1756.9216	1756.9216	R	G	322	338
PSM	IQSAIACTNIFPLGR	238	sp|Q9NRL2-2|BAZ1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:4	ms_run[2]:scan=10227	63.652	2	1659.8767	1659.8767	K	D	761	776
PSM	ISNPWQSPSGTLPALR	239	sp|Q13505-3|MTX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	16-UNIMOD:267	ms_run[2]:scan=9675	60.275	2	1732.9136	1732.9136	K	T	42	58
PSM	LATGSDDNCAAFFEGPPFK	240	sp|O75083|WDR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	9-UNIMOD:4,19-UNIMOD:188	ms_run[2]:scan=10442	65	2	2048.9245	2048.9245	R	F	162	181
PSM	LATQLTGPVMPVR	241	sp|P26373|RL13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:267	ms_run[2]:scan=7346	46.36	2	1391.7834	1391.7834	K	N	146	159
PSM	LFEVGGSPANTR	242	sp|Q08209-5|PP2BA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:267	ms_run[2]:scan=4936	32.274	2	1256.6389	1256.6389	K	Y	34	46
PSM	LGAPLSGLQGLPECTR	243	sp|P50479|PDLI4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=8920	55.708	2	1677.8748	1677.8748	K	C	242	258
PSM	LGLPPLTPEQQEALQK	244	sp|Q9UHX1-4|PUF60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	16-UNIMOD:188	ms_run[2]:scan=8699	54.382	2	1766.9874	1766.9874	K	A	11	27
PSM	LISWYDNEFGYSNR	245	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=10198	63.476	2	1762.7951	1762.7951	K	V	268	282
PSM	LLAAGCGPGLLADAK	246	sp|Q9BSU1|CP070_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:4	ms_run[2]:scan=7853	49.267	2	1425.765	1425.7650	R	M	217	232
PSM	LLLGAGAVAYGVR	247	sp|Q99623-2|PHB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:267	ms_run[2]:scan=8839	55.222	2	1268.748	1268.7480	K	E	25	38
PSM	LQQPAVLQPLASCPR	248	sp|Q92696|PGTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:4	ms_run[2]:scan=7563	47.554	2	1676.9032	1676.9032	R	L	520	535
PSM	LTEQSNTPLLLPLAAR	249	sp|Q9NYL2-2|M3K20_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	16-UNIMOD:267	ms_run[2]:scan=10519	65.471	2	1745.9915	1745.9915	K	M	322	338
PSM	MFVLDEADEMLSR	250	sp|P60842|IF4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:35,10-UNIMOD:35	ms_run[2]:scan=7937	49.753	2	1586.6956	1586.6956	K	G	178	191
PSM	MGGGSIEVSVPR	251	sp|Q96I24-2|FUBP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:35	ms_run[2]:scan=4775	31.423	2	1203.5918	1203.5918	R	F	191	203
PSM	MLGQMTDQVADLR	252	sp|P18206|VINC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:35,13-UNIMOD:267	ms_run[2]:scan=6957	44.121	2	1502.7097	1502.7097	K	A	327	340
PSM	MQGQEAVLAMSSR	253	sp|Q15393|SF3B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:35,13-UNIMOD:267	ms_run[2]:scan=4652	30.78	2	1432.6678	1432.6678	R	S	706	719
PSM	MVVPGLDGAQIPR	254	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:35,13-UNIMOD:267	ms_run[2]:scan=7166	45.315	2	1377.7314	1377.7314	K	D	1159	1172
PSM	NLVAFVSQEAGNR	255	sp|Q9BT73|PSMG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9003	56.206	2	1403.7157	1403.7157	K	A	81	94
PSM	NVFSSSGTSFSGR	256	sp|P49790-2|NU153_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=5746	37.267	2	1331.6106	1331.6106	K	K	1411	1424
PSM	QFASQANVVGPWIQTK	257	sp|O43707|ACTN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	16-UNIMOD:188	ms_run[2]:scan=9100	56.785	2	1778.9411	1778.9411	R	M	653	669
PSM	QGGLGPMNIPLVSDPK	258	sp|Q06830|PRDX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	16-UNIMOD:188	ms_run[2]:scan=10022	62.4	2	1627.8699	1627.8699	K	R	94	110
PSM	SGGGVIRGPAGNNDCR	259	sp|Q07955-3|SRSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:1,15-UNIMOD:4	ms_run[2]:scan=2578	19.171	2	1627.7485	1627.7485	M	I	2	18
PSM	SPFEVQVGPEAGMQK	260	sp|O75369-6|FLNB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	15-UNIMOD:188	ms_run[2]:scan=7231	45.693	2	1608.7913	1608.7913	K	V	537	552
PSM	SPGADLLQVLTK	261	sp|Q3LXA3|TKFC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:188	ms_run[2]:scan=11193	69.601	2	1246.7228	1246.7228	K	A	511	523
PSM	SSVQEECVSTISSSKDEDPLAATR	262	sp|Q7L0Y3|TM10C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:4	ms_run[2]:scan=6432	41.156	2	2595.197	2595.1970	K	E	72	96
PSM	STNGDTFLGGEDFDQALLR	263	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	19-UNIMOD:267	ms_run[2]:scan=11329	70.444	2	2064.9628	2064.9628	K	H	266	285
PSM	SYELPDGQVITIGNER	264	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9556	59.553	2	1789.8846	1789.8846	K	F	239	255
PSM	TFDTFCPLGPALVTK	265	sp|Q96GK7|FAH2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=10751	66.915	2	1671.8638	1671.8638	K	D	210	225
PSM	TLMNLGGLAVAR	266	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9475	59.059	2	1214.6805	1214.6805	R	D	128	140
PSM	TLPGSDWTPNAQFITR	267	sp|P56192-2|SYMC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	16-UNIMOD:267	ms_run[2]:scan=9566	59.612	2	1812.9034	1812.9034	R	S	468	484
PSM	VCTLAIIDPGDSDIIR	268	sp|P62888|RL30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=10548	65.653	2	1766.9112	1766.9112	R	S	91	107
PSM	VEEEEEEKVAEEEETSVK	269	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	8-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=5110	33.367	3	2132.9887	2132.9887	K	K	468	486
PSM	VGGNIEVLGFNAR	270	sp|Q14839|CHD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:267	ms_run[2]:scan=8807	55.035	2	1354.7233	1354.7233	R	Q	1407	1420
PSM	VGVGTSFGLPQTR	271	sp|P50851-2|LRBA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7250	45.804	2	1317.7041	1317.7041	R	R	2172	2185
PSM	VLTGNTIALVLGGGGAR	272	sp|Q8IY17-5|PLPL6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	17-UNIMOD:267	ms_run[2]:scan=11005	68.459	2	1577.9129	1577.9129	R	G	898	915
PSM	VPPSLLCEINTNAR	273	sp|Q9NWT1|PK1IP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:4	ms_run[2]:scan=8696	54.36	2	1582.8137	1582.8137	K	L	282	296
PSM	CTVFHGAQVEDAFR	274	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=9387	58.53100833333334	2	1618.7179	1618.7193	K	Y	1828	1842
PSM	NSNLVGAAHEELQQSR	275	sp|P02545|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	16-UNIMOD:267	ms_run[1]:scan=6241	40.056691666666666	2	1762.846555	1761.863343	R	I	281	297
PSM	QATSTASTFVKPIFSR	276	sp|P56556|NDUA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:28	ms_run[1]:scan=9500	59.21456333333333	2	1722.8902	1722.8936	R	D	8	24
PSM	ADFSPFGNSQGPSR	277	sp|Q9H2M9|RBGPR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6537	41.764	2	1465.6586	1465.6586	K	V	447	461
PSM	AHAGGGSGGSGAGGPAGR	278	sp|O75182-3|SIN3B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:1,18-UNIMOD:267	ms_run[2]:scan=623	7.2351	2	1431.6479	1431.6479	M	G	2	20
PSM	ALGEPITLFGEGPAER	279	sp|O43172-2|PRP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10487	65.277	2	1655.8519	1655.8519	R	R	113	129
PSM	AQAVSEEEEEEEGKSSSPK	280	sp|Q9GZR7-2|DDX24_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=1265	11.035	2	2060.9425	2060.9425	K	K	78	97
PSM	AQLFALTGVQPAR	281	sp|P54578-2|UBP14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:267	ms_run[2]:scan=9019	56.306	2	1380.7753	1380.7753	K	Q	31	44
PSM	CALSSPSLAFTPPIK	282	sp|Q8NFH5-3|NUP35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:4	ms_run[2]:scan=9620	59.941	2	1587.8331	1587.8331	R	T	120	135
PSM	CEFQDAYVLLSEK	283	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=10413	64.817	2	1606.7644	1606.7644	K	K	237	250
PSM	DTSVEGSEMVPGKVELQEK	284	sp|P18754|RCC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6165	39.617	2	2060.9936	2060.9936	R	V	102	121
PSM	EGSGNPTPLINPLAGR	285	sp|Q9NZN8-2|CNOT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	16-UNIMOD:267	ms_run[2]:scan=8129	50.842	2	1601.8401	1601.8401	R	A	65	81
PSM	FGGSGSQVDSAR	286	sp|Q13200-2|PSMD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=1235	10.863	2	1166.5316	1166.5316	R	M	199	211
PSM	FLTGPLNLNDPDAK	287	sp|P86791|CCZ1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:188	ms_run[2]:scan=8996	56.169	2	1519.7978	1519.7978	R	C	282	296
PSM	FLTGPLNLNDPDAK	288	sp|P86791|CCZ1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8997	56.175	2	1513.7777	1513.7777	R	C	282	296
PSM	FVFSLVDAMNGK	289	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11701	72.885	2	1326.6642	1326.6642	R	E	258	270
PSM	GCDVVVIPAGVPR	290	sp|P40926|MDHM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:4	ms_run[2]:scan=7506	47.24	2	1337.7126	1337.7126	K	K	92	105
PSM	GFQEVVTPNIFNSR	291	sp|P26639|SYTC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9952	61.968	2	1606.8104	1606.8104	R	L	368	382
PSM	GIFGFTDSDCIGK	292	sp|P23381-2|SYWC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	10-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=9689	60.363	2	1421.6592	1421.6592	K	I	224	237
PSM	GIFGFTDSDCIGK	293	sp|P23381-2|SYWC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	10-UNIMOD:4	ms_run[2]:scan=9691	60.373	2	1415.6391	1415.6391	K	I	224	237
PSM	GPVFAPPYEPLPENVK	294	sp|P11387|TOP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9272	57.829	2	1752.9087	1752.9087	K	F	224	240
PSM	GVGQADWTPDLGLR	295	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:267	ms_run[2]:scan=9266	57.796	2	1493.7502	1493.7502	R	N	1275	1289
PSM	IFVNSNTDVAPFLR	296	sp|Q96GQ7|DDX27_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:267	ms_run[2]:scan=10206	63.526	2	1601.8441	1601.8441	R	Q	423	437
PSM	IGNLQTDLSDGLR	297	sp|O75369-6|FLNB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:267	ms_run[2]:scan=7938	49.759	2	1410.7342	1410.7342	R	L	37	50
PSM	IPGGIIEDSCVLR	298	sp|P49368-2|TCPG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	10-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=8270	51.7	2	1437.7525	1437.7525	K	G	166	179
PSM	IPGGIIEDSCVLR	299	sp|P49368-2|TCPG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	10-UNIMOD:4	ms_run[2]:scan=8429	52.723	2	1427.7442	1427.7443	K	G	166	179
PSM	IQIEAIPLALQGR	300	sp|Q9H0S4-2|DDX47_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:267	ms_run[2]:scan=10625	66.145	2	1430.8485	1430.8485	K	D	50	63
PSM	ISVYYNEATGGK	301	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=4605	30.519	2	1300.6299	1300.6299	R	Y	47	59
PSM	LAGTQPLEVLEAVQR	302	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	15-UNIMOD:267	ms_run[2]:scan=10690	66.541	2	1632.9074	1632.9074	R	S	639	654
PSM	LATGSDDNCAAFFEGPPFK	303	sp|O75083|WDR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:4	ms_run[2]:scan=10360	64.481	2	2042.9044	2042.9044	R	F	162	181
PSM	LEGLTDEINFLR	304	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11279	70.136	2	1418.7405	1418.7405	R	Q	214	226
PSM	LISWYDNEFGYSNR	305	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:267	ms_run[2]:scan=10196	63.465	2	1772.8034	1772.8034	K	V	268	282
PSM	LLDTIGISQPQWR	306	sp|P27708|PYR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9521	59.342	2	1525.8253	1525.8253	R	E	1054	1067
PSM	LLGSSFSSGPVADGIIR	307	sp|O43597|SPY2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9811	61.099	2	1674.8941	1674.8941	R	V	135	152
PSM	LMMLQSCSGPTCR	308	sp|P15586-2|GNS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=5929	38.28	2	1539.6666	1539.6666	R	T	487	500
PSM	LQIWDTAGQESFR	309	sp|P61019-2|RAB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:267	ms_run[2]:scan=9037	56.413	2	1559.7608	1559.7608	K	S	33	46
PSM	LVVPASQCGSLIGK	310	sp|Q15366-7|PCBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	8-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=6597	42.102	2	1433.8008	1433.8008	R	G	102	116
PSM	MFNIISDSPSPIAAR	311	sp|P20936-2|RASA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:35	ms_run[2]:scan=8768	54.795	2	1633.8134	1633.8134	R	T	737	752
PSM	MGQMAMGGAMGINNR	312	sp|Q15233-2|NONO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:35,15-UNIMOD:267	ms_run[2]:scan=5430	35.466	2	1563.6654	1563.6654	R	G	295	310
PSM	MNLPGEVTFLPLNK	313	sp|Q9UQE7|SMC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:35	ms_run[2]:scan=10253	63.814	2	1587.8331	1587.8331	K	L	579	593
PSM	MNPGDLQWMTAGR	314	sp|O00625|PIR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9159	57.144	2	1475.665	1475.6650	K	G	85	98
PSM	MVPAGMGAGLER	315	sp|P52272-2|HNRPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5481	35.761	2	1187.5791	1187.5791	R	M	493	505
PSM	MVVPGLDGAQIPR	316	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:35	ms_run[2]:scan=7161	45.283	2	1367.7231	1367.7231	K	D	1159	1172
PSM	NFINNPLAQADWAAK	317	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	15-UNIMOD:188	ms_run[2]:scan=10451	65.056	2	1677.857	1677.8570	K	K	15	30
PSM	NIPMTLELLQSTR	318	sp|P23193|TCEA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:267	ms_run[2]:scan=11197	69.628	2	1524.8209	1524.8209	K	I	33	46
PSM	NLLTAAADAIER	319	sp|P33897|ABCD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11355	70.61	2	1256.6725	1256.6725	R	I	390	402
PSM	NLVAFVSQEAGNR	320	sp|Q9BT73|PSMG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:267	ms_run[2]:scan=8999	56.185	2	1413.724	1413.7240	K	A	81	94
PSM	NSSYFVEWIPNNVK	321	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11014	68.514	2	1695.8257	1695.8257	K	T	337	351
PSM	PGPTPSGTNVGSSGR	322	sp|P60468|SC61B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	15-UNIMOD:267	ms_run[2]:scan=1145	10.335	2	1379.6669	1379.6669	M	S	2	17
PSM	PLFATNPFDQDVEK	323	sp|Q92783-2|STAM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:188	ms_run[2]:scan=9987	62.184	2	1625.8033	1625.8033	M	A	2	16
PSM	QAQEYEALLNIK	324	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9147	57.069	2	1418.7405	1418.7405	R	V	359	371
PSM	SAVPFLPVNPEYSATR	325	sp|Q9Y2X7|GIT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9980	62.138	2	1746.8941	1746.8941	R	N	310	326
PSM	SFDTVIMNPPFGTK	326	sp|Q9NRN9|METL5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10377	64.59	2	1552.7596	1552.7596	K	N	119	133
PSM	SLGSAGPSGTLPR	327	sp|Q8WUF5|IASPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:267	ms_run[2]:scan=3874	26.458	2	1208.6389	1208.6389	R	S	332	345
PSM	SPISVPGGSALISNLGK	328	sp|P51610-2|HCFC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9942	61.907	2	1595.8883	1595.8883	K	V	597	614
PSM	SVGGSGGGSFGDNLVTR	329	sp|P02545-5|LMNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5841	37.806	2	1565.7434	1565.7434	R	S	529	546
PSM	TALALAIAQELGSK	330	sp|Q9Y265|RUVB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:188	ms_run[2]:scan=11726	73.056	2	1390.8127	1390.8127	K	V	77	91
PSM	TLMNLGGLAVAR	331	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	12-UNIMOD:267	ms_run[2]:scan=9466	59.005	2	1224.6888	1224.6888	R	D	128	140
PSM	TPAIPTAVNLADSR	332	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7252	45.815	2	1424.7623	1424.7623	R	T	2247	2261
PSM	TPQAPASANLVGPR	333	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=4258	28.593	2	1377.7365	1377.7365	R	S	2329	2343
PSM	VGVGTSFGLPQTR	334	sp|P50851-2|LRBA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:267	ms_run[2]:scan=7251	45.809	2	1327.7124	1327.7124	R	R	2172	2185
PSM	VNQAIWLLCTGAR	335	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=10331	64.301	2	1510.7954	1510.7954	R	E	147	160
PSM	VPLWLQSSEDMEK	336	sp|Q9H4L5-8|OSBL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:188	ms_run[2]:scan=9339	58.243	2	1566.7695	1566.7695	R	C	209	222
PSM	VVPSFLPVDQGGSLVGR	337	sp|Q14126|DSG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10404	64.76	2	1725.9414	1725.9414	K	N	668	685
PSM	PTPQDSPIFLPVDDTSFR	338	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	18-UNIMOD:267	ms_run[1]:scan=11212	69.71777	2	2042.006909	2041.003191	R	W	1406	1424
PSM	TLTIVDTGIGMTK	339	sp|Q58FG1|HS904_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	13-UNIMOD:188	ms_run[1]:scan=8543	53.43976166666667	2	1354.751146	1354.747332	R	A	28	41
PSM	VLGVPIIVQASQAEK	340	sp|Q14498|RBM39_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	15-UNIMOD:188	ms_run[1]:scan=9698	60.41784166666666	2	1556.921853	1556.923322	R	N	218	233
PSM	NVFSSSGTSFSGR	341	sp|P49790|NU153_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=5730	37.172045000000004	2	1331.613970	1331.610593	K	K	1453	1466
PSM	AAEDDEDDDVDTKK	342	sp|P06454|PTMA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	13-UNIMOD:188,14-UNIMOD:188	ms_run[1]:scan=580	6.977785000000001	2	1576.669919	1576.677914	R	Q	91	105
PSM	CSDSDGLAPPQHLIR	343	sp|P04637|P53_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:385,1-UNIMOD:4,15-UNIMOD:267	ms_run[1]:scan=7118	45.03218666666666	2	1657.7786	1657.7752	R	V	182	197
PSM	VNQAIWLLCTGAR	344	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	9-UNIMOD:4,13-UNIMOD:267	ms_run[1]:scan=10429	64.91977666666668	2	1510.794652	1510.795387	R	E	147	160
PSM	AHSPVQSGLPGMQNLK	345	sp|Q9Y6E0-2|STK24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:1	ms_run[2]:scan=7647	48.052	2	1704.8617	1704.8617	M	A	2	18
PSM	ALAVGGLGSIIR	346	sp|Q9BPX5|ARP5L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9681	60.314	2	1125.687	1125.6870	K	V	134	146
PSM	ALLANALTSALR	347	sp|P57088|TMM33_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=10679	66.475	2	1212.719	1212.7190	R	L	58	70
PSM	ALLANALTSALR	348	sp|P57088|TMM33_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:267	ms_run[2]:scan=10680	66.481	2	1222.7273	1222.7273	R	L	58	70
PSM	AQPAQPADEPAEKADEPMEH	349	sp|P25786|PSA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	18-UNIMOD:35	ms_run[2]:scan=1571	13.128	2	2175.9379	2175.9379	K	-	244	264
PSM	DATNDQVTKDAAEAIK	350	sp|O75874|IDHC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	9-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=4861	31.896	2	1700.862	1700.8620	R	K	50	66
PSM	DGPNALTPPPTTPEWIK	351	sp|P05023-3|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9089	56.719	2	1832.9309	1832.9309	R	F	44	61
PSM	EEETSIDVAGKPNEVTK	352	sp|P53985|MOT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=3466	24.22	2	1856.9406	1856.9406	K	A	463	480
PSM	FAAATGATPIAGR	353	sp|P08865|RSSA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:267	ms_run[2]:scan=3930	26.769	2	1212.649	1212.6490	K	F	90	103
PSM	FCNPGFPIGCYITDK	354	sp|Q99805|TM9S2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:4,10-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=10585	65.888	2	1793.8212	1793.8212	R	G	173	188
PSM	FFGEDAEIAAR	355	sp|P20585|MSH3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6924	43.944	2	1224.5775	1224.5775	R	E	258	269
PSM	FGGLAAGEDNGQR	356	sp|O00116|ADAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=3164	22.525	2	1290.5953	1290.5953	K	G	491	504
PSM	FSLVDLAGNER	357	sp|Q99661-2|KIF2C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9522	59.348	2	1219.6197	1219.6197	K	G	434	445
PSM	FSLVDLAGNER	358	sp|Q99661-2|KIF2C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:267	ms_run[2]:scan=9502	59.227	2	1229.628	1229.6280	K	G	434	445
PSM	FTAIIGPNGSGK	359	sp|Q14683|SMC1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=4961	32.389	2	1160.619	1160.6190	R	S	27	39
PSM	GFQEVVTPNIFNSR	360	sp|P26639|SYTC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:267	ms_run[2]:scan=9955	61.985	2	1616.8186	1616.8186	R	L	368	382
PSM	GLPWSCSADEVQR	361	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:4	ms_run[2]:scan=6885	43.727	2	1503.6776	1503.6776	R	F	17	30
PSM	GLSNLFLSCPIPK	362	sp|Q9Y570-3|PPME1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	9-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=11047	68.719	2	1450.795	1450.7950	R	L	28	41
PSM	GPPAPAPEVEELAR	363	sp|P48681|NEST_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6732	42.866	2	1431.7358	1431.7358	R	R	167	181
PSM	ICPVEFNPNFVAR	364	sp|Q9UI30-2|TR112_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=9187	57.314	2	1571.7794	1571.7794	R	M	32	45
PSM	IFANTPDSGCVLGMR	365	sp|P08237-2|PFKAM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	10-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=7975	49.976	2	1646.7784	1646.7784	R	K	669	684
PSM	IFQPVIEAPGASK	366	sp|Q9BTC0-2|DIDO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7146	45.193	2	1355.7449	1355.7449	K	C	384	397
PSM	IGGIGTVPVGR	367	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=4976	32.471	2	1024.6029	1024.6029	K	V	256	267
PSM	IGGIGTVPVGR	368	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5130	33.494	2	1024.6029	1024.6029	K	V	256	267
PSM	ILGIPVIVTEQYPK	369	sp|Q96CN7|ISOC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:188	ms_run[2]:scan=11363	70.661	2	1574.9379	1574.9379	R	G	149	163
PSM	ILGIPVIVTEQYPK	370	sp|Q96CN7|ISOC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=11364	70.666	2	1568.9178	1568.9178	R	G	149	163
PSM	ILPTLEAVAALGNK	371	sp|Q12905|ILF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=11166	69.436	2	1408.829	1408.8290	K	V	128	142
PSM	IQSAIACTNIFPLGR	372	sp|Q9NRL2-2|BAZ1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	7-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=10233	63.692	2	1669.8849	1669.8849	K	D	761	776
PSM	ISVYYNEATGGK	373	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:188	ms_run[2]:scan=4607	30.529	2	1306.6501	1306.6501	R	Y	47	59
PSM	IYGPFCECDNFSCAR	374	sp|P18084|ITB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:4,8-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=8481	53.043	2	1894.7437	1894.7437	K	N	543	558
PSM	LDQPGNLPGSNR	375	sp|P46013-2|KI67_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=3048	21.888	2	1266.6317	1266.6317	K	R	1446	1458
PSM	LEGLTDEINFLR	376	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:267	ms_run[2]:scan=11278	70.131	2	1428.7488	1428.7488	R	Q	214	226
PSM	LFLAGYDPTPTMR	377	sp|O75436|VP26A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9385	58.52	2	1480.7384	1480.7384	R	D	250	263
PSM	LGGGLGVAGGNSTR	378	sp|Q9NPJ6|MED4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=3114	22.25	2	1214.6367	1214.6367	R	E	14	28
PSM	LLDAVDTYIPVPAR	379	sp|P49411|EFTU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:267	ms_run[2]:scan=10087	62.792	2	1551.8536	1551.8536	K	D	239	253
PSM	LLLGAGAVAYGVR	380	sp|Q99623-2|PHB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8841	55.234	2	1258.7398	1258.7398	K	E	25	38
PSM	LLPAAGPAGGEPYR	381	sp|O60934|NBN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5305	34.711	2	1367.7197	1367.7197	K	L	4	18
PSM	LLYNNVSNFGR	382	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:267	ms_run[2]:scan=7103	44.953	2	1305.6705	1305.6705	K	L	1216	1227
PSM	LPDGTSLTQTFR	383	sp|Q04323|UBXN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7396	46.63	2	1334.683	1334.6830	R	A	220	232
PSM	LQIWDTAGQESFR	384	sp|P61019-2|RAB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9039	56.424	2	1549.7525	1549.7525	K	S	33	46
PSM	LTEQSNTPLLLPLAAR	385	sp|Q9NYL2-2|M3K20_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=10530	65.538	2	1735.9832	1735.9832	K	M	322	338
PSM	LVFLACCVAPTNPR	386	sp|Q14566|MCM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=8916	55.686	2	1616.8167	1616.8167	R	F	296	310
PSM	MLVNENFEEYLR	387	sp|P09455|RET1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:35,12-UNIMOD:267	ms_run[2]:scan=9867	61.441	2	1581.7373	1581.7373	K	A	11	23
PSM	MTQLVLPGMVER	388	sp|Q53GQ0|DHB12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:267	ms_run[2]:scan=9518	59.325	2	1382.7289	1382.7289	K	S	168	180
PSM	MVPAGMGAGLER	389	sp|P52272-2|HNRPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:267	ms_run[2]:scan=5479	35.751	2	1197.5874	1197.5874	R	M	493	505
PSM	NEDEEEEEEEKDEAEDLLGR	390	sp|Q9Y5B9|SP16H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7783	48.858	3	2405.983	2405.9830	K	G	434	454
PSM	NGIDILVGTPGR	391	sp|Q9NR30-2|DDX21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8035	50.327	2	1210.667	1210.6670	R	I	239	251
PSM	NGIDILVGTPGR	392	sp|Q9NR30-2|DDX21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:267	ms_run[2]:scan=8036	50.331	2	1220.6753	1220.6753	R	I	239	251
PSM	NLATTVTEEILEK	393	sp|O43390-4|HNRPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:188	ms_run[2]:scan=11782	73.419	2	1465.7971	1465.7971	R	S	249	262
PSM	NVIGLQMGTNR	394	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6105	39.281	2	1201.6237	1201.6237	K	G	172	183
PSM	PGPTPSGTNVGSSGR	395	sp|P60468|SC61B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=1143	10.326	2	1369.6586	1369.6586	M	S	2	17
PSM	PLVVFCGLPYSGK	396	sp|Q96EK9|KTI12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:4	ms_run[2]:scan=10645	66.268	2	1435.7534	1435.7534	M	S	2	15
PSM	PSENLGQVLFGER	397	sp|Q99805|TM9S2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:267	ms_run[2]:scan=10391	64.681	2	1454.7393	1454.7393	R	I	92	105
PSM	QAQEYEALLNIK	398	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:188	ms_run[2]:scan=9142	57.041	2	1424.7607	1424.7607	R	V	359	371
PSM	QGIVPPGLTENELWR	399	sp|Q9H9B4|SFXN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	15-UNIMOD:267	ms_run[2]:scan=10896	67.792	2	1717.9027	1717.9027	R	A	56	71
PSM	QGSPDQVSPVSEMTSTSLYQDKQEGK	400	sp|P46821|MAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7243	45.764	3	2825.3025	2825.3025	K	S	1436	1462
PSM	SGDETPGSEVPGDKAAEEQGDDQDSEK	401	sp|Q1KMD3|HNRL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=2616	19.382	3	2776.1431	2776.1431	R	S	161	188
PSM	SGDETPGSEVPGDKAAEEQGDDQDSEK	402	sp|Q1KMD3|HNRL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:188,27-UNIMOD:188	ms_run[2]:scan=2642	19.545	3	2788.1834	2788.1834	R	S	161	188
PSM	SGGGVIRGPAGNNDCR	403	sp|Q07955-3|SRSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:1,7-UNIMOD:267,15-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=2609	19.347	2	1647.765	1647.7650	M	I	2	18
PSM	SIQFVDWCPTGFK	404	sp|P68363-2|TBA1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	8-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=11170	69.465	2	1589.7644	1589.7644	R	V	224	237
PSM	SIQFVDWCPTGFK	405	sp|P68363-2|TBA1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	8-UNIMOD:4	ms_run[2]:scan=11171	69.471	2	1583.7442	1583.7443	R	V	224	237
PSM	STGGAPTFNVTVTK	406	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5791	37.53	2	1378.7092	1378.7092	K	T	92	106
PSM	TAGPEQGPGLGGR	407	sp|Q5C9Z4|NOM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:267	ms_run[2]:scan=1809	14.716	2	1205.6028	1205.6028	R	S	101	114
PSM	TIAEIFGNPNYLR	408	sp|Q16401-2|PSMD5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:267	ms_run[2]:scan=10626	66.15	2	1516.7913	1516.7913	K	L	425	438
PSM	TIIPLISQCTPK	409	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	9-UNIMOD:4,12-UNIMOD:188	ms_run[2]:scan=8691	54.332	2	1375.7841	1375.7841	K	V	204	216
PSM	TIQFVDWCPTGFK	410	sp|Q71U36-2|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	8-UNIMOD:4	ms_run[2]:scan=11272	70.091	2	1597.7599	1597.7599	R	V	305	318
PSM	TLEAEFNSPSPPTPEPGEGPR	411	sp|A0MZ66-7|SHOT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7071	44.759	2	2208.0335	2208.0335	K	K	113	134
PSM	TLPGWNTDISNAR	412	sp|P30520|PURA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7333	46.286	2	1443.7106	1443.7106	K	A	404	417
PSM	TLTLVDTGIGMTK	413	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8544	53.445	2	1348.7272	1348.7272	R	A	83	96
PSM	TSGETTQTHTEPTGDSK	414	sp|P46013-2|KI67_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=491	6.4303	2	1775.781	1775.7810	R	S	2144	2161
PSM	VFIGNLNTLVVK	415	sp|P07910-4|HNRPC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:188	ms_run[2]:scan=10238	63.725	2	1321.8065	1321.8065	R	K	18	30
PSM	VIGSGCNLDSAR	416	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=2781	20.314	2	1257.6011	1257.6011	R	F	158	170
PSM	VLQDMGLPTGAEGR	417	sp|Q12906|ILF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6677	42.558	2	1442.7188	1442.7188	K	D	461	475
PSM	VLSGDLGQLPTGIR	418	sp|Q16822-2|PCKGM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8651	54.094	2	1424.7987	1424.7987	R	D	32	46
PSM	YGLFPANYVELRQ	419	sp|Q14247-3|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:267	ms_run[2]:scan=10708	66.65	2	1578.807	1578.8070	R	-	501	514
PSM	QRGGAEGELQALR	420	sp|Q15149|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:28,2-UNIMOD:267,13-UNIMOD:267	ms_run[1]:scan=5844	37.825309999999995	2	1386.7097	1386.7113	R	A	1604	1617
PSM	CTVFHGAQVEDAFR	421	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:385,1-UNIMOD:4,14-UNIMOD:267	ms_run[1]:scan=9386	58.525259999999996	2	1628.7259	1628.7276	K	Y	1828	1842
PSM	VGNLGLATSFFNER	422	sp|O00571|DDX3X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=11049	68.729745	2	1523.772452	1523.773242	R	N	535	549
PSM	QAPAPTVIRDPPSITPAVK	423	sp|Q13112|CAF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:28	ms_run[1]:scan=7880	49.42202	2	1940.0658	1940.0726	R	S	439	458
PSM	IGGIGTVPVGR	424	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	11-UNIMOD:267	ms_run[1]:scan=5439	35.51772166666667	2	1034.609665	1034.611198	K	V	256	267
PSM	IGGIGTVPVGR	425	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	11-UNIMOD:267	ms_run[1]:scan=5129	33.490395	2	1034.609665	1034.611198	K	V	256	267
PSM	QGAPTSFLPPEASQLKPDR	426	sp|Q9BUJ2|HNRL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:28,16-UNIMOD:188,19-UNIMOD:267	ms_run[1]:scan=9324	58.149055000000004	2	2037.0468	2037.0497	K	Q	147	166
PSM	QHPGCLAQEACVR	427	sp|Q08426|ECHP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:28,5-UNIMOD:4,11-UNIMOD:4,13-UNIMOD:267	ms_run[1]:scan=4370	29.217331666666666	2	1517.6717	1517.6738	R	A	223	236
PSM	NGLVNSEVHNEDGR	428	sp|Q9NUM4|T106B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=2856	20.792541666666665	2	1539.691012	1538.707347	R	N	28	42
PSM	QATSTASTFVKPIFSR	429	sp|P56556|NDUA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:28,11-UNIMOD:188,16-UNIMOD:267	ms_run[1]:scan=9493	59.17021333333333	2	1738.9184	1738.9220	R	D	8	24
PSM	FYGPQGTPYEGGVWK	430	sp|P62256|UBE2H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=8186	51.150621666666666	2	1684.796826	1684.788558	K	V	38	53
PSM	AAILPTSIFLTNK	431	sp|O14744-3|ANM5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11336	70.49	2	1387.8075	1387.8075	K	K	167	180
PSM	ADKPDMGEIASFDK	432	sp|P63313|TYB10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:1,3-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=7735	48.571	2	1576.7482	1576.7482	M	A	2	16
PSM	AGGEAGVTLGQPHLSR	433	sp|P41091|IF2G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:1,16-UNIMOD:267	ms_run[2]:scan=6045	38.943	2	1600.8197	1600.8197	M	Q	2	18
PSM	AMGIMNSFVNDIFER	434	sp|O60814|H2B1K_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:35,5-UNIMOD:35	ms_run[2]:scan=11207	69.69	2	1774.8018	1774.8018	K	I	59	74
PSM	APVPASELLASGVLSR	435	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	16-UNIMOD:267	ms_run[2]:scan=10212	63.565	3	1575.886	1575.8860	R	A	3447	3463
PSM	ASLEAAIADAEQR	436	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8165	51.027	2	1343.6681	1343.6681	R	G	329	342
PSM	CCSGAIIVLTK	437	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:4,2-UNIMOD:4	ms_run[2]:scan=6394	40.95	2	1220.6257	1220.6257	K	S	423	434
PSM	CPNPTCENMNFSWR	438	sp|P35637-2|FUS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:4,6-UNIMOD:4	ms_run[2]:scan=7924	49.672	2	1811.7178	1811.7178	K	N	427	441
PSM	DGPNALTPPPTTPEWIK	439	sp|P05023-3|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	17-UNIMOD:188	ms_run[2]:scan=9084	56.687	2	1838.951	1838.9510	R	F	44	61
PSM	ENGELLPILRGEN	440	sp|O76003|GLRX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9701	60.435	2	1452.7573	1452.7573	K	-	323	336
PSM	FAAATGATPIAGR	441	sp|P08865|RSSA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=3931	26.774	2	1202.6408	1202.6408	K	F	90	103
PSM	FDEISFVNFAR	442	sp|Q08945|SSRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11161	69.409	2	1343.651	1343.6510	R	G	371	382
PSM	FGFAIGSQTTK	443	sp|Q8WW12-2|PCNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7108	44.975	2	1155.5924	1155.5924	K	K	71	82
PSM	FLAVGLVDNTVR	444	sp|Q15393|SF3B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9302	58.017	2	1302.7296	1302.7296	R	I	604	616
PSM	FLEMCNDLLAR	445	sp|P34932|HSP74_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	5-UNIMOD:4	ms_run[2]:scan=9673	60.264	2	1380.653	1380.6530	K	V	306	317
PSM	FSLIDLAGNER	446	sp|O00139-2|KIF2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:267	ms_run[2]:scan=10322	64.245	2	1243.6436	1243.6436	K	G	407	418
PSM	FTSPADLDASGAGPGPK	447	sp|P52735-3|VAV2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5696	36.973	2	1586.7577	1586.7577	K	M	564	581
PSM	FVFSLVDAMNGK	448	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	9-UNIMOD:35,12-UNIMOD:188	ms_run[2]:scan=9707	60.474	2	1348.6793	1348.6793	R	E	258	270
PSM	GALQNIIPASTGAAK	449	sp|P04406-2|G3P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	15-UNIMOD:188	ms_run[2]:scan=7098	44.92	2	1416.8032	1416.8032	R	A	159	174
PSM	GFIGPGIDVPAPDMSTGER	450	sp|P00367|DHE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9845	61.307	2	1914.9146	1914.9146	K	E	213	232
PSM	GGGLGSPGEGGALPR	451	sp|Q7Z7A3|CTU1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=4170	28.109	2	1280.6473	1280.6473	R	C	195	210
PSM	GGIVGMTLPIAR	452	sp|Q99714-2|HCD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	6-UNIMOD:35	ms_run[2]:scan=7049	44.637	2	1199.6696	1199.6696	K	D	173	185
PSM	GLALALFGGEPK	453	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:188	ms_run[2]:scan=10815	67.299	2	1177.6802	1177.6802	R	N	494	506
PSM	GSLAEAVGSPPPAATPTPTPPTR	454	sp|Q9Y6I3-3|EPN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	23-UNIMOD:267	ms_run[2]:scan=6290	40.342	2	2181.1305	2181.1305	R	K	420	443
PSM	GVVDSEDLPLNISR	455	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8526	53.334	2	1512.7784	1512.7784	R	E	387	401
PSM	HTAAPTDPADGPV	456	sp|Q04941|PLP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=2708	19.913	2	1247.5782	1247.5782	R	-	140	153
PSM	IEGLQNLVNLR	457	sp|Q15435-5|PP1R7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:267	ms_run[2]:scan=10202	63.504	2	1277.7331	1277.7331	K	E	186	197
PSM	IFTSIGEDYDER	458	sp|P35232|PHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:267	ms_run[2]:scan=6792	43.197	2	1453.6601	1453.6601	R	V	106	118
PSM	IFVGGLSPDTPEEK	459	sp|Q14103-4|HNRPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6983	44.262	2	1487.7508	1487.7508	K	I	165	179
PSM	IGGIGTVPVGR	460	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5276	34.5	2	1024.6029	1024.6029	K	V	256	267
PSM	IGGIGTVPVGR	461	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5438	35.514	2	1024.6029	1024.6029	K	V	256	267
PSM	ILFAPGSEEAIER	462	sp|Q12756|KIF1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:267	ms_run[2]:scan=7867	49.348	2	1440.7488	1440.7488	R	L	424	437
PSM	ILILGLDGAGK	463	sp|P40616-2|ARL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:188	ms_run[2]:scan=9348	58.297	2	1074.6744	1074.6744	R	T	3	14
PSM	ILLLGLDNAGK	464	sp|P36405|ARL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9572	59.65	2	1125.6758	1125.6758	R	T	20	31
PSM	ILLLGLDNAGK	465	sp|P36405|ARL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:188	ms_run[2]:scan=9573	59.655	2	1131.6959	1131.6959	R	T	20	31
PSM	ILMLGLDAAGK	466	sp|P62330|ARF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9224	57.537	2	1100.6264	1100.6264	R	T	16	27
PSM	ILMLGLDAAGK	467	sp|P62330|ARF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:188	ms_run[2]:scan=9225	57.542	2	1106.6465	1106.6465	R	T	16	27
PSM	ILQGAPEILDR	468	sp|Q86TP1-2|PRUN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7344	46.346	2	1223.6874	1223.6874	R	Q	89	100
PSM	IQEPNTFPAILR	469	sp|P15586-2|GNS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9363	58.383	2	1397.7667	1397.7667	K	S	106	118
PSM	IVCTPGQGLGDLR	470	sp|Q9Y5L0-5|TNPO3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:4	ms_run[2]:scan=6324	40.543	2	1384.7133	1384.7133	K	T	310	323
PSM	IVNTPFQVLMNSEK	471	sp|Q92544|TM9S4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	14-UNIMOD:188	ms_run[2]:scan=11354	70.604	2	1624.859	1624.8590	R	K	85	99
PSM	IVVMPGGGITDR	472	sp|Q9NTM9|CUTC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6397	40.965	2	1213.6489	1213.6489	R	N	196	208
PSM	IWDLQGSEEPVFR	473	sp|Q6RFH5-2|WDR74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10036	62.482	2	1574.7729	1574.7729	K	A	157	170
PSM	IWSVPNASCVQVVR	474	sp|Q9UMS4|PRP19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	9-UNIMOD:4	ms_run[2]:scan=8760	54.747	2	1613.8348	1613.8348	R	A	290	304
PSM	IYAPQGLLLTDPIER	475	sp|Q7Z5G4-3|GOGA7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10977	68.289	2	1697.9352	1697.9352	K	G	104	119
PSM	IYVGNLPPDIR	476	sp|Q07955-3|SRSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:267	ms_run[2]:scan=7747	48.646	2	1265.7007	1265.7007	R	T	18	29
PSM	IYVGNLPPDIR	477	sp|Q07955-3|SRSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:267	ms_run[2]:scan=7930	49.709	2	1265.7007	1265.7007	R	T	18	29
PSM	IYVGNLPPDIR	478	sp|Q07955-3|SRSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7386	46.574	2	1255.6925	1255.6925	R	T	18	29
PSM	LATQLTGPVMPVR	479	sp|P26373|RL13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	10-UNIMOD:35,13-UNIMOD:267	ms_run[2]:scan=5818	37.681	2	1407.7783	1407.7783	K	N	146	159
PSM	LATQLTGPVMPVR	480	sp|P26373|RL13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7347	46.365	2	1381.7752	1381.7752	K	N	146	159
PSM	LEDVLPLAFTR	481	sp|Q5SSJ5-3|HP1B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:267	ms_run[2]:scan=11198	69.633	2	1282.7161	1282.7161	K	L	107	118
PSM	LGAPLSGLQGLPECTR	482	sp|P50479|PDLI4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	14-UNIMOD:4	ms_run[2]:scan=8961	55.957	2	1667.8665	1667.8665	K	C	242	258
PSM	LIGPNCPGVINPGECK	483	sp|P53597|SUCA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	6-UNIMOD:4,15-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=6137	39.46	2	1729.8587	1729.8587	R	I	167	183
PSM	LIGPNCPGVINPGECK	484	sp|P53597|SUCA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=6138	39.466	2	1723.8386	1723.8386	R	I	167	183
PSM	LLCGGGIAADR	485	sp|P05091-2|ALDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:4	ms_run[2]:scan=3908	26.646	2	1101.5601	1101.5601	K	G	337	348
PSM	LLGELLQDNAK	486	sp|P37837|TALDO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:188	ms_run[2]:scan=7874	49.391	2	1218.6915	1218.6915	K	L	259	270
PSM	LLGELLQDNAK	487	sp|P37837|TALDO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7877	49.407	2	1212.6714	1212.6714	K	L	259	270
PSM	LLLIGDSGVGK	488	sp|P62820-2|RAB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7862	49.318	2	1070.6336	1070.6336	K	S	14	25
PSM	LLLLGAGESGK	489	sp|P04899|GNAI2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7194	45.477	2	1056.6179	1056.6179	K	S	36	47
PSM	LLMLGLDNAGK	490	sp|P36404-2|ARL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:188	ms_run[2]:scan=9081	56.671	2	1149.6523	1149.6523	R	T	19	30
PSM	LLMLGLDNAGK	491	sp|P36404-2|ARL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9083	56.681	2	1143.6322	1143.6322	R	T	19	30
PSM	LLYNNVSNFGR	492	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7104	44.958	2	1295.6622	1295.6622	K	L	1216	1227
PSM	LMMDPLTGLNR	493	sp|O60506-5|HNRPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:267	ms_run[2]:scan=9716	60.529	2	1269.6449	1269.6449	R	G	41	52
PSM	LMMDPLTGLNR	494	sp|O60506-5|HNRPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9734	60.639	2	1259.6366	1259.6366	R	G	41	52
PSM	LQLWDIAGQER	495	sp|O14966|RAB7L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:267	ms_run[2]:scan=9880	61.525	2	1337.6967	1337.6967	R	F	59	70
PSM	LSWSQLGGSPAEPIPGR	496	sp|P50895|BCAM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	17-UNIMOD:267	ms_run[2]:scan=9091	56.731	2	1760.9085	1760.9085	K	Q	483	500
PSM	LTWHSCPEDEAQ	497	sp|Q13185|CBX3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	6-UNIMOD:4	ms_run[2]:scan=4421	29.498	2	1471.6038	1471.6038	R	-	172	184
PSM	LVAIVDVIDQNR	498	sp|P50914|RL14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:267	ms_run[2]:scan=9977	62.122	2	1363.7699	1363.7699	K	A	24	36
PSM	LVAIVDVIDQNR	499	sp|P50914|RL14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9978	62.128	2	1353.7616	1353.7616	K	A	24	36
PSM	LVFLACCVAPTNPR	500	sp|Q14566|MCM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	6-UNIMOD:4,7-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=8909	55.641	2	1626.825	1626.8250	R	F	296	310
PSM	LVFLGLDNAGK	501	sp|Q9NR31|SAR1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9401	58.616	2	1145.6445	1145.6445	K	T	28	39
PSM	LVFLGLDNAGK	502	sp|Q9NR31|SAR1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:188	ms_run[2]:scan=9402	58.621	2	1151.6646	1151.6646	K	T	28	39
PSM	LVILANNCPALR	503	sp|P62888|RL30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	8-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=7546	47.456	2	1362.7681	1362.7681	K	K	45	57
PSM	MLDMGFEPQIR	504	sp|P17844-2|DDX5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:35,4-UNIMOD:35	ms_run[2]:scan=6485	41.456	2	1367.6214	1367.6214	R	K	174	185
PSM	MLDMGFEPQIR	505	sp|P17844-2|DDX5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:35,11-UNIMOD:267	ms_run[2]:scan=8413	52.623	2	1361.6347	1361.6347	R	K	174	185
PSM	MLDMGFEPQIR	506	sp|P17844-2|DDX5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9446	58.887	2	1335.6315	1335.6315	R	K	174	185
PSM	MLGQMTDQVADLR	507	sp|P18206|VINC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:35	ms_run[2]:scan=6955	44.11	2	1492.7014	1492.7014	K	A	327	340
PSM	MQLLEIITTEK	508	sp|P40939|ECHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:35	ms_run[2]:scan=9233	57.591	2	1333.7163	1333.7163	K	T	506	517
PSM	NFLEDGESDGFLR	509	sp|Q9BXS4|TMM59_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:267	ms_run[2]:scan=9780	60.915	2	1507.6819	1507.6819	R	C	220	233
PSM	NIPMTLELLQSTR	510	sp|P23193|TCEA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11188	69.573	2	1514.8127	1514.8127	K	I	33	46
PSM	NSQSFFSGLFGGSSK	511	sp|P54920|SNAA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	15-UNIMOD:188	ms_run[2]:scan=11634	72.436	2	1554.741	1554.7410	K	I	23	38
PSM	NSSYFVEWIPNNVK	512	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	14-UNIMOD:188	ms_run[2]:scan=11002	68.442	2	1701.8458	1701.8458	K	T	337	351
PSM	NTSLPPLWSPEAER	513	sp|P49790-2|NU153_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	14-UNIMOD:267	ms_run[2]:scan=9221	57.519	2	1605.8026	1605.8026	K	S	201	215
PSM	QLAGILQVPLEER	514	sp|Q86VN1-2|VPS36_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10348	64.408	2	1464.83	1464.8300	K	G	190	203
PSM	QLAGILQVPLEER	515	sp|Q86VN1-2|VPS36_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:267	ms_run[2]:scan=10350	64.419	2	1474.8383	1474.8383	K	G	190	203
PSM	QVQAEVPGSPIFVMR	516	sp|Q13085-3|ACACA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9639	60.055	2	1656.8658	1656.8658	R	L	258	273
PSM	SAAEAGGVFHR	517	sp|Q9BRF8-3|CPPED_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:1	ms_run[2]:scan=4703	31.046	2	1142.5469	1142.5469	M	A	2	13
PSM	SETAPLAPTIPAPAEKTPVK	518	sp|P16402|H13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:1	ms_run[2]:scan=7280	45.977	2	2059.1201	2059.1201	M	K	2	22
PSM	SIVVSPILIPENQR	519	sp|P55290-3|CAD13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9542	59.467	2	1563.8984	1563.8984	R	Q	139	153
PSM	SLAVSGLGVIGR	520	sp|Q02880-2|TOP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8321	52.034	2	1127.6663	1127.6663	K	D	483	495
PSM	SLDMDSIIAEVK	521	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:188	ms_run[2]:scan=11012	68.503	2	1325.6844	1325.6844	R	A	253	265
PSM	SLGSAGPSGTLPR	522	sp|Q8WUF5|IASPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=3897	26.585	2	1198.6306	1198.6306	R	S	332	345
PSM	SLGVLPFTLNSGSPEK	523	sp|P42695|CNDD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10826	67.365	2	1644.8723	1644.8723	R	T	1372	1388
PSM	SPDFTNENPLETR	524	sp|P05023-3|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:267	ms_run[2]:scan=6837	43.455	2	1528.7033	1528.7033	R	N	197	210
PSM	SPFTVGVAAPLDLSK	525	sp|O75369-6|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	15-UNIMOD:188	ms_run[2]:scan=10076	62.727	2	1506.8389	1506.8389	K	I	932	947
PSM	SPFTVGVAAPLDLSK	526	sp|O75369-6|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10086	62.786	2	1500.8188	1500.8188	K	I	932	947
PSM	SPGADLLQVLTK	527	sp|Q3LXA3|TKFC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11179	69.521	2	1240.7027	1240.7027	K	A	511	523
PSM	TAGTLFGEGFR	528	sp|Q5T9A4-2|ATD3B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:267	ms_run[2]:scan=8081	50.581	2	1164.5803	1164.5803	R	A	110	121
PSM	TAVVVGTITDDVR	529	sp|Q07020-2|RL18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:267	ms_run[2]:scan=6830	43.412	2	1354.7332	1354.7332	K	V	50	63
PSM	TEGDEEAEEEQEENLEASGDYKYSGR	530	sp|P12956|XRCC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5628	36.587	2	2963.2064	2963.2064	K	D	10	36
PSM	TFQGPNCPATCGR	531	sp|Q13685|AAMP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	7-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=2516	18.836	2	1464.6238	1464.6238	K	V	210	223
PSM	TINEVENQILTR	532	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:267	ms_run[2]:scan=7412	46.723	2	1438.7655	1438.7655	R	D	746	758
PSM	TINEVENQILTR	533	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7423	46.782	2	1428.7573	1428.7573	R	D	746	758
PSM	TLPGWNTDISNAR	534	sp|P30520|PURA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:267	ms_run[2]:scan=7337	46.312	2	1453.7189	1453.7189	K	A	404	417
PSM	TPAIPTAVNLADSR	535	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	14-UNIMOD:267	ms_run[2]:scan=7253	45.82	2	1434.7706	1434.7706	R	T	2247	2261
PSM	TPSGSHSGPVPSQGLV	536	sp|Q9Y6V7|DDX49_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=4820	31.678	2	1505.7474	1505.7474	R	-	468	484
PSM	TVDNFVALATGEK	537	sp|P23284|PPIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:188	ms_run[2]:scan=9134	56.991	2	1369.7185	1369.7185	K	G	72	85
PSM	TVLPFSQEFQR	538	sp|Q7L576-3|CYFP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9365	58.4	2	1350.6932	1350.6932	R	D	61	72
PSM	TVQSLEIDLDSMR	539	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:267	ms_run[2]:scan=10013	62.344	2	1515.7478	1515.7478	R	N	302	315
PSM	VDFPQDQLTALTGR	540	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	14-UNIMOD:267	ms_run[2]:scan=9720	60.551	2	1569.8026	1569.8026	K	I	216	230
PSM	VFLPCTVNLDPK	541	sp|Q9ULH0-2|KDIS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	5-UNIMOD:4	ms_run[2]:scan=9160	57.15	2	1401.7326	1401.7326	K	L	1004	1016
PSM	VLEQLTGQTPVFSK	542	sp|P62913-2|RL11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	14-UNIMOD:188	ms_run[2]:scan=7941	49.775	2	1551.8604	1551.8604	K	A	38	52
PSM	VLGTAFDPFLGGK	543	sp|Q92598-4|HS105_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11057	68.776	2	1320.7078	1320.7078	K	N	224	237
PSM	VLMAPPSMVNNEQR	544	sp|Q9C0E2|XPO4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	14-UNIMOD:267	ms_run[2]:scan=6586	42.04	2	1594.7835	1594.7835	K	Q	21	35
PSM	VLVIGAGGLGCELLK	545	sp|Q8TBC4-2|UBA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:4	ms_run[2]:scan=11120	69.151	2	1497.8589	1497.8589	K	N	58	73
PSM	VNPALAELNLR	546	sp|P13489|RINI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:267	ms_run[2]:scan=8073	50.534	2	1218.696	1218.6960	R	S	54	65
PSM	VNQAIWLLCTGAR	547	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	9-UNIMOD:4	ms_run[2]:scan=10334	64.318	2	1500.7871	1500.7871	R	E	147	160
PSM	YGPSLMPGGNK	548	sp|P52209-2|6PGD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=4847	31.823	2	1119.5383	1119.5383	R	E	124	135
PSM	YLFNCGEGVQR	549	sp|Q9BQ52-4|RNZ2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	5-UNIMOD:4,11-UNIMOD:267	ms_run[2]:scan=6047	38.954	2	1351.6218	1351.6218	R	L	83	94
PSM	YLLEQDFPGMR	550	sp|Q9NZN3-2|EHD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9818	61.143	2	1367.6544	1367.6544	R	I	77	88
PSM	YLLEQDFPGMR	551	sp|Q9NZN3-2|EHD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:267	ms_run[2]:scan=9833	61.236	2	1377.6626	1377.6626	R	I	77	88
PSM	YQQAGLPLIVLAGK	552	sp|P21399|ACOC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11215	69.74	2	1469.8606	1469.8606	R	E	759	773
PSM	YSFLQFDPAPR	553	sp|P67775-2|PP2AA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:267	ms_run[2]:scan=10392	64.687	2	1349.6644	1349.6644	K	R	230	241
PSM	YTDQGGEEEEDYESEEQLQHR	554	sp|O75208-2|COQ9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=4259	28.597	3	2570.0317	2570.0317	R	I	82	103
PSM	CRPDQLTGLSLLPLSEK	555	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=11958	74.63439666666667	2	1909.0013	1908.9974	R	A	3336	3353
PSM	LLLIGDSGVGK	556	sp|P61026|RAB10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	11-UNIMOD:188	ms_run[1]:scan=7858	49.29776	2	1076.650459	1076.653689	K	T	12	23
PSM	LLLGAGAVAYGVR	557	sp|Q99623|PHB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	13-UNIMOD:267	ms_run[1]:scan=8852	55.299971666666664	2	1268.752966	1268.748026	K	E	25	38
PSM	PSENLGQVLFGER	558	sp|Q99805|TM9S2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=10375	64.57791833333333	2	1444.725531	1444.731043	R	I	92	105
PSM	FVSISDLLVPK	559	sp|P50395|GDIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=11896	74.18821166666667	2	1216.710018	1216.706725	K	D	380	391
PSM	IGGIGTVPVGR	560	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	11-UNIMOD:267	ms_run[1]:scan=5277	34.50394166666667	2	1034.609665	1034.611198	K	V	256	267
PSM	SLAVSGLGVIGR	561	sp|Q02880|TOP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=8352	52.24982333333333	2	1127.668071	1127.666258	K	D	488	500
PSM	QHLLTNLVEVDGR	562	sp|Q8NFV4|ABHDB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:28	ms_run[1]:scan=9839	61.26873666666667	2	1475.7725	1475.7727	R	F	217	230
PSM	QHLLTNLVEVDGR	563	sp|Q8NFV4|ABHDB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:28,13-UNIMOD:267	ms_run[1]:scan=9827	61.197608333333335	2	1485.7784	1485.7810	R	F	217	230
PSM	CASCPYLGMPAFKPGEK	564	sp|Q6FI81|CPIN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:385,1-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=9491	59.1587	2	1894.8362	1894.8411	R	V	285	302
PSM	IEGLQNLVNLR	565	sp|Q15435|PP1R7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=10193	63.44868666666667	2	1267.715900	1267.724835	K	E	245	256
PSM	ILLLGAGESGK	566	sp|Q03113|GNA12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	11-UNIMOD:188	ms_run[1]:scan=7193	45.47297666666667	2	1062.639909	1062.638039	K	S	60	71
PSM	GNLGAGNGNLQGPR	567	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	14-UNIMOD:267	ms_run[1]:scan=3058	21.945018333333334	2	1334.656973	1333.672629	R	H	374	388
PSM	CSDSDGLAPPQHLIR	568	sp|P04637|P53_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=7101	44.93754833333333	2	1647.7686	1647.7670	R	V	182	197
PSM	LQEIGLGAFER	569	sp|Q32P44|EMAL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=9029	56.366265000000006	2	1231.659410	1231.656087	K	G	350	361
PSM	AGMSAEQAQGLLEK	570	sp|Q9Y2Q3|GSTK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=6471	41.376645	2	1431.692422	1431.702779	K	I	145	159
PSM	QRPASLVVADFGCGDCR	571	sp|O43159|RRP8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:28,2-UNIMOD:267,13-UNIMOD:4,16-UNIMOD:4,17-UNIMOD:267	ms_run[1]:scan=8859	55.33877	2	1909.8758	1909.8673	R	L	305	322
PSM	AALGHLAGEAAAAPGPGTPCASR	572	sp|Q9H7E9|CH033_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:1,20-UNIMOD:4,23-UNIMOD:267	ms_run[2]:scan=8024	50.261	3	2154.0516	2154.0516	M	G	2	25
PSM	ACGLNFADLMAR	573	sp|Q99536|VAT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=10796	67.186	2	1347.6303	1347.6303	R	Q	85	97
PSM	ACGNFGIPCELR	574	sp|P22234|PUR6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:4,9-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=7703	48.383	2	1402.6361	1402.6361	K	V	287	299
PSM	ADLINNLGTIAK	575	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8452	52.87	2	1241.698	1241.6980	K	S	101	113
PSM	AGGVFTPGAAFSK	576	sp|Q8NBX0|SCPDL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6961	44.146	2	1208.619	1208.6190	K	T	395	408
PSM	AHSPVQSGLPGMQNLK	577	sp|Q9Y6E0-2|STK24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:1,16-UNIMOD:188	ms_run[2]:scan=7643	48.029	2	1710.8819	1710.8819	M	A	2	18
PSM	AIPLAIFQAEPTVR	578	sp|Q07864|DPOE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	14-UNIMOD:267	ms_run[2]:scan=11256	69.992	2	1534.8747	1534.8747	R	K	1093	1107
PSM	ALAVGGLGSIIR	579	sp|Q9BPX5|ARP5L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:267	ms_run[2]:scan=9663	60.202	2	1135.6953	1135.6953	K	V	134	146
PSM	APGEQTVPALNLQNAFR	580	sp|Q9Y5B9|SP16H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	17-UNIMOD:267	ms_run[2]:scan=10186	63.403	2	1834.9565	1834.9565	K	I	607	624
PSM	AQLPVMVIVTPQDR	581	sp|Q9H6R4-2|NOL6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	14-UNIMOD:267	ms_run[2]:scan=10115	62.962	2	1575.8682	1575.8682	R	K	942	956
PSM	ASEIMVDDEELAQHPATTEDIR	582	sp|Q8IY81|SPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7242	45.758	3	2469.1329	2469.1329	K	V	270	292
PSM	ASLEAAIADAEQR	583	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:267	ms_run[2]:scan=8164	51.022	2	1353.6764	1353.6764	R	G	329	342
PSM	AVFVDLEPTVIDEVR	584	sp|P68363-2|TBA1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11395	70.858	2	1700.8985	1700.8985	R	T	65	80
PSM	CCSGAIIVLTK	585	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:4,2-UNIMOD:4,11-UNIMOD:188	ms_run[2]:scan=6401	40.99	2	1226.6458	1226.6458	K	S	423	434
PSM	CGPMVLDALIK	586	sp|P21912|SDHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:4	ms_run[2]:scan=10868	67.621	2	1215.6356	1215.6356	K	I	68	79
PSM	CSVLAAANSVFGR	587	sp|P33992|MCM5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=9794	60.995	2	1360.6797	1360.6797	R	W	482	495
PSM	ELGSLPLPLSTSEQR	588	sp|Q86Y82|STX12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	15-UNIMOD:267	ms_run[2]:scan=9575	59.666	2	1635.8707	1635.8707	K	Q	83	98
PSM	FDGILTEGEGPR	589	sp|Q96HE7|ERO1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6701	42.693	2	1289.6252	1289.6252	R	R	288	300
PSM	FGFAIGSQTTK	590	sp|Q8WW12-2|PCNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:188	ms_run[2]:scan=7107	44.97	2	1161.6126	1161.6126	K	K	71	82
PSM	FMELLEPLNER	591	sp|Q01082-3|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:267	ms_run[2]:scan=10841	67.456	2	1399.7045	1399.7045	K	K	1454	1465
PSM	FMELLEPLNER	592	sp|Q01082-3|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10842	67.462	2	1389.6962	1389.6962	K	K	1454	1465
PSM	FQAFDWGSSAK	593	sp|P38571-2|LICH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8420	52.667	2	1242.5669	1242.5669	K	N	249	260
PSM	FSLVGIGGQDLNEGNR	594	sp|P13796|PLSL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9204	57.416	3	1674.8325	1674.8325	K	T	473	489
PSM	FVLSGANIMCPGLTSPGAK	595	sp|Q9ULC4-2|MCTS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	10-UNIMOD:4,19-UNIMOD:188	ms_run[2]:scan=10263	63.876	2	1924.9846	1924.9846	K	L	92	111
PSM	FVSISDLLVPK	596	sp|P50395|GDIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:188	ms_run[2]:scan=11897	74.194	2	1222.7269	1222.7269	K	D	380	391
PSM	GLALALFGGEPK	597	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10816	67.305	2	1171.6601	1171.6601	R	N	494	506
PSM	GLPWSCSADEVQR	598	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=6883	43.716	2	1513.6859	1513.6859	R	F	17	30
PSM	GVGQADWTPDLGLR	599	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9252	57.707	2	1483.7419	1483.7419	R	N	1275	1289
PSM	GVGSPEPGPTAPYLGR	600	sp|Q9C0B5-2|ZDHC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6023	38.815	2	1553.7838	1553.7838	R	S	565	581
PSM	GYISPYFINTSK	601	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:188	ms_run[2]:scan=8428	52.717	2	1394.7177	1394.7177	R	G	222	234
PSM	IALTDNALIAR	602	sp|P18124|RL7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:267	ms_run[2]:scan=7470	47.051	2	1179.6851	1179.6851	R	S	167	178
PSM	ILILGLDGAGK	603	sp|P40616-2|ARL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9359	58.362	2	1068.6543	1068.6543	R	T	3	14
PSM	INISEGNCPER	604	sp|Q15365|PCBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	8-UNIMOD:4	ms_run[2]:scan=2687	19.791	2	1287.5877	1287.5877	R	I	47	58
PSM	ITVPFLEQCPIR	605	sp|P48147|PPCE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	9-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=10917	67.919	2	1481.794	1481.7940	K	G	49	61
PSM	IVLTNPVCTEVGEK	606	sp|P41091|IF2G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	8-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=7073	44.77	2	1563.8274	1563.8274	K	I	427	441
PSM	IYVGNLPPDIR	607	sp|Q07955-3|SRSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7571	47.602	2	1255.6925	1255.6925	R	T	18	29
PSM	IYVGNLPPDIR	608	sp|Q07955-3|SRSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7929	49.703	2	1255.6925	1255.6925	R	T	18	29
PSM	KITIADCGQLE	609	sp|P62937-2|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	7-UNIMOD:4	ms_run[2]:scan=5483	35.775	2	1246.6227	1246.6227	K	-	95	106
PSM	LANILFTQELAR	610	sp|Q8TC12-2|RDH11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10484	65.26	2	1387.7823	1387.7823	K	R	194	206
PSM	LANRAPEPTPQQVAQQQ	611	sp|Q14839|CHD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	4-UNIMOD:267	ms_run[2]:scan=3499	24.404	2	1884.9681	1884.9681	R	-	1896	1913
PSM	LCWFLDEAAAR	612	sp|O95336|6PGL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:4,11-UNIMOD:267	ms_run[2]:scan=10934	68.022	2	1360.6473	1360.6473	K	L	236	247
PSM	LFEVGGSPANTR	613	sp|Q08209-5|PP2BA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4940	32.29	2	1246.6306	1246.6306	K	Y	34	46
PSM	LLGFLDVENTPCAR	614	sp|Q5RI15|COX20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=10782	67.101	2	1613.8111	1613.8111	K	H	18	32
PSM	LLIALLESNQQK	615	sp|Q9NP81|SYSM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:188	ms_run[2]:scan=10466	65.152	2	1374.8178	1374.8178	R	D	460	472
PSM	LLLINNAGSLGDVSK	616	sp|P35270|SPRE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9171	57.216	2	1512.8512	1512.8512	R	G	95	110
PSM	LLTFMGMAVENK	617	sp|Q7L2H7-2|EIF3M_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:188	ms_run[2]:scan=10780	67.09	2	1358.7034	1358.7034	R	E	147	159
PSM	LMMDPLSGQNR	618	sp|O43390-4|HNRPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7062	44.706	2	1260.5955	1260.5955	R	G	95	106
PSM	LMMDPLSGQNR	619	sp|O43390-4|HNRPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:267	ms_run[2]:scan=7064	44.717	2	1270.6037	1270.6037	R	G	95	106
PSM	LVILANNCPALR	620	sp|P62888|RL30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	8-UNIMOD:4	ms_run[2]:scan=7548	47.465	2	1352.7598	1352.7598	K	K	45	57
PSM	LVPTGLDFGQEGFTR	621	sp|P46087-3|NOP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9835	61.247	2	1635.8257	1635.8257	R	F	535	550
PSM	LVVPASQCGSLIGK	622	sp|Q15366-7|PCBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	8-UNIMOD:4	ms_run[2]:scan=6602	42.133	2	1427.7806	1427.7806	R	G	102	116
PSM	LWTGGLDNTVR	623	sp|Q04726-2|TLE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6978	44.239	2	1230.6357	1230.6357	K	S	621	632
PSM	MLDMGFEPQIR	624	sp|P17844-2|DDX5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:35,4-UNIMOD:35,11-UNIMOD:267	ms_run[2]:scan=6487	41.467	2	1377.6296	1377.6296	R	K	174	185
PSM	MLDMGFEPQIR	625	sp|P17844-2|DDX5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	4-UNIMOD:35,11-UNIMOD:267	ms_run[2]:scan=7293	46.058	2	1361.6347	1361.6347	R	K	174	185
PSM	MLQPCGPPADKPEEN	626	sp|Q9BWJ5|SF3B5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:35,5-UNIMOD:4,11-UNIMOD:188	ms_run[2]:scan=2602	19.306	2	1703.759	1703.7590	K	-	72	87
PSM	MNPEKDFAPLTPNIVR	627	sp|Q08AM6|VAC14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:1	ms_run[2]:scan=10776	67.063	2	1882.9611	1882.9611	-	A	1	17
PSM	MSTSPEAFLALR	628	sp|P78527-2|PRKDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:35	ms_run[2]:scan=9342	58.26	2	1337.6649	1337.6649	R	S	3859	3871
PSM	MTQLVLPGMVER	629	sp|Q53GQ0|DHB12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:35,12-UNIMOD:267	ms_run[2]:scan=8602	53.802	2	1398.7239	1398.7239	K	S	168	180
PSM	MVIITGPPEAQFK	630	sp|Q9NZI8|IF2B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:35	ms_run[2]:scan=7173	45.352	2	1445.7588	1445.7588	R	A	453	466
PSM	MVIITGPPEAQFK	631	sp|Q9NZI8|IF2B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:188	ms_run[2]:scan=8587	53.709	2	1435.7841	1435.7841	R	A	453	466
PSM	NAGVEGSLIVEK	632	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:188	ms_run[2]:scan=4963	32.403	2	1220.6708	1220.6708	K	I	482	494
PSM	NFWVSGLSSTTR	633	sp|Q15424-2|SAFB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8936	55.805	2	1353.6677	1353.6677	R	A	338	350
PSM	NFWVSGLSSTTR	634	sp|Q15424-2|SAFB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:267	ms_run[2]:scan=8942	55.843	2	1363.676	1363.6760	R	A	338	350
PSM	NIPGITLLNVSK	635	sp|P36578|RL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10062	62.639	2	1267.75	1267.7500	R	L	223	235
PSM	NLLTAAADAIER	636	sp|P33897|ABCD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:267	ms_run[2]:scan=11360	70.644	2	1266.6807	1266.6807	R	I	390	402
PSM	NLNNSNLFSPVNR	637	sp|P52948-4|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7158	45.267	2	1487.7481	1487.7481	K	D	587	600
PSM	NNLAGAEELFAR	638	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8777	54.851	2	1303.6521	1303.6521	R	K	355	367
PSM	NNLAGAEELFAR	639	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:267	ms_run[2]:scan=8781	54.877	2	1313.6603	1313.6603	R	K	355	367
PSM	NSILAQVLDQSAR	640	sp|O14737|PDCD5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:267	ms_run[2]:scan=10689	66.535	2	1423.7659	1423.7659	R	A	41	54
PSM	NSILAQVLDQSAR	641	sp|O14737|PDCD5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10692	66.552	2	1413.7576	1413.7576	R	A	41	54
PSM	NSQSFFSGLFGGSSK	642	sp|P54920|SNAA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11637	72.453	2	1548.7209	1548.7209	K	I	23	38
PSM	NTGIICTIGPASR	643	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=5933	38.307	2	1368.7059	1368.7059	R	S	44	57
PSM	NTGIICTIGPASR	644	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:4	ms_run[2]:scan=5934	38.311	2	1358.6976	1358.6976	R	S	44	57
PSM	QITVNDLPVGR	645	sp|P32119|PRDX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6716	42.78	2	1210.667	1210.6670	R	S	140	151
PSM	RESPESEGPIYEGLIL	646	sp|Q96QK1|VPS35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11375	70.733	2	1787.8941	1787.8941	R	-	781	797
PSM	SAVPFLPVNPEYSATR	647	sp|Q9Y2X7|GIT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	16-UNIMOD:267	ms_run[2]:scan=9986	62.178	2	1756.9024	1756.9024	R	N	310	326
PSM	SFENSLGINVPR	648	sp|Q16851-2|UGPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8283	51.781	2	1331.6834	1331.6834	K	S	367	379
PSM	SGPRPVVLSGPSGAGK	649	sp|Q16774|KGUA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:1	ms_run[2]:scan=4680	30.926	2	1506.8154	1506.8154	M	S	2	18
PSM	SISCEEATCSDTSESILEEEPQENQKK	650	sp|O94763-2|RMP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	4-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=6006	38.715	3	3127.3445	3127.3445	R	L	364	391
PSM	SLLVNPEGPTLMR	651	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8879	55.463	2	1425.765	1425.7650	R	L	2221	2234
PSM	SLVPAAELLESR	652	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:267	ms_run[2]:scan=9702	60.441	2	1293.7168	1293.7168	R	V	3116	3128
PSM	SQETECTYFSTPLLLGK	653	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:4	ms_run[2]:scan=10973	68.26	2	1972.9452	1972.9452	K	K	280	297
PSM	STGGAPTFNVTVTK	654	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	14-UNIMOD:188	ms_run[2]:scan=5798	37.572	2	1384.7294	1384.7294	K	T	92	106
PSM	TDKSSASAPDVDDPEAFPALA	655	sp|Q8NC51-4|PAIRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8958	55.935	2	2102.9644	2102.9644	R	-	367	388
PSM	TGALLLQGFIQDR	656	sp|Q07812-5|BAX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11413	70.966	2	1430.7882	1430.7882	K	A	22	35
PSM	TIQFVDWCPTGFK	657	sp|Q71U36-2|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	8-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=11269	70.075	2	1603.78	1603.7800	R	V	305	318
PSM	TLGVDLVALATR	658	sp|P27708|PYR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:267	ms_run[2]:scan=11110	69.091	2	1237.727	1237.7270	K	V	1229	1241
PSM	TPPGVSAPTEPLLCK	659	sp|P29558-2|RBMS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	14-UNIMOD:4	ms_run[2]:scan=6696	42.665	2	1565.8123	1565.8123	K	F	208	223
PSM	TPQAPASANLVGPR	660	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	14-UNIMOD:267	ms_run[2]:scan=4257	28.588	2	1387.7447	1387.7447	R	S	2329	2343
PSM	TTNFAGILSQGLR	661	sp|P09874|PARP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:267	ms_run[2]:scan=10654	66.321	2	1386.7495	1386.7495	R	I	866	879
PSM	TVTAMDVVYALK	662	sp|P62805|H4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:188	ms_run[2]:scan=10940	68.061	2	1315.7153	1315.7153	K	R	81	93
PSM	VADIGLAAWGR	663	sp|P23526|SAHH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8783	54.888	2	1127.6087	1127.6087	K	K	9	20
PSM	VAIPASVLPGPEEPGGQR	664	sp|P48681|NEST_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7942	49.781	2	1772.9421	1772.9421	R	Q	434	452
PSM	VFDFLVDSINK	665	sp|Q12965|MYO1E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11353	70.599	2	1295.6762	1295.6762	R	A	363	374
PSM	VGINYQPPTVVPGGDLAK	666	sp|P68363-2|TBA1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8360	52.3	2	1823.9781	1823.9781	K	V	237	255
PSM	VPECLYTLPSLR	667	sp|Q13045-2|FLII_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	4-UNIMOD:4	ms_run[2]:scan=9803	61.05	2	1446.7541	1446.7541	R	R	184	196
PSM	WALSQSNPSALR	668	sp|P55072|TERA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:267	ms_run[2]:scan=6755	42.999	2	1338.692	1338.6920	R	E	454	466
PSM	YGLFPANYVELRQ	669	sp|Q14247-3|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10693	66.557	2	1568.7987	1568.7987	R	-	501	514
PSM	YGLIGLNGIGK	670	sp|Q9UG63|ABCF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:188	ms_run[2]:scan=9114	56.869	2	1109.654	1109.6540	R	S	114	125
PSM	YGLIGLNGIGK	671	sp|Q9UG63|ABCF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9131	56.974	2	1103.6339	1103.6339	R	S	114	125
PSM	YLFNCGEGVQR	672	sp|Q9BQ52-4|RNZ2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	5-UNIMOD:4	ms_run[2]:scan=6051	38.978	2	1341.6136	1341.6136	R	L	83	94
PSM	YSFLQFDPAPR	673	sp|P67775-2|PP2AA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10400	64.738	2	1339.6561	1339.6561	K	R	230	241
PSM	CRPDQLTGLSLLPLSEK	674	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:267,17-UNIMOD:188	ms_run[1]:scan=11946	74.54904666666667	2	1925.0283	1925.0258	R	A	3336	3353
PSM	TVIIEQSWGSPK	675	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=6826	43.390859999999996	2	1344.717134	1343.708516	R	V	61	73
PSM	TLTLVDTGIGMTK	676	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	13-UNIMOD:188	ms_run[1]:scan=8807	55.03547833333333	2	1354.7282	1354.7472	R	A	83	96
PSM	FLAVGLVDNTVR	677	sp|Q15393|SF3B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=9356	58.34553833333333	2	1302.727646	1302.729586	R	I	604	616
PSM	VIGSGCNLDSAR	678	sp|Q6ZMR3|LDH6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	6-UNIMOD:4	ms_run[1]:scan=2801	20.44249	2	1247.580537	1247.592835	R	F	158	170
PSM	ILLLGLDNAGK	679	sp|P36405|ARL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	11-UNIMOD:188	ms_run[1]:scan=9627	59.983998333333325	2	1131.694239	1131.695889	R	T	20	31
PSM	FVSISDLLVPK	680	sp|P50395|GDIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=12031	75.20401	2	1216.710018	1216.706725	K	D	380	391
PSM	ALLANALTSALR	681	sp|P57088|TMM33_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=10664	66.38155666666667	2	1212.717293	1212.719021	R	L	58	70
PSM	QQNHTLDYNLAPGPLGR	682	sp|Q9NR61|DLL4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:28	ms_run[1]:scan=8203	51.25075	2	1875.9237	1875.9222	K	G	608	625
PSM	VNQAIWLLCTGAR	683	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	9-UNIMOD:4	ms_run[1]:scan=10420	64.86255666666666	2	1500.786594	1500.787118	R	E	147	160
PSM	CLIATGGTPR	684	sp|O95831|AIFM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:4,10-UNIMOD:267	ms_run[1]:scan=3271	23.118251666666666	2	1054.545785	1054.546883	K	S	256	266
PSM	LLIALLESNQQK	685	sp|Q9NP81|SYSM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	12-UNIMOD:188	ms_run[1]:scan=10421	64.86813833333333	2	1374.817831	1374.817795	R	D	460	472
PSM	LPPNVVEESAR	686	sp|P01023|A2MG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=4238	28.48748333333333	2	1209.635598	1209.635351	K	A	935	946
PSM	QSGSLPLSSLTHVLR	687	sp|Q13416|ORC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:28	ms_run[1]:scan=11502	71.56290333333334	2	1576.8609	1576.8568	K	S	468	483
PSM	AAAVLPVLDLAQR	688	sp|P19404|NDUV2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:267	ms_run[2]:scan=10859	67.567	2	1345.7957	1345.7957	K	Q	76	89
PSM	AAAVLPVLDLAQR	689	sp|P19404|NDUV2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10860	67.572	2	1335.7874	1335.7874	K	Q	76	89
PSM	ACPQIVTALTLLNR	690	sp|Q14146|URB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:4	ms_run[2]:scan=11862	73.963	2	1568.8708	1568.8708	R	E	1293	1307
PSM	ADKPDMGEIASFDK	691	sp|P63313|TYB10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:1	ms_run[2]:scan=7758	48.708	2	1564.7079	1564.7079	M	A	2	16
PSM	AFSVFLFNTENK	692	sp|Q13907|IDI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11560	71.928	2	1415.7085	1415.7085	R	L	53	65
PSM	AFSVFLFNTENK	693	sp|Q13907|IDI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:188	ms_run[2]:scan=11561	71.934	2	1421.7286	1421.7286	R	L	53	65
PSM	AIPLAIFQAEPTVR	694	sp|Q07864|DPOE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11261	70.025	2	1524.8664	1524.8664	R	K	1093	1107
PSM	AITIAGVPQSVTECVK	695	sp|Q15365|PCBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=8426	52.7	2	1677.9067	1677.9067	R	Q	145	161
PSM	ALLDPPLELNSDR	696	sp|Q9P0V3-2|SH3B4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:267	ms_run[2]:scan=9219	57.503	2	1461.7703	1461.7703	K	S	358	371
PSM	APLGAGVIER	697	sp|Q8IV50|LYSM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=4711	31.087	2	991.569	991.5690	R	H	60	70
PSM	APLGAGVIER	698	sp|Q8IV50|LYSM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4715	31.104	2	981.56073	981.5607	R	H	60	70
PSM	AQLFALTGVQPAR	699	sp|P54578-2|UBP14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9018	56.3	2	1370.767	1370.7670	K	Q	31	44
PSM	AQPAQPADEPAEKADEPMEH	700	sp|P25786|PSA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:188,18-UNIMOD:35	ms_run[2]:scan=1576	13.174	2	2181.958	2181.9580	K	-	244	264
PSM	AVLLAGPPGTGK	701	sp|Q9Y265|RUVB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:188	ms_run[2]:scan=4898	32.089	2	1085.654	1085.6540	R	T	65	77
PSM	AVLLAGPPGTGK	702	sp|Q9Y265|RUVB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4909	32.145	2	1079.6339	1079.6339	R	T	65	77
PSM	DLQEFVPFGR	703	sp|Q9H1A4|APC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10518	65.465	2	1206.6033	1206.6033	R	D	16	26
PSM	DPENFPFVVLGNK	704	sp|P51149|RAB7A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11267	70.058	2	1474.7456	1474.7456	R	I	114	127
PSM	EAINVEQAFQTIAR	705	sp|P51149|RAB7A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:267	ms_run[2]:scan=11165	69.43	2	1598.8292	1598.8292	K	N	158	172
PSM	EGNPEEDLTADKANAQAAALYK	706	sp|P40121-2|CAPG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6707	42.728	3	2318.1026	2318.1026	K	V	217	239
PSM	FAEAFEAIPR	707	sp|P50990-3|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=7911	49.606	2	1159.5901	1159.5901	K	A	368	378
PSM	FAEAFEAIPR	708	sp|P50990-3|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7913	49.614	2	1149.5819	1149.5819	K	A	368	378
PSM	FDAGELITQR	709	sp|P35232|PHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=7301	46.105	2	1158.5909	1158.5909	R	E	134	144
PSM	FDAGELITQR	710	sp|P35232|PHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7302	46.11	2	1148.5826	1148.5826	R	E	134	144
PSM	FGAQLQCVTGPQATR	711	sp|O15031|PLXB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	7-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=5930	38.286	2	1642.8125	1642.8125	K	G	942	957
PSM	FIDTSQFILNR	712	sp|O60220|TIM8A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9504	59.238	2	1352.7089	1352.7089	R	L	70	81
PSM	FLEFGPENCTSWIK	713	sp|Q9BZJ0-2|CRNL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	9-UNIMOD:4	ms_run[2]:scan=11218	69.758	2	1726.8025	1726.8025	K	F	471	485
PSM	FLITGADQNR	714	sp|Q6P2E9|EDC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=4878	31.991	2	1143.5912	1143.5912	R	E	369	379
PSM	FLITGADQNR	715	sp|Q6P2E9|EDC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4882	32.014	2	1133.5829	1133.5829	R	E	369	379
PSM	FMELLEPLNER	716	sp|Q01082-3|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:35	ms_run[2]:scan=8730	54.568	2	1405.6912	1405.6912	K	K	1454	1465
PSM	FNASQLITQR	717	sp|Q99623-2|PHB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7042	44.595	2	1176.6251	1176.6251	K	A	148	158
PSM	FNASQLITQR	718	sp|Q99623-2|PHB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=7050	44.642	2	1186.6334	1186.6334	K	A	148	158
PSM	FQAFDWGSSAK	719	sp|P38571-2|LICH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8259	51.619	2	1242.5669	1242.5669	K	N	249	260
PSM	FTAIIGPNGSGK	720	sp|Q14683|SMC1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:188	ms_run[2]:scan=4964	32.407	2	1166.6391	1166.6391	R	S	27	39
PSM	FTDFQPFCCSESGPR	721	sp|O75170-6|PP6R2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	8-UNIMOD:4,9-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=8317	52.006	2	1843.7533	1843.7533	K	C	700	715
PSM	GFIGPGIDVPAPDMSTGER	722	sp|P00367|DHE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:35	ms_run[2]:scan=8733	54.584	2	1930.9095	1930.9095	K	E	213	232
PSM	GIFGSSAVPQPK	723	sp|O60341|KDM1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:188	ms_run[2]:scan=6519	41.66	2	1192.6548	1192.6548	K	E	733	745
PSM	GLGPSPAGDGPSGSGK	724	sp|Q92934|BAD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	16-UNIMOD:188	ms_run[2]:scan=1840	14.91	2	1345.6569	1345.6569	R	H	21	37
PSM	GLQSFVQCQPFER	725	sp|Q7Z6Z7-2|HUWE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	8-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=8790	54.93	2	1604.7645	1604.7645	R	L	617	630
PSM	GLQSFVQCQPFER	726	sp|Q7Z6Z7-2|HUWE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	8-UNIMOD:4	ms_run[2]:scan=8798	54.979	2	1594.7562	1594.7562	R	L	617	630
PSM	GNLGAGNGNLQGPR	727	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:267	ms_run[2]:scan=2504	18.77	2	1333.6726	1333.6726	R	H	374	388
PSM	GNVGVVLFNFGK	728	sp|P33316-2|DUT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:188	ms_run[2]:scan=11058	68.78	2	1255.702	1255.7020	R	E	107	119
PSM	GPVFAPPYEPLPENVK	729	sp|P11387|TOP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	16-UNIMOD:188	ms_run[2]:scan=9270	57.818	2	1758.9288	1758.9288	K	F	224	240
PSM	GPVGLEGLLTTK	730	sp|P54886-2|P5CS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9797	61.016	2	1183.6812	1183.6812	R	W	748	760
PSM	GPVGLEGLLTTK	731	sp|P54886-2|P5CS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9887	61.57	2	1183.6812	1183.6812	R	W	748	760
PSM	GPVGLEGLLTTK	732	sp|P54886-2|P5CS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:188	ms_run[2]:scan=9798	61.022	2	1189.7014	1189.7014	R	W	748	760
PSM	GVVQELQQAISK	733	sp|P29692-3|EF1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:188	ms_run[2]:scan=10364	64.51	2	1304.7395	1304.7395	R	L	72	84
PSM	ICSWNVDGLR	734	sp|P27695|APEX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:4	ms_run[2]:scan=7374	46.509	2	1218.5815	1218.5815	K	A	64	74
PSM	IEVIEIMTDR	735	sp|P09651-3|ROA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9685	60.335	2	1217.6326	1217.6326	K	G	131	141
PSM	IGALQGAVDR	736	sp|Q9UP83-3|COG5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3568	24.801	2	998.55089	998.5509	R	I	138	148
PSM	IGPIATPDYIQNAPGLPK	737	sp|Q9NR19|ACSA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9552	59.526	2	1864.0094	1864.0094	K	T	639	657
PSM	IGTLELGAFDGLSR	738	sp|Q96JA1-2|LRIG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10811	67.273	2	1447.7671	1447.7671	R	S	175	189
PSM	IINDLLQSLR	739	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=10169	63.295	2	1193.7007	1193.7007	R	S	385	395
PSM	IITLAGPTNAIFK	740	sp|Q15366-7|PCBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10320	64.234	2	1357.7969	1357.7969	R	A	58	71
PSM	ILQNLDPPFSIDGK	741	sp|P78332-2|RBM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:188	ms_run[2]:scan=10010	62.322	2	1561.8447	1561.8447	K	M	196	210
PSM	ILTFDQLALDSPK	742	sp|Q07020-2|RL18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10670	66.419	2	1459.7922	1459.7922	K	G	91	104
PSM	IQIAPDSGGLPER	743	sp|Q96AE4|FUBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:267	ms_run[2]:scan=5766	37.385	2	1361.7178	1361.7178	K	S	134	147
PSM	IQQGALELLR	744	sp|Q92621|NU205_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8003	50.139	2	1139.6663	1139.6663	K	S	1566	1576
PSM	ISGLIYEETR	745	sp|P62805|H4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=6114	39.332	2	1189.6218	1189.6218	R	G	47	57
PSM	ISISTSGGSFR	746	sp|P13647|K2C5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:267	ms_run[2]:scan=5433	35.483	2	1120.5752	1120.5752	R	N	74	85
PSM	IVCTPGQGLGDLR	747	sp|Q9Y5L0-5|TNPO3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=6323	40.537	2	1394.7216	1394.7216	K	T	310	323
PSM	IYGPFCECDNFSCAR	748	sp|P18084|ITB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:4,8-UNIMOD:4,13-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=8455	52.886	2	1904.7519	1904.7519	K	N	543	558
PSM	IYVGNLPPDIR	749	sp|Q07955-3|SRSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7748	48.651	2	1255.6925	1255.6925	R	T	18	29
PSM	LAALNPESNTAGLDIFAK	750	sp|O00299|CLIC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	18-UNIMOD:188	ms_run[2]:scan=10821	67.332	2	1849.9881	1849.9881	K	F	96	114
PSM	LAVNCFVNNNR	751	sp|P16422|EPCAM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	5-UNIMOD:4,11-UNIMOD:267	ms_run[2]:scan=5832	37.757	2	1329.6487	1329.6487	K	Q	34	45
PSM	LDLLGNLPGSK	752	sp|P46013-2|KI67_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:188	ms_run[2]:scan=9320	58.127	2	1131.6595	1131.6595	K	R	1568	1579
PSM	LETVGSIFSR	753	sp|Q9Y3D9|RT23_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=8110	50.738	2	1117.6007	1117.6007	R	T	6	16
PSM	LFPPDDSPLPVSSR	754	sp|Q05519-2|SRS11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7873	49.385	2	1525.7777	1525.7777	R	V	64	78
PSM	LGGAVPFAPPEVSPEQAK	755	sp|Q6ZSR9|YJ005_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8368	52.349	2	1792.9359	1792.9359	K	T	81	99
PSM	LGIGMDTCVIPLR	756	sp|P49903-2|SPS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	5-UNIMOD:35,8-UNIMOD:4	ms_run[2]:scan=8967	55.991	2	1459.7527	1459.7527	R	H	64	77
PSM	LLIALLESNQQK	757	sp|Q9NP81|SYSM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10436	64.966	2	1368.7977	1368.7977	R	D	460	472
PSM	LLLNNDNLLR	758	sp|P47755-2|CAZA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8672	54.221	2	1196.6877	1196.6877	R	E	38	48
PSM	LLSTGPTEPWSIR	759	sp|Q9H0E9-4|BRD8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8894	55.55	2	1455.7722	1455.7722	K	E	10	23
PSM	LLTFMGMAVENK	760	sp|Q7L2H7-2|EIF3M_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10774	67.051	2	1352.6832	1352.6832	R	E	147	159
PSM	LMMDPLTGLNR	761	sp|O60506-5|HNRPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:35	ms_run[2]:scan=7798	48.947	2	1275.6315	1275.6315	R	G	41	52
PSM	LMMDPLTGLNR	762	sp|O60506-5|HNRPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:35,11-UNIMOD:267	ms_run[2]:scan=8391	52.488	2	1285.6398	1285.6398	R	G	41	52
PSM	LPSTSGSEGVPFR	763	sp|P29317|EPHA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:267	ms_run[2]:scan=5720	37.115	2	1342.6756	1342.6756	R	T	895	908
PSM	LQQPAVLQPLASCPR	764	sp|Q92696|PGTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=7580	47.654	2	1686.9115	1686.9115	R	L	520	535
PSM	LSLLLNDISR	765	sp|Q15645|PCH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9838	61.263	2	1142.6659	1142.6659	K	K	369	379
PSM	LTGADGTPPGFLLK	766	sp|Q02978-2|M2OM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8684	54.289	2	1385.7555	1385.7555	R	A	58	72
PSM	LVGIFENQER	767	sp|O95989|NUDT3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6979	44.244	2	1203.6248	1203.6248	R	K	80	90
PSM	LWTGGLDNTVR	768	sp|Q04726-2|TLE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:267	ms_run[2]:scan=6969	44.189	2	1240.644	1240.6440	K	S	621	632
PSM	LWTLVSEQTR	769	sp|P46776|RL27A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=8045	50.379	2	1241.6644	1241.6644	K	V	78	88
PSM	MDRGEQGLLR	770	sp|P55327-2|TPD52_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:1	ms_run[2]:scan=5883	38.027	2	1215.603	1215.6030	-	T	1	11
PSM	MLQPCGPPADKPEEN	771	sp|Q9BWJ5|SF3B5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:35,5-UNIMOD:4	ms_run[2]:scan=2579	19.177	2	1697.7389	1697.7389	K	-	72	87
PSM	MTDVFEGSIIR	772	sp|P42285|MTREX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:35	ms_run[2]:scan=7759	48.714	2	1282.6227	1282.6227	K	C	985	996
PSM	MTQLVLPGMVER	773	sp|Q53GQ0|DHB12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:35,9-UNIMOD:35,12-UNIMOD:267	ms_run[2]:scan=6593	42.081	2	1414.7188	1414.7188	K	S	168	180
PSM	MTQLVLPGMVER	774	sp|Q53GQ0|DHB12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	9-UNIMOD:35	ms_run[2]:scan=7456	46.974	2	1388.7156	1388.7156	K	S	168	180
PSM	MVIITGPPEAQFK	775	sp|Q9NZI8|IF2B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:35,13-UNIMOD:188	ms_run[2]:scan=7172	45.346	2	1451.779	1451.7790	R	A	453	466
PSM	MYAPAWVAPEALQK	776	sp|Q13418-3|ILK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:35,14-UNIMOD:188	ms_run[2]:scan=8645	54.061	2	1595.8113	1595.8113	R	K	216	230
PSM	NAGVEGSLIVEK	777	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4967	32.423	2	1214.6507	1214.6507	K	I	482	494
PSM	NALTTLAGPLTPPVK	778	sp|Q9H3P2|NELFA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9936	61.869	2	1491.8661	1491.8661	K	H	147	162
PSM	NFLEDGESDGFLR	779	sp|Q9BXS4|TMM59_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9773	60.87	2	1497.6736	1497.6736	R	C	220	233
PSM	NLATTVTEEILEK	780	sp|O43390-4|HNRPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11772	73.359	2	1459.777	1459.7770	R	S	249	262
PSM	NLTNPNTVIILIGNK	781	sp|P61106|RAB14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	15-UNIMOD:188	ms_run[2]:scan=10398	64.72	2	1628.9557	1628.9557	R	A	111	126
PSM	NSQEDSEDSEDKDVK	782	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=568	6.9054	2	1735.7423	1735.7423	K	T	53	68
PSM	NVIGLQMGTNR	783	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:267	ms_run[2]:scan=6104	39.275	2	1211.632	1211.6320	K	G	172	183
PSM	NVMEQFNPGLR	784	sp|Q9UHR4|BI2L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7625	47.925	2	1303.6343	1303.6343	R	N	18	29
PSM	PLELELCPGR	785	sp|Q9NR45|SIAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	7-UNIMOD:4,10-UNIMOD:267	ms_run[2]:scan=7801	48.968	2	1192.615	1192.6150	M	W	2	12
PSM	PLVVFCGLPYSGK	786	sp|Q96EK9|KTI12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=10647	66.278	2	1441.7735	1441.7735	M	S	2	15
PSM	PQYQTWEEFSR	787	sp|P49458-2|SRP09_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7634	47.977	2	1469.6575	1469.6575	M	A	2	13
PSM	QFGAQANVIGPWIQTK	788	sp|P12814-2|ACTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	16-UNIMOD:188	ms_run[2]:scan=10135	63.084	2	1762.9462	1762.9462	K	M	634	650
PSM	QGGDLGWMTR	789	sp|Q9Y237|PIN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=6905	43.838	2	1129.5214	1129.5214	R	G	78	88
PSM	QGGGGGGGSVPGIER	790	sp|P52272-2|HNRPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=2410	18.248	2	1283.6218	1283.6218	K	M	350	365
PSM	QGGGGGGGSVPGIER	791	sp|P52272-2|HNRPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	15-UNIMOD:267	ms_run[2]:scan=2420	18.303	2	1293.6301	1293.6301	K	M	350	365
PSM	QGLIGVGLINVEDR	792	sp|A3KN83-3|SBNO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10465	65.146	2	1481.8202	1481.8202	R	S	1075	1089
PSM	QITVNDLPVGR	793	sp|P32119|PRDX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:267	ms_run[2]:scan=6708	42.733	2	1220.6753	1220.6753	R	S	140	151
PSM	QVPGGGGGGGSGGGGGSGGGGSGGGR	794	sp|Q9UHB9-4|SRP68_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	26-UNIMOD:267	ms_run[2]:scan=489	6.4188	3	1852.8036	1852.8036	K	G	6	32
PSM	RESPESEGPIYEGLIL	795	sp|Q96QK1|VPS35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:267	ms_run[2]:scan=11377	70.749	2	1797.9024	1797.9024	R	-	781	797
PSM	RVEIMEEESEQ	796	sp|P54578-2|UBP14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:267,5-UNIMOD:35	ms_run[2]:scan=1927	15.391	2	1403.6114	1403.6114	R	-	449	460
PSM	SCVEEPEPEPEAAEGDGDKK	797	sp|P51858-2|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:4	ms_run[2]:scan=2518	18.847	2	2171.9165	2171.9165	K	G	100	120
PSM	SEGVVAVLLTK	798	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:188	ms_run[2]:scan=9443	58.866	2	1120.6799	1120.6799	R	K	225	236
PSM	SFDAVLEALSR	799	sp|Q6P1N0-2|C2D1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11876	74.057	2	1206.6245	1206.6245	K	G	292	303
PSM	SIPLAMAPVFEQK	800	sp|Q9UBF2-2|COPG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:188	ms_run[2]:scan=10430	64.925	2	1435.7841	1435.7841	K	A	578	591
PSM	SLDMDSIIAEVK	801	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11013	68.509	2	1319.6643	1319.6643	R	A	253	265
PSM	SLFSSIGEVESAK	802	sp|Q15717|ELAV1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9406	58.642	2	1352.6824	1352.6824	R	L	38	51
PSM	SLLPGCQSVISR	803	sp|O95571|ETHE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=6689	42.628	2	1325.7001	1325.7001	R	L	93	105
PSM	SLVPAAELLESR	804	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9710	60.491	2	1283.7085	1283.7085	R	V	3116	3128
PSM	SPSPPDGSPAATPEIR	805	sp|O00499-9|BIN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4097	27.695	2	1577.7686	1577.7686	K	V	265	281
PSM	SQAPGISLPGVLVGNK	806	sp|Q9BW83-2|IFT27_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9869	61.458	2	1535.8671	1535.8671	R	T	108	124
PSM	SQETECTYFSTPLLLGK	807	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=10964	68.204	2	1978.9653	1978.9653	K	K	280	297
PSM	SRTPSASNDDQQE	808	sp|O43765|SGTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=514	6.5784	2	1433.6019	1433.6019	R	-	301	314
PSM	SSAEAQTPEDTPNKSGAEAK	809	sp|O43493-4|TGON2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=876	8.7109	2	2016.9236	2016.9236	K	T	70	90
PSM	SSGPTSLFAVTVAPPGAR	810	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9900	61.647	2	1713.905	1713.9050	K	Q	187	205
PSM	SSGPTSLFAVTVAPPGAR	811	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	18-UNIMOD:267	ms_run[2]:scan=9902	61.659	2	1723.9133	1723.9133	K	Q	187	205
PSM	SWFEGQGLAGK	812	sp|Q9H3U1-2|UN45A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7343	46.34	2	1178.572	1178.5720	K	L	386	397
PSM	TFDEIASGFR	813	sp|P11166|GTR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=7828	49.126	2	1151.5487	1151.5487	R	Q	459	469
PSM	TLDLPIYVTR	814	sp|P53621|COPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9690	60.368	2	1189.6707	1189.6707	R	V	563	573
PSM	TPPGVSAPTEPLLCK	815	sp|P29558-2|RBMS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=6714	42.764	2	1571.8325	1571.8325	K	F	208	223
PSM	TPTAPAVNLAGAR	816	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:267	ms_run[2]:scan=4846	31.818	2	1247.6862	1247.6862	R	T	2289	2302
PSM	TSFFQALGITTK	817	sp|P05388-2|RLA0_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11734	73.107	2	1312.7027	1312.7027	K	I	135	147
PSM	TVDNFVALATGEK	818	sp|P23284|PPIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9144	57.052	2	1363.6983	1363.6983	K	G	72	85
PSM	TVTAMDVVYALK	819	sp|P62805|H4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10939	68.055	2	1309.6952	1309.6952	K	R	81	93
PSM	VAVTSSSSSSSSSSSIPSAEKVPTTK	820	sp|Q6WCQ1-3|MPRIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3734	25.695	3	2497.2395	2497.2395	K	S	175	201
PSM	VCFGDFPTMPK	821	sp|Q9BQ52-4|RNZ2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:4	ms_run[2]:scan=9350	58.308	2	1297.5835	1297.5835	K	L	712	723
PSM	VFASLPQVER	822	sp|O75083|WDR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=6878	43.691	2	1154.6323	1154.6323	K	G	8	18
PSM	VFEFGGPEVLK	823	sp|Q08257|QOR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9347	58.292	2	1220.6441	1220.6441	R	L	13	24
PSM	VFIGNLNTLVVK	824	sp|P07910-4|HNRPC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10230	63.675	2	1315.7864	1315.7864	R	K	18	30
PSM	VGIGPGSVCTTR	825	sp|Q9P2T1-3|GMPR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	9-UNIMOD:4	ms_run[2]:scan=3905	26.629	2	1202.6078	1202.6078	K	K	150	162
PSM	VGIGPGSVCTTR	826	sp|Q9P2T1-3|GMPR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	9-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=3912	26.671	2	1212.616	1212.6160	K	K	150	162
PSM	VLALSFDAPGR	827	sp|Q9H1Z4-2|WDR13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:267	ms_run[2]:scan=8475	53.01	2	1154.6323	1154.6323	R	L	215	226
PSM	VLIIGGGDGGVLR	828	sp|P19623|SPEE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8339	52.152	2	1224.719	1224.7190	K	E	97	110
PSM	VLITTDLLAR	829	sp|P60842|IF4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=9311	58.073	2	1123.684	1123.6840	R	G	325	335
PSM	VLSIGDGIAR	830	sp|P25705-2|ATPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=6167	39.633	2	1009.5796	1009.5796	R	V	24	34
PSM	VLVIGAGGLGCELLK	831	sp|Q8TBC4-2|UBA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=11116	69.129	2	1503.879	1503.8790	K	N	58	73
PSM	VNFSEEGETEEDDQDSSHSSVTTVK	832	sp|Q5JTV8-3|TOIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4487	29.868	2	2755.158	2755.1580	K	A	213	238
PSM	YGGQPVPNFPSK	833	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:188	ms_run[2]:scan=5366	35.097	2	1295.6606	1295.6606	K	L	1235	1247
PSM	YISPDQLADLYK	834	sp|P06733-2|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:188	ms_run[2]:scan=9740	60.67	2	1430.7389	1430.7389	R	S	177	189
PSM	YSDPPVNFLPVPSR	835	sp|Q6P158|DHX57_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:267	ms_run[2]:scan=9743	60.692	2	1596.8176	1596.8176	K	T	432	446
PSM	YSDPPVNFLPVPSR	836	sp|Q6P158|DHX57_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9744	60.698	2	1586.8093	1586.8093	K	T	432	446
PSM	MGLAMGGGGGASFDR	837	sp|P52272|HNRPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:35,5-UNIMOD:35,15-UNIMOD:267	ms_run[1]:scan=3283	23.181651666666667	2	1424.603387	1424.605204	R	A	607	622
PSM	QGGLGPMNIPLVSDPK	838	sp|Q06830|PRDX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:28	ms_run[1]:scan=11346	70.55242833333334	2	1604.8242	1604.8227	K	R	94	110
PSM	PEFLEDPSVLTK	839	sp|P42166|LAP2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0		ms_run[1]:scan=8862	55.36009	2	1373.7073	1373.7073	M	D	2	14
PSM	QRYEILTPNAIPK	840	sp|Q7Z406|MYH14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:28	ms_run[1]:scan=8593	53.74672333333333	2	1524.8353	1524.8295	R	G	743	756
PSM	MFVLDEADEMLSR	841	sp|P60842|IF4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:35,13-UNIMOD:267	ms_run[1]:scan=10636	66.211405	2	1580.708433	1580.709000	K	G	178	191
PSM	QQEGFKGTFPDAR	842	sp|Q15233|NONO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:28	ms_run[1]:scan=6066	39.05920666666667	2	1462.6838	1462.6836	R	E	366	379
PSM	VLNLGQALER	843	sp|Q8NI27|THOC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=7768	48.76856	2	1112.625227	1111.634957	K	R	1137	1147
PSM	VLNLGQALER	844	sp|Q8NI27|THOC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=7775	48.81084333333334	2	1111.639711	1111.634957	K	R	1137	1147
PSM	NDEELNKLLGR	845	sp|P04908|H2A1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	7-UNIMOD:188,11-UNIMOD:267	ms_run[1]:scan=8678	54.25033833333333	2	1316.695481	1315.706677	R	V	90	101
PSM	SPAFVQLAPLSSK	846	sp|P51610|HCFC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=8816	55.09014499999999	2	1343.749627	1343.744902	R	V	1205	1218
PSM	QMADTGKLNTLLQR	847	sp|Q00839|HNRPU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:28	ms_run[1]:scan=8758	54.73569666666667	2	1570.8180	1570.8132	K	A	545	559
PSM	CVSSPHFQVAER	848	sp|Q14738|2A5D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=6684	42.598585	2	1398.6365	1398.6345	K	A	410	422
PSM	CVSSPHFQVAER	849	sp|Q14738|2A5D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:385,1-UNIMOD:4,12-UNIMOD:267	ms_run[1]:scan=6698	42.680335	2	1408.6445	1408.6428	K	A	410	422
PSM	TLVLIGAQGVGR	850	sp|Q14168|MPP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=7490	47.162675	2	1183.712118	1182.708457	K	R	376	388
PSM	CASCPYLGMPAFKPGEK	851	sp|Q6FI81|CPIN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:385,1-UNIMOD:4,4-UNIMOD:4,13-UNIMOD:188,17-UNIMOD:188	ms_run[1]:scan=9501	59.22043166666666	2	1906.8767	1906.8813	R	V	285	302
PSM	FAEAFEAIPR	852	sp|P50990|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	10-UNIMOD:267	ms_run[1]:scan=7972	49.96155833333333	2	1160.616120	1159.590128	K	A	441	451
PSM	QVEPLDPPAGSAPGEHVFVK	853	sp|P54577|SYYC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:28	ms_run[1]:scan=8515	53.261628333333334	2	2056.0316	2056.0260	R	G	451	471
PSM	LINLVGESLR	854	sp|P46379|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	10-UNIMOD:267	ms_run[1]:scan=8735	54.60066666666666	2	1122.671674	1122.663628	R	L	322	332
PSM	CLIATGGTPR	855	sp|O95831|AIFM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:4	ms_run[1]:scan=3262	23.067698333333333	2	1044.537929	1044.538614	K	S	256	266
PSM	VLVEGPLNNLR	856	sp|Q92900|RENT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	11-UNIMOD:267	ms_run[1]:scan=7903	49.56027833333333	2	1232.704557	1232.711640	K	E	908	919
PSM	SLFSSIGEVESAK	857	sp|Q15717|ELAV1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	13-UNIMOD:188	ms_run[1]:scan=9416	58.70155	2	1360.700392	1358.702490	R	L	38	51
PSM	AAEDDEDDDVDTKK	858	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=548	6.7844	2	1564.6377	1564.6377	R	Q	90	104
PSM	AATTGSGVKVPR	859	sp|Q13404-8|UB2V1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:1	ms_run[2]:scan=3017	21.719	2	1184.6513	1184.6513	M	N	2	14
PSM	AGFAGDDAPR	860	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:267	ms_run[2]:scan=1853	14.982	2	985.44928	985.4493	K	A	19	29
PSM	AGPGVEDLWR	861	sp|Q9UNI6|DUS12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8012	50.193	2	1098.5458	1098.5458	K	L	68	78
PSM	ALIAGGGAPEIELALR	862	sp|P50991-2|TCPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10720	66.722	2	1549.8828	1549.8828	R	L	390	406
PSM	ANFLNSNDVFVLK	863	sp|P09327|VILI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11024	68.576	2	1479.7722	1479.7722	R	T	537	550
PSM	APSYIEIFGR	864	sp|Q5T4S7-3|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:267	ms_run[2]:scan=9678	60.292	2	1161.6058	1161.6058	R	T	2364	2374
PSM	APSYIEIFGR	865	sp|Q5T4S7-3|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9683	60.324	2	1151.5975	1151.5975	R	T	2364	2374
PSM	AVVGVVAGGGR	866	sp|P62917|RL8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=2497	18.728	2	940.54541	940.5454	R	I	164	175
PSM	AWGPGLEGGVVGK	867	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7031	44.534	2	1225.6455	1225.6455	R	S	581	594
PSM	CDPVFDFGTGPR	868	sp|Q9BY44-4|EIF2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=8519	53.29	2	1376.6059	1376.6059	K	N	245	257
PSM	CIESLIAVFQK	869	sp|P31949|S10AB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:4	ms_run[2]:scan=11794	73.499	2	1306.6955	1306.6955	R	Y	13	24
PSM	CPFTGNVSIR	870	sp|P62280|RS11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:4,10-UNIMOD:267	ms_run[2]:scan=5494	35.832	2	1159.5683	1159.5683	K	G	60	70
PSM	DDTIYEDEDVKEAIR	871	sp|P14927|QCR7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6235	40.022	3	1809.8269	1809.8269	R	R	35	50
PSM	DIQGPGNPQCFSLR	872	sp|O95163|ELP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:4	ms_run[2]:scan=7085	44.846	2	1587.7464	1587.7464	R	T	14	28
PSM	DPENFPFVVLGNK	873	sp|P51149|RAB7A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11282	70.153	2	1474.7456	1474.7456	R	I	114	127
PSM	ELLLQPVTISR	874	sp|P59998|ARPC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9010	56.251	2	1267.75	1267.7500	K	N	45	56
PSM	ELPQFATGENLPR	875	sp|Q9BZZ5-3|API5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:267	ms_run[2]:scan=7756	48.698	2	1480.755	1480.7550	K	V	85	98
PSM	FDEISFVNFAR	876	sp|Q08945|SSRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:267	ms_run[2]:scan=11173	69.482	2	1353.6593	1353.6593	R	G	371	382
PSM	FFGYCNDVDR	877	sp|Q9NRP2|COXM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:4	ms_run[2]:scan=6604	42.144	2	1291.5292	1291.5292	K	E	33	43
PSM	FGVSSVAEAMALGR	878	sp|P28340|DPOD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10702	66.612	2	1393.7024	1393.7024	R	E	763	777
PSM	FLTQPQVVAR	879	sp|O43760|SNG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4928	32.237	2	1157.6557	1157.6557	R	A	20	30
PSM	FSADEFFIPR	880	sp|Q8IWT0-2|ARCH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:267	ms_run[2]:scan=10788	67.138	2	1237.6007	1237.6007	K	V	100	110
PSM	FSADEFFIPR	881	sp|Q8IWT0-2|ARCH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10789	67.144	2	1227.5924	1227.5924	K	V	100	110
PSM	FSLIDLAGNER	882	sp|O00139-2|KIF2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10314	64.194	2	1233.6354	1233.6354	K	G	407	418
PSM	FVEGLPINDFSR	883	sp|P40925-2|MDHC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:267	ms_run[2]:scan=9617	59.924	2	1402.712	1402.7120	K	E	210	222
PSM	FVEGLPINDFSR	884	sp|P40925-2|MDHC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9626	59.979	2	1392.7038	1392.7038	K	E	210	222
PSM	FVNWQVDGEYR	885	sp|O96008-2|TOM40_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:267	ms_run[2]:scan=7567	47.575	2	1421.6603	1421.6603	K	G	185	196
PSM	GAAGGAEQPGPGGR	886	sp|Q99447|PCY2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	14-UNIMOD:267	ms_run[2]:scan=671	7.5196	2	1190.5668	1190.5668	R	R	7	21
PSM	GFAFVQYVNER	887	sp|P07910-4|HNRPC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:267	ms_run[2]:scan=9377	58.47	2	1338.6596	1338.6596	K	N	51	62
PSM	GFAFVQYVNER	888	sp|P07910-4|HNRPC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9380	58.487	2	1328.6513	1328.6513	K	N	51	62
PSM	GGIVGMTLPIAR	889	sp|Q99714-2|HCD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	6-UNIMOD:35,12-UNIMOD:267	ms_run[2]:scan=7023	44.489	2	1209.6779	1209.6779	K	D	173	185
PSM	GGYFDEFGIIR	890	sp|P11413|G6PD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:267	ms_run[2]:scan=10975	68.278	2	1282.6222	1282.6222	R	D	247	258
PSM	GLAGAVSELLR	891	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:267	ms_run[2]:scan=10770	67.03	2	1094.6323	1094.6323	K	S	614	625
PSM	GLFIIDPNGVIK	892	sp|P30048-2|PRDX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11371	70.711	2	1284.7442	1284.7442	R	H	167	179
PSM	GLPWSCSADEVQR	893	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	6-UNIMOD:4	ms_run[2]:scan=6889	43.75	2	1503.6776	1503.6776	R	F	17	30
PSM	GLSNLFLSCPIPK	894	sp|Q9Y570-3|PPME1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	9-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=10999	68.42	2	1450.795	1450.7950	R	L	28	41
PSM	GLTPSQIGVILR	895	sp|P62277|RS13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:267	ms_run[2]:scan=9590	59.758	2	1262.7586	1262.7586	K	D	44	56
PSM	GQSEDPGSLLSLFR	896	sp|P08195-2|4F2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	14-UNIMOD:267	ms_run[2]:scan=12315	77.677	2	1514.7604	1514.7604	K	R	410	424
PSM	GSFSEQGINEFLR	897	sp|Q15084-3|PDIA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:267	ms_run[2]:scan=9834	61.241	2	1492.7186	1492.7186	K	E	371	384
PSM	GTRDDEYDYLFK	898	sp|P62491-2|RB11A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:1	ms_run[2]:scan=9063	56.565	2	1562.6889	1562.6889	M	V	2	14
PSM	GVVQELQQAISK	899	sp|P29692-3|EF1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10373	64.566	2	1298.7194	1298.7194	R	L	72	84
PSM	ICDDELILIK	900	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:4	ms_run[2]:scan=9206	57.427	2	1230.653	1230.6530	R	N	356	366
PSM	ICPVEFNPNFVAR	901	sp|Q9UI30-2|TR112_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:4	ms_run[2]:scan=9188	57.32	2	1561.7711	1561.7711	R	M	32	45
PSM	ICSWNVDGLR	902	sp|P27695|APEX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:4,10-UNIMOD:267	ms_run[2]:scan=7375	46.515	2	1228.5898	1228.5898	K	A	64	74
PSM	IFFAGDTIPK	903	sp|O75369-6|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8276	51.739	2	1107.5964	1107.5964	K	S	430	440
PSM	IFGGVLESDAR	904	sp|O00165-5|HAX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7168	45.325	2	1162.5982	1162.5982	R	S	92	103
PSM	IFQPVIEAPGASK	905	sp|Q9BTC0-2|DIDO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:188	ms_run[2]:scan=7141	45.167	2	1361.765	1361.7650	K	C	384	397
PSM	IFVGGLSPDTPEEK	906	sp|Q14103-4|HNRPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	14-UNIMOD:188	ms_run[2]:scan=7002	44.367	2	1493.7709	1493.7709	K	I	165	179
PSM	IGALQGAVDR	907	sp|Q9UP83-3|COG5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:267	ms_run[2]:scan=3561	24.759	2	1008.5592	1008.5592	R	I	138	148
PSM	IGQGTFGEVFK	908	sp|P50750|CDK9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7914	49.618	2	1181.6081	1181.6081	K	A	25	36
PSM	IINDLLQSLR	909	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10195	63.459	2	1183.6925	1183.6925	R	S	385	395
PSM	ILGSEGEPAFR	910	sp|Q8TED1|GPX8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:267	ms_run[2]:scan=5803	37.597	2	1184.6065	1184.6065	K	F	142	153
PSM	IMNTFSVVPSPK	911	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:35	ms_run[2]:scan=6551	41.843	2	1334.6904	1334.6904	R	V	163	175
PSM	IPANQLAELWLK	912	sp|Q9NZM1-5|MYOF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11878	74.068	2	1394.7922	1394.7922	K	L	682	694
PSM	IPEGLFDPSNVK	913	sp|O96019-2|ACL6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:188	ms_run[2]:scan=8381	52.43	2	1320.7021	1320.7021	K	G	262	274
PSM	IPLVVYGCQNER	914	sp|Q7Z6V5-2|ADAT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	8-UNIMOD:4	ms_run[2]:scan=6741	42.917	2	1446.7289	1446.7289	K	F	72	84
PSM	IQELEDLLAK	915	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9279	57.874	2	1170.6496	1170.6496	R	E	321	331
PSM	IQEPNTFPAILR	916	sp|P15586-2|GNS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:267	ms_run[2]:scan=9366	58.405	2	1407.775	1407.7750	K	S	106	118
PSM	IQQGALELLR	917	sp|Q92621|NU205_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:267	ms_run[2]:scan=8001	50.129	2	1149.6745	1149.6745	K	S	1566	1576
PSM	ISGLIYEETR	918	sp|P62805|H4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6113	39.327	2	1179.6136	1179.6136	R	G	47	57
PSM	IVAFENAFER	919	sp|O60763|USO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8490	53.097	2	1194.6033	1194.6033	K	L	203	213
PSM	IVAFENAFER	920	sp|O60763|USO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:267	ms_run[2]:scan=8491	53.103	2	1204.6116	1204.6116	K	L	203	213
PSM	IYAPQGLLLTDPIER	921	sp|Q7Z5G4-3|GOGA7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	15-UNIMOD:267	ms_run[2]:scan=10971	68.249	2	1707.9435	1707.9435	K	G	104	119
PSM	IYGISFPDPK	922	sp|P26639|SYTC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:188	ms_run[2]:scan=9205	57.421	2	1141.6115	1141.6115	R	M	297	307
PSM	KGQGGAGAGDDEEED	923	sp|P46781|RS9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=467	6.2792	2	1433.5543	1433.5543	K	-	180	195
PSM	LAATNALLNSLEFTK	924	sp|Q14974|IMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11624	72.367	2	1604.8774	1604.8774	K	A	192	207
PSM	LAGFLDLTEQEFR	925	sp|Q9Y262-2|EIF3L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11998	74.945	2	1537.7777	1537.7777	K	I	427	440
PSM	LASGDWFTSR	926	sp|P30154-4|2AAB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7451	46.945	2	1138.5407	1138.5407	R	T	147	157
PSM	LATQLTGPVMPVR	927	sp|P26373|RL13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:35	ms_run[2]:scan=5821	37.695	2	1397.7701	1397.7701	K	N	146	159
PSM	LAYINPDLALEEK	928	sp|P31948-3|STIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:188	ms_run[2]:scan=9119	56.899	2	1493.8073	1493.8073	R	N	328	341
PSM	LCQDLPCFSR	929	sp|O14929-2|HAT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:4,7-UNIMOD:4,10-UNIMOD:267	ms_run[2]:scan=6620	42.235	2	1304.5881	1304.5881	K	E	208	218
PSM	LDIDSPPITAR	930	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6439	41.195	2	1196.6401	1196.6401	R	N	33	44
PSM	LETVGSIFSR	931	sp|Q9Y3D9|RT23_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8111	50.743	2	1107.5924	1107.5924	R	T	6	16
PSM	LFIGGLNTETNEK	932	sp|P38159-2|RBMX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7404	46.677	2	1434.7355	1434.7355	K	A	10	23
PSM	LFTNFSGADLLK	933	sp|Q12800-2|TFCP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10735	66.818	2	1324.7027	1324.7027	R	L	297	309
PSM	LGVQDLFNSSK	934	sp|P30740-2|ILEU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9153	57.107	2	1206.6245	1206.6245	R	A	140	151
PSM	LIRGPAETEATTD	935	sp|Q12792-4|TWF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=2911	21.139	2	1372.6834	1372.6834	R	-	240	253
PSM	LITPAVVSER	936	sp|P62851|RS25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:267	ms_run[2]:scan=5726	37.152	2	1093.6371	1093.6371	K	L	67	77
PSM	LITPAVVSER	937	sp|P62851|RS25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5735	37.204	2	1083.6288	1083.6288	K	L	67	77
PSM	LLEGCLVGGR	938	sp|P49821-2|NDUV1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:4	ms_run[2]:scan=5846	37.834	2	1072.5699	1072.5699	K	A	129	139
PSM	LLQSNPVLEAFGNAK	939	sp|O00159-2|MYO1C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	15-UNIMOD:188	ms_run[2]:scan=10675	66.447	2	1605.8822	1605.8822	R	T	139	154
PSM	LNIPVSQVNPR	940	sp|P05023-3|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:267	ms_run[2]:scan=5880	38.014	2	1245.7069	1245.7069	R	D	617	628
PSM	LNVWDIGGQR	941	sp|P36405|ARL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:267	ms_run[2]:scan=8676	54.24	2	1166.6072	1166.6072	K	K	63	73
PSM	LQEIGLGAFER	942	sp|Q32P44|EMAL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:267	ms_run[2]:scan=9042	56.446	2	1241.6644	1241.6644	K	G	350	361
PSM	LSELEAALQR	943	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6986	44.283	2	1128.6139	1128.6139	K	A	353	363
PSM	LSELIQPLPLER	944	sp|Q92876-2|KLK6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9961	62.023	2	1406.8133	1406.8133	K	D	11	23
PSM	LSLLLNDISR	945	sp|Q15645|PCH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:267	ms_run[2]:scan=9852	61.353	2	1152.6742	1152.6742	K	K	369	379
PSM	LTFSCLGGSDNFK	946	sp|Q15185-2|TEBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:4	ms_run[2]:scan=8421	52.672	2	1444.6657	1444.6657	K	H	36	49
PSM	LVNTGLLTLR	947	sp|Q9BYT8|NEUL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8784	54.893	2	1098.6761	1098.6761	R	Q	568	578
PSM	LVNTGLLTLR	948	sp|Q9BYT8|NEUL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:267	ms_run[2]:scan=8792	54.941	2	1108.6844	1108.6844	R	Q	568	578
PSM	LVNYPGFNISTPR	949	sp|Q6NZY4-2|ZCHC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8683	54.283	2	1476.7725	1476.7725	K	G	126	139
PSM	LVQAFQFTDK	950	sp|Q06830|PRDX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:188	ms_run[2]:scan=7437	46.868	2	1201.6439	1201.6439	R	H	159	169
PSM	LVVECVMNNVTCTR	951	sp|Q01469|FABP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=8434	52.751	2	1693.795	1693.7950	K	I	116	130
PSM	MAGDPVANVR	952	sp|P30153|2AAA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:35	ms_run[2]:scan=1917	15.338	2	1044.5022	1044.5022	R	F	528	538
PSM	MENQVLTPHVYWAQR	953	sp|Q9P035-2|HACD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:1,15-UNIMOD:267	ms_run[2]:scan=10150	63.179	2	1922.9337	1922.9337	-	H	1	16
PSM	MGPSYCLPPTFPK	954	sp|O15067|PUR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:35,6-UNIMOD:4	ms_run[2]:scan=7761	48.725	2	1509.6996	1509.6996	R	A	1039	1052
PSM	MISDAIPELK	955	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:35,10-UNIMOD:188	ms_run[2]:scan=7052	44.651	2	1137.6047	1137.6047	K	A	315	325
PSM	MLGSGFKAER	956	sp|P53990-2|IST1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:1	ms_run[2]:scan=6685	42.604	2	1136.5648	1136.5648	-	L	1	11
PSM	MPDCSVALPFPSISK	957	sp|Q14676-4|MDC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:35,4-UNIMOD:4	ms_run[2]:scan=9717	60.534	2	1663.795	1663.7950	R	Q	59	74
PSM	MTQLVLPGMVER	958	sp|Q53GQ0|DHB12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:35	ms_run[2]:scan=8594	53.752	2	1388.7156	1388.7156	K	S	168	180
PSM	NALDPMSVLLAR	959	sp|P42785|PCP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:267	ms_run[2]:scan=11830	73.746	2	1308.7099	1308.7099	K	S	463	475
PSM	NCEPMIGLVPILK	960	sp|Q9Y2R9|RT07_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:4,5-UNIMOD:35	ms_run[2]:scan=10512	65.427	2	1498.7888	1498.7888	K	G	151	164
PSM	NFSGAELEGLVR	961	sp|P46459-2|NSF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9253	57.713	2	1290.6568	1290.6568	K	A	341	353
PSM	NGMLNVSPIGR	962	sp|O15305|PMM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6807	43.285	2	1156.6023	1156.6023	R	S	124	135
PSM	NINNAFGPGTANER	963	sp|Q53H47-3|SETMR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4125	27.857	2	1473.6961	1473.6961	R	T	232	246
PSM	NLIDAGVDALR	964	sp|P12268|IMDH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:267	ms_run[2]:scan=9235	57.602	2	1165.6331	1165.6331	K	V	312	323
PSM	NLNNSNLFSPVNR	965	sp|P52948-4|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:267	ms_run[2]:scan=7139	45.157	2	1497.7564	1497.7564	K	D	587	600
PSM	NLQGFLEQPK	966	sp|Q5T4S7-3|UBR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:188	ms_run[2]:scan=7427	46.809	2	1178.6391	1178.6391	K	E	4989	4999
PSM	NQLTSNPENTVFDAK	967	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	15-UNIMOD:188	ms_run[2]:scan=6494	41.511	2	1682.8207	1682.8207	K	R	82	97
PSM	NSQEDSEDSEDKDVK	968	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=570	6.9165	2	1723.702	1723.7020	K	T	53	68
PSM	NTSLPPLWSPEAER	969	sp|P49790-2|NU153_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9223	57.531	2	1595.7944	1595.7944	K	S	201	215
PSM	NVLCGNIPPDLFAR	970	sp|P23193|TCEA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	4-UNIMOD:4	ms_run[2]:scan=10333	64.312	2	1584.8082	1584.8082	K	M	209	223
PSM	QFLSQFEMQSR	971	sp|Q16630-3|CPSF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:267	ms_run[2]:scan=8640	54.028	2	1409.6637	1409.6637	K	K	162	173
PSM	RVEIMEEESEQ	972	sp|P54578-2|UBP14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:267	ms_run[2]:scan=3880	26.492	2	1387.6165	1387.6165	R	-	449	460
PSM	RVEIMEEESEQ	973	sp|P54578-2|UBP14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3882	26.503	2	1377.6082	1377.6082	R	-	449	460
PSM	SCVEEPEPEPEAAEGDGDKK	974	sp|P51858-2|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:4,19-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=2500	18.745	2	2183.9567	2183.9567	K	G	100	120
PSM	SEGVVAVLLTK	975	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9442	58.86	2	1114.6598	1114.6598	R	K	225	236
PSM	SFENSLGINVPR	976	sp|Q16851-2|UGPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:267	ms_run[2]:scan=8272	51.711	2	1341.6916	1341.6916	K	S	367	379
PSM	SGAYLIPLLER	977	sp|P26196|DDX6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:267	ms_run[2]:scan=11350	70.582	2	1240.7055	1240.7055	K	L	147	158
PSM	SGPQPTEVPGTPGPLNR	978	sp|Q2M3G4-2|SHRM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	17-UNIMOD:267	ms_run[2]:scan=5354	35.024	2	1712.8721	1712.8721	R	Q	93	110
PSM	SLDGEGNFNWR	979	sp|Q9NZM1-5|MYOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7208	45.554	2	1293.5738	1293.5738	R	F	1353	1364
PSM	SLGLQLPDGQR	980	sp|O15067|PUR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7239	45.743	2	1182.6357	1182.6357	R	R	407	418
PSM	SLLQALNEVK	981	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:188	ms_run[2]:scan=9474	59.054	2	1119.6595	1119.6595	K	G	3748	3758
PSM	SLPCFEPYEFTPR	982	sp|O95602|RPA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	4-UNIMOD:4	ms_run[2]:scan=10520	65.477	2	1641.7497	1641.7497	K	A	934	947
PSM	SPLAGDFITMQCR	983	sp|O96019-2|ACL6A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:4	ms_run[2]:scan=8846	55.263	2	1494.6959	1494.6959	K	E	153	166
PSM	SPQTPELVEALAFR	984	sp|Q9NZB2-4|F120A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	14-UNIMOD:267	ms_run[2]:scan=11298	70.255	2	1566.8281	1566.8281	K	E	652	666
PSM	SQAPGISLPGVLVGNK	985	sp|Q9BW83-2|IFT27_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	16-UNIMOD:188	ms_run[2]:scan=9862	61.414	2	1541.8873	1541.8873	R	T	108	124
PSM	SRTPSASNDDQQE	986	sp|O43765|SGTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:267	ms_run[2]:scan=513	6.5727	2	1443.6101	1443.6101	R	-	301	314
PSM	TAVETAVLLLR	987	sp|P49368-2|TCPG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10459	65.107	2	1184.7129	1184.7129	K	I	470	481
PSM	TFQGPNCPATCGR	988	sp|Q13685|AAMP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	7-UNIMOD:4,11-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=2481	18.636	2	1474.6321	1474.6321	K	V	210	223
PSM	TGALLLQGFIQDR	989	sp|Q07812-5|BAX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:267	ms_run[2]:scan=11407	70.929	2	1440.7964	1440.7964	K	A	22	35
PSM	TIAEIFGNPNYLR	990	sp|Q16401-2|PSMD5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10634	66.2	2	1506.7831	1506.7831	K	L	425	438
PSM	TIIPLISQCTPK	991	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	9-UNIMOD:4	ms_run[2]:scan=8694	54.349	2	1369.7639	1369.7639	K	V	204	216
PSM	TLGVDLVALATR	992	sp|P27708|PYR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11111	69.096	2	1227.7187	1227.7187	K	V	1229	1241
PSM	TLVLFPNIDAGSK	993	sp|Q9Y223-4|GLCNE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:188	ms_run[2]:scan=10627	66.156	2	1379.7756	1379.7756	R	E	247	260
PSM	TSVLEMIAQAR	994	sp|O60313-13|OPA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:267	ms_run[2]:scan=10966	68.222	2	1227.6521	1227.6521	K	I	266	277
PSM	TVQSLEIDLDSMR	995	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10015	62.355	2	1505.7396	1505.7396	R	N	302	315
PSM	TWNDPSVQQDIK	996	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:188	ms_run[2]:scan=5526	36.006	2	1435.7039	1435.7039	R	F	102	114
PSM	VADIGLAAWGR	997	sp|P23526|SAHH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:267	ms_run[2]:scan=8782	54.882	2	1137.617	1137.6170	K	K	9	20
PSM	VALLDFGATR	998	sp|Q8NI60-2|COQ8A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9182	57.282	2	1061.5869	1061.5869	K	E	19	29
PSM	VCFVGDGFTR	999	sp|O95478|NSA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:4,10-UNIMOD:267	ms_run[2]:scan=7001	44.362	2	1166.5418	1166.5418	K	K	153	163
PSM	VGGNIEVLGFNAR	1000	sp|Q14839|CHD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8816	55.09	2	1344.715	1344.7150	R	Q	1407	1420
PSM	VGQISFDLPR	1001	sp|Q9Y4W6|AFG32_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:267	ms_run[2]:scan=8638	54.017	2	1140.6167	1140.6167	K	Q	670	680
PSM	VGQISFDLPR	1002	sp|Q9Y4W6|AFG32_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8654	54.116	2	1130.6084	1130.6084	K	Q	670	680
PSM	VLEQLTGQTPVFSK	1003	sp|P62913-2|RL11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7946	49.807	2	1545.8403	1545.8403	K	A	38	52
PSM	VLSIGDGIAR	1004	sp|P25705-2|ATPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6158	39.581	2	999.57129	999.5713	R	V	24	34
PSM	VMIPVPAGVEDGQTVR	1005	sp|Q96EY1-3|DNJA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8076	50.55	2	1666.8712	1666.8712	R	M	151	167
PSM	VNNADDFPNLFR	1006	sp|Q13085-3|ACACA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:267	ms_run[2]:scan=9993	62.217	2	1430.6818	1430.6818	K	Q	246	258
PSM	VNPALAELNLR	1007	sp|P13489|RINI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8090	50.631	2	1208.6877	1208.6877	R	S	54	65
PSM	VTAVIPCFPYAR	1008	sp|P60891|PRPS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	7-UNIMOD:4	ms_run[2]:scan=9532	59.407	2	1392.7224	1392.7224	R	Q	85	97
PSM	VWLWTACDFADGER	1009	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	7-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=11742	73.159	2	1734.77	1734.7700	R	K	2401	2415
PSM	WASGLTPAQNCPR	1010	sp|O15533-2|TPSN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=4646	30.744	2	1466.6964	1466.6964	K	A	105	118
PSM	YISPDQLADLYK	1011	sp|P06733-2|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9770	60.853	2	1424.7187	1424.7187	R	S	177	189
PSM	YQQAGLPLIVLAGK	1012	sp|P21399|ACOC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	14-UNIMOD:188	ms_run[2]:scan=11156	69.374	2	1475.8807	1475.8807	R	E	759	773
PSM	YWLCAATGPSIK	1013	sp|P63244|RACK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	4-UNIMOD:4	ms_run[2]:scan=8264	51.652	2	1365.6751	1365.6751	R	I	246	258
PSM	QLREYQELMNVK	1014	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28	ms_run[1]:scan=9843	61.296231666666664	2	1532.7655	1532.7652	R	L	370	382
PSM	PGGWVEKETYY	1015	sp|P05023|AT1A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	7-UNIMOD:188	ms_run[1]:scan=6725	42.828541666666666	2	1334.617647	1333.628597	R	-	1013	1024
PSM	QNGDDPLLTYRFPPK	1016	sp|P02545|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28,11-UNIMOD:267,15-UNIMOD:188	ms_run[1]:scan=10595	65.95016	2	1758.8911	1758.8907	R	F	472	487
PSM	AITIANQTNCPLYITK	1017	sp|Q16555|DPYL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	10-UNIMOD:4	ms_run[1]:scan=7790	48.89603833333334	2	1820.954688	1819.950220	R	V	239	255
PSM	IIQLLDDYPK	1018	sp|Q8NHW5|RLA0L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=9099	56.77974833333333	2	1216.675536	1216.670340	K	C	17	27
PSM	EAGGGGVGGPGAK	1019	sp|Q8NC51|PAIRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=653	7.411326666666667	2	1012.489001	1012.493772	K	S	40	53
PSM	GPVGLEGLLTTK	1020	sp|P54886|P5CS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=9896	61.62515500000001	2	1183.680251	1183.681239	R	W	750	762
PSM	FGGALDAAAK	1021	sp|P53396|ACLY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	10-UNIMOD:188	ms_run[1]:scan=3353	23.570515	2	925.499191	925.496460	R	M	935	945
PSM	IGGIGTVPVGR	1022	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	11-UNIMOD:267	ms_run[1]:scan=4973	32.457095	2	1034.609665	1034.611198	K	V	256	267
PSM	QADFEAHNILR	1023	sp|P49915|GUAA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28,11-UNIMOD:267	ms_run[1]:scan=7383	46.55941	2	1305.6424	1305.6336	R	E	590	601
PSM	IWDLQGSEEPVFR	1024	sp|Q6RFH5|WDR74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=10115	62.96185	2	1574.771720	1574.772908	K	A	157	170
PSM	QHPGCLAQEACVR	1025	sp|Q08426|ECHP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28,5-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=4382	29.283516666666667	2	1507.6646	1507.6655	R	A	223	236
PSM	MTISQQEFGR	1026	sp|P55036|PSMD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:35,10-UNIMOD:267	ms_run[1]:scan=3381	23.73815666666667	2	1221.567776	1221.568741	K	T	263	273
PSM	VLVTGATGLLGR	1027	sp|Q9NZL9|MAT2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=7831	49.14167	2	1155.692446	1155.697558	R	A	31	43
PSM	QKPSNTEDFIEDIVK	1028	sp|P46063|RECQ1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28	ms_run[1]:scan=11130	69.21333833333333	2	1744.8501	1744.8514	R	L	292	307
PSM	QMVIDVLHPGK	1029	sp|P62847|RS24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28,2-UNIMOD:35	ms_run[1]:scan=7697	48.344748333333335	2	1234.6411	1234.6375	K	A	22	33
PSM	QMVIDVLHPGK	1030	sp|P62847|RS24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28	ms_run[1]:scan=9762	60.804763333333334	2	1218.6408	1218.6426	K	A	22	33
PSM	QMVIDVLHPGK	1031	sp|P62847|RS24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28	ms_run[1]:scan=9938	61.879758333333335	2	1218.6408	1218.6426	K	A	22	33
PSM	QLEMILNKPGLK	1032	sp|Q04828|AK1C1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28,4-UNIMOD:35	ms_run[1]:scan=9195	57.36159666666667	2	1381.7596	1381.7634	R	Y	172	184
PSM	QLLAGGIAGAVSR	1033	sp|Q6NUK1|SCMC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=7187	45.43543333333333	2	1211.701521	1211.698620	R	T	197	210
PSM	GFGFVTFENSADADR	1034	sp|Q9NWB1|RFOX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=9964	62.03912333333333	2	1631.727063	1631.721600	K	A	157	172
PSM	LINNNPEIFGPLK	1035	sp|Q9NW13|RBM28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	13-UNIMOD:188	ms_run[1]:scan=9136	57.002183333333335	2	1473.826539	1473.828694	R	R	559	572
PSM	VSGGLEVLAEK	1036	sp|P39687|AN32A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=6357	40.73787	2	1101.619666	1100.607740	R	C	76	87
PSM	AAEAAPPTQEAQGETEPTEQAPDALEQAADTSRR	1037	sp|Q8N163-2|CCAR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6431	41.149	3	3535.6299	3535.6299	K	N	447	481
PSM	AALNALQPPEFR	1038	sp|Q3ZAQ7|VMA21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8406	52.58	2	1325.7092	1325.7092	K	N	7	19
PSM	ACGLNFADLMAR	1039	sp|Q99536|VAT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:4	ms_run[2]:scan=10800	67.207	2	1337.622	1337.6220	R	Q	85	97
PSM	ADLINNLGTIAK	1040	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:188	ms_run[2]:scan=8451	52.865	2	1247.7181	1247.7181	K	S	101	113
PSM	AGFAGDDAPR	1041	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=1839	14.905	2	975.44101	975.4410	K	A	19	29
PSM	AGSSAAGASGWTSAGSLNSVPTNSAQQGHNSPDSPVTSAAK	1042	sp|Q86XP3-2|DDX42_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6419	41.085	3	3811.7634	3811.7634	K	G	602	643
PSM	AIPLAIFQAEPTVR	1043	sp|Q07864|DPOE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11245	69.925	2	1524.8664	1524.8664	R	K	1093	1107
PSM	AIVEFLSNLAR	1044	sp|Q13112|CAF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11790	73.47	2	1231.6925	1231.6925	K	H	54	65
PSM	ALMDSLGPEWR	1045	sp|Q15785|TOM34_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:267	ms_run[2]:scan=9415	58.696	2	1283.6208	1283.6208	R	L	131	142
PSM	ALQFLQIDSCR	1046	sp|Q7L5Y1-7|ENOF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:4	ms_run[2]:scan=9261	57.762	2	1349.6762	1349.6762	K	L	91	102
PSM	ALQFLQIDSCR	1047	sp|Q7L5Y1-7|ENOF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:4,11-UNIMOD:267	ms_run[2]:scan=9262	57.768	2	1359.6844	1359.6844	K	L	91	102
PSM	AMGIMNSFVNDIFER	1048	sp|O60814|H2B1K_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	5-UNIMOD:35	ms_run[2]:scan=11990	74.893	2	1758.8069	1758.8069	K	I	59	74
PSM	AVSTGVKVPR	1049	sp|Q15819|UB2V2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:1	ms_run[2]:scan=4079	27.595	2	1054.6135	1054.6135	M	N	2	12
PSM	AWMAFMSEAER	1050	sp|Q9UNF0-2|PACN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:267	ms_run[2]:scan=10205	63.521	2	1337.5772	1337.5772	K	V	82	93
PSM	CDENILWLDYK	1051	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:4,11-UNIMOD:188	ms_run[2]:scan=10581	65.866	2	1473.6905	1473.6905	K	N	152	163
PSM	CDENILWLDYK	1052	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:4	ms_run[2]:scan=10586	65.894	2	1467.6704	1467.6704	K	N	152	163
PSM	CDPVFDFGTGPR	1053	sp|Q9BY44-4|EIF2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:4	ms_run[2]:scan=8528	53.345	2	1366.5976	1366.5976	K	N	245	257
PSM	CPGESLINPGFK	1054	sp|Q9BUH6|PAXX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:4,12-UNIMOD:188	ms_run[2]:scan=7134	45.126	2	1323.6589	1323.6589	R	S	180	192
PSM	DGEDQTQDTELVETRPAGDGTFQK	1055	sp|P10321-2|HLAC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5592	36.383	3	2636.1838	2636.1838	R	W	244	268
PSM	DGKLVSESSDVLPK	1056	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=5711	37.063	2	1484.8125	1484.8125	R	-	470	484
PSM	DIQYPFLGPVPTR	1057	sp|Q14CX7-2|NAA25_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:267	ms_run[2]:scan=10479	65.228	2	1511.8012	1511.8012	K	M	748	761
PSM	DPENFPFVVLGNK	1058	sp|P51149|RAB7A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:188	ms_run[2]:scan=11265	70.047	2	1480.7658	1480.7658	R	I	114	127
PSM	ELGSLPLPLSTSEQR	1059	sp|Q86Y82|STX12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9576	59.672	2	1625.8625	1625.8625	K	Q	83	98
PSM	ENGELLPILR	1060	sp|O76003|GLRX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9790	60.973	2	1152.6503	1152.6503	K	G	323	333
PSM	FDGAEGSWFQK	1061	sp|Q92888-2|ARHG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7568	47.581	2	1270.5619	1270.5619	R	I	467	478
PSM	FEELNADLFR	1062	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9810	61.093	2	1252.6088	1252.6088	R	G	302	312
PSM	FINDCTELFR	1063	sp|O94874-3|UFL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	5-UNIMOD:4	ms_run[2]:scan=8307	51.931	2	1313.6074	1313.6074	K	E	368	378
PSM	FVCVGGSPSR	1064	sp|Q16831|UPP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:4	ms_run[2]:scan=2605	19.322	2	1064.5073	1064.5073	K	M	55	65
PSM	FVNWQVDGEYR	1065	sp|O96008-2|TOM40_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7577	47.633	2	1411.6521	1411.6521	K	G	185	196
PSM	GAGTGGLGLAVEGPSEAK	1066	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	18-UNIMOD:188	ms_run[2]:scan=6255	40.135	2	1575.82	1575.8200	R	M	1382	1400
PSM	GGDPFWDGPGDPMR	1067	sp|Q96QC0|PP1RA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9172	57.222	2	1502.6249	1502.6249	R	G	675	689
PSM	GGIVGMTLPIAR	1068	sp|Q99714-2|HCD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:267	ms_run[2]:scan=9583	59.715	2	1193.683	1193.6830	K	D	173	185
PSM	GIGTDEFTLNR	1069	sp|P12429|ANXA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:267	ms_run[2]:scan=6906	43.842	2	1231.6072	1231.6072	K	I	264	275
PSM	GIVNEQFLLQR	1070	sp|P49748-2|ACADV_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:267	ms_run[2]:scan=8980	56.071	2	1325.7331	1325.7331	K	L	535	546
PSM	GLAGAVSELLR	1071	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10772	67.04	2	1084.6241	1084.6241	K	S	614	625
PSM	GLGLEPTALAR	1072	sp|Q8WZA9|IRGQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7181	45.4	2	1096.6241	1096.6241	R	R	519	530
PSM	GLPSPYNMSSAPGSR	1073	sp|P15924-2|DESP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6271	40.229	2	1519.7089	1519.7089	K	S	2213	2228
PSM	GNVGVVLFNFGK	1074	sp|P33316-2|DUT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11060	68.791	2	1249.6819	1249.6819	R	E	107	119
PSM	GPGGSQGSQGPSPQGAR	1075	sp|Q96MG7|NSE3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=742	7.9602	2	1523.7077	1523.7077	R	R	53	70
PSM	GPIVPLNVADQK	1076	sp|P55011-3|S12A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6680	42.578	2	1249.703	1249.7030	K	L	980	992
PSM	GQVWINGFNLGR	1077	sp|P16278-2|BGAL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:267	ms_run[2]:scan=10245	63.764	2	1369.713	1369.7130	K	Y	448	460
PSM	ICDDELILIK	1078	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:4,10-UNIMOD:188	ms_run[2]:scan=9207	57.432	2	1236.6731	1236.6731	R	N	356	366
PSM	ICSLHSLPPQS	1079	sp|P03928|ATP8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:4	ms_run[2]:scan=4213	28.349	2	1237.6125	1237.6125	K	-	58	69
PSM	IDTIEIITDR	1080	sp|P22626-2|ROA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8332	52.109	2	1187.6398	1187.6398	K	Q	126	136
PSM	IFFAGDTIPK	1081	sp|O75369-6|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:188	ms_run[2]:scan=8338	52.147	2	1113.6166	1113.6166	K	S	430	440
PSM	IFGVTTLDIVR	1082	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11039	68.669	2	1232.7129	1232.7129	K	A	166	177
PSM	ILGNQGSFLTK	1083	sp|P01730|CD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6569	41.946	2	1176.6503	1176.6503	K	G	61	72
PSM	ILVATNLFGR	1084	sp|Q13838-2|DX39B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9668	60.231	2	1102.6499	1102.6499	R	G	355	365
PSM	IWSVPNASCVQVVR	1085	sp|Q9UMS4|PRP19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	9-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=8759	54.741	2	1623.8431	1623.8431	R	A	290	304
PSM	IYVGNLPPDIR	1086	sp|Q07955-3|SRSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:267	ms_run[2]:scan=7572	47.606	2	1265.7007	1265.7007	R	T	18	29
PSM	IYVGNLPPDIR	1087	sp|Q07955-3|SRSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8123	50.806	2	1255.6925	1255.6925	R	T	18	29
PSM	IYVGNLPPDIR	1088	sp|Q07955-3|SRSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8442	52.806	2	1255.6925	1255.6925	R	T	18	29
PSM	KITIADCGQLE	1089	sp|P62937-2|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:188,7-UNIMOD:4	ms_run[2]:scan=5478	35.747	2	1252.6429	1252.6429	K	-	95	106
PSM	LAGTQPLEVLEAVQR	1090	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10688	66.529	2	1622.8992	1622.8992	R	S	639	654
PSM	LCWFLDEAAAR	1091	sp|O95336|6PGL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:4	ms_run[2]:scan=10919	67.93	2	1350.6391	1350.6391	K	L	236	247
PSM	LFGQETPEQR	1092	sp|O95219|SNX4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:267	ms_run[2]:scan=3861	26.389	2	1213.5967	1213.5967	K	E	362	372
PSM	LFTNFSGADLLK	1093	sp|Q12800-2|TFCP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:188	ms_run[2]:scan=10736	66.824	2	1330.7228	1330.7228	R	L	297	309
PSM	LGGPEAGLGEYLFER	1094	sp|P02792|FRIL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	15-UNIMOD:267	ms_run[2]:scan=11119	69.146	2	1616.8074	1616.8074	R	L	155	170
PSM	LGPEGELLIR	1095	sp|Q15758-3|AAAT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:267	ms_run[2]:scan=7918	49.643	2	1105.6371	1105.6371	K	F	20	30
PSM	LGSFNWYGEQCSCGR	1096	sp|Q9UNI6|DUS12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=8329	52.088	2	1819.7406	1819.7406	K	W	297	312
PSM	LGVIPNVEGR	1097	sp|P22570-4|ADRO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:267	ms_run[2]:scan=6505	41.575	2	1062.6061	1062.6061	K	V	325	335
PSM	LLAVQELLDR	1098	sp|Q7L9B9|EEPD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11162	69.414	2	1168.6816	1168.6816	K	E	296	306
PSM	LLCGGGIAADR	1099	sp|P05091-2|ALDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:4,11-UNIMOD:267	ms_run[2]:scan=3913	26.676	2	1111.5683	1111.5683	K	G	337	348
PSM	LLNLEGFPSGSQSR	1100	sp|Q8IYB8|SUV3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8700	54.388	2	1503.7682	1503.7682	K	L	685	699
PSM	LMMDPLTGLNR	1101	sp|O60506-5|HNRPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:35	ms_run[2]:scan=8393	52.499	2	1275.6315	1275.6315	R	G	41	52
PSM	LNLGTVGFYR	1102	sp|P55786-2|PSA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:267	ms_run[2]:scan=8969	56.007	2	1148.6218	1148.6218	K	T	501	511
PSM	LNVWDIGGQR	1103	sp|P36405|ARL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8681	54.272	2	1156.5989	1156.5989	K	K	63	73
PSM	LPDGTSLTQTFR	1104	sp|Q04323|UBXN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:267	ms_run[2]:scan=7394	46.62	2	1344.6913	1344.6913	R	A	220	232
PSM	LPTGQISGPEIK	1105	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5616	36.515	2	1238.6871	1238.6871	K	G	5513	5525
PSM	LQLWDIAGQER	1106	sp|O14966|RAB7L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9879	61.519	2	1327.6884	1327.6884	R	F	59	70
PSM	LQLWDTAGQER	1107	sp|P20340-2|RAB6A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6899	43.803	2	1315.6521	1315.6521	R	F	64	75
PSM	LTIGSNLSIR	1108	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7287	46.02	2	1072.6241	1072.6241	R	I	251	261
PSM	LVFPQDLLEK	1109	sp|Q8TCT9-5|HM13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:188	ms_run[2]:scan=10823	67.348	2	1206.6956	1206.6956	K	G	200	210
PSM	LVGLEAPSVR	1110	sp|Q8NBN7-2|RDH13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:267	ms_run[2]:scan=6326	40.553	2	1049.6109	1049.6109	R	E	245	255
PSM	LVLDFINAGGAR	1111	sp|Q9P2K6|KLH42_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10177	63.346	2	1244.6877	1244.6877	R	E	64	76
PSM	LWDLTTGTTTR	1112	sp|P63244|RACK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:267	ms_run[2]:scan=7492	47.172	2	1273.6542	1273.6542	R	R	89	100
PSM	MELVQVLKR	1113	sp|Q9UI09-2|NDUAC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:1	ms_run[2]:scan=11551	71.872	2	1156.6638	1156.6638	-	G	1	10
PSM	MIDLSGNPVLR	1114	sp|O14735-3|CDIPT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:35	ms_run[2]:scan=7195	45.48	2	1229.6438	1229.6438	K	I	77	88
PSM	MIDLSGNPVLR	1115	sp|O14735-3|CDIPT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:35,11-UNIMOD:267	ms_run[2]:scan=7212	45.581	2	1239.6521	1239.6521	K	I	77	88
PSM	MIDLSGNPVLR	1116	sp|O14735-3|CDIPT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:267	ms_run[2]:scan=8311	51.957	2	1223.6572	1223.6572	K	I	77	88
PSM	MLATLEPEQR	1117	sp|P54886-2|P5CS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:35,10-UNIMOD:267	ms_run[2]:scan=3682	25.413	2	1212.6048	1212.6048	R	A	374	384
PSM	MLDMGFEPQIR	1118	sp|P17844-2|DDX5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:267	ms_run[2]:scan=9438	58.838	2	1345.6398	1345.6398	R	K	174	185
PSM	MNGALPSDAVGYR	1119	sp|Q8WUX1|S38A5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:35,13-UNIMOD:267	ms_run[2]:scan=4610	30.543	2	1375.643	1375.6430	K	Q	8	21
PSM	MNGALPSDAVGYR	1120	sp|Q8WUX1|S38A5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:35	ms_run[2]:scan=4601	30.494	2	1365.6347	1365.6347	K	Q	8	21
PSM	MPSLEISAPK	1121	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:188	ms_run[2]:scan=7040	44.585	2	1077.5836	1077.5836	K	V	4906	4916
PSM	MVPAGMGAGLER	1122	sp|P52272-2|HNRPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:35	ms_run[2]:scan=4368	29.207	2	1203.574	1203.5740	R	M	493	505
PSM	NFGIGQDIQPK	1123	sp|P62424|RL7A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6160	39.591	2	1215.6248	1215.6248	K	R	38	49
PSM	NGPLPIPSEGSGFTK	1124	sp|Q5VYK3|ECM29_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7575	47.622	2	1499.762	1499.7620	R	L	823	838
PSM	NSGQNLEEDMGQSEQKADPPATEK	1125	sp|Q9HAV7|GRPE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4555	30.234	2	2602.1453	2602.1453	K	T	35	59
PSM	NYGQLDIFPAR	1126	sp|P15941-12|MUC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9174	57.233	2	1292.6513	1292.6513	K	D	94	105
PSM	PLAQLADPWQK	1127	sp|P51812|KS6A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8655	54.121	2	1265.6768	1265.6768	M	M	2	13
PSM	PLAQLADPWQK	1128	sp|P51812|KS6A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:188	ms_run[2]:scan=8658	54.138	2	1271.697	1271.6970	M	M	2	13
PSM	PPEVFEQEIR	1129	sp|Q9C0C9|UBE2O_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6649	42.398	2	1242.6245	1242.6245	R	Q	1119	1129
PSM	PQYQTWEEFSR	1130	sp|P49458-2|SRP09_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:267	ms_run[2]:scan=7629	47.945	2	1479.6658	1479.6658	M	A	2	13
PSM	QGIVPPGLTENELWR	1131	sp|Q9H9B4|SFXN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10897	67.798	2	1707.8944	1707.8944	R	A	56	71
PSM	QIGENLIVPGGVK	1132	sp|Q16555-2|DPYL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:188	ms_run[2]:scan=7445	46.915	2	1328.7759	1328.7759	K	T	8	21
PSM	SEKENNFPPLPK	1133	sp|Q969E2-3|SCAM4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:1,3-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=6141	39.487	2	1452.7652	1452.7652	M	F	2	14
PSM	SGAPVLSLLSVR	1134	sp|Q9BRP4-3|PAAF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:267	ms_run[2]:scan=11297	70.249	2	1207.7164	1207.7164	R	D	206	218
PSM	SGDETPGSEVPGDKAAEEQGDDQDSEK	1135	sp|Q1KMD3|HNRL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2619	19.404	2	2776.1431	2776.1431	R	S	161	188
PSM	SGQGAFGNMCR	1136	sp|P36578|RL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:4,11-UNIMOD:267	ms_run[2]:scan=3147	22.429	2	1193.4945	1193.4945	R	G	87	98
PSM	SGQGAFGNMCR	1137	sp|P36578|RL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:4	ms_run[2]:scan=3153	22.465	2	1183.4863	1183.4863	R	G	87	98
PSM	SIPLAMAPVFEQK	1138	sp|Q9UBF2-2|COPG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10428	64.914	2	1429.7639	1429.7639	K	A	578	591
PSM	SLLVNPEGPTLMR	1139	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:267	ms_run[2]:scan=8876	55.441	2	1435.7733	1435.7733	R	L	2221	2234
PSM	SPDFTNENPLETR	1140	sp|P05023-3|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6846	43.508	2	1518.6951	1518.6951	R	N	197	210
PSM	SSAFGTLNWFTK	1141	sp|Q4KMQ2-3|ANO6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:188	ms_run[2]:scan=11525	71.712	2	1363.6868	1363.6868	R	V	137	149
PSM	TDGEPGPQGWSPR	1142	sp|Q9H773|DCTP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4362	29.172	2	1382.6215	1382.6215	K	E	75	88
PSM	TLGGLEMELR	1143	sp|Q9Y4L1|HYOU1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:267	ms_run[2]:scan=8352	52.25	2	1127.5884	1127.5884	R	L	269	279
PSM	TLGGLEMELR	1144	sp|Q9Y4L1|HYOU1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8372	52.376	2	1117.5801	1117.5801	R	L	269	279
PSM	TLQIFNIEMK	1145	sp|Q00610-2|CLH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:188	ms_run[2]:scan=10991	68.371	2	1241.6785	1241.6785	K	S	87	97
PSM	TLVLFPNIDAGSK	1146	sp|Q9Y223-4|GLCNE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10638	66.223	2	1373.7555	1373.7555	R	E	247	260
PSM	TPEGLPDAPR	1147	sp|Q92673|SORL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3617	25.07	2	1051.5298	1051.5298	R	N	1646	1656
PSM	TSFFQALGITTK	1148	sp|P05388-2|RLA0_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:188	ms_run[2]:scan=11728	73.067	2	1318.7228	1318.7228	K	I	135	147
PSM	TVIIEQSWGSPK	1149	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:188	ms_run[2]:scan=6834	43.438	2	1349.7286	1349.7286	R	V	61	73
PSM	TVLPFSQEFQR	1150	sp|Q7L576-3|CYFP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:267	ms_run[2]:scan=9357	58.351	2	1360.7015	1360.7015	R	D	61	72
PSM	VALIGFPSVGK	1151	sp|P55039|DRG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:188	ms_run[2]:scan=9469	59.022	2	1092.6639	1092.6639	R	S	65	76
PSM	VCFVGDGFTR	1152	sp|O95478|NSA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:4	ms_run[2]:scan=6991	44.305	2	1156.5335	1156.5335	K	K	153	163
PSM	VDFPQDQLTALTGR	1153	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9775	60.881	2	1559.7944	1559.7944	K	I	216	230
PSM	VEILANDQGNR	1154	sp|P17066|HSP76_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2634	19.494	2	1227.6208	1227.6208	R	T	28	39
PSM	VFEFGGPEVLK	1155	sp|Q08257|QOR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:188	ms_run[2]:scan=9349	58.303	2	1226.6643	1226.6643	R	L	13	24
PSM	VHNNLQDGTEV	1156	sp|Q86XX4|FRAS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2432	18.365	2	1224.5735	1224.5735	R	-	3998	4009
PSM	VLTGNAIALVLGGGGAR	1157	sp|Q6ZV29-3|PLPL7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	17-UNIMOD:267	ms_run[2]:scan=11637	72.453	2	1547.9023	1547.9023	R	G	920	937
PSM	VNAVYLLPVPK	1158	sp|P42694-2|HELZ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9722	60.562	2	1211.7278	1211.7278	K	Q	531	542
PSM	VTAVIPCFPYAR	1159	sp|P60891|PRPS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	7-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=9536	59.434	2	1402.7307	1402.7307	R	Q	85	97
PSM	YGDLANWMIPGK	1160	sp|P55809|SCOT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10494	65.319	2	1363.6595	1363.6595	K	M	407	419
PSM	VEIIANDQGNR	1161	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	11-UNIMOD:267	ms_run[1]:scan=2624	19.431808333333333	2	1237.629206	1237.629033	R	I	50	61
PSM	ELVGPPLAETVFTPK	1162	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=10719	66.71668000000001	2	1596.876757	1596.876310	K	T	1384	1399
PSM	LQIWDTAGQER	1163	sp|P61026|RAB10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=7330	46.27012166666667	2	1316.660386	1315.652064	K	F	60	71
PSM	NSNLVGAAHEELQQSR	1164	sp|P02545|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=6251	40.11304166666667	2	1752.838671	1751.855074	R	I	281	297
PSM	QNGDDPLLTYRFPPK	1165	sp|P02545|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28	ms_run[1]:scan=10182	63.37307	2	1742.8618	1742.8623	R	F	472	487
PSM	SLGLQLPDGQR	1166	sp|O15067|PUR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=7221	45.63413166666667	2	1182.639142	1182.635686	R	R	407	418
PSM	ALEAANGELEVK	1167	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	12-UNIMOD:188	ms_run[1]:scan=4813	31.637355	2	1248.666534	1248.665711	R	I	100	112
PSM	SPISQLDCLNR	1168	sp|Q04726|TLE3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	8-UNIMOD:4	ms_run[1]:scan=7034	44.54872	2	1301.636012	1301.639785	K	D	521	532
PSM	QTSDGNWLMVHR	1169	sp|O75131|CPNE3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28	ms_run[1]:scan=7952	49.839371666666665	2	1425.6407	1425.6454	K	T	168	180
PSM	IGGIGTVPVGR	1170	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	11-UNIMOD:267	ms_run[1]:scan=5784	37.48923166666666	2	1034.606220	1034.611198	K	V	256	267
PSM	QADFEAHNILR	1171	sp|P49915|GUAA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28,11-UNIMOD:267	ms_run[1]:scan=7351	46.384013333333336	2	1305.6424	1305.6336	R	E	590	601
PSM	ILGVGPDDPDLVR	1172	sp|P48449|ERG7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=8528	53.34517833333333	2	1364.736231	1364.729980	R	A	163	176
PSM	MELVQVLKR	1173	sp|Q9UI09|NDUAC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:1	ms_run[1]:scan=11545	71.83378499999999	2	1156.665406	1156.663815	-	G	1	10
PSM	FAEAFEAIPR	1174	sp|P50990|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0		ms_run[1]:scan=8001	50.128575	2	1149.5783	1149.5813	K	A	441	451
PSM	QMVIDVLHPGK	1175	sp|P62847|RS24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28,11-UNIMOD:188	ms_run[1]:scan=9925	61.80242166666667	2	1224.6604	1224.6627	K	A	22	33
PSM	QMVIDVLHPGK	1176	sp|P62847|RS24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28,2-UNIMOD:35,11-UNIMOD:188	ms_run[1]:scan=7667	48.172806666666666	2	1240.6610	1240.6576	K	A	22	33
PSM	TIDDLKNQILNLTTDNANILLQIDNAR	1177	sp|P13645|K1C10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=13293	91.02361666666667	3	3051.625351	3051.620043	K	L	202	229
PSM	QFHLTDDDLLR	1178	sp|Q04446|GLGB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28	ms_run[1]:scan=10284	64.01013166666667	2	1354.6509	1354.6512	R	Y	566	577
PSM	TSVLEMIAQAR	1179	sp|O60313|OPA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	11-UNIMOD:267	ms_run[1]:scan=11029	68.608565	2	1227.653015	1227.652077	K	I	302	313
PSM	AAPSDGFKPR	1180	sp|Q92979|NEP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1,8-UNIMOD:188,10-UNIMOD:267	ms_run[1]:scan=2929	21.240638333333333	2	1102.5737	1102.5737	M	E	2	12
PSM	QLEMILNKPGLK	1181	sp|Q04828|AK1C1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28	ms_run[1]:scan=10563	65.75183333333334	2	1365.7677	1365.7685	R	Y	172	184
PSM	QDFVQHFSQIVR	1182	sp|P14324|FPPS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28,12-UNIMOD:267	ms_run[1]:scan=10671	66.42507666666667	2	1496.7362	1495.7442	K	V	81	93
PSM	LPPNVVEESAR	1183	sp|P01023|A2MG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=4055	27.456206666666667	2	1209.635598	1209.635351	K	A	935	946
PSM	LLNGSAGDTWR	1184	sp|P08138|TNR16_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	11-UNIMOD:267	ms_run[1]:scan=6298	40.390368333333335	2	1199.582701	1198.597005	K	H	350	361
PSM	FMELLEPLNER	1185	sp|Q01082|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	11-UNIMOD:267	ms_run[1]:scan=10912	67.89150666666667	2	1399.704746	1399.704506	K	K	1467	1478
PSM	MFVLDEADEMLSR	1186	sp|P60842|IF4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:35	ms_run[1]:scan=10533	65.55502833333333	2	1570.700725	1570.700731	K	G	178	191
PSM	AAILPTSIFLTNK	1187	sp|O14744-3|ANM5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	13-UNIMOD:188	ms_run[2]:scan=11335	70.485	2	1393.8276	1393.8276	K	K	167	180
PSM	AAYKLVLIR	1188	sp|P18669|PGAM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:1	ms_run[2]:scan=9789	60.968	2	1087.6754	1087.6754	M	H	2	11
PSM	AEFTSPPSLFK	1189	sp|Q6UN15-4|FIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:188	ms_run[2]:scan=8801	54.996	2	1228.6435	1228.6435	K	T	240	251
PSM	AFFPCFDTPAVK	1190	sp|Q9H4A4|AMPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	5-UNIMOD:4,12-UNIMOD:188	ms_run[2]:scan=10463	65.135	2	1404.6843	1404.6843	R	Y	177	189
PSM	AFITNIPFDVK	1191	sp|P52272-2|HNRPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10752	66.921	2	1263.6863	1263.6863	R	W	73	84
PSM	APVPASELLASGVLSR	1192	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10229	63.669	3	1565.8777	1565.8777	R	A	3447	3463
PSM	ASFVTEVLAHSGR	1193	sp|O43264-2|ZW10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:1	ms_run[2]:scan=12504	79.851	2	1414.7205	1414.7205	M	L	2	15
PSM	AVAQALEVIPR	1194	sp|P49368-2|TCPG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:267	ms_run[2]:scan=7560	47.533	2	1175.6902	1175.6902	R	T	401	412
PSM	AWGPGLEGGVVGK	1195	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	13-UNIMOD:188	ms_run[2]:scan=7024	44.493	2	1231.6657	1231.6657	R	S	581	594
PSM	CALSSPSLAFTPPIK	1196	sp|Q8NFH5-3|NUP35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=9622	59.952	2	1593.8532	1593.8532	R	T	120	135
PSM	CEQPFFWNIK	1197	sp|Q8IWB7|WDFY1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:4,10-UNIMOD:188	ms_run[2]:scan=10914	67.903	2	1373.6534	1373.6534	K	Q	290	300
PSM	CLAPMMSEVIR	1198	sp|P40939|ECHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:4,5-UNIMOD:35,11-UNIMOD:267	ms_run[2]:scan=7128	45.091	2	1331.6275	1331.6275	R	I	550	561
PSM	CNGVLEGIR	1199	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:4,9-UNIMOD:267	ms_run[2]:scan=4732	31.19	2	1026.5156	1026.5156	R	I	694	703
PSM	CPFTGNVSIR	1200	sp|P62280|RS11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:4	ms_run[2]:scan=5498	35.851	2	1149.5601	1149.5601	K	G	60	70
PSM	DDGLFSGDPNWFPK	1201	sp|P37802|TAGL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11715	72.982	2	1593.71	1593.7100	R	K	140	154
PSM	DIQGPGNPQCFSLR	1202	sp|O95163|ELP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=7086	44.852	2	1597.7546	1597.7546	R	T	14	28
PSM	EGAFSNFPISEETIK	1203	sp|Q9NR30-2|DDX21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9623	59.957	2	1667.8043	1667.8043	K	L	117	132
PSM	EGSGLFPDLLVR	1204	sp|Q86Y56|DAAF5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11692	72.83	2	1301.698	1301.6980	K	E	815	827
PSM	ELCQGLGQPGSVLR	1205	sp|P13489|RINI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=6745	42.942	2	1522.7801	1522.7801	R	V	360	374
PSM	ELVGPPLAETVFTPK	1206	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10731	66.789	2	1596.8763	1596.8763	K	T	1384	1399
PSM	ENGELLPILRGEN	1207	sp|O76003|GLRX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:267	ms_run[2]:scan=9694	60.39	2	1462.7655	1462.7655	K	-	323	336
PSM	FAFVEFADQNSVPR	1208	sp|Q8WXA9|SREK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10234	63.697	2	1625.7838	1625.7838	R	A	108	122
PSM	FASLEFSPGSK	1209	sp|Q8N766-4|EMC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7063	44.711	2	1168.5764	1168.5764	K	K	42	53
PSM	FDGILTEGEGPR	1210	sp|Q96HE7|ERO1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:267	ms_run[2]:scan=6702	42.698	2	1299.6334	1299.6334	R	R	288	300
PSM	FGAVLEALEK	1211	sp|Q5T0F9-3|C2D1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9093	56.743	2	1075.5914	1075.5914	R	G	7	17
PSM	FIALANVGNPEK	1212	sp|Q69YN2-3|C19L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7191	45.457	2	1271.6874	1271.6874	R	K	86	98
PSM	FLALGDSGVGK	1213	sp|P51159-2|RB27A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6757	43.01	2	1062.571	1062.5710	K	T	12	23
PSM	FLIPNASQAESK	1214	sp|P63104-2|1433Z_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6339	40.633	2	1303.6772	1303.6772	K	V	29	41
PSM	FLIWDTAGQER	1215	sp|Q9UL26|RB22A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:267	ms_run[2]:scan=10001	62.266	2	1344.6702	1344.6702	K	F	56	67
PSM	FLIWDTAGQER	1216	sp|Q9UL26|RB22A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10026	62.422	2	1334.6619	1334.6619	K	F	56	67
PSM	FLMANGQLVK	1217	sp|P50395|GDIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6970	44.194	2	1119.6111	1119.6111	K	M	80	90
PSM	FLSQIESDR	1218	sp|P19367-4|HXK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4792	31.521	2	1093.5404	1093.5404	K	L	774	783
PSM	FLVIGNAGTGK	1219	sp|P20338|RAB4A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6402	40.994	2	1075.6026	1075.6026	K	S	16	27
PSM	FVCVGGSPSR	1220	sp|Q16831|UPP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:4,10-UNIMOD:267	ms_run[2]:scan=2603	19.312	2	1074.5156	1074.5156	K	M	55	65
PSM	FVELPGAEMGK	1221	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7186	45.431	2	1176.5849	1176.5849	K	V	187	198
PSM	FYNQVSTPLLR	1222	sp|P19823|ITIH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7774	48.806	2	1336.7139	1336.7139	K	N	489	500
PSM	GCLLYGPPGTGK	1223	sp|P62333|PRS10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:4	ms_run[2]:scan=5578	36.3	2	1218.6067	1218.6067	K	T	169	181
PSM	GGGLGSPGEGGALPR	1224	sp|Q7Z7A3|CTU1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	15-UNIMOD:267	ms_run[2]:scan=4171	28.114	2	1290.6556	1290.6556	R	C	195	210
PSM	GGIVGMTLPIAR	1225	sp|Q99714-2|HCD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9585	59.726	2	1183.6747	1183.6747	K	D	173	185
PSM	GIFGSSAVPQPK	1226	sp|O60341|KDM1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6489	41.478	2	1186.6346	1186.6346	K	E	733	745
PSM	GIFTSEIGTK	1227	sp|P78527-2|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:188	ms_run[2]:scan=6561	41.901	2	1057.5751	1057.5751	R	Q	2941	2951
PSM	GIVNEQFLLQR	1228	sp|P49748-2|ACADV_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8978	56.061	2	1315.7248	1315.7248	K	L	535	546
PSM	GKVPVTYLELLS	1229	sp|Q9NR46|SHLB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:188	ms_run[2]:scan=11396	70.864	2	1323.7745	1323.7745	K	-	384	396
PSM	GLSSLLCNFTK	1230	sp|P78527-2|PRKDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	7-UNIMOD:4,11-UNIMOD:188	ms_run[2]:scan=10998	68.415	2	1244.653	1244.6530	K	S	226	237
PSM	GNRGMEDLIPLVNR	1231	sp|Q05193-5|DYN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:1	ms_run[2]:scan=10566	65.769	2	1624.8355	1624.8355	M	L	2	16
PSM	GQPLGPAGVQVSLR	1232	sp|Q5JPE7-2|NOMO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7116	45.022	2	1377.7728	1377.7728	K	N	139	153
PSM	GVTFLFPIQAK	1233	sp|Q9NR30-2|DDX21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11382	70.777	2	1219.6965	1219.6965	R	T	137	148
PSM	ICIVGPNGVGK	1234	sp|Q8NE71-2|ABCF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:4,11-UNIMOD:188	ms_run[2]:scan=5136	33.531	2	1118.6213	1118.6213	R	S	616	627
PSM	IDIIPNPQER	1235	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6734	42.882	2	1193.6404	1193.6404	K	T	73	83
PSM	IDLAVLLGK	1236	sp|Q14157-4|UBP2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:188	ms_run[2]:scan=11404	70.913	2	946.61585	946.6158	R	T	275	284
PSM	IFFAGDTIPK	1237	sp|O75369-6|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:188	ms_run[2]:scan=8179	51.114	2	1113.6166	1113.6166	K	S	430	440
PSM	IFGVTTLDIVR	1238	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:267	ms_run[2]:scan=11040	68.675	2	1242.7211	1242.7211	K	A	166	177
PSM	IGGDAGTSLNSNDYGYGGQK	1239	sp|Q96AE4|FUBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	20-UNIMOD:188	ms_run[2]:scan=5064	33.012	2	1978.8964	1978.8964	K	R	45	65
PSM	IGGDPGLSPR	1240	sp|Q16877-2|F264_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:267	ms_run[2]:scan=2607	19.332	2	977.51696	977.5170	R	G	268	278
PSM	IGPIATPDYIQNAPGLPK	1241	sp|Q9NR19|ACSA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	18-UNIMOD:188	ms_run[2]:scan=9548	59.504	2	1870.0296	1870.0296	K	T	639	657
PSM	IITLTGPTNAIFK	1242	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	13-UNIMOD:188	ms_run[2]:scan=10248	63.786	2	1393.8276	1393.8276	R	A	58	71
PSM	IITLTGPTNAIFK	1243	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10249	63.791	2	1387.8075	1387.8075	R	A	58	71
PSM	ILGVGPDDPDLVR	1244	sp|P48449-2|ERG7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8533	53.379	2	1364.73	1364.7300	R	A	83	96
PSM	ILNLLSPSDGER	1245	sp|Q9Y5Q9-2|TF3C3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:267	ms_run[2]:scan=8125	50.822	2	1322.7069	1322.7069	R	F	277	289
PSM	ILVGTNLVR	1246	sp|Q96QK1|VPS35_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267	ms_run[2]:scan=6626	42.272	2	993.62103	993.6210	R	L	218	227
PSM	IPEIQATMR	1247	sp|Q9Y3E7-2|CHMP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5523	35.991	2	1057.559	1057.5590	K	E	54	63
PSM	IQDIVGILR	1248	sp|P46087-3|NOP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267	ms_run[2]:scan=9050	56.495	2	1035.6316	1035.6316	R	D	239	248
PSM	IQDIVGILR	1249	sp|P46087-3|NOP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9051	56.499	2	1025.6233	1025.6233	R	D	239	248
PSM	IQELEDLLAK	1250	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:188	ms_run[2]:scan=9285	57.911	2	1176.6697	1176.6697	R	E	321	331
PSM	ISGFELDPDPFVR	1251	sp|Q9Y289|SC5A6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	13-UNIMOD:267	ms_run[2]:scan=11308	70.315	2	1500.7488	1500.7488	R	H	241	254
PSM	ITDFGEFMR	1252	sp|Q9NVM9|INT13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267	ms_run[2]:scan=8970	56.012	2	1124.52	1124.5200	R	E	415	424
PSM	IVLTNPVCTEVGEK	1253	sp|P41091|IF2G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	8-UNIMOD:4	ms_run[2]:scan=7082	44.825	2	1557.8072	1557.8072	K	I	427	441
PSM	IVNTPFQVLMNSEK	1254	sp|Q92544|TM9S4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11362	70.655	2	1618.8389	1618.8389	R	K	85	99
PSM	IWDLQGSEEPVFR	1255	sp|Q6RFH5-2|WDR74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	13-UNIMOD:267	ms_run[2]:scan=10042	62.521	2	1584.7812	1584.7812	K	A	157	170
PSM	IYVGNLPPDIR	1256	sp|Q07955-3|SRSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8083	50.59	2	1255.6925	1255.6925	R	T	18	29
PSM	LAATNALLNSLEFTK	1257	sp|Q14974|IMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	15-UNIMOD:188	ms_run[2]:scan=11617	72.322	2	1610.8975	1610.8975	K	A	192	207
PSM	LATLLGLQAPPTR	1258	sp|Q14152-2|EIF3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	13-UNIMOD:267	ms_run[2]:scan=9109	56.837	2	1359.8114	1359.8114	R	I	321	334
PSM	LDEGGFFLTR	1259	sp|P42685-2|FRK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9137	57.008	2	1153.5768	1153.5768	R	R	28	38
PSM	LDLLGNLPGSK	1260	sp|P46013-2|KI67_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9329	58.183	2	1125.6394	1125.6394	K	R	1568	1579
PSM	LGDVISIQPCPDVK	1261	sp|P55072|TERA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=7617	47.876	2	1545.8168	1545.8168	R	Y	96	110
PSM	LGEWVGLCK	1262	sp|P25398|RS12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	8-UNIMOD:4,9-UNIMOD:188	ms_run[2]:scan=7382	46.556	2	1066.5577	1066.5577	K	I	85	94
PSM	LGGAVPFAPPEVSPEQAK	1263	sp|Q6ZSR9|YJ005_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	18-UNIMOD:188	ms_run[2]:scan=8375	52.392	2	1798.9561	1798.9561	K	T	81	99
PSM	LGGNPGTNSR	1264	sp|Q969G3-2|SMCE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=673	7.5325	2	971.47846	971.4785	R	V	41	51
PSM	LGPALATGNVVVMK	1265	sp|P05091-2|ALDH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7844	49.215	2	1368.7799	1368.7799	K	V	149	163
PSM	LIIQWNGPESTR	1266	sp|P09327|VILI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8547	53.462	2	1412.7412	1412.7412	K	M	173	185
PSM	LIRGPAETEATTD	1267	sp|Q12792-4|TWF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:267	ms_run[2]:scan=2895	21.042	2	1382.6917	1382.6917	R	-	240	253
PSM	LLFNDVQTLK	1268	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8899	55.582	2	1189.6707	1189.6707	R	D	588	598
PSM	LLQNLEILQR	1269	sp|Q9BZF3-6|OSBL6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:267	ms_run[2]:scan=9246	57.668	2	1248.7429	1248.7429	K	T	278	288
PSM	LLSALCILPQPEDMNER	1270	sp|O60610-2|DIAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	6-UNIMOD:4,14-UNIMOD:35	ms_run[2]:scan=10898	67.804	2	2013.9863	2013.9863	K	V	253	270
PSM	LNLDSIIGR	1271	sp|P62136-3|PP1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267	ms_run[2]:scan=9529	59.391	2	1009.5796	1009.5796	K	L	7	16
PSM	LPSTSGSEGVPFR	1272	sp|P29317|EPHA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5730	37.172	2	1332.6674	1332.6674	R	T	895	908
PSM	LSNIFVIGK	1273	sp|P62701|RS4X_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:188	ms_run[2]:scan=8663	54.17	2	995.6111	995.6111	R	G	222	231
PSM	LSVISVEDPPQR	1274	sp|P38117|ETFB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6309	40.454	2	1338.7143	1338.7143	K	T	222	234
PSM	LTEQSNTPLLLPLAAR	1275	sp|Q9NYL2-2|M3K20_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10565	65.763	2	1735.9832	1735.9832	K	M	322	338
PSM	LTIGSNLSIR	1276	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:267	ms_run[2]:scan=7281	45.984	2	1082.6323	1082.6323	R	I	251	261
PSM	LVLDFINAGGAR	1277	sp|Q9P2K6|KLH42_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:267	ms_run[2]:scan=10200	63.488	2	1254.696	1254.6960	R	E	64	76
PSM	LVVECVMNNVTCTR	1278	sp|Q01469|FABP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	5-UNIMOD:4,12-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=8433	52.745	2	1703.8032	1703.8033	K	I	116	130
PSM	MAQALEELR	1279	sp|Q03252|LMNB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:35,9-UNIMOD:267	ms_run[2]:scan=4239	28.493	2	1085.5415	1085.5415	K	S	256	265
PSM	MAQALEELR	1280	sp|Q03252|LMNB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:35	ms_run[2]:scan=4240	28.498	2	1075.5332	1075.5332	K	S	256	265
PSM	MEFGTAGLR	1281	sp|Q96G03|PGM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:35	ms_run[2]:scan=4098	27.701	2	996.46987	996.4699	R	A	55	64
PSM	MFEDPETTR	1282	sp|P60228|EIF3E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:35	ms_run[2]:scan=2370	18.018	2	1140.4757	1140.4757	K	Q	94	103
PSM	MGELPLDINIQEPR	1283	sp|Q9BWM7|SFXN3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:35	ms_run[2]:scan=9712	60.501	2	1639.824	1639.8240	-	W	1	15
PSM	MILLEVNNR	1284	sp|O15144|ARPC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:35	ms_run[2]:scan=5640	36.656	2	1116.5961	1116.5961	-	I	1	10
PSM	MLISILTER	1285	sp|P12429|ANXA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:35,9-UNIMOD:267	ms_run[2]:scan=8906	55.625	2	1100.6139	1100.6139	K	S	40	49
PSM	MLISILTER	1286	sp|P12429|ANXA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:35	ms_run[2]:scan=8908	55.636	2	1090.6056	1090.6056	K	S	40	49
PSM	MLISILTER	1287	sp|P12429|ANXA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10418	64.852	2	1074.6107	1074.6107	K	S	40	49
PSM	MQLLEIITTEK	1288	sp|P40939|ECHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:35,11-UNIMOD:188	ms_run[2]:scan=9258	57.746	2	1339.7364	1339.7364	K	T	506	517
PSM	MVGGVLVER	1289	sp|Q9UHV9|PFD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:35,9-UNIMOD:267	ms_run[2]:scan=3684	25.424	2	984.53017	984.5302	R	T	73	82
PSM	MVGGVLVER	1290	sp|Q9UHV9|PFD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:35	ms_run[2]:scan=3692	25.465	2	974.5219	974.5219	R	T	73	82
PSM	MVGGVLVER	1291	sp|Q9UHV9|PFD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267	ms_run[2]:scan=4972	32.453	2	968.53526	968.5353	R	T	73	82
PSM	MVVPGLDGAQIPR	1292	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	13-UNIMOD:267	ms_run[2]:scan=8808	55.041	2	1361.7365	1361.7365	K	D	1159	1172
PSM	NAGLAFIELVNEGR	1293	sp|P50851-2|LRBA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	14-UNIMOD:267	ms_run[2]:scan=11783	73.425	2	1511.7972	1511.7972	K	L	1869	1883
PSM	NAGLAFIELVNEGR	1294	sp|P50851-2|LRBA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11787	73.453	2	1501.7889	1501.7889	K	L	1869	1883
PSM	NDGVLLLQALTR	1295	sp|O60763|USO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:267	ms_run[2]:scan=11903	74.228	2	1321.7593	1321.7593	R	S	184	196
PSM	NFALLGVGTSK	1296	sp|A0AVT1-2|UBA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8382	52.435	2	1105.6132	1105.6132	K	E	4	15
PSM	NIPGITLLNVSK	1297	sp|P36578|RL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:188	ms_run[2]:scan=10058	62.617	2	1273.7701	1273.7701	R	L	223	235
PSM	NIPMTLELLQSTR	1298	sp|P23193|TCEA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	4-UNIMOD:35	ms_run[2]:scan=10166	63.279	2	1530.8076	1530.8076	K	I	33	46
PSM	NLDLDSIIAEVK	1299	sp|P13647|K2C5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=12137	76.058	2	1328.7187	1328.7187	R	A	332	344
PSM	NLDNGGFYISPR	1300	sp|P06239-2|LCK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7234	45.711	2	1351.6521	1351.6521	R	I	185	197
PSM	NLLDEIASR	1301	sp|O60437|PEPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9113	56.864	2	1029.5455	1029.5455	K	E	772	781
PSM	NLLDVIDQAR	1302	sp|Q05397-6|FAK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10346	64.397	2	1155.6248	1155.6248	K	L	341	351
PSM	NLLDVIDQAR	1303	sp|Q05397-6|FAK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:267	ms_run[2]:scan=10351	64.425	2	1165.6331	1165.6331	K	L	341	351
PSM	NLVCTDLFTR	1304	sp|P26196|DDX6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	4-UNIMOD:4,10-UNIMOD:267	ms_run[2]:scan=8901	55.593	2	1247.6208	1247.6208	R	G	387	397
PSM	NNWTGEFSAR	1305	sp|Q9NXR7-4|BABA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6088	39.182	2	1180.5261	1180.5261	K	F	163	173
PSM	NYPATFWVNPQFK	1306	sp|P07384|CAN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	13-UNIMOD:188	ms_run[2]:scan=10721	66.728	2	1616.8083	1616.8083	R	I	386	399
PSM	PEFLEDPSVLTK	1307	sp|P42166|LAP2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:188	ms_run[2]:scan=8868	55.392	2	1379.728	1379.7280	M	D	2	14
PSM	PLELELCPGR	1308	sp|Q9NR45|SIAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	7-UNIMOD:4	ms_run[2]:scan=7807	49.001	2	1182.6067	1182.6067	M	W	2	12
PSM	QGNLSLPLNR	1309	sp|Q4G0N4-3|NAKD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:267	ms_run[2]:scan=6087	39.177	2	1120.6228	1120.6228	R	E	178	188
PSM	QLNPINLTER	1310	sp|O00442|RTCA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6764	43.047	2	1196.6513	1196.6513	K	G	177	187
PSM	RIEDNLPAGEE	1311	sp|O43617-2|TPPC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3689	25.452	2	1241.5888	1241.5888	R	-	124	135
PSM	RVEIMEEESEQ	1312	sp|P54578-2|UBP14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	5-UNIMOD:35	ms_run[2]:scan=1925	15.381	2	1393.6031	1393.6031	R	-	449	460
PSM	SCDGNQELLNFLR	1313	sp|Q9UIG0-2|BAZ1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:4	ms_run[2]:scan=11140	69.274	2	1564.7304	1564.7304	K	S	1040	1053
PSM	SGAPVLSLLSVR	1314	sp|Q9BRP4-3|PAAF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11288	70.193	2	1197.7081	1197.7081	R	D	206	218
PSM	SLDGEGNFNWR	1315	sp|Q9NZM1-5|MYOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:267	ms_run[2]:scan=7211	45.576	2	1303.5821	1303.5821	R	F	1353	1364
PSM	SLFSNVVTK	1316	sp|P31939-2|PUR9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:188	ms_run[2]:scan=7013	44.435	2	999.56963	999.5696	K	N	397	406
PSM	SLGVLPFTLNSGSPEK	1317	sp|P42695|CNDD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	16-UNIMOD:188	ms_run[2]:scan=10825	67.359	2	1650.8924	1650.8924	R	T	1372	1388
PSM	SLLFVNTLER	1318	sp|Q9NY93-2|DDX56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:267	ms_run[2]:scan=10083	62.764	2	1200.6742	1200.6742	K	S	261	271
PSM	SPAFVQLAPLSSK	1319	sp|P51610-2|HCFC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8800	54.991	2	1343.7449	1343.7449	R	V	1136	1149
PSM	SPPEALVQGR	1320	sp|Q9UHB6|LIMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:267	ms_run[2]:scan=3172	22.57	2	1062.5697	1062.5697	R	Y	132	142
PSM	SQPAILLLTAAR	1321	sp|Q5JTV8-3|TOIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:267	ms_run[2]:scan=10185	63.398	2	1262.7586	1262.7586	R	D	406	418
PSM	SSWWIINPDGGK	1322	sp|O43524-2|FOXO3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:188	ms_run[2]:scan=10828	67.376	2	1364.682	1364.6820	K	S	11	23
PSM	TAAFALPVLER	1323	sp|Q96GQ7|DDX27_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:267	ms_run[2]:scan=10310	64.172	2	1196.6793	1196.6793	K	L	269	280
PSM	TAAFALPVLER	1324	sp|Q96GQ7|DDX27_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10311	64.178	2	1186.671	1186.6710	K	L	269	280
PSM	TFDEIASGFR	1325	sp|P11166|GTR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7833	49.152	2	1141.5404	1141.5404	R	Q	459	469
PSM	TIPIDGDFFSYTR	1326	sp|P05091-2|ALDH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10886	67.731	2	1530.7355	1530.7355	K	H	113	126
PSM	TLLEALEQR	1327	sp|Q6P1N0-2|C2D1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267	ms_run[2]:scan=8897	55.571	2	1081.6007	1081.6007	R	M	347	356
PSM	TLVLLDNLNVR	1328	sp|P39656|OST48_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10603	66.003	2	1268.7452	1268.7452	R	E	47	58
PSM	TMQTLLSLVR	1329	sp|P00492|HPRT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:267	ms_run[2]:scan=11315	70.36	2	1170.667	1170.6670	K	Q	142	152
PSM	TNQELQEINR	1330	sp|P07355|ANXA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:267	ms_run[2]:scan=2884	20.973	2	1253.6239	1253.6239	R	V	136	146
PSM	VDLPLAVLSK	1331	sp|Q9H773|DCTP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:188	ms_run[2]:scan=10259	63.854	2	1059.6635	1059.6635	R	M	112	122
PSM	VFDFLVDSINK	1332	sp|Q12965|MYO1E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:188	ms_run[2]:scan=11361	70.65	2	1301.6963	1301.6963	R	A	363	374
PSM	VFDPVPVGVTK	1333	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7185	45.426	2	1156.6492	1156.6492	K	V	698	709
PSM	VFLGNGISELSR	1334	sp|Q8TEA1|NSUN6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8573	53.62	2	1290.6932	1290.6932	K	K	170	182
PSM	VGINYQPPTVVPGGDLAK	1335	sp|P68363-2|TBA1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	18-UNIMOD:188	ms_run[2]:scan=8356	52.272	2	1829.9983	1829.9983	K	V	237	255
PSM	VGNLGLATSFFNER	1336	sp|O00571-2|DDX3X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	14-UNIMOD:267	ms_run[2]:scan=11041	68.68	2	1533.7815	1533.7815	R	N	519	533
PSM	VIDDTNITR	1337	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267	ms_run[2]:scan=2581	19.188	2	1055.5487	1055.5487	K	L	188	197
PSM	VIDDTNITR	1338	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2585	19.21	2	1045.5404	1045.5404	K	L	188	197
PSM	VITIMQNPR	1339	sp|P62269|RS18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267	ms_run[2]:scan=4891	32.06	2	1080.5989	1080.5989	R	Q	67	76
PSM	VLGATLLPDLIQK	1340	sp|P55786-2|PSA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	13-UNIMOD:188	ms_run[2]:scan=11524	71.706	2	1385.8589	1385.8589	R	V	702	715
PSM	VLITTDLLAR	1341	sp|P60842|IF4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9307	58.045	2	1113.6758	1113.6758	R	G	325	335
PSM	VLLVPGPEKEN	1342	sp|Q99536|VAT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5539	36.081	2	1193.6656	1193.6656	K	-	383	394
PSM	VPTANVSVVDLTCR	1343	sp|P04406-2|G3P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	13-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=7551	47.481	2	1539.7954	1539.7954	R	L	193	207
PSM	VTFQPPSSIGCR	1344	sp|A0MZ66-7|SHOT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:4	ms_run[2]:scan=6244	40.073	2	1347.6605	1347.6605	K	K	143	155
PSM	VTLMQLPTR	1345	sp|P55884|EIF3B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267	ms_run[2]:scan=7366	46.466	2	1067.6037	1067.6037	R	Q	493	502
PSM	VTLMQLPTR	1346	sp|P55884|EIF3B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7370	46.486	2	1057.5954	1057.5954	R	Q	493	502
PSM	VTLTSEEEAR	1347	sp|P00338|LDHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2383	18.088	2	1133.5564	1133.5564	K	L	306	316
PSM	VVLAYEPVWAIGTGK	1348	sp|P60174-4|TPIS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11269	70.075	2	1601.8817	1601.8817	K	T	79	94
PSM	VVPCLVTPVTGR	1349	sp|O75369-6|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	4-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=6946	44.065	2	1306.7307	1306.7307	K	E	988	1000
PSM	VVPCLVTPVTGR	1350	sp|O75369-6|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	4-UNIMOD:4	ms_run[2]:scan=6959	44.137	2	1296.7224	1296.7224	K	E	988	1000
PSM	VWDPNSPLTDR	1351	sp|Q9BTC8-2|MTA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:267	ms_run[2]:scan=6549	41.832	2	1308.6338	1308.6338	K	Q	181	192
PSM	VWLWTACDFADGER	1352	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	7-UNIMOD:4	ms_run[2]:scan=11745	73.176	2	1724.7617	1724.7617	R	K	2401	2415
PSM	VWQVTIGTR	1353	sp|P63244|RACK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267	ms_run[2]:scan=6923	43.94	2	1068.5955	1068.5955	R	-	309	318
PSM	VWQVTIGTR	1354	sp|P63244|RACK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6932	43.99	2	1058.5873	1058.5873	R	-	309	318
PSM	WDQSTFLGR	1355	sp|Q9BWM7|SFXN3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6782	43.141	2	1108.5302	1108.5302	R	A	15	24
PSM	YGPSLMPGGNK	1356	sp|P52209-2|6PGD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:188	ms_run[2]:scan=4848	31.827	2	1125.5584	1125.5584	R	E	124	135
PSM	QSVENDIHGLR	1357	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28,11-UNIMOD:267	ms_run[1]:scan=5834	37.77211833333333	2	1259.6116	1259.6129	R	K	176	187
PSM	QNGDDPLLTYRFPPK	1358	sp|P02545|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28,11-UNIMOD:267,15-UNIMOD:188	ms_run[1]:scan=10765	66.99755	2	1758.8911	1758.8907	R	F	472	487
PSM	GNPTVEVDLFTSK	1359	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0		ms_run[1]:scan=8730	54.56774333333333	2	1405.6972	1405.7082	R	G	16	29
PSM	LLYNNVSNFGR	1360	sp|Q00610|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	11-UNIMOD:267	ms_run[1]:scan=7095	44.90481833333334	2	1307.651623	1305.670504	K	L	1216	1227
PSM	LLQSLLDTR	1361	sp|Q13045|FLII_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	9-UNIMOD:267	ms_run[1]:scan=8054	50.4311	2	1068.615957	1067.621428	R	C	765	774
PSM	ALEAANGELEVK	1362	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=4814	31.642823333333332	2	1242.649009	1242.645582	R	I	100	112
PSM	VLNLGQALER	1363	sp|Q8NI27|THOC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	10-UNIMOD:267	ms_run[1]:scan=7767	48.76332333333333	2	1121.646775	1121.643226	K	R	1137	1147
PSM	GVGQADWTPDLGLR	1364	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	14-UNIMOD:267	ms_run[1]:scan=9245	57.662675	2	1493.747963	1493.750211	R	N	1275	1289
PSM	QAIKELPQFATGENLPR	1365	sp|Q9BZZ5|API5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28	ms_run[1]:scan=9846	61.31321833333333	2	1893.9929	1893.9943	R	V	81	98
PSM	WDQSTFIGR	1366	sp|Q9H9B4|SFXN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	9-UNIMOD:267	ms_run[1]:scan=6774	43.098796666666665	2	1118.540232	1118.538427	R	A	16	25
PSM	GGGVGGFLPAMK	1367	sp|Q9Y3I0|RTCB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=8597	53.76845333333333	2	1090.573436	1089.564101	R	Q	56	68
PSM	STGGDFGNPLRK	1368	sp|P20340|RAB6A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1	ms_run[1]:scan=5377	35.15857166666667	2	1289.6370	1289.6359	M	F	2	14
PSM	CLFSHVDFSGDGK	1369	sp|A5YKK6|CNOT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=10674	66.44160833333333	2	1450.6201	1450.6182	R	S	50	63
PSM	LWDTAGQER	1370	sp|Q9H0N0|RAB6C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=3238	22.929848333333332	2	1074.509515	1074.509423	R	L	66	75
PSM	CREMDEQIR	1371	sp|P06753-2|TPM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=3851	26.336278333333333	2	1218.5099	1218.5116	R	L	154	163
PSM	FAQQITGMR	1372	sp|Q6IQ22|RAB12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	9-UNIMOD:267	ms_run[1]:scan=4449	29.653376666666666	2	1060.530003	1060.536318	K	F	173	182
PSM	SPQTPELVEALAFR	1373	sp|Q9NZB2|F120A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=11299	70.26018333333333	2	1556.817421	1556.819858	K	E	652	666
PSM	MTISQQEFGR	1374	sp|P55036|PSMD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:35	ms_run[1]:scan=3394	23.81572166666667	2	1211.559859	1211.560472	K	T	263	273
PSM	NGLVNSEVHNEDGR	1375	sp|Q9NUM4|T106B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	14-UNIMOD:267	ms_run[1]:scan=2868	20.867866666666664	2	1549.699285	1548.715616	R	N	28	42
PSM	VLGMDPLPQMSQR	1376	sp|Q96KR1|ZFR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	13-UNIMOD:267	ms_run[1]:scan=8928	55.756655	2	1481.762416	1480.740574	K	F	1029	1042
PSM	SPPEALVQGR	1377	sp|Q9UHB6|LIMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=3149	22.439686666666667	2	1053.556952	1052.561458	R	Y	132	142
PSM	QMVIDVLHPGK	1378	sp|P62847|RS24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28,11-UNIMOD:188	ms_run[1]:scan=9759	60.78330666666667	2	1224.6604	1224.6627	K	A	22	33
PSM	FDGAEGSWFQK	1379	sp|Q92888|ARHG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=7660	48.12863	2	1270.563469	1270.561852	R	I	500	511
PSM	AIYKGPGSEAGP	1380	sp|P21964|COMT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=3430	24.018913333333334	2	1145.570968	1145.571688	K	-	260	272
PSM	AIYKGPGSEAGP	1381	sp|P21964|COMT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=3242	22.950708333333335	2	1145.570968	1145.571688	K	-	260	272
PSM	GLFIIDPNGVIK	1382	sp|P30048|PRDX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0		ms_run[1]:scan=11779	73.40296666666666	2	1285.7302	1284.7432	R	H	185	197
PSM	IYNGIGVSR	1383	sp|Q96PD2|DCBD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	9-UNIMOD:267	ms_run[1]:scan=3603	24.994846666666668	2	987.536070	987.537699	R	T	133	142
PSM	QWYESHYALPLGR	1384	sp|P62241|RS8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28,13-UNIMOD:267	ms_run[1]:scan=10537	65.58366	2	1611.7704	1611.7704	R	K	111	124
PSM	IGFGSFVEK	1385	sp|P05556|ITB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	9-UNIMOD:188	ms_run[1]:scan=7985	50.03617	2	988.530927	988.532512	R	T	182	191
PSM	QFHLTDDDLLR	1386	sp|Q04446|GLGB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28,11-UNIMOD:267	ms_run[1]:scan=10277	63.96538	2	1364.6590	1364.6595	R	Y	566	577
PSM	SDNGELEDKPPAPPVR	1387	sp|Q13177|PAK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1	ms_run[1]:scan=5422	35.417521666666666	2	1762.8412	1761.8532	M	M	2	18
PSM	SDNGELEDKPPAPPVR	1388	sp|Q13177|PAK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,9-UNIMOD:188,16-UNIMOD:267	ms_run[1]:scan=5424	35.429485	2	1778.8692	1777.8812	M	M	2	18
PSM	AGAGAPELLR	1389	sp|Q00653|NFKB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	10-UNIMOD:267	ms_run[1]:scan=4408	29.424605	2	963.537041	963.537699	R	A	570	580
PSM	FLIWDTAGQER	1390	sp|Q13636|RAB31_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=10051	62.573795	2	1334.660078	1334.661900	K	F	56	67
PSM	MVCVEYPGVVR	1391	sp|Q9Y5Q8|TF3C5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:35,3-UNIMOD:4,11-UNIMOD:267	ms_run[1]:scan=6196	39.79626	2	1334.662669	1333.639798	R	D	24	35
PSM	LVLVGDGGTGK	1392	sp|P62826|RAN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	11-UNIMOD:188	ms_run[1]:scan=4237	28.482863333333334	2	1020.591620	1020.591089	K	T	13	24
PSM	SLEDQVEMLR	1393	sp|P14314|GLU2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=7968	49.93485166666667	2	1219.596636	1218.591438	K	T	168	178
PSM	ISGLGLTPEQK	1394	sp|O95831|AIFM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=4994	32.568475	2	1142.629978	1141.634289	R	Q	99	110
PSM	FDPFIVEEIQR	1395	sp|Q9Y5W7|SNX14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=10972	68.25480333333333	2	1393.727896	1391.708516	R	I	411	422
PSM	MNLPGEVTFLPLNK	1396	sp|Q9UQE7|SMC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:35,14-UNIMOD:188	ms_run[1]:scan=10335	64.32332166666667	2	1593.853261	1593.853194	K	L	579	593
PSM	ACPQIVTALTLLNR	1397	sp|Q14146|URB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	2-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=11856	73.916	2	1578.8791	1578.8791	R	E	1293	1307
PSM	ADLTALFLPR	1398	sp|Q13045-2|FLII_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=11572	72.009	2	1125.6422	1125.6422	K	Q	820	830
PSM	AEAGVPAEFSIWTR	1399	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	14-UNIMOD:267	ms_run[2]:scan=10753	66.926	2	1542.7706	1542.7706	R	E	2243	2257
PSM	AGLQFPVGR	1400	sp|P0C0S8|H2A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:267	ms_run[2]:scan=6776	43.107	2	953.53222	953.5322	R	V	22	31
PSM	AIDLMNALMR	1401	sp|Q96SI9-2|STRBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11401	70.892	2	1146.5889	1146.5889	K	L	371	381
PSM	AQPAQPADEPAEKADEPMEH	1402	sp|P25786|PSA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	13-UNIMOD:188	ms_run[2]:scan=2663	19.667	3	2165.9631	2165.9631	K	-	244	264
PSM	AVPEGFVIPR	1403	sp|P43490|NAMPT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=7855	49.283	2	1093.6159	1093.6159	K	G	118	128
PSM	AVQLGSLLVR	1404	sp|Q96EK7-3|F120B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=9125	56.937	2	1064.6581	1064.6581	R	G	101	111
PSM	CDKEFMWALK	1405	sp|P58546|MTPN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:1,1-UNIMOD:4,3-UNIMOD:188,10-UNIMOD:188	ms_run[2]:scan=10450	65.051	2	1380.6609	1380.6609	M	N	2	12
PSM	CEFQDAYVLLSEK	1406	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:4	ms_run[2]:scan=10414	64.823	2	1600.7443	1600.7443	K	K	237	250
PSM	CFIVGADNVGSK	1407	sp|P05388-2|RLA0_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:4	ms_run[2]:scan=5562	36.207	2	1265.6074	1265.6074	K	Q	27	39
PSM	CNGVLEGIR	1408	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:4	ms_run[2]:scan=4757	31.319	2	1016.5073	1016.5073	R	I	694	703
PSM	CSDAVPGGLFGFAAR	1409	sp|Q8TEQ6|GEMI5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=10641	66.239	2	1533.7274	1533.7274	R	T	19	34
PSM	DLQEFVPFGR	1410	sp|Q9H1A4|APC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=10517	65.46	2	1216.6116	1216.6116	R	D	16	26
PSM	DPIPYLPPLEK	1411	sp|P08621-3|RU17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:188	ms_run[2]:scan=9842	61.291	2	1286.7218	1286.7218	R	L	17	28
PSM	EGDPGTIFFFR	1412	sp|Q9NWS8-2|RMND1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:267	ms_run[2]:scan=11491	71.495	2	1294.6222	1294.6222	K	E	9	20
PSM	EGLLLWCQR	1413	sp|O43707|ACTN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	7-UNIMOD:4	ms_run[2]:scan=9892	61.598	2	1173.5965	1173.5965	K	K	167	176
PSM	FAQPGTFEFEYASR	1414	sp|Q8WXF1-2|PSPC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8911	55.652	2	1648.7522	1648.7522	R	W	265	279
PSM	FEELNADLFR	1415	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=9815	61.126	2	1262.6171	1262.6171	R	G	302	312
PSM	FGDSNTVMR	1416	sp|P15924-2|DESP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=2834	20.653	2	1025.46	1025.4600	K	F	917	926
PSM	FGISSVPTK	1417	sp|P82979|SARNP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=4873	31.968	2	934.51238	934.5124	R	G	127	136
PSM	FGNTEQGFK	1418	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=2541	18.977	2	1026.4771	1026.4771	K	F	1852	1861
PSM	FGQVPDQPAGLR	1419	sp|Q9HCU5|PREB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	12-UNIMOD:267	ms_run[2]:scan=5583	36.331	2	1293.6705	1293.6705	R	L	252	264
PSM	FIALANVGNPEK	1420	sp|Q69YN2-3|C19L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	12-UNIMOD:188	ms_run[2]:scan=7182	45.405	2	1277.7075	1277.7075	R	K	86	98
PSM	FLMANGQLVK	1421	sp|P50395|GDIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:188	ms_run[2]:scan=6971	44.199	2	1125.6312	1125.6312	K	M	80	90
PSM	FLTQPQVVAR	1422	sp|O43760|SNG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=4930	32.245	2	1167.664	1167.6640	R	A	20	30
PSM	FQELIFEDFAR	1423	sp|Q96TA1-2|NIBA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:267	ms_run[2]:scan=11838	73.797	2	1423.7011	1423.7011	R	F	506	517
PSM	FQGPDNGQGPK	1424	sp|O43396|TXNL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=1184	10.565	2	1143.5309	1143.5309	K	Y	182	193
PSM	FQILDFTSPK	1425	sp|Q9BYD6|RM01_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=10643	66.257	2	1194.6285	1194.6285	K	Q	109	119
PSM	FSQLSELPR	1426	sp|A7KAX9|RHG32_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6277	40.266	2	1075.5662	1075.5662	R	S	192	201
PSM	FTDFQPFCCSESGPR	1427	sp|O75170-6|PP6R2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	8-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=8312	51.963	2	1833.7451	1833.7451	K	C	700	715
PSM	FVNLGIEPPK	1428	sp|P35998-2|PRS7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7846	49.231	2	1112.623	1112.6230	R	G	64	74
PSM	GAFGEVQLVR	1429	sp|O75116|ROCK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=7319	46.208	2	1084.5905	1084.5905	R	H	101	111
PSM	GAFGEVQLVR	1430	sp|O75116|ROCK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7320	46.212	2	1074.5822	1074.5822	R	H	101	111
PSM	GCLLYGPPGTGK	1431	sp|P62333|PRS10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	2-UNIMOD:4,12-UNIMOD:188	ms_run[2]:scan=5575	36.284	2	1224.6268	1224.6268	K	T	169	181
PSM	GDGPICLVLAPTR	1432	sp|P17844-2|DDX5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	6-UNIMOD:4	ms_run[2]:scan=9439	58.844	2	1367.7231	1367.7231	R	E	86	99
PSM	GDGPICLVLAPTR	1433	sp|P17844-2|DDX5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	6-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=9440	58.849	2	1377.7314	1377.7314	R	E	86	99
PSM	GGGVGGFLPAMK	1434	sp|Q9Y3I0|RTCB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	12-UNIMOD:188	ms_run[2]:scan=8620	53.911	2	1095.5842	1095.5842	R	Q	56	68
PSM	GGNFGFGDSR	1435	sp|P22626-2|ROA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=4276	28.684	2	1022.4445	1022.4445	R	G	192	202
PSM	GGYFDEFGIIR	1436	sp|P11413|G6PD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=10984	68.332	2	1272.6139	1272.6139	R	D	247	258
PSM	GISQEQMQEFR	1437	sp|O43707|ACTN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:267	ms_run[2]:scan=5440	35.522	2	1361.6273	1361.6273	K	A	761	772
PSM	GKVPVTYLELLS	1438	sp|Q9NR46|SHLB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	2-UNIMOD:188	ms_run[2]:scan=11370	70.706	2	1323.7745	1323.7745	K	-	384	396
PSM	GLGLSPDLVVCR	1439	sp|P17812|PYRG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:4	ms_run[2]:scan=8954	55.913	2	1284.686	1284.6860	R	C	206	218
PSM	GLTPSQIGVILR	1440	sp|P62277|RS13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9586	59.732	2	1252.7503	1252.7503	K	D	44	56
PSM	GNLGAGNGNLQGPR	1441	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=2490	18.688	2	1323.6644	1323.6644	R	H	374	388
PSM	GPPPSYGGSSR	1442	sp|P38159-2|RBMX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=886	8.7645	2	1060.4938	1060.4938	R	Y	286	297
PSM	GPVYIGELPQDFLR	1443	sp|Q9H0E2|TOLIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11748	73.2	2	1602.8406	1602.8406	R	I	10	24
PSM	GPVYIGELPQDFLR	1444	sp|Q9H0E2|TOLIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	14-UNIMOD:267	ms_run[2]:scan=11755	73.245	2	1612.8489	1612.8489	R	I	10	24
PSM	IDIIPNPQER	1445	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=6735	42.886	2	1203.6487	1203.6487	K	T	73	83
PSM	IEFSLPDLEGR	1446	sp|P35998-2|PRS7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=10885	67.726	2	1274.6507	1274.6507	K	T	204	215
PSM	IFGGVLESDAR	1447	sp|O00165-5|HAX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:267	ms_run[2]:scan=7163	45.294	2	1172.6065	1172.6065	R	S	92	103
PSM	IFVGGLNPEATEEK	1448	sp|Q99729-3|ROAA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	14-UNIMOD:188	ms_run[2]:scan=7162	45.289	2	1508.7818	1508.7818	K	I	156	170
PSM	IGLINDMVR	1449	sp|Q14152-2|EIF3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:267	ms_run[2]:scan=8033	50.312	2	1039.5724	1039.5724	R	F	334	343
PSM	IITLAGPTNAIFK	1450	sp|Q15366-7|PCBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	13-UNIMOD:188	ms_run[2]:scan=10319	64.229	2	1363.8171	1363.8171	R	A	58	71
PSM	ILGPAESDEFLAR	1451	sp|Q5T4S7-3|UBR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	13-UNIMOD:267	ms_run[2]:scan=8191	51.183	2	1426.7332	1426.7332	R	V	1337	1350
PSM	IPEGLFDPSNVK	1452	sp|O96019-2|ACL6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8390	52.483	2	1314.682	1314.6820	K	G	262	274
PSM	IPEIQATMR	1453	sp|Q9Y3E7-2|CHMP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:267	ms_run[2]:scan=5515	35.946	2	1067.5673	1067.5673	K	E	54	63
PSM	IQIAPDSGGLPER	1454	sp|Q96AE4|FUBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5764	37.374	2	1351.7096	1351.7096	K	S	134	147
PSM	IQPDTIIQVWR	1455	sp|P06865|HEXA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:267	ms_run[2]:scan=10556	65.706	2	1377.7644	1377.7644	K	E	383	394
PSM	ITDFGEFMR	1456	sp|Q9NVM9|INT13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8964	55.974	2	1114.5117	1114.5117	R	E	415	424
PSM	IVLQIDNAR	1457	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:267	ms_run[2]:scan=5611	36.49	2	1050.6061	1050.6061	R	L	150	159
PSM	IVPNVLLEQGK	1458	sp|O75390|CISY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:188	ms_run[2]:scan=7274	45.946	2	1214.733	1214.7330	K	A	383	394
PSM	IYGISFPDPK	1459	sp|P26639|SYTC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9199	57.383	2	1135.5914	1135.5914	R	M	297	307
PSM	IYIPLPEEAAR	1460	sp|Q9UN37|VPS4A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:267	ms_run[2]:scan=8888	55.517	2	1280.7004	1280.7004	R	A	289	300
PSM	KFSEDFGQES	1461	sp|Q9UN37|VPS4A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=4234	28.463	2	1172.4986	1172.4986	K	-	428	438
PSM	LALEDSENTASTNCDSSSEGLEKDTATQR	1462	sp|Q49AR2|CE022_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	14-UNIMOD:4	ms_run[2]:scan=5160	33.691	3	3128.3688	3128.3688	K	S	182	211
PSM	LAVVDPLFGMQPIR	1463	sp|P08243|ASNS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:35,14-UNIMOD:267	ms_run[2]:scan=10636	66.211	2	1580.8624	1580.8624	R	V	50	64
PSM	LDIDSPPITAR	1464	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:267	ms_run[2]:scan=6421	41.096	2	1206.6484	1206.6484	R	N	33	44
PSM	LFGQETPEQR	1465	sp|O95219|SNX4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3870	26.438	2	1203.5884	1203.5884	K	E	362	372
PSM	LFQEDDEIPLYLK	1466	sp|P14406|CX7A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=10835	67.419	2	1621.8239	1621.8239	K	G	34	47
PSM	LFVTPPEGSSR	1467	sp|Q14244-5|MAP7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:267	ms_run[2]:scan=4978	32.48	2	1198.6222	1198.6222	K	R	128	139
PSM	LGEWVGLCK	1468	sp|P25398|RS12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	8-UNIMOD:4	ms_run[2]:scan=7373	46.505	2	1060.5376	1060.5376	K	I	85	94
PSM	LGFGSFVEK	1469	sp|P18564-2|ITB6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7990	50.069	2	982.51238	982.5124	R	P	172	181
PSM	LGLPPLTPEQQEALQK	1470	sp|Q9UHX1-4|PUF60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	16-UNIMOD:188	ms_run[2]:scan=8530	53.357	2	1766.9874	1766.9874	K	A	11	27
PSM	LGPEGELLIR	1471	sp|Q15758-3|AAAT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7912	49.61	2	1095.6288	1095.6288	K	F	20	30
PSM	LGTPQQIAIAR	1472	sp|Q7L576-3|CYFP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5408	35.334	2	1166.6772	1166.6772	R	E	260	271
PSM	LIDFLECGK	1473	sp|P17844-2|DDX5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	7-UNIMOD:4	ms_run[2]:scan=9104	56.812	2	1093.5478	1093.5478	R	T	149	158
PSM	LIDFLECGK	1474	sp|P17844-2|DDX5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	7-UNIMOD:4,9-UNIMOD:188	ms_run[2]:scan=9105	56.817	2	1099.5679	1099.5679	R	T	149	158
PSM	LIDIGNSCR	1475	sp|O00139-2|KIF2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	8-UNIMOD:4,9-UNIMOD:267	ms_run[2]:scan=4111	27.781	2	1056.5261	1056.5261	K	T	367	376
PSM	LINLVGESLR	1476	sp|P46379-4|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8744	54.654	2	1112.6554	1112.6554	R	L	316	326
PSM	LLEEQGIFLR	1477	sp|Q5T4S7-3|UBR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=9106	56.822	2	1226.6898	1226.6898	K	A	3219	3229
PSM	LLLNNDNLLR	1478	sp|P47755-2|CAZA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=8754	54.713	2	1206.696	1206.6960	R	E	38	48
PSM	LLPELLQPYTER	1479	sp|Q13057|COASY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	12-UNIMOD:267	ms_run[2]:scan=10599	65.981	2	1480.8165	1480.8165	K	V	236	248
PSM	LLPVYLNCVLK	1480	sp|P53992|SC24C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	8-UNIMOD:4	ms_run[2]:scan=11199	69.639	2	1330.7683	1330.7683	K	S	903	914
PSM	LLQDFFNGK	1481	sp|P17066|HSP76_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:188	ms_run[2]:scan=9077	56.652	2	1086.5805	1086.5805	K	E	351	360
PSM	LMDISPFLPEK	1482	sp|Q9Y4B5-2|MTCL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=10803	67.224	2	1288.6737	1288.6737	R	G	1035	1046
PSM	LNFGDDIPSALR	1483	sp|Q9UNE7-2|CHIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	12-UNIMOD:267	ms_run[2]:scan=9692	60.379	2	1326.6807	1326.6807	R	I	57	69
PSM	LNIPVSQVNPR	1484	sp|P05023-3|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5915	38.204	2	1235.6986	1235.6986	R	D	617	628
PSM	LNLGTVGFYR	1485	sp|P55786-2|PSA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8971	56.018	2	1138.6135	1138.6135	K	T	501	511
PSM	LNYLDILMR	1486	sp|P23229-7|ITA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	8-UNIMOD:35	ms_run[2]:scan=10783	67.106	2	1165.6165	1165.6165	K	A	849	858
PSM	LQVVDQPLPVR	1487	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:267	ms_run[2]:scan=6801	43.249	2	1272.7429	1272.7429	R	G	374	385
PSM	LSELEAALQR	1488	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=6977	44.235	2	1138.6222	1138.6222	K	A	353	363
PSM	LTFSCLGGSDNFK	1489	sp|Q15185-2|TEBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	5-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=8415	52.634	2	1450.6858	1450.6858	K	H	36	49
PSM	LVIITAGAR	1490	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5066	33.029	2	912.57565	912.5757	K	Q	91	100
PSM	LVIITAGAR	1491	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:267	ms_run[2]:scan=5067	33.033	2	922.58392	922.5839	K	Q	91	100
PSM	LWTLVSEQTR	1492	sp|P46776|RL27A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8053	50.427	2	1231.6561	1231.6561	K	V	78	88
PSM	MGPGATAGGAEK	1493	sp|P62820-2|RAB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:35,12-UNIMOD:188	ms_run[2]:scan=521	6.6208	2	1067.5013	1067.5013	R	S	112	124
PSM	MGPNIYELR	1494	sp|Q9BPW8|NIPS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:35	ms_run[2]:scan=6107	39.291	2	1107.5383	1107.5383	R	T	180	189
PSM	MGPNIYELR	1495	sp|Q9BPW8|NIPS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:35,9-UNIMOD:267	ms_run[2]:scan=6126	39.397	2	1117.5465	1117.5465	R	T	180	189
PSM	MGQMAMGGAMGINNR	1496	sp|Q15233-2|NONO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:35	ms_run[2]:scan=5420	35.407	2	1553.6571	1553.6571	R	G	295	310
PSM	MIDLSGNPVLR	1497	sp|O14735-3|CDIPT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8296	51.861	2	1213.6489	1213.6489	K	I	77	88
PSM	MLEILEQQK	1498	sp|P11172-2|UMPS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:35,9-UNIMOD:188	ms_run[2]:scan=5587	36.352	2	1152.6156	1152.6156	-	K	1	10
PSM	MLIEFYESPDPER	1499	sp|Q9NUQ2|PLCE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:35	ms_run[2]:scan=8611	53.856	2	1640.7392	1640.7392	K	R	291	304
PSM	MLLNDFLNDQNR	1500	sp|Q01581|HMCS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:35	ms_run[2]:scan=9260	57.757	2	1507.7089	1507.7089	R	D	278	290
PSM	MNLPGEVTFLPLNK	1501	sp|Q9UQE7|SMC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:35,14-UNIMOD:188	ms_run[2]:scan=10257	63.843	2	1593.8532	1593.8532	K	L	579	593
PSM	MNPQSAFFQGK	1502	sp|P22307-6|NLTP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6615	42.206	2	1253.5863	1253.5863	K	L	105	116
PSM	MVIITGPPEAQFK	1503	sp|Q9NZI8|IF2B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8585	53.697	2	1429.7639	1429.7639	R	A	453	466
PSM	NALDPMSVLLAR	1504	sp|P42785|PCP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11807	73.577	2	1298.7017	1298.7017	K	S	463	475
PSM	NLWVSGLSSTTR	1505	sp|Q14151|SAFB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	12-UNIMOD:267	ms_run[2]:scan=8042	50.36	2	1329.6916	1329.6916	R	A	408	420
PSM	NLWVSGLSSTTR	1506	sp|Q14151|SAFB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8048	50.395	2	1319.6834	1319.6834	R	A	408	420
PSM	NNQNPWTFER	1507	sp|Q9NX20|RM16_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=6844	43.497	2	1314.5981	1314.5981	R	I	208	218
PSM	NNWTGEFSAR	1508	sp|Q9NXR7-4|BABA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=6084	39.156	2	1190.5344	1190.5344	K	F	163	173
PSM	NSIPEPIDPLFK	1509	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9953	61.974	2	1368.7289	1368.7289	K	H	620	632
PSM	NTFLWTEFTDR	1510	sp|Q86T03|PP4P1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11574	72.02	2	1428.6674	1428.6674	K	T	179	190
PSM	NVFSSSGTSFSGR	1511	sp|P49790-2|NU153_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	13-UNIMOD:267	ms_run[2]:scan=5720	37.115	2	1341.6189	1341.6189	K	K	1411	1424
PSM	NVQGIIEILK	1512	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=10460	65.113	2	1125.6758	1125.6758	K	G	454	464
PSM	PTPQDSPIFLPVDDTSFR	1513	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11216	69.746	2	2030.9949	2030.9949	R	W	1406	1424
PSM	QANTGLFNLR	1514	sp|P52888-2|THOP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=7510	47.264	2	1142.6072	1142.6072	R	Q	55	65
PSM	QAQIEVVPSASALIIK	1515	sp|P30050|RL12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	16-UNIMOD:188	ms_run[2]:scan=10142	63.129	2	1671.9867	1671.9867	R	A	68	84
PSM	QDTFSGTGFFPLDR	1516	sp|Q9Y4E8-2|UBP15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	14-UNIMOD:267	ms_run[2]:scan=10864	67.594	2	1596.7448	1596.7448	R	E	904	918
PSM	QGLGPASTTSPSPGPR	1517	sp|P98171|RHG04_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=2998	21.613	2	1508.7583	1508.7583	R	S	890	906
PSM	QGSPDQVSPVSEMTSTSLYQDKQEGK	1518	sp|P46821|MAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	22-UNIMOD:188,26-UNIMOD:188	ms_run[2]:scan=7230	45.687	3	2837.3428	2837.3428	K	S	1436	1462
PSM	QLNPINLTER	1519	sp|O00442|RTCA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=6763	43.043	2	1206.6596	1206.6596	K	G	177	187
PSM	SAFSNLFGGEPLSYTR	1520	sp|P02786|TFR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	16-UNIMOD:267	ms_run[2]:scan=11659	72.607	2	1754.8503	1754.8503	R	F	7	23
PSM	SDNGELEDKPPAPPVR	1521	sp|Q13177|PAK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:1	ms_run[2]:scan=4997	32.588	2	1761.8533	1761.8533	M	M	2	18
PSM	SFQGALEFK	1522	sp|Q9NRK6|ABCBA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7315	46.182	2	1025.5182	1025.5182	K	N	487	496
PSM	SGQQIVGPPR	1523	sp|Q9UNZ2-4|NSF1C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=2110	16.454	2	1047.5701	1047.5701	R	K	102	112
PSM	SHVEQLVQNQFI	1524	sp|Q8IYQ7|THNS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8706	54.421	2	1440.7361	1440.7361	K	-	732	744
PSM	SIDGSIVLPLAR	1525	sp|Q9HD20-2|AT131_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	12-UNIMOD:267	ms_run[2]:scan=9672	60.258	2	1249.727	1249.7270	R	G	668	680
PSM	SLDMDSIIAEVK	1526	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	4-UNIMOD:35	ms_run[2]:scan=7739	48.598	2	1335.6592	1335.6592	R	A	253	265
PSM	SLESFVELMK	1527	sp|Q6KB66-2|K2C80_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11795	73.505	2	1181.6002	1181.6002	K	T	208	218
PSM	SLLFVNTLER	1528	sp|Q9NY93-2|DDX56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=10091	62.813	2	1190.6659	1190.6659	K	S	261	271
PSM	SLLLSVNAR	1529	sp|Q14697|GANAB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6771	43.085	2	971.57638	971.5764	R	G	165	174
PSM	SLLPGCQSVISR	1530	sp|O95571|ETHE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	6-UNIMOD:4	ms_run[2]:scan=6709	42.738	2	1315.6918	1315.6918	R	L	93	105
PSM	SLLQALNEVK	1531	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9464	58.995	2	1113.6394	1113.6394	K	G	3748	3758
PSM	SLLQQLENVTK	1532	sp|Q9UPN9-2|TRI33_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=10918	67.925	2	1271.7085	1271.7085	K	E	379	390
PSM	SLLVNPEGPTLMR	1533	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	12-UNIMOD:35	ms_run[2]:scan=7229	45.681	2	1441.7599	1441.7599	R	L	2221	2234
PSM	SLNILTAFQK	1534	sp|P30040|ERP29_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:188	ms_run[2]:scan=10790	67.149	2	1139.6646	1139.6646	K	K	244	254
PSM	SNCVLEAFGNAK	1535	sp|O94832|MYO1D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	3-UNIMOD:4,12-UNIMOD:188	ms_run[2]:scan=7428	46.814	2	1314.6334	1314.6334	K	T	141	153
PSM	SNEILTAIIQGMR	1536	sp|Q14974|IMB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	12-UNIMOD:35,13-UNIMOD:267	ms_run[2]:scan=10422	64.874	2	1470.774	1470.7740	K	K	170	183
PSM	SNPDQPAVILLLR	1537	sp|Q6PGP7|TTC37_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	13-UNIMOD:267	ms_run[2]:scan=11154	69.363	2	1444.8277	1444.8277	K	Q	1355	1368
PSM	SPVIEFWENK	1538	sp|P48029-4|SC6A8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:188	ms_run[2]:scan=9693	60.385	2	1253.6388	1253.6388	R	V	93	103
PSM	SPVIEFWENK	1539	sp|P48029-4|SC6A8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9705	60.457	2	1247.6186	1247.6186	R	V	93	103
PSM	SSGPTSLFAVTVAPPGAR	1540	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	18-UNIMOD:267	ms_run[2]:scan=9943	61.913	3	1723.9133	1723.9133	K	Q	187	205
PSM	STIFPLDGVVR	1541	sp|O60318|GANP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:267	ms_run[2]:scan=10103	62.891	2	1212.6742	1212.6742	R	M	896	907
PSM	STVHEILCK	1542	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:1,8-UNIMOD:4,9-UNIMOD:188	ms_run[2]:scan=5825	37.721	2	1133.5846	1133.5846	M	L	2	11
PSM	STVHEILCK	1543	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:1,8-UNIMOD:4	ms_run[2]:scan=5830	37.746	2	1127.5645	1127.5645	M	L	2	11
PSM	SVGNTIDPVILFQK	1544	sp|P46821|MAP1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	14-UNIMOD:188	ms_run[2]:scan=10942	68.072	2	1535.8655	1535.8655	R	M	401	415
PSM	TFAPEEISAMVLTK	1545	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	14-UNIMOD:188	ms_run[2]:scan=11415	70.977	2	1541.8107	1541.8107	K	M	139	153
PSM	TFEVCDLPVR	1546	sp|P35606-2|COPB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	5-UNIMOD:4,10-UNIMOD:267	ms_run[2]:scan=8004	50.144	2	1244.6099	1244.6099	K	A	23	33
PSM	TLDLPIYVTR	1547	sp|P53621|COPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=9680	60.309	2	1199.6789	1199.6789	R	V	563	573
PSM	TLGGLEMELR	1548	sp|Q9Y4L1|HYOU1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	7-UNIMOD:35,10-UNIMOD:267	ms_run[2]:scan=7119	45.038	2	1143.5833	1143.5833	R	L	269	279
PSM	TLLEALEQR	1549	sp|Q6P1N0-2|C2D1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8895	55.555	2	1071.5924	1071.5924	R	M	347	356
PSM	TLQLWLDNPK	1550	sp|O60341|KDM1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:188	ms_run[2]:scan=9453	58.924	2	1232.6861	1232.6861	R	I	217	227
PSM	TLVLIGASGVGR	1551	sp|Q00013-2|EM55_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	12-UNIMOD:267	ms_run[2]:scan=7686	48.285	2	1151.6902	1151.6902	K	S	254	266
PSM	TLVNPANVTFK	1552	sp|O75608-2|LYPA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:188	ms_run[2]:scan=7247	45.791	2	1208.6861	1208.6861	K	T	175	186
PSM	TMQTLLSLVR	1553	sp|P00492|HPRT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11323	70.411	2	1160.6587	1160.6587	K	Q	142	152
PSM	TPISLLQEYGTR	1554	sp|Q15633-2|TRBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9326	58.161	2	1376.73	1376.7300	K	I	9	21
PSM	TPPLITDYR	1555	sp|P11388|TOP2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6062	39.04	2	1074.571	1074.5710	K	E	950	959
PSM	TWTTPEVTSPPPSPR	1556	sp|Q7Z6M1-2|RABEK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	15-UNIMOD:267	ms_run[2]:scan=6219	39.929	2	1661.8289	1661.8289	R	T	74	89
PSM	VDILDPALLR	1557	sp|P17980|PRS6A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=10630	66.172	2	1133.6684	1133.6684	R	S	335	345
PSM	VFDPVPVGVTK	1558	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:188	ms_run[2]:scan=7184	45.421	2	1162.6693	1162.6693	K	V	698	709
PSM	VFGAAPLENVVR	1559	sp|Q16656-2|NRF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8471	52.982	2	1270.7034	1270.7034	K	K	146	158
PSM	VGEFSGANK	1560	sp|P10599-2|THIO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:188	ms_run[2]:scan=1217	10.754	2	913.46007	913.4601	K	E	66	75
PSM	VIVPNMEFR	1561	sp|P55060-4|XPO2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:267	ms_run[2]:scan=7928	49.699	2	1113.588	1113.5880	K	A	291	300
PSM	VLATQPGPGR	1562	sp|Q5JTH9-2|RRP12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=1206	10.691	2	994.55598	994.5560	R	G	1029	1039
PSM	VNQAIWLLCTGAR	1563	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=10349	64.413	3	1510.7954	1510.7954	R	E	147	160
PSM	VTLTLPVLNAAR	1564	sp|O95336|6PGL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=10497	65.335	2	1266.766	1266.7660	R	T	186	198
PSM	VVGNPCPICR	1565	sp|Q9Y676|RT18B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	6-UNIMOD:4,9-UNIMOD:4,10-UNIMOD:267	ms_run[2]:scan=2604	19.317	2	1180.5721	1180.5721	K	D	100	110
PSM	VVINVPIFK	1566	sp|P48506|GSH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=10080	62.748	2	1027.643	1027.6430	K	D	201	210
PSM	YAGLSTCFR	1567	sp|P49591|SYSC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	7-UNIMOD:4,9-UNIMOD:267	ms_run[2]:scan=5967	38.491	2	1083.5047	1083.5047	K	Q	294	303
PSM	YEFGIFNQK	1568	sp|P11216|PYGB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9061	56.555	2	1144.5553	1144.5553	R	I	162	171
PSM	YEFGIFNQK	1569	sp|P11216|PYGB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:188	ms_run[2]:scan=9062	56.56	2	1150.5754	1150.5754	R	I	162	171
PSM	YIDQEELNK	1570	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:188	ms_run[2]:scan=2873	20.9	2	1156.5707	1156.5707	K	T	284	293
PSM	YTALNLIGPR	1571	sp|Q8NCN5|PDPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8082	50.585	2	1116.6291	1116.6291	K	A	621	631
PSM	LDIDSPPITAR	1572	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=6407	41.01782166666667	2	1197.663478	1196.640102	R	N	33	44
PSM	QSVENDIHGLR	1573	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28	ms_run[1]:scan=5835	37.77643166666667	2	1249.6034	1249.6046	R	K	176	187
PSM	QLFHPEQLITGK	1574	sp|P68363|TBA1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28,12-UNIMOD:188	ms_run[1]:scan=10481	65.24472666666668	2	1398.7589	1398.7598	R	E	85	97
PSM	QRYEILTPNSIPK	1575	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28	ms_run[1]:scan=8326	52.071036666666664	2	1540.8242	1540.8244	R	G	719	732
PSM	IMNTFSVVPSPK	1576	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	12-UNIMOD:188	ms_run[1]:scan=7777	48.82031	2	1324.718417	1324.715638	R	V	163	175
PSM	GVVDSEDLPLNISR	1577	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	14-UNIMOD:267	ms_run[1]:scan=8525	53.32847333333333	2	1522.790982	1522.786656	R	E	387	401
PSM	GWPLELLCEK	1578	sp|Q12906|ILF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	8-UNIMOD:4,10-UNIMOD:188	ms_run[1]:scan=11917	74.31747666666668	2	1249.649008	1249.647224	R	S	248	258
PSM	TLMNLGGLAVAR	1579	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=9465	58.999995	2	1214.678927	1214.680527	R	D	128	140
PSM	QVLIASHLPSYELR	1580	sp|Q13085|ACACA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28,14-UNIMOD:267	ms_run[1]:scan=10557	65.711575	2	1617.8727	1617.8749	R	H	1083	1097
PSM	IQIEAIPLALQGR	1581	sp|Q9H0S4|DDX47_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	13-UNIMOD:267	ms_run[1]:scan=10727	66.76637833333334	2	1430.847532	1430.848468	K	D	50	63
PSM	FVFGTTPEDILR	1582	sp|P07996|TSP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=11085	68.94063666666666	2	1393.727280	1393.724166	R	N	217	229
PSM	YQQAGLPLIVLAGK	1583	sp|P21399|ACOC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=11224	69.79647166666666	2	1469.861861	1469.860600	R	E	759	773
PSM	AATFFGEVVKAPCR	1584	sp|O95456|PSMG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1,10-UNIMOD:188,13-UNIMOD:4,14-UNIMOD:267	ms_run[1]:scan=11327	70.43199166666666	2	1610.8422	1609.8252	M	A	2	16
PSM	QGTTPPIWHLTDK	1585	sp|P55265|DSRAD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28,13-UNIMOD:188	ms_run[1]:scan=8928	55.756655	2	1481.7619	1481.7605	R	K	346	359
PSM	MEKPSPLLVGR	1586	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1	ms_run[1]:scan=7149	45.214420000000004	2	1267.6978	1267.6953	V	E	3	14
PSM	MEKPSPLLVGR	1587	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1,3-UNIMOD:188,11-UNIMOD:267	ms_run[1]:scan=7142	45.172533333333334	2	1283.7269	1283.7237	V	E	3	14
PSM	GSAPPGPVPEGSIR	1588	sp|P78417|GSTO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=3798	26.052936666666668	2	1319.682773	1319.683364	K	I	12	26
PSM	QIEEFNIGKR	1589	sp|P82933|RT09_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28	ms_run[1]:scan=7557	47.51724	2	1215.6261	1215.6243	K	H	77	87
PSM	GIVNEQFLLQR	1590	sp|P49748|ACADV_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=9014	56.27854166666666	2	1315.723120	1315.724835	K	L	557	568
PSM	QQPGPSEHIER	1591	sp|P50552|VASP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28,11-UNIMOD:267	ms_run[1]:scan=1893	15.202020000000001	2	1269.5970	1269.5972	R	R	144	155
PSM	AIYKGPGSEAGP	1592	sp|P21964|COMT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:188	ms_run[1]:scan=3341	23.498608333333333	2	1151.590832	1151.591817	K	-	260	272
PSM	GVLLYGPPGTGK	1593	sp|Q8NB90|AFG2H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	12-UNIMOD:188	ms_run[1]:scan=5855	37.880763333333334	2	1163.663480	1163.664588	R	T	389	401
PSM	VALLDFGATR	1594	sp|Q8NI60|COQ8A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=9191	57.336225	2	1062.569599	1061.586945	K	E	503	513
PSM	TSVLEMIAQAR	1595	sp|O60313|OPA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=10967	68.22717833333333	2	1217.646147	1217.643808	K	I	302	313
PSM	SLDLDSIIAEVK	1596	sp|P04264|K2C1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=12154	76.21436166666668	2	1301.710386	1301.707848	R	A	344	356
PSM	LGEWVGLCK	1597	sp|P25398|RS12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	8-UNIMOD:4,9-UNIMOD:188	ms_run[1]:scan=7366	46.46611	2	1066.558594	1066.557681	K	I	85	94
PSM	CHVQTIQLCR	1598	sp|O00541|PESC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:385,1-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=5875	37.98644166666667	2	1296.6044	1296.6062	K	R	153	163
PSM	CHVQTIQLCR	1599	sp|O00541|PESC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:385,1-UNIMOD:4,9-UNIMOD:4,10-UNIMOD:267	ms_run[1]:scan=5872	37.97155166666666	2	1306.6127	1306.6145	K	R	153	163
PSM	QLSLDINRLPGEK	1600	sp|Q15059|BRD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28	ms_run[1]:scan=9599	59.813501666666674	2	1464.7877	1464.7931	R	L	579	592
PSM	SWFEPLVEDMQR	1601	sp|P02649|APOE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	10-UNIMOD:35	ms_run[1]:scan=10285	64.01562166666666	2	1551.703365	1551.702779	K	Q	281	293
PSM	QWLNSGHINDVR	1602	sp|O14974|MYPT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28,12-UNIMOD:267	ms_run[1]:scan=7512	47.27276833333333	2	1430.6893	1430.6925	R	H	183	195
PSM	NVEDGFGIAFR	1603	sp|Q68DK2|ZFY26_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	11-UNIMOD:267	ms_run[1]:scan=9280	57.87931333333333	2	1234.609255	1233.601756	K	V	2383	2394
PSM	DPQLVPILIEAAR	1604	sp|Q15738|NSDHL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	13-UNIMOD:267	ms_run[1]:scan=11890	74.14819333333334	2	1443.834909	1443.832484	R	N	208	221
PSM	TPSGGGGGPWRGLSAAAAAR	1605	sp|Q2TBC4-2|PRIC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	20-UNIMOD:267	ms_run[1]:scan=8234	51.44315666666667	2	1805.951850	1805.916047	R	T	274	294
PSM	KTTPANPVGPSGGMSDDDK	1606	sp|Q14746|COG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:188,14-UNIMOD:35,19-UNIMOD:188	ms_run[1]:scan=5822	37.69976	2	1900.911592	1900.887530	R	I	672	691
PSM	LVGLEAPSVR	1607	sp|Q8NBN7|RDH13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	10-UNIMOD:267	ms_run[1]:scan=6315	40.49081666666667	2	1049.612409	1049.610864	R	E	316	326
PSM	VLTELLEQER	1608	sp|Q13428|TCOF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	10-UNIMOD:267	ms_run[1]:scan=7619	47.88730833333333	2	1240.661498	1238.674586	K	K	1318	1328
PSM	AALNALQPPEFR	1609	sp|Q3ZAQ7|VMA21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=8567	53.587	2	1325.7092	1325.7092	K	N	7	19
PSM	AAPDILIATPGR	1610	sp|Q96GQ7|DDX27_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	12-UNIMOD:267	ms_run[2]:scan=7122	45.059	2	1203.6851	1203.6851	R	L	338	350
PSM	ACGNFGIPCELR	1611	sp|P22234|PUR6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	2-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=7705	48.393	2	1392.6278	1392.6278	K	V	287	299
PSM	AFFPCFDTPAVK	1612	sp|Q9H4A4|AMPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	5-UNIMOD:4	ms_run[2]:scan=10457	65.096	2	1398.6642	1398.6642	R	Y	177	189
PSM	AGGIETIANEFSDR	1613	sp|Q92598-2|HS105_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=9309	58.056	2	1478.7001	1478.7001	R	C	20	34
PSM	AGNLGGGVVTIER	1614	sp|P35268|RL22_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=5552	36.151	2	1241.6728	1241.6728	K	S	53	66
PSM	AGPGVEDLWR	1615	sp|Q9UNI6|DUS12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	10-UNIMOD:267	ms_run[2]:scan=8013	50.198	2	1108.5541	1108.5541	K	L	68	78
PSM	ALESSIAPIVIFASNR	1616	sp|Q9Y265|RUVB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	16-UNIMOD:267	ms_run[2]:scan=11996	74.934	3	1696.9387	1696.9387	R	G	318	334
PSM	ALPPEQQFEPPLQPR	1617	sp|Q96SZ5|AEDO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	15-UNIMOD:267	ms_run[2]:scan=7661	48.134	2	1755.9183	1755.9183	R	E	146	161
PSM	ASESGKLWGGR	1618	sp|P04424-3|ARLY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:1	ms_run[2]:scan=5196	33.961	2	1188.5887	1188.5887	M	F	2	13
PSM	ASFVTEVLAHSGR	1619	sp|O43264-2|ZW10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:1,13-UNIMOD:267	ms_run[2]:scan=12501	79.828	2	1424.7287	1424.7287	M	L	2	15
PSM	CLAPMMSEVIR	1620	sp|P40939|ECHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:4	ms_run[2]:scan=9214	57.475	2	1305.6243	1305.6243	R	I	550	561
PSM	CLQLLGNLGSLEK	1621	sp|Q96HW7-2|INT4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:4	ms_run[2]:scan=10927	67.978	2	1443.7755	1443.7756	K	S	170	183
PSM	CNFESNFPR	1622	sp|Q96JM3|CHAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:4	ms_run[2]:scan=5709	37.052	2	1169.4924	1169.4924	R	G	770	779
PSM	CVLSGPPQLEK	1623	sp|Q9BQ52-4|RNZ2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:4,11-UNIMOD:188	ms_run[2]:scan=5793	37.541	2	1232.653	1232.6530	K	Y	136	147
PSM	CVLSGPPQLEK	1624	sp|Q9BQ52-4|RNZ2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:4	ms_run[2]:scan=5795	37.551	2	1226.6329	1226.6329	K	Y	136	147
PSM	CVSCLPGQR	1625	sp|Q9Y490|TLN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:4,4-UNIMOD:4,9-UNIMOD:267	ms_run[2]:scan=2079	16.262	2	1085.4986	1085.4986	R	D	1199	1208
PSM	DGEDQTQDTELVETRPAGDGTFQK	1626	sp|P10321-2|HLAC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	15-UNIMOD:267,24-UNIMOD:188	ms_run[2]:scan=5593	36.388	2	2652.2122	2648.2241	R	W	244	268
PSM	DLEEFFSTVGK	1627	sp|Q14498-3|RBM39_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	11-UNIMOD:188	ms_run[2]:scan=11628	72.396	2	1276.6283	1276.6283	R	V	146	157
PSM	DLLEVADVLEK	1628	sp|Q9HAV7|GRPE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=11671	72.693	2	1242.6707	1242.6707	K	A	110	121
PSM	DLVSFPLSPAVR	1629	sp|O43502-2|RA51C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=10574	65.82	2	1299.7187	1299.7187	R	V	13	25
PSM	EAALPPVSPLK	1630	sp|Q04637-6|IF4G1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=6335	40.607	2	1120.6492	1120.6492	R	A	1028	1039
PSM	EADGEQDEEEKDDGEAK	1631	sp|Q8IX12-2|CCAR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=566	6.8938	2	1892.7396	1892.7396	K	E	592	609
PSM	EGSGLFPDLLVR	1632	sp|Q86Y56|DAAF5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	12-UNIMOD:267	ms_run[2]:scan=11691	72.824	2	1311.7062	1311.7062	K	E	815	827
PSM	ELAPLFEELR	1633	sp|Q9UHA4-2|LTOR3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	10-UNIMOD:267	ms_run[2]:scan=11270	70.08	2	1225.6582	1225.6582	K	Q	102	112
PSM	ELPQFATGENLPR	1634	sp|Q9BZZ5-3|API5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=7757	48.703	2	1470.7467	1470.7467	K	V	85	98
PSM	ELVGPPLAETVFTPK	1635	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	15-UNIMOD:188	ms_run[2]:scan=10728	66.772	2	1602.8964	1602.8964	K	T	1384	1399
PSM	ENGELLPILR	1636	sp|O76003|GLRX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	10-UNIMOD:267	ms_run[2]:scan=9791	60.979	2	1162.6585	1162.6585	K	G	323	333
PSM	EVAAGYLVPLLR	1637	sp|Q13395|TARB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=11503	71.569	2	1299.7551	1299.7551	R	S	63	75
PSM	FADLSEAANR	1638	sp|P08670|VIME_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=4102	27.728	2	1092.52	1092.5200	K	N	295	305
PSM	FEVGDIMLIR	1639	sp|P00491|PNPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	10-UNIMOD:267	ms_run[2]:scan=11759	73.267	2	1201.6404	1201.6404	K	D	124	134
PSM	FFQELPGSDPVFK	1640	sp|Q6P996-3|PDXD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	13-UNIMOD:188	ms_run[2]:scan=9677	60.287	2	1515.7705	1515.7705	R	A	303	316
PSM	FGDPECQVILPLLK	1641	sp|P22102-2|PUR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	6-UNIMOD:4	ms_run[2]:scan=11957	74.629	2	1627.8644	1627.8644	R	S	293	307
PSM	FGNTEQGFK	1642	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	9-UNIMOD:188	ms_run[2]:scan=2534	18.936	2	1032.4972	1032.4972	K	F	1852	1861
PSM	FIVSPVPESR	1643	sp|Q9H4A3-4|WNK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=6250	40.108	2	1129.6132	1129.6132	R	L	851	861
PSM	FLEFGPENCTSWIK	1644	sp|Q9BZJ0-2|CRNL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	9-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=11228	69.819	2	1732.8226	1732.8226	K	F	471	485
PSM	FLSLDYIPQR	1645	sp|Q14790-6|CASP8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	10-UNIMOD:267	ms_run[2]:scan=9492	59.165	2	1260.6742	1260.6742	K	K	24	34
PSM	FSLVDLAGNER	1646	sp|Q99661-2|KIF2C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=9496	59.187	2	1219.6197	1219.6197	K	G	434	445
PSM	GAVLNGGPPSTR	1647	sp|Q5VTB9-3|RN220_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=2227	17.221	2	1124.5938	1124.5938	R	I	220	232
PSM	GFFEGTIASK	1648	sp|P53621|COPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	10-UNIMOD:188	ms_run[2]:scan=6891	43.76	2	1061.5489	1061.5489	K	G	816	826
PSM	GFFEGTIASK	1649	sp|P53621|COPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=6892	43.765	2	1055.5288	1055.5288	K	G	816	826
PSM	GIDPFSLDALSK	1650	sp|P40227-2|TCPZ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	12-UNIMOD:188	ms_run[2]:scan=10843	67.468	2	1267.6755	1267.6755	K	E	251	263
PSM	GIFTSEIGTK	1651	sp|P78527-2|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=6572	41.966	2	1051.555	1051.5550	R	Q	2941	2951
PSM	GIYLWDVEGR	1652	sp|P04181|OAT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=10141	63.124	2	1206.6033	1206.6033	K	K	67	77
PSM	GIYLWDVEGR	1653	sp|P04181|OAT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	10-UNIMOD:267	ms_run[2]:scan=10143	63.135	2	1216.6116	1216.6116	K	K	67	77
PSM	GKVPITYLELLN	1654	sp|Q9Y371-3|SHLB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=11416	70.983	2	1358.781	1358.7810	K	-	254	266
PSM	GLGGLLEVPEQPR	1655	sp|Q562E7-4|WDR81_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=9092	56.737	2	1363.746	1363.7460	K	V	744	757
PSM	GLGLEPTALAR	1656	sp|Q8WZA9|IRGQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	11-UNIMOD:267	ms_run[2]:scan=7170	45.336	2	1106.6323	1106.6323	R	R	519	530
PSM	GLLEENDIFR	1657	sp|Q86XK2-6|FBX11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	10-UNIMOD:267	ms_run[2]:scan=9456	58.945	2	1214.6171	1214.6171	R	N	659	669
PSM	GLLEENDIFR	1658	sp|Q86XK2-6|FBX11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	10-UNIMOD:267	ms_run[2]:scan=9465	59	2	1214.6171	1214.6171	R	N	659	669
PSM	GLYDGPVCEVSVTPK	1659	sp|Q16555-2|DPYL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	8-UNIMOD:4	ms_run[2]:scan=7232	45.699	2	1619.7865	1619.7865	R	T	461	476
PSM	GSAPPGPVPEGSIR	1660	sp|P78417-2|GSTO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	14-UNIMOD:267	ms_run[2]:scan=3804	26.087	2	1329.6916	1329.6916	K	I	12	26
PSM	GTLSGWILSK	1661	sp|P27824-2|CALX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	10-UNIMOD:188	ms_run[2]:scan=9467	59.011	2	1066.6118	1066.6118	R	A	113	123
PSM	GTLSGWILSK	1662	sp|P27824-2|CALX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=9473	59.049	2	1060.5917	1060.5917	R	A	113	123
PSM	GVLPYVGNLITK	1663	sp|Q5T4S7-3|UBR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	12-UNIMOD:188	ms_run[2]:scan=10706	66.639	2	1278.7643	1278.7643	R	E	4180	4192
PSM	GWPLELLCEK	1664	sp|Q12906|ILF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	8-UNIMOD:4	ms_run[2]:scan=11916	74.312	2	1243.6271	1243.6271	R	S	248	258
PSM	GYSFTTTAER	1665	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=4035	27.34	2	1131.5197	1131.5197	R	E	197	207
PSM	IAQITGPPDR	1666	sp|Q96AE4|FUBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	10-UNIMOD:267	ms_run[2]:scan=3038	21.833	2	1076.5854	1076.5854	R	C	322	332
PSM	IDIIPNPQER	1667	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	10-UNIMOD:267	ms_run[2]:scan=6559	41.89	2	1203.6487	1203.6487	K	T	73	83
PSM	IDLAVLLGK	1668	sp|Q14157-4|UBP2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=11405	70.918	2	940.59572	940.5957	R	T	275	284
PSM	IEITSLLPSR	1669	sp|Q8NFH3-2|NUP43_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	10-UNIMOD:267	ms_run[2]:scan=9729	60.606	2	1137.6633	1137.6633	R	S	244	254
PSM	IIDTPQFQR	1670	sp|Q9Y3Z3-3|SAMH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	9-UNIMOD:267	ms_run[2]:scan=5406	35.323	2	1126.601	1126.6010	R	L	135	144
PSM	ILITTVPPNLR	1671	sp|Q12905|ILF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	11-UNIMOD:267	ms_run[2]:scan=8037	50.336	2	1245.7684	1245.7684	K	K	175	186
PSM	ILLNPVQVFDVTK	1672	sp|P52429|DGKE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	13-UNIMOD:188	ms_run[2]:scan=12163	76.282	2	1490.8804	1490.8804	R	T	242	255
PSM	ILLTQENPFFR	1673	sp|Q08J23-3|NSUN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=11090	68.972	2	1376.7452	1376.7452	K	K	393	404
PSM	ILTFDQLALDSPK	1674	sp|Q07020-2|RL18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	13-UNIMOD:188	ms_run[2]:scan=10662	66.37	2	1465.8124	1465.8124	K	G	91	104
PSM	INQGWLDSSR	1675	sp|Q96AC1-2|FERM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=5331	34.875	2	1174.5731	1174.5731	K	S	248	258
PSM	IPYAPSGEIPK	1676	sp|O60701-3|UGDH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=5709	37.052	2	1170.6285	1170.6285	R	F	374	385
PSM	ITPSYVAFTPEGER	1677	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	14-UNIMOD:267	ms_run[2]:scan=7430	46.824	2	1575.7808	1575.7808	R	L	61	75
PSM	ITVPFLEQCPIR	1678	sp|P48147|PPCE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	9-UNIMOD:4	ms_run[2]:scan=10915	67.908	2	1471.7857	1471.7857	K	G	49	61
PSM	IVLQIDNAR	1679	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=5612	36.495	2	1040.5978	1040.5978	R	L	150	159
PSM	IWDISQPGSK	1680	sp|Q04726-2|TLE3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=6172	39.656	2	1129.5768	1129.5768	K	S	499	509
PSM	IYVGNLPPDIR	1681	sp|Q07955-3|SRSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	11-UNIMOD:267	ms_run[2]:scan=8166	51.033	2	1265.7007	1265.7007	R	T	18	29
PSM	IYVGNLPPDIR	1682	sp|Q07955-3|SRSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	11-UNIMOD:267	ms_run[2]:scan=8320	52.028	2	1265.7007	1265.7007	R	T	18	29
PSM	KGQGGAGAGDDEEED	1683	sp|P46781|RS9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:188	ms_run[2]:scan=466	6.2735	2	1439.5744	1439.5744	K	-	180	195
PSM	LALFNPDVCWDR	1684	sp|O00483|NDUA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	9-UNIMOD:4	ms_run[2]:scan=11159	69.391	2	1504.7133	1504.7133	R	N	36	48
PSM	LDQLIYIPLPDEK	1685	sp|P55072|TERA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=11485	71.456	2	1555.8498	1555.8498	R	S	639	652
PSM	LFTAESLIGLK	1686	sp|P48444|COPD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	11-UNIMOD:188	ms_run[2]:scan=11108	69.08	2	1196.7112	1196.7112	K	N	337	348
PSM	LGDGEVFFLK	1687	sp|A1A4S6|RHG10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=10164	63.262	2	1123.5914	1123.5914	K	E	313	323
PSM	LGDPLEAFPVFK	1688	sp|Q86UY6-3|NAA40_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	12-UNIMOD:188	ms_run[2]:scan=12273	77.246	2	1337.7327	1337.7327	R	K	14	26
PSM	LGVIPNVEGR	1689	sp|P22570-4|ADRO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=6512	41.617	2	1052.5978	1052.5978	K	V	325	335
PSM	LGVQDLFNSSK	1690	sp|P30740-2|ILEU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	11-UNIMOD:188	ms_run[2]:scan=9152	57.101	2	1212.6446	1212.6446	R	A	140	151
PSM	LIDIGNSCR	1691	sp|O00139-2|KIF2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	8-UNIMOD:4	ms_run[2]:scan=4086	27.634	2	1046.5179	1046.5179	K	T	367	376
PSM	LIHEQEQQSSS	1692	sp|Q96FQ6|S10AG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=835	8.4909	2	1284.5946	1284.5946	K	-	93	104
PSM	LLAVQELLDR	1693	sp|Q7L9B9|EEPD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	10-UNIMOD:267	ms_run[2]:scan=11176	69.499	2	1178.6898	1178.6898	K	E	296	306
PSM	LLELQELVLR	1694	sp|Q08379-2|GOGA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=12037	75.256	2	1224.7442	1224.7442	K	L	500	510
PSM	LLFNDVQTLK	1695	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	10-UNIMOD:188	ms_run[2]:scan=8891	55.533	2	1195.6908	1195.6908	R	D	588	598
PSM	LLGIETPLPK	1696	sp|P05362|ICAM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	10-UNIMOD:188	ms_run[2]:scan=8993	56.148	2	1085.6792	1085.6792	K	K	57	67
PSM	LLSNTVMPR	1697	sp|P35221-3|CTNA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	9-UNIMOD:267	ms_run[2]:scan=4900	32.103	2	1039.5724	1039.5724	K	F	208	217
PSM	LLVPDIQEIR	1698	sp|Q12756|KIF1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	10-UNIMOD:267	ms_run[2]:scan=9631	60.006	2	1204.7055	1204.7055	R	V	1562	1572
PSM	LNIPVSQVNPR	1699	sp|P05023-3|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	11-UNIMOD:267	ms_run[2]:scan=6059	39.024	2	1245.7069	1245.7069	R	D	617	628
PSM	LNVGAPDVTLR	1700	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	11-UNIMOD:267	ms_run[2]:scan=6773	43.094	2	1163.6538	1163.6538	K	G	5356	5367
PSM	LQVVDQPLPVR	1701	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=6806	43.28	2	1262.7347	1262.7347	R	G	374	385
PSM	LSSGDPSTSPSLSQTTPSKDTDDQSR	1702	sp|Q99504-2|EYA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=3121	22.291	3	2693.2264	2693.2264	R	K	128	154
PSM	LTLSALLDGK	1703	sp|P21796|VDAC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=10601	65.992	2	1029.607	1029.6070	K	N	257	267
PSM	LTLSALVDGK	1704	sp|P45880-2|VDAC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	10-UNIMOD:188	ms_run[2]:scan=8903	55.604	2	1021.6115	1021.6115	K	S	257	267
PSM	LVFPQDLLEK	1705	sp|Q8TCT9-5|HM13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=10824	67.354	2	1200.6754	1200.6754	K	G	200	210
PSM	LVGLEAPSVR	1706	sp|Q8NBN7-2|RDH13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=6330	40.579	2	1039.6026	1039.6026	R	E	245	255
PSM	LVNYPGFNISTPR	1707	sp|Q6NZY4-2|ZCHC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	13-UNIMOD:267	ms_run[2]:scan=8659	54.143	2	1486.7808	1486.7808	K	G	126	139
PSM	LYLINSPVVR	1708	sp|P41252|SYIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=8453	52.876	2	1172.6917	1172.6917	R	A	625	635
PSM	LYLINSPVVR	1709	sp|P41252|SYIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	10-UNIMOD:267	ms_run[2]:scan=8458	52.908	2	1182.7	1182.7000	R	A	625	635
PSM	MADLSELLK	1710	sp|P30519-2|HMOX2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:35	ms_run[2]:scan=8128	50.838	2	1034.5318	1034.5318	-	E	1	10
PSM	MDVHDLFR	1711	sp|Q9Y2R4|DDX52_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:1	ms_run[2]:scan=10217	63.593	2	1073.4964	1073.4964	-	R	1	9
PSM	MDVHDLFR	1712	sp|Q9Y2R4|DDX52_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:1,8-UNIMOD:267	ms_run[2]:scan=10220	63.615	2	1083.5047	1083.5047	-	R	1	9
PSM	MFEDPETTR	1713	sp|P60228|EIF3E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:35,9-UNIMOD:267	ms_run[2]:scan=2278	17.503	2	1150.484	1150.4840	K	Q	94	103
PSM	MGPGATAGGAEK	1714	sp|P62820-2|RAB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:35	ms_run[2]:scan=522	6.626	2	1061.4812	1061.4812	R	S	112	124
PSM	MGPNIYELR	1715	sp|Q9BPW8|NIPS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=7240	45.748	2	1091.5434	1091.5434	R	T	180	189
PSM	MGPNIYELR	1716	sp|Q9BPW8|NIPS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	9-UNIMOD:267	ms_run[2]:scan=7241	45.752	2	1101.5516	1101.5516	R	T	180	189
PSM	MGSQVIIPYR	1717	sp|Q16795|NDUA9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:35	ms_run[2]:scan=5756	37.326	2	1178.6118	1178.6118	R	C	76	86
PSM	MIEVVCNDR	1718	sp|Q9BZL1|UBL5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:35,6-UNIMOD:4	ms_run[2]:scan=2476	18.606	2	1150.5111	1150.5111	-	L	1	10
PSM	MIEVVCNDR	1719	sp|Q9BZL1|UBL5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:35,6-UNIMOD:4,9-UNIMOD:267	ms_run[2]:scan=2483	18.647	2	1160.5193	1160.5193	-	L	1	10
PSM	MISDAIPELK	1720	sp|P40926|MDHM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:35	ms_run[2]:scan=7051	44.647	2	1131.5846	1131.5846	K	A	315	325
PSM	MLDMGFEPQIR	1721	sp|P17844-2|DDX5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:35	ms_run[2]:scan=8407	52.586	2	1351.6264	1351.6264	R	K	174	185
PSM	MLVSGAGDIK	1722	sp|P40227-2|TCPZ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:35,10-UNIMOD:188	ms_run[2]:scan=2939	21.296	2	1011.5366	1011.5366	K	L	46	56
PSM	MLVSGAGDIK	1723	sp|P40227-2|TCPZ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:35	ms_run[2]:scan=2941	21.306	2	1005.5165	1005.5165	K	L	46	56
PSM	MPGAPETAPGDGAGASR	1724	sp|O75116|ROCK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	17-UNIMOD:267	ms_run[2]:scan=2713	19.936	2	1550.7023	1550.7023	K	Q	10	27
PSM	MVPAGMGAGLER	1725	sp|P52272-2|HNRPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:35,12-UNIMOD:267	ms_run[2]:scan=4390	29.328	2	1213.5823	1213.5823	R	M	493	505
PSM	NALSSLWGK	1726	sp|P60228|EIF3E_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	9-UNIMOD:188	ms_run[2]:scan=8889	55.523	2	980.53866	980.5387	R	L	164	173
PSM	NCEPMIGLVPILK	1727	sp|Q9Y2R9|RT07_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	2-UNIMOD:4	ms_run[2]:scan=11806	73.572	2	1482.7938	1482.7938	K	G	151	164
PSM	NFGIGQDIQPK	1728	sp|P62424|RL7A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	11-UNIMOD:188	ms_run[2]:scan=6159	39.586	2	1221.6449	1221.6449	K	R	38	49
PSM	NLVDNITGQR	1729	sp|Q15149|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	10-UNIMOD:267	ms_run[2]:scan=6321	40.527	2	1138.597	1138.5970	R	L	4438	4448
PSM	NSNILEDLETLR	1730	sp|P48444|COPD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=12160	76.259	2	1415.7256	1415.7256	K	L	73	85
PSM	NVLCGNIPPDLFAR	1731	sp|P23193|TCEA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	4-UNIMOD:4	ms_run[2]:scan=10541	65.606	2	1584.8082	1584.8082	K	M	209	223
PSM	NVMEQFNPGLR	1732	sp|Q9UHR4|BI2L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	11-UNIMOD:267	ms_run[2]:scan=7616	47.871	2	1313.6426	1313.6426	R	N	18	29
PSM	NVQGIIEILK	1733	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	10-UNIMOD:188	ms_run[2]:scan=10455	65.085	2	1131.6959	1131.6959	K	G	454	464
PSM	PGGDTIFGK	1734	sp|P49773|HINT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	9-UNIMOD:188	ms_run[2]:scan=4156	28.034	2	896.46991	896.4699	R	I	13	22
PSM	QAGPASVPLR	1735	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	10-UNIMOD:267	ms_run[2]:scan=3057	21.94	2	1004.5642	1004.5642	K	T	131	141
PSM	QLFAYPGCDAGIR	1736	sp|P50851-2|LRBA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	8-UNIMOD:4	ms_run[2]:scan=8167	51.038	2	1466.6976	1466.6976	K	A	2801	2814
PSM	QPQVAELLAEAR	1737	sp|P51570|GALK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=9057	56.531	2	1323.7147	1323.7147	R	R	6	18
PSM	QSNVEVPFFPAR	1738	sp|P48200|IREB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	12-UNIMOD:267	ms_run[2]:scan=9431	58.794	2	1399.7124	1399.7124	K	V	73	85
PSM	RIEDNLPAGEE	1739	sp|O43617-2|TPPC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:267	ms_run[2]:scan=3687	25.443	2	1251.5971	1251.5971	R	-	124	135
PSM	SAVPFLPVNPEYSATR	1740	sp|Q9Y2X7|GIT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	16-UNIMOD:267	ms_run[2]:scan=10034	62.471	2	1756.9024	1756.9024	R	N	310	326
PSM	SCDGNQELLNFLR	1741	sp|Q9UIG0-2|BAZ1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	2-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=11136	69.253	2	1574.7387	1574.7387	K	S	1040	1053
PSM	SEDLLDYGPFR	1742	sp|P04843|RPN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	11-UNIMOD:267	ms_run[2]:scan=10461	65.118	2	1320.6225	1320.6226	R	D	194	205
PSM	SEGGFIWACK	1743	sp|O75874|IDHC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	9-UNIMOD:4,10-UNIMOD:188	ms_run[2]:scan=7556	47.512	2	1159.5428	1159.5428	K	N	261	271
PSM	SEKENNFPPLPK	1744	sp|Q969E2-3|SCAM4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:1	ms_run[2]:scan=6142	39.493	2	1440.7249	1440.7249	M	F	2	14
PSM	SGGGVIRGPAGNNDCR	1745	sp|Q07955-3|SRSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:1,7-UNIMOD:267,15-UNIMOD:4	ms_run[2]:scan=2622	19.421	2	1637.7568	1637.7568	M	I	2	18
PSM	SGVGNIFIK	1746	sp|P11940-2|PABP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	9-UNIMOD:188	ms_run[2]:scan=7056	44.67	2	939.5485	939.5485	K	N	96	105
PSM	SIDGSIVLPLAR	1747	sp|Q9HD20-2|AT131_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=9629	59.995	2	1239.7187	1239.7187	R	G	668	680
PSM	SLDLIESLLR	1748	sp|A5YKK6-4|CNOT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	10-UNIMOD:267	ms_run[2]:scan=12781	83.64	2	1167.6739	1167.6739	K	L	450	460
PSM	SLDMDSIIAEVK	1749	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	4-UNIMOD:35,12-UNIMOD:188	ms_run[2]:scan=7733	48.56	2	1341.6793	1341.6793	R	A	253	265
PSM	SLESFVELMK	1750	sp|Q6KB66-2|K2C80_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	10-UNIMOD:188	ms_run[2]:scan=11792	73.482	2	1187.6203	1187.6203	K	T	208	218
PSM	SLLQQLENVTK	1751	sp|Q9UPN9-2|TRI33_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	11-UNIMOD:188	ms_run[2]:scan=10924	67.962	2	1277.7286	1277.7286	K	E	379	390
PSM	SMSAPVIFDR	1752	sp|O60749|SNX2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	10-UNIMOD:267	ms_run[2]:scan=7459	46.989	2	1131.5622	1131.5622	K	S	117	127
PSM	SPFTVGVAAPLDLSK	1753	sp|O75369-6|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	15-UNIMOD:188	ms_run[2]:scan=10188	63.414	2	1506.8389	1506.8389	K	I	932	947
PSM	TIFAYFTGSK	1754	sp|Q9BRA2|TXD17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=10159	63.235	2	1133.5757	1133.5757	K	D	26	36
PSM	TIFQGIAAK	1755	sp|P52209-2|6PGD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=6115	39.337	2	947.54402	947.5440	K	V	142	151
PSM	TIFQGIAAK	1756	sp|P52209-2|6PGD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	9-UNIMOD:188	ms_run[2]:scan=6116	39.342	2	953.56415	953.5641	K	V	142	151
PSM	TLDDLFPLR	1757	sp|Q8IZH2-2|XRN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=10907	67.859	2	1088.5866	1088.5866	K	S	848	857
PSM	TLVNPANVTFK	1758	sp|O75608-2|LYPA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=7238	45.738	2	1202.6659	1202.6659	K	T	175	186
PSM	TLVQILTEPR	1759	sp|O76031|CLPX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	10-UNIMOD:267	ms_run[2]:scan=9399	58.6	2	1178.6898	1178.6898	K	N	513	523
PSM	TPTAPAVNLAGAR	1760	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=4855	31.867	2	1237.6779	1237.6779	R	T	2289	2302
PSM	TPVQPNPIVYMMK	1761	sp|O96000-2|NDUBA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=9975	62.105	2	1516.7782	1516.7782	R	A	17	30
PSM	TTGWGILEIR	1762	sp|Q6P4A8|PLBL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	10-UNIMOD:267	ms_run[2]:scan=10887	67.737	2	1154.6323	1154.6323	K	A	76	86
PSM	TVGTPIASVPGSTNTGTVPGSEKDSDSMETEEK	1763	sp|Q99460-2|PSMD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=6005	38.709	3	3307.5249	3307.5249	R	T	270	303
PSM	TWNDPSVQQDIK	1764	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=5534	36.052	2	1429.6838	1429.6838	R	F	102	114
PSM	VAPPGLTQIPQIQK	1765	sp|P05026-2|AT1B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=7760	48.72	2	1488.8664	1488.8664	R	T	72	86
PSM	VATWFNQPAR	1766	sp|P26373|RL13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=6692	42.644	2	1188.604	1188.6040	R	K	22	32
PSM	VAVCDIPPR	1767	sp|Q13509-2|TBB3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	4-UNIMOD:4,9-UNIMOD:267	ms_run[2]:scan=3463	24.205	2	1035.5411	1035.5411	K	G	279	288
PSM	VAVFFGGLSIK	1768	sp|Q13838-2|DX39B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	11-UNIMOD:188	ms_run[2]:scan=11309	70.32	2	1142.6795	1142.6795	K	K	160	171
PSM	VEQLGAEGNVEESQKVMDEVEK	1769	sp|Q9Y383-3|LC7L2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	17-UNIMOD:35	ms_run[2]:scan=5645	36.687	3	2462.1483	2462.1483	K	A	137	159
PSM	VFNETPINPR	1770	sp|Q9Y678|COPG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=4659	30.821	2	1185.6142	1185.6142	R	K	33	43
PSM	VFNETPINPR	1771	sp|Q9Y678|COPG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	10-UNIMOD:267	ms_run[2]:scan=4662	30.836	2	1195.6225	1195.6225	R	K	33	43
PSM	VGMIPVPYVEK	1772	sp|P46109|CRKL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=8893	55.544	2	1230.6682	1230.6682	R	L	170	181
PSM	VIPLISDAGLR	1773	sp|Q6P1Q0-4|LTMD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=9559	59.57	2	1152.6867	1152.6867	K	W	44	55
PSM	VLLDIFTGVR	1774	sp|P49916-3|DNLI3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	10-UNIMOD:267	ms_run[2]:scan=11859	73.94	2	1141.6735	1141.6735	K	L	846	856
PSM	VLLSPDYLPAMR	1775	sp|Q7Z6Z7-2|HUWE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=10256	63.838	2	1373.7377	1373.7377	K	R	633	645
PSM	VLMAPPSMVNNEQR	1776	sp|Q9C0E2|XPO4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=6588	42.051	2	1584.7752	1584.7752	K	Q	21	35
PSM	VLQATVVAVGSGSK	1777	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=4804	31.586	2	1314.7507	1314.7507	K	G	41	55
PSM	VNFSEEGETEEDDQDSSHSSVTTVK	1778	sp|Q5JTV8-3|TOIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	25-UNIMOD:188	ms_run[2]:scan=4495	29.915	3	2761.1782	2761.1782	K	A	213	238
PSM	VPECLYTLPSLR	1779	sp|Q13045-2|FLII_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	4-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=9858	61.386	2	1456.7624	1456.7624	R	R	184	196
PSM	VTFSCAAGFGQR	1780	sp|Q14203-5|DCTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	5-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=6338	40.627	2	1309.6113	1309.6113	K	H	1109	1121
PSM	VTGVPLSYLLSR	1781	sp|P28340|DPOD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	12-UNIMOD:267	ms_run[2]:scan=11368	70.695	2	1313.7583	1313.7583	R	G	538	550
PSM	VWDPNSPLTDR	1782	sp|Q9BTC8-2|MTA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=6556	41.875	2	1298.6255	1298.6255	K	Q	181	192
PSM	YFFFDDGNGLK	1783	sp|P61009|SPCS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=10730	66.784	2	1321.5979	1321.5979	K	G	127	138
PSM	YGGQPVPNFPSK	1784	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=5377	35.159	2	1289.6404	1289.6404	K	L	1235	1247
PSM	YGVNPGPIVGTTR	1785	sp|P42166|LAP2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	13-UNIMOD:267	ms_run[2]:scan=5605	36.456	2	1339.7124	1339.7124	K	K	127	140
PSM	YITDWQNVFR	1786	sp|O75340-2|PDCD6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=10858	67.561	2	1340.6513	1340.6513	K	T	91	101
PSM	YLGINSDGLVVGR	1787	sp|Q14331|FRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	13-UNIMOD:267	ms_run[2]:scan=8934	55.794	2	1371.7386	1371.7386	K	S	116	129
PSM	YLQSNSNNWR	1788	sp|Q7Z6Z7-2|HUWE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=3256	23.032	2	1280.5898	1280.5898	K	W	1609	1619
PSM	YNFLFLDSK	1789	sp|Q8IUX4|ABC3F_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	9-UNIMOD:188	ms_run[2]:scan=11208	69.696	2	1151.5958	1151.5958	K	L	359	368
PSM	YTALNLIGPR	1790	sp|Q8NCN5|PDPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	10-UNIMOD:267	ms_run[2]:scan=8086	50.606	2	1126.6374	1126.6374	K	A	621	631
PSM	YVLGMQELFR	1791	sp|Q96J01-2|THOC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	10-UNIMOD:267	ms_run[2]:scan=11397	70.87	2	1264.6513	1264.6513	R	G	34	44
PSM	LVSESSDVLPK	1792	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=4658	30.816461666666665	2	1173.635557	1172.628869	K	-	473	484
PSM	LQVVDQPLPVR	1793	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=6843	43.492151666666665	2	1262.737039	1262.734672	R	G	374	385
PSM	QLFHPEQLITGK	1794	sp|P68363|TBA1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:28	ms_run[1]:scan=10458	65.10167833333334	2	1392.7398	1392.7396	R	E	85	97
PSM	QLDSIVGERGR	1795	sp|P13647|K2C5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:28,9-UNIMOD:267,11-UNIMOD:267	ms_run[1]:scan=6527	41.70509333333334	2	1231.6395	1231.6419	R	L	229	240
PSM	LQIWDTAGQER	1796	sp|P61026|RAB10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	11-UNIMOD:267	ms_run[1]:scan=6898	43.797828333333335	2	1325.661975	1325.660333	K	F	60	71
PSM	LQIWDTAGQER	1797	sp|P61026|RAB10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	11-UNIMOD:267	ms_run[1]:scan=7332	46.28049166666667	2	1325.659973	1325.660333	K	F	60	71
PSM	QNGDDPLLTYRFPPK	1798	sp|P02545|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:28,11-UNIMOD:267,15-UNIMOD:188	ms_run[1]:scan=9777	60.89242166666667	2	1758.8896	1758.8907	R	F	472	487
PSM	QNGDDPLLTYRFPPK	1799	sp|P02545|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:28,11-UNIMOD:267,15-UNIMOD:188	ms_run[1]:scan=9596	59.79108333333334	2	1758.8896	1758.8907	R	F	472	487
PSM	QLSGNNIRPVVK	1800	sp|Q9NZM1|MYOF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:28	ms_run[1]:scan=5474	35.72703666666666	2	1306.7360	1306.7352	R	V	210	222
PSM	QRYEILTPNAIPK	1801	sp|Q7Z406|MYH14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:28,2-UNIMOD:267,13-UNIMOD:188	ms_run[1]:scan=8600	53.784468333333336	2	1540.8622	1540.8579	R	G	743	756
PSM	APGEQTVPALNLQNAFR	1802	sp|Q9Y5B9|SP16H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=10216	63.58755166666667	3	1825.949456	1824.948246	K	I	607	624
PSM	FLITGADQNR	1803	sp|Q6P2E9|EDC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=4864	31.916576666666668	2	1134.584843	1133.582922	R	E	369	379
PSM	NDEELNKLLGR	1804	sp|P04908|H2A1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0		ms_run[1]:scan=8677	54.24491166666667	2	1300.6672	1299.6782	R	V	90	101
PSM	YPEAPPSVR	1805	sp|Q15819|UB2V2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	9-UNIMOD:267	ms_run[1]:scan=3148	22.434541666666664	2	1024.522082	1024.521714	K	F	73	82
PSM	FGEVVDCTIK	1806	sp|O14979|HNRDL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	7-UNIMOD:4,10-UNIMOD:188	ms_run[1]:scan=5684	36.90609833333333	2	1172.584393	1172.584290	R	T	171	181
PSM	CDPVFDFGTGPR	1807	sp|Q9BY44|EIF2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:385,1-UNIMOD:4,12-UNIMOD:267	ms_run[1]:scan=11067	68.83290500000001	2	1359.5790	1359.5788	K	N	306	318
PSM	QRLQEDEMR	1808	sp|Q04323|UBXN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:28,2-UNIMOD:267,9-UNIMOD:267	ms_run[1]:scan=2953	21.37277166666667	2	1206.5575	1206.5561	R	R	136	145
PSM	GSLPANVPTPR	1809	sp|P33240|CSTF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	11-UNIMOD:267	ms_run[1]:scan=4388	29.317359999999997	2	1117.612571	1117.611926	R	G	309	320
PSM	FVNLGIEPPK	1810	sp|P35998|PRS7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	10-UNIMOD:188	ms_run[1]:scan=7865	49.337655	2	1118.641327	1118.643125	R	G	201	211
PSM	LQLPVWEYK	1811	sp|O43143|DHX15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=9988	62.18937333333333	2	1174.635014	1174.638646	R	D	135	144
PSM	QHLSSVVFIK	1812	sp|O43324|MCA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:28	ms_run[1]:scan=8459	52.913765000000005	2	1139.6357	1139.6334	R	N	157	167
PSM	QHLSSVVFIK	1813	sp|O43324|MCA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:28	ms_run[1]:scan=8477	53.02128666666667	2	1139.6357	1139.6334	R	N	157	167
PSM	MIDLSGNPVLR	1814	sp|O14735|CDIPT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	11-UNIMOD:267	ms_run[1]:scan=8339	52.15181166666667	2	1223.657734	1223.657162	K	I	122	133
PSM	IFGGVLESDAR	1815	sp|O00165|HAX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=7184	45.42127833333333	2	1162.600279	1162.598238	R	S	140	151
PSM	GVLLYGPPGTGK	1816	sp|Q8NB90|AFG2H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	12-UNIMOD:188	ms_run[1]:scan=6539	41.77379333333334	2	1163.665554	1163.664588	R	T	389	401
PSM	GLFIIDPNGVIK	1817	sp|P30048|PRDX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	12-UNIMOD:188	ms_run[1]:scan=11780	73.40839	2	1291.750706	1290.764303	R	H	185	197
PSM	LGGPEAGLGEYLFER	1818	sp|P02792|FRIL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=11121	69.15682333333332	2	1607.813245	1606.799122	R	L	155	170
PSM	CRFPVVENGK	1819	sp|P15529|MCP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=5900	38.115986666666664	2	1187.5770	1187.5752	K	Q	228	238
PSM	AGVSFSGHR	1820	sp|Q16643|DREB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1,9-UNIMOD:267	ms_run[1]:scan=3221	22.838655	2	968.4702	968.4698	M	L	2	11
PSM	AGVSFSGHR	1821	sp|Q16643|DREB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1	ms_run[1]:scan=3223	22.84768	2	958.4620	958.4616	M	L	2	11
PSM	QLTQPETHFGR	1822	sp|Q9UJU6|DBNL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:28,11-UNIMOD:267	ms_run[1]:scan=5631	36.60341	2	1305.6308	1305.6336	K	E	289	300
PSM	VLALSFDAPGR	1823	sp|Q9H1Z4|WDR13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0		ms_run[1]:scan=8464	52.94157333333333	2	1145.6512	1144.6232	R	L	307	318
PSM	QGGDLGWMTR	1824	sp|Q9Y237|PIN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:28	ms_run[1]:scan=9052	56.503776666666674	2	1102.4843	1102.4861	R	G	78	88
PSM	ITVPFLEQCPIR	1825	sp|P48147|PPCE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	9-UNIMOD:4,12-UNIMOD:267	ms_run[1]:scan=10930	68.00019	2	1481.794723	1481.793990	K	G	49	61
PSM	AAAGGAEGRR	1826	sp|Q86UK7|ZN598_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1	ms_run[1]:scan=637	7.320771666666666	2	956.4747	956.4783	M	A	2	12
PSM	MEGAGAGSGFRK	1827	sp|A8MT69|CENPX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:1	ms_run[1]:scan=3552	24.70825333333333	2	1208.555940	1208.560807	-	E	1	13
PSM	QSTVLAPVIDLKR	1828	sp|Q96I25|SPF45_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:28,12-UNIMOD:188,13-UNIMOD:267	ms_run[1]:scan=9644	60.088635	2	1437.8510	1437.8521	K	G	47	60
PSM	QLPCNCHGSMPGK	1829	sp|Q7Z2T5|TRM1L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:28,4-UNIMOD:4,6-UNIMOD:4,13-UNIMOD:188	ms_run[1]:scan=3847	26.31255	2	1473.6241	1473.6253	R	T	510	523
PSM	IIQFNPGPEK	1830	sp|P46926|GNPI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=5157	33.670955	2	1142.628524	1141.613159	R	Y	24	34
PSM	IGSTIFGER	1831	sp|O94903|PLPHP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	9-UNIMOD:267	ms_run[1]:scan=5782	37.47835166666667	2	988.522086	988.521714	R	D	242	251
PSM	QVTKEEGLALAR	1832	sp|Q92963|RIT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:28,12-UNIMOD:267	ms_run[1]:scan=9487	59.130790000000005	2	1306.6992	1306.7112	R	E	143	155
PSM	LMAFQPAPK	1833	sp|Q96C36|P5CR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=4932	32.253285	2	1002.550045	1001.536823	K	V	108	117
PSM	GLAGLGDVAEVR	1834	sp|P11216|PYGB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	12-UNIMOD:267	ms_run[1]:scan=7362	46.44308	2	1166.639632	1165.633056	R	K	18	30
PSM	LNFDDKVMLK	1835	sp|Q03188|CENPC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=10077	62.732325	2	1221.638870	1221.642745	R	K	207	217
PSM	NATLLFPESIR	1836	sp|Q66K14|TBC9B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	11-UNIMOD:267	ms_run[1]:scan=9547	59.499091666666665	2	1269.700897	1269.695656	K	V	208	219
PSM	ILQDDVACDIIK	1837	sp|Q13601|KRR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:4	ms_run[1]:scan=7996	50.0961	2	1402.743578	1401.717367	R	I	135	147
PSM	LSESVLSPPCFVR	1838	sp|Q93009|UBP7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	10-UNIMOD:4	ms_run[1]:scan=9392	58.56324166666666	2	1489.752813	1489.759900	R	N	81	94
PSM	QDRGAPPMDSSYAK	1839	sp|Q969V6|MRTFA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=10993	68.38682166666666	2	1523.706049	1521.688192	K	I	248	262
PSM	QVQAEVPGSPIFVMR	1840	sp|Q13085|ACACA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	15-UNIMOD:267	ms_run[1]:scan=9623	59.95746333333333	2	1666.869115	1666.874031	R	L	336	351