MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000208 -- new
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220618\20220618002634800212^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\111222_HL06.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220618\20220618002634800212^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\111222_HL06.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Acetyl (Protein N-term),Label:13C(6) (K),Label:13C(6)15N(4) (R),Oxidation (M)
MTD	software[1]-setting	maxMissedCleavages=1
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=40
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Label:13C(6) (K),Label:13C(6)15N(4) (R),Acetyl (Protein N-term)
MTD	software[2]-setting	TOL(-)=20
MTD	software[2]-setting	TOL(+)=20
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=1000
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=1
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Acetyl (Protein N-term),Label:13C(6) (K),Label:13C(6)15N(4) (R),Oxidation (M)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=1
MTD	software[3]-setting	peptide_mass_tolerance=20
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:1, Acetyl,]
MTD	variable_mod[1]-site	N-term
MTD	variable_mod[1]-position	Protein N-term
MTD	variable_mod[2]	[UNIMOD, UNIMOD:188, Label:13C(6),]
MTD	variable_mod[2]-site	K
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:267, Label:13C(6)15N(4),]
MTD	variable_mod[3]-site	R
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[4]-site	M
MTD	variable_mod[4]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q9UBE0-2|SAE1_HUMAN	Isoform 2 of SUMO-activating enzyme subunit 1 OS=Homo sapiens OX=9606 GN=SAE1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	null	4-UNIMOD:188,21-UNIMOD:267,228-UNIMOD:188,230-UNIMOD:188	0.13	51.0	4	2	1
PRT	sp|Q3LXA3-2|TKFC_HUMAN	Isoform 2 of Triokinase/FMN cyclase OS=Homo sapiens OX=9606 GN=TKFC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null		0.04	48.0	1	1	1
PRT	sp|P18754|RCC1_HUMAN	Regulator of chromosome condensation OS=Homo sapiens OX=9606 GN=RCC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	139-UNIMOD:267	0.05	48.0	4	1	0
PRT	sp|Q9HCC0|MCCB_HUMAN	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Homo sapiens OX=9606 GN=MCCC2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	46.0	null	267-UNIMOD:4,248-UNIMOD:188	0.09	46.0	6	3	1
PRT	sp|Q13813-2|SPTN1_HUMAN	Isoform 2 of Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	73-UNIMOD:188,81-UNIMOD:188,1786-UNIMOD:188,1788-UNIMOD:188,439-UNIMOD:267	0.03	46.0	11	5	1
PRT	sp|Q9Y277|VDAC3_HUMAN	Voltage-dependent anion-selective channel protein 3 OS=Homo sapiens OX=9606 GN=VDAC3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	36-UNIMOD:4,53-UNIMOD:188	0.07	46.0	2	1	0
PRT	sp|P09972|ALDOC_HUMAN	Fructose-bisphosphate aldolase C OS=Homo sapiens OX=9606 GN=ALDOC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.07	46.0	2	1	0
PRT	sp|Q96T23-3|RSF1_HUMAN	Isoform 3 of Remodeling and spacing factor 1 OS=Homo sapiens OX=9606 GN=RSF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	398-UNIMOD:4,274-UNIMOD:188	0.04	45.0	5	3	1
PRT	sp|P53384-2|NUBP1_HUMAN	Isoform 2 of Cytosolic Fe-S cluster assembly factor NUBP1 OS=Homo sapiens OX=9606 GN=NUBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	31-UNIMOD:4,47-UNIMOD:188,49-UNIMOD:188	0.07	45.0	4	1	0
PRT	sp|Q9UGP4|LIMD1_HUMAN	LIM domain-containing protein 1 OS=Homo sapiens OX=9606 GN=LIMD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	293-UNIMOD:267	0.04	45.0	2	1	0
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	44.0	null	2449-UNIMOD:188,2468-UNIMOD:4,2471-UNIMOD:188,298-UNIMOD:188,634-UNIMOD:385,634-UNIMOD:4,642-UNIMOD:4,646-UNIMOD:188	0.03	44.0	10	3	0
PRT	sp|Q15233-2|NONO_HUMAN	Isoform 2 of Non-POU domain-containing octamer-binding protein OS=Homo sapiens OX=9606 GN=NONO	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	352-UNIMOD:35,367-UNIMOD:267	0.06	44.0	4	1	0
PRT	sp|Q15554|TERF2_HUMAN	Telomeric repeat-binding factor 2 OS=Homo sapiens OX=9606 GN=TERF2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	375-UNIMOD:188,395-UNIMOD:188	0.04	44.0	3	1	0
PRT	sp|P20810-3|ICAL_HUMAN	Isoform 3 of Calpastatin OS=Homo sapiens OX=9606 GN=CAST	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	525-UNIMOD:188,543-UNIMOD:4,555-UNIMOD:188,325-UNIMOD:188,326-UNIMOD:188,135-UNIMOD:188,143-UNIMOD:188	0.11	44.0	7	3	0
PRT	sp|Q02952-3|AKA12_HUMAN	Isoform 3 of A-kinase anchor protein 12 OS=Homo sapiens OX=9606 GN=AKAP12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	365-UNIMOD:4,362-UNIMOD:188,382-UNIMOD:188	0.01	44.0	3	1	0
PRT	sp|Q99460-2|PSMD1_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PSMD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	543-UNIMOD:188,532-UNIMOD:35,903-UNIMOD:188	0.04	44.0	6	2	0
PRT	sp|P27816-2|MAP4_HUMAN	Isoform 2 of Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	346-UNIMOD:188,352-UNIMOD:188,254-UNIMOD:188,262-UNIMOD:188,312-UNIMOD:188,318-UNIMOD:188	0.05	44.0	7	3	0
PRT	sp|Q8N5P1|ZC3H8_HUMAN	Zinc finger CCCH domain-containing protein 8 OS=Homo sapiens OX=9606 GN=ZC3H8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	82-UNIMOD:4	0.08	44.0	1	1	1
PRT	sp|O00499-9|BIN1_HUMAN	Isoform BIN1-10-13 of Myc box-dependent-interacting protein 1 OS=Homo sapiens OX=9606 GN=BIN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	47-UNIMOD:4	0.09	44.0	4	2	0
PRT	sp|P63027|VAMP2_HUMAN	Vesicle-associated membrane protein 2 OS=Homo sapiens OX=9606 GN=VAMP2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	null		0.22	44.0	2	2	1
PRT	sp|Q15149-7|PLEC_HUMAN	Isoform 7 of Plectin OS=Homo sapiens OX=9606 GN=PLEC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	2592-UNIMOD:188,1032-UNIMOD:267,3812-UNIMOD:267	0.01	43.0	7	3	0
PRT	sp|Q06830|PRDX1_HUMAN	Peroxiredoxin-1 OS=Homo sapiens OX=9606 GN=PRDX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	43.0	null	27-UNIMOD:188,35-UNIMOD:188,21-UNIMOD:35,94-UNIMOD:28,109-UNIMOD:188,110-UNIMOD:267,100-UNIMOD:35	0.19	43.0	5	2	0
PRT	sp|Q8WTV0-3|SCRB1_HUMAN	Isoform 2 of Scavenger receptor class B member 1 OS=Homo sapiens OX=9606 GN=SCARB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	384-UNIMOD:188,400-UNIMOD:188	0.05	43.0	4	1	0
PRT	sp|Q01082|SPTB2_HUMAN	Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	784-UNIMOD:188,2262-UNIMOD:4,2269-UNIMOD:188,2270-UNIMOD:188	0.01	43.0	4	2	1
PRT	sp|Q9Y490|TLN1_HUMAN	Talin-1 OS=Homo sapiens OX=9606 GN=TLN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	43.0	null	943-UNIMOD:188,923-UNIMOD:28	0.01	43.0	5	1	0
PRT	sp|P13646-2|K1C13_HUMAN	Isoform 2 of Keratin, type I cytoskeletal 13 OS=Homo sapiens OX=9606 GN=KRT13	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	293-UNIMOD:188,306-UNIMOD:188	0.06	43.0	2	1	0
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	43.0	null	481-UNIMOD:4,474-UNIMOD:35,314-UNIMOD:188,400-UNIMOD:267,69-UNIMOD:188,74-UNIMOD:188,558-UNIMOD:188,559-UNIMOD:188,631-UNIMOD:188,632-UNIMOD:188	0.14	43.0	10	7	4
PRT	sp|P52888|THOP1_HUMAN	Thimet oligopeptidase OS=Homo sapiens OX=9606 GN=THOP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	578-UNIMOD:267	0.03	43.0	3	1	0
PRT	sp|Q9BYT8|NEUL_HUMAN	Neurolysin, mitochondrial OS=Homo sapiens OX=9606 GN=NLN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	43.0	null	602-UNIMOD:188	0.03	43.0	4	1	0
PRT	sp|P61163|ACTZ_HUMAN	Alpha-centractin OS=Homo sapiens OX=9606 GN=ACTR1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	222-UNIMOD:4,230-UNIMOD:188,238-UNIMOD:188	0.05	42.0	4	1	0
PRT	sp|P17980|PRS6A_HUMAN	26S proteasome regulatory subunit 6A OS=Homo sapiens OX=9606 GN=PSMC3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	180-UNIMOD:267,193-UNIMOD:188	0.05	42.0	3	1	0
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	42.0	null	1033-UNIMOD:188,1049-UNIMOD:188,5740-UNIMOD:188,5744-UNIMOD:188,4489-UNIMOD:188,4501-UNIMOD:188	0.01	42.0	5	3	2
PRT	sp|Q14195|DPYL3_HUMAN	Dihydropyrimidinase-related protein 3 OS=Homo sapiens OX=9606 GN=DPYSL3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.04	42.0	1	1	1
PRT	sp|O60701-3|UGDH_HUMAN	Isoform 3 of UDP-glucose 6-dehydrogenase OS=Homo sapiens OX=9606 GN=UGDH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.05	42.0	1	1	1
PRT	sp|P30419|NMT1_HUMAN	Glycylpeptide N-tetradecanoyltransferase 1 OS=Homo sapiens OX=9606 GN=NMT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	80-UNIMOD:188,88-UNIMOD:267	0.04	42.0	3	1	0
PRT	sp|Q06210-2|GFPT1_HUMAN	Isoform 2 of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Homo sapiens OX=9606 GN=GFPT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	55-UNIMOD:4,48-UNIMOD:188,56-UNIMOD:188	0.04	42.0	4	1	0
PRT	sp|O75150-3|BRE1B_HUMAN	Isoform 3 of E3 ubiquitin-protein ligase BRE1B OS=Homo sapiens OX=9606 GN=RNF40	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	264-UNIMOD:188,271-UNIMOD:188	0.04	42.0	4	2	1
PRT	sp|Q9Y383-3|LC7L2_HUMAN	Isoform 3 of Putative RNA-binding protein Luc7-like 2 OS=Homo sapiens OX=9606 GN=LUC7L2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.05	42.0	2	1	0
PRT	sp|Q16527|CSRP2_HUMAN	Cysteine and glycine-rich protein 2 OS=Homo sapiens OX=9606 GN=CSRP2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	58-UNIMOD:4,59-UNIMOD:188	0.09	42.0	2	1	0
PRT	sp|P54136-2|SYRC_HUMAN	Isoform Monomeric of Arginine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=RARS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	321-UNIMOD:188,323-UNIMOD:267	0.03	42.0	3	1	0
PRT	sp|P23588-2|IF4B_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 4B OS=Homo sapiens OX=9606 GN=EIF4B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.03	42.0	1	1	1
PRT	sp|Q15181|IPYR_HUMAN	Inorganic pyrophosphatase OS=Homo sapiens OX=9606 GN=PPA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.08	42.0	2	1	0
PRT	sp|Q96A49|SYAP1_HUMAN	Synapse-associated protein 1 OS=Homo sapiens OX=9606 GN=SYAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	42.0	null	211-UNIMOD:28,227-UNIMOD:188,230-UNIMOD:188,84-UNIMOD:188,85-UNIMOD:188	0.10	42.0	6	2	0
PRT	sp|P39748|FEN1_HUMAN	Flap endonuclease 1 OS=Homo sapiens OX=9606 GN=FEN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	null	110-UNIMOD:28,125-UNIMOD:188,128-UNIMOD:188	0.05	42.0	2	1	0
PRT	sp|P13861-2|KAP2_HUMAN	Isoform 2 of cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	181-UNIMOD:267	0.05	41.0	4	1	0
PRT	sp|Q96PZ0|PUS7_HUMAN	Pseudouridylate synthase 7 homolog OS=Homo sapiens OX=9606 GN=PUS7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	31-UNIMOD:188,32-UNIMOD:188,469-UNIMOD:267	0.05	41.0	5	2	0
PRT	sp|Q15003|CND2_HUMAN	Condensin complex subunit 2 OS=Homo sapiens OX=9606 GN=NCAPH PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	20-UNIMOD:267	0.03	41.0	2	1	0
PRT	sp|Q14247-3|SRC8_HUMAN	Isoform 3 of Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	280-UNIMOD:35,144-UNIMOD:188,147-UNIMOD:188	0.07	41.0	3	2	1
PRT	sp|P21291|CSRP1_HUMAN	Cysteine and glycine-rich protein 1 OS=Homo sapiens OX=9606 GN=CSRP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	41.0	null	58-UNIMOD:4,59-UNIMOD:188,161-UNIMOD:188,167-UNIMOD:4,168-UNIMOD:188	0.19	41.0	8	2	0
PRT	sp|P09622-2|DLDH_HUMAN	Isoform 2 of Dihydrolipoyl dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=DLD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	67-UNIMOD:188,78-UNIMOD:188,311-UNIMOD:188,318-UNIMOD:188	0.08	41.0	7	2	0
PRT	sp|Q9Y5M8|SRPRB_HUMAN	Signal recognition particle receptor subunit beta OS=Homo sapiens OX=9606 GN=SRPRB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	227-UNIMOD:188,228-UNIMOD:188	0.08	41.0	2	1	0
PRT	sp|P50897-2|PPT1_HUMAN	Isoform 2 of Palmitoyl-protein thioesterase 1 OS=Homo sapiens OX=9606 GN=PPT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	150-UNIMOD:188,165-UNIMOD:267	0.10	41.0	2	1	0
PRT	sp|P52594-2|AGFG1_HUMAN	Isoform 2 of Arf-GAP domain and FG repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=AGFG1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	273-UNIMOD:188	0.05	41.0	3	1	0
PRT	sp|Q96PK6|RBM14_HUMAN	RNA-binding protein 14 OS=Homo sapiens OX=9606 GN=RBM14 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	541-UNIMOD:267	0.04	41.0	3	1	0
PRT	sp|Q09161|NCBP1_HUMAN	Nuclear cap-binding protein subunit 1 OS=Homo sapiens OX=9606 GN=NCBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	36-UNIMOD:4,37-UNIMOD:188	0.02	41.0	2	1	0
PRT	sp|P08670|VIME_HUMAN	Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null	322-UNIMOD:28,328-UNIMOD:4,334-UNIMOD:188,342-UNIMOD:267	0.08	41.0	7	2	0
PRT	sp|P21796|VDAC1_HUMAN	Voltage-dependent anion-selective channel protein 1 OS=Homo sapiens OX=9606 GN=VDAC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	34-UNIMOD:188,53-UNIMOD:188	0.08	41.0	3	1	0
PRT	sp|Q9P265|DIP2B_HUMAN	Disco-interacting protein 2 homolog B OS=Homo sapiens OX=9606 GN=DIP2B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	198-UNIMOD:188	0.01	41.0	2	1	0
PRT	sp|P46013|KI67_HUMAN	Proliferation marker protein Ki-67 OS=Homo sapiens OX=9606 GN=MKI67 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	1915-UNIMOD:188,1927-UNIMOD:188,1248-UNIMOD:188,1251-UNIMOD:4,1266-UNIMOD:188,1508-UNIMOD:188,1512-UNIMOD:188,1752-UNIMOD:188,1756-UNIMOD:188	0.02	40.0	6	4	2
PRT	sp|O60832|DKC1_HUMAN	H/ACA ribonucleoprotein complex subunit DKC1 OS=Homo sapiens OX=9606 GN=DKC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	433-UNIMOD:188,443-UNIMOD:188,498-UNIMOD:188,499-UNIMOD:188	0.08	40.0	5	2	0
PRT	sp|O75369-6|FLNB_HUMAN	Isoform 6 of Filamin-B OS=Homo sapiens OX=9606 GN=FLNB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	1562-UNIMOD:188,1564-UNIMOD:188,909-UNIMOD:188,1436-UNIMOD:267,836-UNIMOD:267	0.03	40.0	8	5	1
PRT	sp|Q9UNZ2-4|NSF1C_HUMAN	Isoform 2 of NSFL1 cofactor p47 OS=Homo sapiens OX=9606 GN=NSFL1C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.05	40.0	2	1	0
PRT	sp|P13010|XRCC5_HUMAN	X-ray repair cross-complementing protein 5 OS=Homo sapiens OX=9606 GN=XRCC5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	565-UNIMOD:188,469-UNIMOD:188,481-UNIMOD:188	0.05	40.0	6	2	0
PRT	sp|P23229-7|ITA6_HUMAN	Isoform 7 of Integrin alpha-6 OS=Homo sapiens OX=9606 GN=ITGA6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	507-UNIMOD:4,513-UNIMOD:4	0.02	40.0	1	1	1
PRT	sp|P21281|VATB2_HUMAN	V-type proton ATPase subunit B, brain isoform OS=Homo sapiens OX=9606 GN=ATP6V1B2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	29-UNIMOD:267	0.05	40.0	6	1	0
PRT	sp|P35579|MYH9_HUMAN	Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	1373-UNIMOD:35,1379-UNIMOD:4,1014-UNIMOD:188,1016-UNIMOD:188,1513-UNIMOD:188,1518-UNIMOD:188,850-UNIMOD:188,856-UNIMOD:188,1506-UNIMOD:35	0.03	40.0	15	4	0
PRT	sp|P52272-2|HNRPM_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein M OS=Homo sapiens OX=9606 GN=HNRNPM	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	568-UNIMOD:35,582-UNIMOD:267,553-UNIMOD:35,567-UNIMOD:267,572-UNIMOD:35,557-UNIMOD:35	0.04	40.0	11	2	0
PRT	sp|Q13435|SF3B2_HUMAN	Splicing factor 3B subunit 2 OS=Homo sapiens OX=9606 GN=SF3B2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.02	40.0	2	1	0
PRT	sp|Q9UKV3-5|ACINU_HUMAN	Isoform 4 of Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	516-UNIMOD:188,524-UNIMOD:267	0.01	40.0	2	1	0
PRT	sp|P49790-2|NU153_HUMAN	Isoform 2 of Nuclear pore complex protein Nup153 OS=Homo sapiens OX=9606 GN=NUP153	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	1064-UNIMOD:188,1078-UNIMOD:188	0.01	40.0	3	1	0
PRT	sp|P46821|MAP1B_HUMAN	Microtubule-associated protein 1B OS=Homo sapiens OX=9606 GN=MAP1B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	1914-UNIMOD:188,1928-UNIMOD:188	0.01	40.0	4	2	1
PRT	sp|Q9Y5P6|GMPPB_HUMAN	Mannose-1-phosphate guanyltransferase beta OS=Homo sapiens OX=9606 GN=GMPPB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	149-UNIMOD:4	0.05	40.0	2	1	0
PRT	sp|Q8N4X5-2|AF1L2_HUMAN	Isoform 2 of Actin filament-associated protein 1-like 2 OS=Homo sapiens OX=9606 GN=AFAP1L2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	321-UNIMOD:188	0.03	40.0	2	1	0
PRT	sp|P50990|TCPQ_HUMAN	T-complex protein 1 subunit theta OS=Homo sapiens OX=9606 GN=CCT8 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	40.0	null	422-UNIMOD:28,430-UNIMOD:4,439-UNIMOD:188,440-UNIMOD:188,459-UNIMOD:188,466-UNIMOD:188	0.07	40.0	4	2	0
PRT	sp|O43707|ACTN4_HUMAN	Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	217-UNIMOD:188,233-UNIMOD:188	0.02	40.0	2	1	0
PRT	sp|Q99543-2|DNJC2_HUMAN	Isoform 2 of DnaJ homolog subfamily C member 2 OS=Homo sapiens OX=9606 GN=DNAJC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	131-UNIMOD:188,140-UNIMOD:4,143-UNIMOD:188,235-UNIMOD:188,237-UNIMOD:188	0.06	39.0	2	2	1
PRT	sp|O95202|LETM1_HUMAN	Mitochondrial proton/calcium exchanger protein OS=Homo sapiens OX=9606 GN=LETM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	360-UNIMOD:188,373-UNIMOD:188,597-UNIMOD:188,603-UNIMOD:188	0.06	39.0	7	3	1
PRT	sp|Q9UJZ1-2|STML2_HUMAN	Isoform 2 of Stomatin-like protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=STOML2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.07	39.0	2	1	0
PRT	sp|Q9UPN3-4|MACF1_HUMAN	Isoform 5 of Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	3221-UNIMOD:4,3236-UNIMOD:267,1041-UNIMOD:188,1047-UNIMOD:188	0.01	39.0	3	2	1
PRT	sp|Q9Y295|DRG1_HUMAN	Developmentally-regulated GTP-binding protein 1 OS=Homo sapiens OX=9606 GN=DRG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null	195-UNIMOD:4,366-UNIMOD:188,186-UNIMOD:188,206-UNIMOD:188,77-UNIMOD:188	0.14	39.0	7	3	1
PRT	sp|Q9H3K6-2|BOLA2_HUMAN	Isoform 2 of BolA-like protein 2 OS=Homo sapiens OX=9606 GN=BOLA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	30-UNIMOD:267	0.29	39.0	4	1	0
PRT	sp|P11717|MPRI_HUMAN	Cation-independent mannose-6-phosphate receptor OS=Homo sapiens OX=9606 GN=IGF2R PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	531-UNIMOD:4,538-UNIMOD:4,542-UNIMOD:188,546-UNIMOD:188,1726-UNIMOD:267	0.01	39.0	4	2	0
PRT	sp|P19338|NUCL_HUMAN	Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	624-UNIMOD:188,444-UNIMOD:188,449-UNIMOD:188	0.07	39.0	6	3	0
PRT	sp|Q9NYB0|TE2IP_HUMAN	Telomeric repeat-binding factor 2-interacting protein 1 OS=Homo sapiens OX=9606 GN=TERF2IP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.05	39.0	1	1	1
PRT	sp|Q9BSJ2|GCP2_HUMAN	Gamma-tubulin complex component 2 OS=Homo sapiens OX=9606 GN=TUBGCP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	92-UNIMOD:188,103-UNIMOD:188	0.02	39.0	2	1	0
PRT	sp|Q15075|EEA1_HUMAN	Early endosome antigen 1 OS=Homo sapiens OX=9606 GN=EEA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	202-UNIMOD:188,211-UNIMOD:188	0.05	39.0	7	4	3
PRT	sp|Q9UKX7-2|NUP50_HUMAN	Isoform 2 of Nuclear pore complex protein Nup50 OS=Homo sapiens OX=9606 GN=NUP50	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	186-UNIMOD:188,201-UNIMOD:188	0.05	39.0	3	1	0
PRT	sp|P54709|AT1B3_HUMAN	Sodium/potassium-transporting ATPase subunit beta-3 OS=Homo sapiens OX=9606 GN=ATP1B3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	111-UNIMOD:188,112-UNIMOD:188,31-UNIMOD:267	0.11	39.0	4	2	0
PRT	sp|Q13217|DNJC3_HUMAN	DnaJ homolog subfamily C member 3 OS=Homo sapiens OX=9606 GN=DNAJC3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	142-UNIMOD:188,150-UNIMOD:188	0.06	39.0	5	2	1
PRT	sp|Q8ND82|Z280C_HUMAN	Zinc finger protein 280C OS=Homo sapiens OX=9606 GN=ZNF280C PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	126-UNIMOD:188,131-UNIMOD:188	0.03	39.0	1	1	1
PRT	sp|Q05209-2|PTN12_HUMAN	Isoform 2 of Tyrosine-protein phosphatase non-receptor type 12 OS=Homo sapiens OX=9606 GN=PTPN12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	288-UNIMOD:188,298-UNIMOD:188	0.03	39.0	2	1	0
PRT	sp|O75116|ROCK2_HUMAN	Rho-associated protein kinase 2 OS=Homo sapiens OX=9606 GN=ROCK2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	989-UNIMOD:188,995-UNIMOD:188,941-UNIMOD:188,943-UNIMOD:188,709-UNIMOD:188	0.04	39.0	7	3	0
PRT	sp|O43776-2|SYNC_HUMAN	Isoform 2 of Asparagine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=NARS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.13	39.0	1	1	1
PRT	sp|A5YM69|ARG35_HUMAN	Rho guanine nucleotide exchange factor 35 OS=Homo sapiens OX=9606 GN=ARHGEF35 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	186-UNIMOD:4	0.05	39.0	1	1	1
PRT	sp|P18858-2|DNLI1_HUMAN	Isoform 2 of DNA ligase 1 OS=Homo sapiens OX=9606 GN=LIG1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	376-UNIMOD:188,387-UNIMOD:267	0.02	38.0	2	1	0
PRT	sp|P07355|ANXA2_HUMAN	Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	196-UNIMOD:267	0.05	38.0	1	1	1
PRT	sp|P11387|TOP1_HUMAN	DNA topoisomerase 1 OS=Homo sapiens OX=9606 GN=TOP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	504-UNIMOD:4,505-UNIMOD:4,493-UNIMOD:188,508-UNIMOD:267	0.03	38.0	3	1	0
PRT	sp|Q16543|CDC37_HUMAN	Hsp90 co-chaperone Cdc37 OS=Homo sapiens OX=9606 GN=CDC37 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	352-UNIMOD:188,369-UNIMOD:188	0.06	38.0	5	1	0
PRT	sp|O00487|PSDE_HUMAN	26S proteasome non-ATPase regulatory subunit 14 OS=Homo sapiens OX=9606 GN=PSMD14 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	264-UNIMOD:188,273-UNIMOD:188,265-UNIMOD:35	0.05	38.0	4	1	0
PRT	sp|O95376|ARI2_HUMAN	E3 ubiquitin-protein ligase ARIH2 OS=Homo sapiens OX=9606 GN=ARIH2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	280-UNIMOD:4,295-UNIMOD:188	0.03	38.0	3	1	0
PRT	sp|P78371-2|TCPB_HUMAN	Isoform 2 of T-complex protein 1 subunit beta OS=Homo sapiens OX=9606 GN=CCT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.03	38.0	1	1	1
PRT	sp|P32322-2|P5CR1_HUMAN	Isoform 2 of Pyrroline-5-carboxylate reductase 1, mitochondrial OS=Homo sapiens OX=9606 GN=PYCR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	147-UNIMOD:267	0.06	38.0	3	1	0
PRT	sp|Q8WWI1-3|LMO7_HUMAN	Isoform 3 of LIM domain only protein 7 OS=Homo sapiens OX=9606 GN=LMO7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.01	38.0	1	1	1
PRT	sp|P35606-2|COPB2_HUMAN	Isoform 2 of Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	161-UNIMOD:4	0.03	38.0	2	1	0
PRT	sp|Q16181-2|SEPT7_HUMAN	Isoform 2 of Septin-7 OS=Homo sapiens OX=9606 GN=SEPTIN7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	234-UNIMOD:188,237-UNIMOD:188,203-UNIMOD:4,207-UNIMOD:188,208-UNIMOD:188	0.08	38.0	3	2	0
PRT	sp|P26641|EF1G_HUMAN	Elongation factor 1-gamma OS=Homo sapiens OX=9606 GN=EEF1G PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null	253-UNIMOD:188,263-UNIMOD:35,266-UNIMOD:4,275-UNIMOD:188	0.05	38.0	12	1	0
PRT	sp|P78362|SRPK2_HUMAN	SRSF protein kinase 2 OS=Homo sapiens OX=9606 GN=SRPK2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	300-UNIMOD:188,320-UNIMOD:4,324-UNIMOD:188	0.04	38.0	2	1	0
PRT	sp|P50991|TCPD_HUMAN	T-complex protein 1 subunit delta OS=Homo sapiens OX=9606 GN=CCT4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	60-UNIMOD:35,65-UNIMOD:188,79-UNIMOD:188	0.04	38.0	3	1	0
PRT	sp|O60488-2|ACSL4_HUMAN	Isoform Short of Long-chain-fatty-acid--CoA ligase 4 OS=Homo sapiens OX=9606 GN=ACSL4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	495-UNIMOD:188,508-UNIMOD:267	0.03	38.0	3	1	0
PRT	sp|O43670-3|ZN207_HUMAN	Isoform 3 of BUB3-interacting and GLEBS motif-containing protein ZNF207 OS=Homo sapiens OX=9606 GN=ZNF207	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	267-UNIMOD:188,279-UNIMOD:188	0.05	38.0	2	1	0
PRT	sp|Q9NYV4-3|CDK12_HUMAN	Isoform 3 of Cyclin-dependent kinase 12 OS=Homo sapiens OX=9606 GN=CDK12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	472-UNIMOD:188	0.01	38.0	2	1	0
PRT	sp|Q9Y266|NUDC_HUMAN	Nuclear migration protein nudC OS=Homo sapiens OX=9606 GN=NUDC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.06	38.0	1	1	1
PRT	sp|P62424|RL7A_HUMAN	60S ribosomal protein L7a OS=Homo sapiens OX=9606 GN=RPL7A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	199-UNIMOD:4	0.08	38.0	2	1	0
PRT	sp|O60506-4|HNRPQ_HUMAN	Isoform 4 of Heterogeneous nuclear ribonucleoprotein Q OS=Homo sapiens OX=9606 GN=SYNCRIP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	282-UNIMOD:188,117-UNIMOD:188,123-UNIMOD:188,91-UNIMOD:188	0.08	38.0	4	3	2
PRT	sp|Q9Y6W5-2|WASF2_HUMAN	Isoform 2 of Wiskott-Aldrich syndrome protein family member 2 OS=Homo sapiens OX=9606 GN=WASF2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	85-UNIMOD:188,97-UNIMOD:267	0.07	38.0	3	1	0
PRT	sp|Q9UIG0-2|BAZ1B_HUMAN	Isoform 2 of Tyrosine-protein kinase BAZ1B OS=Homo sapiens OX=9606 GN=BAZ1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	120-UNIMOD:4,126-UNIMOD:188,128-UNIMOD:188,981-UNIMOD:188	0.03	38.0	5	2	0
PRT	sp|P16435|NCPR_HUMAN	NADPH--cytochrome P450 reductase OS=Homo sapiens OX=9606 GN=POR PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	336-UNIMOD:188	0.05	38.0	5	2	1
PRT	sp|P78527|PRKDC_HUMAN	DNA-dependent protein kinase catalytic subunit OS=Homo sapiens OX=9606 GN=PRKDC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	810-UNIMOD:188,820-UNIMOD:267	0.00	38.0	2	1	0
PRT	sp|Q9UNF0|PACN2_HUMAN	Protein kinase C and casein kinase substrate in neurons protein 2 OS=Homo sapiens OX=9606 GN=PACSIN2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null		0.03	38.0	1	1	0
PRT	sp|P50990-3|TCPQ_HUMAN	Isoform 3 of T-complex protein 1 subunit theta OS=Homo sapiens OX=9606 GN=CCT8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	386-UNIMOD:188,393-UNIMOD:188,203-UNIMOD:35,193-UNIMOD:35,197-UNIMOD:188,208-UNIMOD:188,357-UNIMOD:4,366-UNIMOD:188,367-UNIMOD:188	0.12	37.0	15	3	0
PRT	sp|Q9Y5J6|T10B_HUMAN	Mitochondrial import inner membrane translocase subunit Tim10 B OS=Homo sapiens OX=9606 GN=TIMM10B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	48-UNIMOD:4,52-UNIMOD:4,55-UNIMOD:188	0.17	37.0	2	1	0
PRT	sp|O43765|SGTA_HUMAN	Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Homo sapiens OX=9606 GN=SGTA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	196-UNIMOD:188,200-UNIMOD:188	0.05	37.0	2	1	0
PRT	sp|Q9NRL3-2|STRN4_HUMAN	Isoform 2 of Striatin-4 OS=Homo sapiens OX=9606 GN=STRN4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	119-UNIMOD:188	0.07	37.0	2	1	0
PRT	sp|Q96PK6-5|RBM14_HUMAN	Isoform 5 of RNA-binding protein 14 OS=Homo sapiens OX=9606 GN=RBM14	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	316-UNIMOD:267	0.09	37.0	2	1	0
PRT	sp|Q9C0C2|TB182_HUMAN	182 kDa tankyrase-1-binding protein OS=Homo sapiens OX=9606 GN=TNKS1BP1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.01	37.0	1	1	1
PRT	sp|P05787-2|K2C8_HUMAN	Isoform 2 of Keratin, type II cytoskeletal 8 OS=Homo sapiens OX=9606 GN=KRT8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	309-UNIMOD:35,313-UNIMOD:188,323-UNIMOD:188,233-UNIMOD:35,500-UNIMOD:188,511-UNIMOD:188,292-UNIMOD:188,235-UNIMOD:188,241-UNIMOD:267,253-UNIMOD:267	0.15	37.0	24	5	0
PRT	sp|O60566-2|BUB1B_HUMAN	Isoform 2 of Mitotic checkpoint serine/threonine-protein kinase BUB1 beta OS=Homo sapiens OX=9606 GN=BUB1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	582-UNIMOD:188	0.02	37.0	1	1	1
PRT	sp|P24752|THIL_HUMAN	Acetyl-CoA acetyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=ACAT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	91-UNIMOD:35,251-UNIMOD:188,257-UNIMOD:188	0.09	37.0	4	2	0
PRT	sp|Q15459-2|SF3A1_HUMAN	Isoform 2 of Splicing factor 3A subunit 1 OS=Homo sapiens OX=9606 GN=SF3A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	430-UNIMOD:188,434-UNIMOD:188	0.05	37.0	3	2	0
PRT	sp|P14618|KPYM_HUMAN	Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	49-UNIMOD:4,56-UNIMOD:267	0.06	37.0	2	2	2
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	157-UNIMOD:188,158-UNIMOD:188,68-UNIMOD:188,74-UNIMOD:188	0.14	37.0	4	2	0
PRT	sp|Q7Z739|YTHD3_HUMAN	YTH domain-containing family protein 3 OS=Homo sapiens OX=9606 GN=YTHDF3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	271-UNIMOD:188	0.03	37.0	1	1	1
PRT	sp|O00763-3|ACACB_HUMAN	Isoform 3 of Acetyl-CoA carboxylase 2 OS=Homo sapiens OX=9606 GN=ACACB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.01	37.0	2	1	0
PRT	sp|Q99816-2|TS101_HUMAN	Isoform 2 of Tumor susceptibility gene 101 protein OS=Homo sapiens OX=9606 GN=TSG101	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	181-UNIMOD:188,187-UNIMOD:188	0.06	37.0	3	1	0
PRT	sp|B7ZAP0|RBG10_HUMAN	Rab GTPase-activating protein 1-like, isoform 10 OS=Homo sapiens OX=9606 GN=RABGAP1L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	41-UNIMOD:188	0.07	37.0	3	1	0
PRT	sp|Q9NTJ3-2|SMC4_HUMAN	Isoform 2 of Structural maintenance of chromosomes protein 4 OS=Homo sapiens OX=9606 GN=SMC4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.02	37.0	2	1	0
PRT	sp|Q9BVL4|SELO_HUMAN	Protein adenylyltransferase SelO, mitochondrial OS=Homo sapiens OX=9606 GN=SELENOO PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	629-UNIMOD:4,648-UNIMOD:267	0.04	37.0	2	1	0
PRT	sp|O15027-2|SC16A_HUMAN	Isoform 2 of Protein transport protein Sec16A OS=Homo sapiens OX=9606 GN=SEC16A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	1967-UNIMOD:267	0.01	37.0	2	1	0
PRT	sp|Q01105-3|SET_HUMAN	Isoform 3 of Protein SET OS=Homo sapiens OX=9606 GN=SET	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	43-UNIMOD:188,47-UNIMOD:188	0.06	37.0	4	1	0
PRT	sp|P31939-2|PUR9_HUMAN	Isoform 2 of Bifunctional purine biosynthesis protein PURH OS=Homo sapiens OX=9606 GN=ATIC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	362-UNIMOD:4	0.04	37.0	1	1	1
PRT	sp|Q12906|ILF3_HUMAN	Interleukin enhancer-binding factor 3 OS=Homo sapiens OX=9606 GN=ILF3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.04	37.0	1	1	1
PRT	sp|P06744|G6PI_HUMAN	Glucose-6-phosphate isomerase OS=Homo sapiens OX=9606 GN=GPI PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	119-UNIMOD:35,116-UNIMOD:188,124-UNIMOD:188	0.03	37.0	6	1	0
PRT	sp|Q14789-4|GOGB1_HUMAN	Isoform 4 of Golgin subfamily B member 1 OS=Homo sapiens OX=9606 GN=GOLGB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	320-UNIMOD:4,324-UNIMOD:188,329-UNIMOD:188	0.01	37.0	1	1	1
PRT	sp|O15446|RPA34_HUMAN	DNA-directed RNA polymerase I subunit RPA34 OS=Homo sapiens OX=9606 GN=CD3EAP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	270-UNIMOD:188,288-UNIMOD:188	0.04	37.0	4	1	0
PRT	sp|P50395-2|GDIB_HUMAN	Isoform 2 of Rab GDP dissociation inhibitor beta OS=Homo sapiens OX=9606 GN=GDI2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	369-UNIMOD:4,373-UNIMOD:188	0.04	37.0	3	1	0
PRT	sp|Q00839|HNRPU_HUMAN	Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	53-UNIMOD:35	0.04	37.0	4	1	0
PRT	sp|P27348|1433T_HUMAN	14-3-3 protein theta OS=Homo sapiens OX=9606 GN=YWHAQ PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	37.0	null	140-UNIMOD:28,157-UNIMOD:188,158-UNIMOD:188,68-UNIMOD:188,74-UNIMOD:188	0.14	37.0	8	2	0
PRT	sp|Q8TAQ2|SMRC2_HUMAN	SWI/SNF complex subunit SMARCC2 OS=Homo sapiens OX=9606 GN=SMARCC2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	836-UNIMOD:188,845-UNIMOD:267	0.01	37.0	2	1	0
PRT	sp|Q9BY42|RTF2_HUMAN	Replication termination factor 2 OS=Homo sapiens OX=9606 GN=RTF2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	210-UNIMOD:188,222-UNIMOD:188	0.07	36.0	4	1	0
PRT	sp|P36776-3|LONM_HUMAN	Isoform 3 of Lon protease homolog, mitochondrial OS=Homo sapiens OX=9606 GN=LONP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	302-UNIMOD:188,324-UNIMOD:4,333-UNIMOD:188	0.04	36.0	4	2	0
PRT	sp|Q12824-2|SNF5_HUMAN	Isoform B of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 OS=Homo sapiens OX=9606 GN=SMARCB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	97-UNIMOD:188,99-UNIMOD:188	0.05	36.0	2	1	0
PRT	sp|P30043|BLVRB_HUMAN	Flavin reductase (NADPH) OS=Homo sapiens OX=9606 GN=BLVRB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	36.0	null	188-UNIMOD:4,188-UNIMOD:385	0.10	36.0	2	1	0
PRT	sp|P21333-2|FLNA_HUMAN	Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	33-UNIMOD:188,42-UNIMOD:188,1087-UNIMOD:267,1590-UNIMOD:188,1592-UNIMOD:188	0.03	36.0	5	4	2
PRT	sp|Q9Y5P4-2|CERT_HUMAN	Isoform 2 of Ceramide transfer protein OS=Homo sapiens OX=9606 GN=CERT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	198-UNIMOD:188,211-UNIMOD:267	0.03	36.0	2	1	0
PRT	sp|Q9UJS0|CMC2_HUMAN	Calcium-binding mitochondrial carrier protein Aralar2 OS=Homo sapiens OX=9606 GN=SLC25A13 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	251-UNIMOD:188,260-UNIMOD:188	0.04	36.0	4	2	1
PRT	sp|Q99497|PARK7_HUMAN	Protein/nucleic acid deglycase DJ-1 OS=Homo sapiens OX=9606 GN=PARK7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	53-UNIMOD:4,62-UNIMOD:188,63-UNIMOD:188	0.08	36.0	2	1	0
PRT	sp|Q86V48-2|LUZP1_HUMAN	Isoform 2 of Leucine zipper protein 1 OS=Homo sapiens OX=9606 GN=LUZP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	656-UNIMOD:188,672-UNIMOD:188	0.02	36.0	1	1	1
PRT	sp|Q8NFW8|NEUA_HUMAN	N-acylneuraminate cytidylyltransferase OS=Homo sapiens OX=9606 GN=CMAS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	380-UNIMOD:4	0.04	36.0	1	1	1
PRT	sp|O43395|PRPF3_HUMAN	U4/U6 small nuclear ribonucleoprotein Prp3 OS=Homo sapiens OX=9606 GN=PRPF3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.05	36.0	2	2	2
PRT	sp|O00159-2|MYO1C_HUMAN	Isoform 2 of Unconventional myosin-Ic OS=Homo sapiens OX=9606 GN=MYO1C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	970-UNIMOD:188	0.02	36.0	3	1	0
PRT	sp|P50579-3|MAP2_HUMAN	Isoform 3 of Methionine aminopeptidase 2 OS=Homo sapiens OX=9606 GN=METAP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.05	36.0	2	1	0
PRT	sp|Q8N684-2|CPSF7_HUMAN	Isoform 2 of Cleavage and polyadenylation specificity factor subunit 7 OS=Homo sapiens OX=9606 GN=CPSF7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	140-UNIMOD:188	0.08	36.0	3	2	1
PRT	sp|Q13185|CBX3_HUMAN	Chromobox protein homolog 3 OS=Homo sapiens OX=9606 GN=CBX3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	21-UNIMOD:188,34-UNIMOD:188,103-UNIMOD:188,105-UNIMOD:188	0.16	36.0	7	2	0
PRT	sp|Q86YP4-2|P66A_HUMAN	Isoform 2 of Transcriptional repressor p66-alpha OS=Homo sapiens OX=9606 GN=GATAD2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	249-UNIMOD:267	0.03	36.0	2	1	0
PRT	sp|Q86UP2-2|KTN1_HUMAN	Isoform 2 of Kinectin OS=Homo sapiens OX=9606 GN=KTN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	727-UNIMOD:188,735-UNIMOD:188	0.02	36.0	3	1	0
PRT	sp|P05023-2|AT1A1_HUMAN	Isoform 2 of Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	374-UNIMOD:4,91-UNIMOD:188	0.07	36.0	3	2	0
PRT	sp|P40818-2|UBP8_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 8 OS=Homo sapiens OX=9606 GN=USP8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	674-UNIMOD:267,524-UNIMOD:188	0.04	36.0	3	2	1
PRT	sp|P39748-2|FEN1_HUMAN	Isoform FENMIT of Flap endonuclease 1 OS=Homo sapiens OX=9606 GN=FEN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	61-UNIMOD:188,64-UNIMOD:188	0.06	36.0	3	1	0
PRT	sp|Q7Z417|NUFP2_HUMAN	Nuclear fragile X mental retardation-interacting protein 2 OS=Homo sapiens OX=9606 GN=NUFIP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	603-UNIMOD:188	0.03	36.0	2	1	0
PRT	sp|P29218-2|IMPA1_HUMAN	Isoform 2 of Inositol monophosphatase 1 OS=Homo sapiens OX=9606 GN=IMPA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	49-UNIMOD:188,52-UNIMOD:188	0.09	36.0	3	1	0
PRT	sp|Q99447-2|PCY2_HUMAN	Isoform 2 of Ethanolamine-phosphate cytidylyltransferase OS=Homo sapiens OX=9606 GN=PCYT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.06	36.0	1	1	1
PRT	sp|P04844-2|RPN2_HUMAN	Isoform 2 of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Homo sapiens OX=9606 GN=RPN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	424-UNIMOD:188,428-UNIMOD:188	0.03	36.0	2	1	0
PRT	sp|P62987|RL40_HUMAN	Ubiquitin-60S ribosomal protein L40 OS=Homo sapiens OX=9606 GN=UBA52 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	27-UNIMOD:188,29-UNIMOD:188	0.15	36.0	2	1	0
PRT	sp|Q9Y605|MOFA1_HUMAN	MORF4 family-associated protein 1 OS=Homo sapiens OX=9606 GN=MRFAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	92-UNIMOD:267	0.20	36.0	3	1	0
PRT	sp|P62191-2|PRS4_HUMAN	Isoform 2 of 26S proteasome regulatory subunit 4 OS=Homo sapiens OX=9606 GN=PSMC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	105-UNIMOD:188,125-UNIMOD:188	0.07	36.0	2	1	0
PRT	sp|P49189|AL9A1_HUMAN	4-trimethylaminobutyraldehyde dehydrogenase OS=Homo sapiens OX=9606 GN=ALDH9A1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.04	36.0	1	1	1
PRT	sp|O75569-3|PRKRA_HUMAN	Isoform 3 of Interferon-inducible double-stranded RNA-dependent protein kinase activator A OS=Homo sapiens OX=9606 GN=PRKRA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	52-UNIMOD:4,59-UNIMOD:188,60-UNIMOD:188	0.06	36.0	2	1	0
PRT	sp|Q99543|DNJC2_HUMAN	DnaJ homolog subfamily C member 2 OS=Homo sapiens OX=9606 GN=DNAJC2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	140-UNIMOD:4,131-UNIMOD:188,143-UNIMOD:188	0.03	36.0	3	1	0
PRT	sp|Q2TAA2|IAH1_HUMAN	Isoamyl acetate-hydrolyzing esterase 1 homolog OS=Homo sapiens OX=9606 GN=IAH1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	237-UNIMOD:188	0.07	36.0	3	1	0
PRT	sp|Q562E7|WDR81_HUMAN	WD repeat-containing protein 81 OS=Homo sapiens OX=9606 GN=WDR81 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	null	44-UNIMOD:28	0.01	36.0	1	1	1
PRT	sp|P05204|HMGN2_HUMAN	Non-histone chromosomal protein HMG-17 OS=Homo sapiens OX=9606 GN=HMGN2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	64-UNIMOD:188,76-UNIMOD:188,82-UNIMOD:188,90-UNIMOD:188	0.36	35.0	5	2	0
PRT	sp|Q8IWT6|LRC8A_HUMAN	Volume-regulated anion channel subunit LRRC8A OS=Homo sapiens OX=9606 GN=LRRC8A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	2	1	0
PRT	sp|O95182|NDUA7_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 OS=Homo sapiens OX=9606 GN=NDUFA7 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.17	35.0	2	1	0
PRT	sp|Q9P2E9|RRBP1_HUMAN	Ribosome-binding protein 1 OS=Homo sapiens OX=9606 GN=RRBP1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	1038-UNIMOD:4,1039-UNIMOD:188,1041-UNIMOD:188	0.03	35.0	3	2	1
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	79-UNIMOD:188,80-UNIMOD:188	0.05	35.0	2	1	0
PRT	sp|Q96HE7|ERO1A_HUMAN	ERO1-like protein alpha OS=Homo sapiens OX=9606 GN=ERO1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	99-UNIMOD:4,104-UNIMOD:4,102-UNIMOD:188,114-UNIMOD:188	0.04	35.0	4	1	0
PRT	sp|Q6ZNB6-2|NFXL1_HUMAN	Isoform 2 of NF-X1-type zinc finger protein NFXL1 OS=Homo sapiens OX=9606 GN=NFXL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|P13647|K2C5_HUMAN	Keratin, type II cytoskeletal 5 OS=Homo sapiens OX=9606 GN=KRT5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	286-UNIMOD:188,292-UNIMOD:188,48-UNIMOD:267,284-UNIMOD:35	0.05	35.0	4	2	1
PRT	sp|O75746-2|CMC1_HUMAN	Isoform 2 of Calcium-binding mitochondrial carrier protein Aralar1 OS=Homo sapiens OX=9606 GN=SLC25A12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.03	35.0	1	1	1
PRT	sp|Q6L8Q7-2|PDE12_HUMAN	Isoform 2 of 2',5'-phosphodiesterase 12 OS=Homo sapiens OX=9606 GN=PDE12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	171-UNIMOD:267	0.09	35.0	2	2	2
PRT	sp|O75937|DNJC8_HUMAN	DnaJ homolog subfamily C member 8 OS=Homo sapiens OX=9606 GN=DNAJC8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	146-UNIMOD:188,159-UNIMOD:188	0.07	35.0	4	1	0
PRT	sp|O75643|U520_HUMAN	U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens OX=9606 GN=SNRNP200 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	769-UNIMOD:4,770-UNIMOD:188,775-UNIMOD:188,1367-UNIMOD:35	0.02	35.0	3	3	3
PRT	sp|O75534-2|CSDE1_HUMAN	Isoform 2 of Cold shock domain-containing protein E1 OS=Homo sapiens OX=9606 GN=CSDE1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	421-UNIMOD:188,433-UNIMOD:4,436-UNIMOD:188	0.02	35.0	1	1	1
PRT	sp|Q96G46-2|DUS3L_HUMAN	Isoform 2 of tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Homo sapiens OX=9606 GN=DUS3L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.04	35.0	1	1	1
PRT	sp|Q32MZ4-3|LRRF1_HUMAN	Isoform 3 of Leucine-rich repeat flightless-interacting protein 1 OS=Homo sapiens OX=9606 GN=LRRFIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	588-UNIMOD:4,575-UNIMOD:188,577-UNIMOD:188,646-UNIMOD:188,650-UNIMOD:188	0.07	35.0	5	3	1
PRT	sp|Q9Y2X3|NOP58_HUMAN	Nucleolar protein 58 OS=Homo sapiens OX=9606 GN=NOP58 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	450-UNIMOD:188,457-UNIMOD:188,439-UNIMOD:4,441-UNIMOD:188,442-UNIMOD:188	0.06	35.0	5	2	1
PRT	sp|Q9BXP5-5|SRRT_HUMAN	Isoform 5 of Serrate RNA effector molecule homolog OS=Homo sapiens OX=9606 GN=SRRT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	2	1	0
PRT	sp|Q96C19|EFHD2_HUMAN	EF-hand domain-containing protein D2 OS=Homo sapiens OX=9606 GN=EFHD2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	188-UNIMOD:188,191-UNIMOD:188	0.07	35.0	1	1	1
PRT	sp|Q13011|ECH1_HUMAN	Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial OS=Homo sapiens OX=9606 GN=ECH1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	59-UNIMOD:267,318-UNIMOD:188,321-UNIMOD:188	0.13	35.0	4	2	0
PRT	sp|Q9HD26-2|GOPC_HUMAN	Isoform 2 of Golgi-associated PDZ and coiled-coil motif-containing protein OS=Homo sapiens OX=9606 GN=GOPC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	400-UNIMOD:4,401-UNIMOD:188,408-UNIMOD:188	0.06	35.0	2	1	0
PRT	sp|O60437|PEPL_HUMAN	Periplakin OS=Homo sapiens OX=9606 GN=PPL PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	43-UNIMOD:188,51-UNIMOD:188	0.01	35.0	1	1	1
PRT	sp|Q14571|ITPR2_HUMAN	Inositol 1,4,5-trisphosphate receptor type 2 OS=Homo sapiens OX=9606 GN=ITPR2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	2087-UNIMOD:4	0.02	35.0	2	2	2
PRT	sp|Q9NR30|DDX21_HUMAN	Nucleolar RNA helicase 2 OS=Homo sapiens OX=9606 GN=DDX21 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	129-UNIMOD:188,131-UNIMOD:188	0.04	35.0	3	2	1
PRT	sp|Q5T6F2|UBAP2_HUMAN	Ubiquitin-associated protein 2 OS=Homo sapiens OX=9606 GN=UBAP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	71-UNIMOD:4,78-UNIMOD:4,84-UNIMOD:188	0.02	35.0	3	1	0
PRT	sp|Q8IY22|CMIP_HUMAN	C-Maf-inducing protein OS=Homo sapiens OX=9606 GN=CMIP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	35.0	null	15-UNIMOD:28	0.03	35.0	2	1	0
PRT	sp|Q8N488|RYBP_HUMAN	RING1 and YY1-binding protein OS=Homo sapiens OX=9606 GN=RYBP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.10	35.0	2	1	0
PRT	sp|P26196|DDX6_HUMAN	Probable ATP-dependent RNA helicase DDX6 OS=Homo sapiens OX=9606 GN=DDX6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	482-UNIMOD:188	0.04	35.0	3	1	0
PRT	sp|Q14676-3|MDC1_HUMAN	Isoform 3 of Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|P02545-3|LMNA_HUMAN	Isoform ADelta10 of Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	540-UNIMOD:4,552-UNIMOD:267	0.04	35.0	1	1	1
PRT	sp|Q9BQ61|TRIR_HUMAN	Telomerase RNA component interacting RNase OS=Homo sapiens OX=9606 GN=TRIR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	146-UNIMOD:188,152-UNIMOD:188	0.09	35.0	3	1	0
PRT	sp|P07814|SYEP_HUMAN	Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	800-UNIMOD:188,824-UNIMOD:188	0.02	35.0	4	1	0
PRT	sp|P68363-2|TBA1B_HUMAN	Isoform 2 of Tubulin alpha-1B chain OS=Homo sapiens OX=9606 GN=TUBA1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	60-UNIMOD:188,231-UNIMOD:4,236-UNIMOD:188,254-UNIMOD:188	0.21	35.0	7	4	1
PRT	sp|Q9H0A0-2|NAT10_HUMAN	Isoform 2 of RNA cytidine acetyltransferase OS=Homo sapiens OX=9606 GN=NAT10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	870-UNIMOD:188,875-UNIMOD:188	0.02	35.0	2	1	0
PRT	sp|P41567|EIF1_HUMAN	Eukaryotic translation initiation factor 1 OS=Homo sapiens OX=9606 GN=EIF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	56-UNIMOD:188,57-UNIMOD:188	0.14	35.0	2	1	0
PRT	sp|Q9BWU0|NADAP_HUMAN	Kanadaptin OS=Homo sapiens OX=9606 GN=SLC4A1AP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	730-UNIMOD:4,737-UNIMOD:188,742-UNIMOD:188	0.02	35.0	2	1	0
PRT	sp|Q9Y2R5|RT17_HUMAN	28S ribosomal protein S17, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS17 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	100-UNIMOD:4	0.23	35.0	1	1	1
PRT	sp|Q9BRP8-2|PYM1_HUMAN	Isoform 2 of Partner of Y14 and mago OS=Homo sapiens OX=9606 GN=PYM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	180-UNIMOD:188,185-UNIMOD:188,32-UNIMOD:188,47-UNIMOD:188	0.17	35.0	5	2	0
PRT	sp|P61604|CH10_HUMAN	10 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPE1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	54-UNIMOD:188	0.15	35.0	2	1	0
PRT	sp|Q9Y6Y8|S23IP_HUMAN	SEC23-interacting protein OS=Homo sapiens OX=9606 GN=SEC23IP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|P18669|PGAM1_HUMAN	Phosphoglycerate mutase 1 OS=Homo sapiens OX=9606 GN=PGAM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	153-UNIMOD:4,157-UNIMOD:188,162-UNIMOD:267	0.09	35.0	3	1	0
PRT	sp|P68104-2|EF1A1_HUMAN	Isoform 2 of Elongation factor 1-alpha 1 OS=Homo sapiens OX=9606 GN=EEF1A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	151-UNIMOD:188,158-UNIMOD:188,245-UNIMOD:267	0.06	35.0	5	2	0
PRT	sp|Q12774|ARHG5_HUMAN	Rho guanine nucleotide exchange factor 5 OS=Homo sapiens OX=9606 GN=ARHGEF5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	186-UNIMOD:4,205-UNIMOD:267	0.02	35.0	2	1	0
PRT	sp|O75369|FLNB_HUMAN	Filamin-B OS=Homo sapiens OX=9606 GN=FLNB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	35.0	null		0.01	35.0	2	2	0
PRT	sp|P05783|K1C18_HUMAN	Keratin, type I cytoskeletal 18 OS=Homo sapiens OX=9606 GN=KRT18 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	35.0	null	417-UNIMOD:188,426-UNIMOD:188,370-UNIMOD:188,158-UNIMOD:267,313-UNIMOD:35,314-UNIMOD:267	0.12	35.0	9	4	0
PRT	sp|O75367|H2AY_HUMAN	Core histone macro-H2A.1 OS=Homo sapiens OX=9606 GN=MACROH2A1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	271-UNIMOD:188	0.06	35.0	2	1	0
PRT	sp|P08727|K1C19_HUMAN	Keratin, type I cytoskeletal 19 OS=Homo sapiens OX=9606 GN=KRT19 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	398-UNIMOD:188	0.05	35.0	2	1	0
PRT	sp|Q5T8P6|RBM26_HUMAN	RNA-binding protein 26 OS=Homo sapiens OX=9606 GN=RBM26 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	725-UNIMOD:188,726-UNIMOD:188	0.02	35.0	1	1	0
PRT	sp|Q14C86|GAPD1_HUMAN	GTPase-activating protein and VPS9 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=GAPVD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|P50570-3|DYN2_HUMAN	Isoform 3 of Dynamin-2 OS=Homo sapiens OX=9606 GN=DNM2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	641-UNIMOD:35	0.05	34.0	2	2	2
PRT	sp|P78347-2|GTF2I_HUMAN	Isoform 2 of General transcription factor II-I OS=Homo sapiens OX=9606 GN=GTF2I	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	205-UNIMOD:188,217-UNIMOD:35,218-UNIMOD:188,417-UNIMOD:188,418-UNIMOD:188	0.05	34.0	5	2	0
PRT	sp|Q99459|CDC5L_HUMAN	Cell division cycle 5-like protein OS=Homo sapiens OX=9606 GN=CDC5L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	2	1	0
PRT	sp|Q13409-6|DC1I2_HUMAN	Isoform 2F of Cytoplasmic dynein 1 intermediate chain 2 OS=Homo sapiens OX=9606 GN=DYNC1I2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	229-UNIMOD:188,238-UNIMOD:188	0.02	34.0	2	1	0
PRT	sp|P40939|ECHA_HUMAN	Trifunctional enzyme subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=HADHA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	531-UNIMOD:188,534-UNIMOD:188	0.02	34.0	2	1	0
PRT	sp|P53618|COPB_HUMAN	Coatomer subunit beta OS=Homo sapiens OX=9606 GN=COPB1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	501-UNIMOD:188,513-UNIMOD:188	0.02	34.0	2	1	0
PRT	sp|P53675-2|CLH2_HUMAN	Isoform 2 of Clathrin heavy chain 2 OS=Homo sapiens OX=9606 GN=CLTCL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	459-UNIMOD:4,456-UNIMOD:188,468-UNIMOD:188	0.01	34.0	2	1	0
PRT	sp|P31153|METK2_HUMAN	S-adenosylmethionine synthase isoform type-2 OS=Homo sapiens OX=9606 GN=MAT2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	34-UNIMOD:4	0.10	34.0	2	2	2
PRT	sp|P25445-6|TNR6_HUMAN	Isoform 6 of Tumor necrosis factor receptor superfamily member 6 OS=Homo sapiens OX=9606 GN=FAS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	242-UNIMOD:188,253-UNIMOD:188	0.05	34.0	1	1	1
PRT	sp|O75683|SURF6_HUMAN	Surfeit locus protein 6 OS=Homo sapiens OX=9606 GN=SURF6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	189-UNIMOD:4,170-UNIMOD:188,193-UNIMOD:267	0.07	34.0	2	1	0
PRT	sp|P40763-3|STAT3_HUMAN	Isoform 3 of Signal transducer and activator of transcription 3 OS=Homo sapiens OX=9606 GN=STAT3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	140-UNIMOD:188	0.04	34.0	2	1	0
PRT	sp|P50552|VASP_HUMAN	Vasodilator-stimulated phosphoprotein OS=Homo sapiens OX=9606 GN=VASP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	320-UNIMOD:35,334-UNIMOD:4	0.07	34.0	1	1	1
PRT	sp|O00625|PIR_HUMAN	Pirin OS=Homo sapiens OX=9606 GN=PIR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	85-UNIMOD:35,97-UNIMOD:267	0.05	34.0	2	1	0
PRT	sp|Q9BUR5-2|MIC26_HUMAN	Isoform 2 of MICOS complex subunit MIC26 OS=Homo sapiens OX=9606 GN=APOO	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.11	34.0	1	1	1
PRT	sp|P12270-2|TPR_HUMAN	Isoform 2 of Nucleoprotein TPR OS=Homo sapiens OX=9606 GN=TPR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.04	34.0	3	2	1
PRT	sp|O43175|SERA_HUMAN	D-3-phosphoglycerate dehydrogenase OS=Homo sapiens OX=9606 GN=PHGDH PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	58-UNIMOD:188,69-UNIMOD:188,384-UNIMOD:188,394-UNIMOD:188	0.06	34.0	4	2	0
PRT	sp|Q9UQ80-2|PA2G4_HUMAN	Isoform 2 of Proliferation-associated protein 2G4 OS=Homo sapiens OX=9606 GN=PA2G4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	47-UNIMOD:188,53-UNIMOD:188	0.04	34.0	5	1	0
PRT	sp|Q96RU2-3|UBP28_HUMAN	Isoform 3 of Ubiquitin carboxyl-terminal hydrolase 28 OS=Homo sapiens OX=9606 GN=USP28	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	1	1	1
PRT	sp|P40222|TXLNA_HUMAN	Alpha-taxilin OS=Homo sapiens OX=9606 GN=TXLNA PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	33-UNIMOD:267,53-UNIMOD:267	0.07	34.0	2	1	0
PRT	sp|Q9H9Q2-2|CSN7B_HUMAN	Isoform 2 of COP9 signalosome complex subunit 7b OS=Homo sapiens OX=9606 GN=COPS7B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	110-UNIMOD:188,111-UNIMOD:188	0.10	34.0	2	1	0
PRT	sp|P29317|EPHA2_HUMAN	Ephrin type-A receptor 2 OS=Homo sapiens OX=9606 GN=EPHA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	603-UNIMOD:188	0.02	34.0	2	1	0
PRT	sp|O43684-2|BUB3_HUMAN	Isoform 2 of Mitotic checkpoint protein BUB3 OS=Homo sapiens OX=9606 GN=BUB3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	216-UNIMOD:188,217-UNIMOD:188,322-UNIMOD:188,324-UNIMOD:188	0.08	34.0	5	2	0
PRT	sp|P33176|KINH_HUMAN	Kinesin-1 heavy chain OS=Homo sapiens OX=9606 GN=KIF5B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	34.0	null	65-UNIMOD:4,67-UNIMOD:188,68-UNIMOD:188,382-UNIMOD:188,384-UNIMOD:188,431-UNIMOD:28,435-UNIMOD:188,448-UNIMOD:188,252-UNIMOD:188,256-UNIMOD:188	0.07	34.0	7	4	2
PRT	sp|Q641Q2-2|WAC2A_HUMAN	Isoform 2 of WASH complex subunit 2A OS=Homo sapiens OX=9606 GN=WASHC2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	2	2	2
PRT	sp|Q8N8A6|DDX51_HUMAN	ATP-dependent RNA helicase DDX51 OS=Homo sapiens OX=9606 GN=DDX51 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	1	1	1
PRT	sp|Q9Y333|LSM2_HUMAN	U6 snRNA-associated Sm-like protein LSm2 OS=Homo sapiens OX=9606 GN=LSM2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.22	34.0	1	1	1
PRT	sp|P05023|AT1A1_HUMAN	Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	211-UNIMOD:4	0.04	34.0	3	2	0
PRT	sp|Q9Y4L1|HYOU1_HUMAN	Hypoxia up-regulated protein 1 OS=Homo sapiens OX=9606 GN=HYOU1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	685-UNIMOD:188,686-UNIMOD:188	0.04	33.0	3	2	1
PRT	sp|Q86XL3-2|ANKL2_HUMAN	Isoform 2 of Ankyrin repeat and LEM domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ANKLE2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	508-UNIMOD:267	0.04	33.0	2	1	0
PRT	sp|Q8WW12-2|PCNP_HUMAN	Isoform 2 of PEST proteolytic signal-containing nuclear protein OS=Homo sapiens OX=9606 GN=PCNP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	29-UNIMOD:188,32-UNIMOD:188,64-UNIMOD:188,67-UNIMOD:188	0.25	33.0	4	2	0
PRT	sp|Q5JVF3-3|PCID2_HUMAN	Isoform 3 of PCI domain-containing protein 2 OS=Homo sapiens OX=9606 GN=PCID2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.05	33.0	2	1	0
PRT	sp|O75190-4|DNJB6_HUMAN	Isoform D of DnaJ homolog subfamily B member 6 OS=Homo sapiens OX=9606 GN=DNAJB6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	253-UNIMOD:188	0.06	33.0	2	1	0
PRT	sp|Q12955-6|ANK3_HUMAN	Isoform 4 of Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|O43493-6|TGON2_HUMAN	Isoform 6 of Trans-Golgi network integral membrane protein 2 OS=Homo sapiens OX=9606 GN=TGOLN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	125-UNIMOD:188,139-UNIMOD:188	0.07	33.0	3	1	0
PRT	sp|P47914|RL29_HUMAN	60S ribosomal protein L29 OS=Homo sapiens OX=9606 GN=RPL29 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	134-UNIMOD:188,149-UNIMOD:188	0.13	33.0	3	1	0
PRT	sp|P23381|SYWC_HUMAN	Tryptophan--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=WARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	431-UNIMOD:188,432-UNIMOD:188	0.03	33.0	2	1	0
PRT	sp|Q14651|PLSI_HUMAN	Plastin-1 OS=Homo sapiens OX=9606 GN=PLS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	580-UNIMOD:188,585-UNIMOD:188	0.02	33.0	2	1	0
PRT	sp|Q9NYU2-2|UGGG1_HUMAN	Isoform 2 of UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	632-UNIMOD:35,634-UNIMOD:188	0.01	33.0	3	1	0
PRT	sp|O43837-2|IDH3B_HUMAN	Isoform A of Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=IDH3B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	180-UNIMOD:267	0.04	33.0	2	1	0
PRT	sp|P51532-5|SMCA4_HUMAN	Isoform 5 of Transcription activator BRG1 OS=Homo sapiens OX=9606 GN=SMARCA4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	991-UNIMOD:188,997-UNIMOD:188	0.01	33.0	2	1	0
PRT	sp|O15118-2|NPC1_HUMAN	Isoform 2 of NPC intracellular cholesterol transporter 1 OS=Homo sapiens OX=9606 GN=NPC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	692-UNIMOD:188	0.01	33.0	2	1	0
PRT	sp|Q13428-2|TCOF_HUMAN	Isoform 2 of Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	1337-UNIMOD:188,1346-UNIMOD:188	0.03	33.0	5	2	1
PRT	sp|Q9Y536|PAL4A_HUMAN	Peptidyl-prolyl cis-trans isomerase A-like 4A OS=Homo sapiens OX=9606 GN=PPIAL4A PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	61-UNIMOD:35,62-UNIMOD:4,69-UNIMOD:267	0.09	33.0	20	1	0
PRT	sp|P07195|LDHB_HUMAN	L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	82-UNIMOD:188,91-UNIMOD:188	0.04	33.0	5	1	0
PRT	sp|Q00839-2|HNRPU_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	33.0	null	53-UNIMOD:35,50-UNIMOD:267,69-UNIMOD:267,205-UNIMOD:28,215-UNIMOD:188,219-UNIMOD:188	0.08	33.0	4	3	2
PRT	sp|P49748-2|ACADV_HUMAN	Isoform 2 of Very long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADVL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	485-UNIMOD:188	0.03	33.0	2	1	0
PRT	sp|Q9BY44-2|EIF2A_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 2A OS=Homo sapiens OX=9606 GN=EIF2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	321-UNIMOD:188,322-UNIMOD:188	0.05	33.0	2	1	0
PRT	sp|O94842-3|TOX4_HUMAN	Isoform 3 of TOX high mobility group box family member 4 OS=Homo sapiens OX=9606 GN=TOX4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	551-UNIMOD:4,559-UNIMOD:188,566-UNIMOD:4,570-UNIMOD:4,573-UNIMOD:188	0.04	33.0	1	1	1
PRT	sp|Q9UJA5-4|TRM6_HUMAN	Isoform 4 of tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6 OS=Homo sapiens OX=9606 GN=TRMT6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	51-UNIMOD:35,68-UNIMOD:267	0.11	33.0	3	2	1
PRT	sp|P46940|IQGA1_HUMAN	Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens OX=9606 GN=IQGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	660-UNIMOD:4	0.02	33.0	1	1	1
PRT	sp|Q14008-2|CKAP5_HUMAN	Isoform 2 of Cytoskeleton-associated protein 5 OS=Homo sapiens OX=9606 GN=CKAP5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	860-UNIMOD:188,868-UNIMOD:188,1113-UNIMOD:4	0.02	33.0	4	2	1
PRT	sp|P13796|PLSL_HUMAN	Plastin-2 OS=Homo sapiens OX=9606 GN=LCP1 PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null		0.04	33.0	3	2	1
PRT	sp|Q13464|ROCK1_HUMAN	Rho-associated protein kinase 1 OS=Homo sapiens OX=9606 GN=ROCK1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.01	33.0	1	1	1
PRT	sp|P12081-3|HARS1_HUMAN	Isoform 3 of Histidine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=HARS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	358-UNIMOD:188,359-UNIMOD:188	0.03	33.0	2	1	0
PRT	sp|Q9NP64-2|NO40_HUMAN	Isoform 2 of Nucleolar protein of 40 kDa OS=Homo sapiens OX=9606 GN=ZCCHC17	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.11	33.0	1	1	1
PRT	sp|P09211|GSTP1_HUMAN	Glutathione S-transferase P OS=Homo sapiens OX=9606 GN=GSTP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	20-UNIMOD:35,30-UNIMOD:188	0.15	33.0	3	2	1
PRT	sp|P61353|RL27_HUMAN	60S ribosomal protein L27 OS=Homo sapiens OX=9606 GN=RPL27 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	93-UNIMOD:188,98-UNIMOD:188	0.11	33.0	2	1	0
PRT	sp|O75534|CSDE1_HUMAN	Cold shock domain-containing protein E1 OS=Homo sapiens OX=9606 GN=CSDE1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	600-UNIMOD:188	0.03	33.0	1	1	1
PRT	sp|Q14157|UBP2L_HUMAN	Ubiquitin-associated protein 2-like OS=Homo sapiens OX=9606 GN=UBAP2L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	68-UNIMOD:4,75-UNIMOD:4,81-UNIMOD:267	0.02	33.0	3	1	0
PRT	sp|Q9Y666|S12A7_HUMAN	Solute carrier family 12 member 7 OS=Homo sapiens OX=9606 GN=SLC12A7 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|Q13148|TADBP_HUMAN	TAR DNA-binding protein 43 OS=Homo sapiens OX=9606 GN=TARDBP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	293-UNIMOD:267	0.05	33.0	2	1	0
PRT	sp|Q13263|TIF1B_HUMAN	Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	319-UNIMOD:188,327-UNIMOD:267	0.02	33.0	3	1	0
PRT	sp|O95292|VAPB_HUMAN	Vesicle-associated membrane protein-associated protein B/C OS=Homo sapiens OX=9606 GN=VAPB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	33.0	null	147-UNIMOD:188,155-UNIMOD:188	0.07	33.0	3	1	0
PRT	sp|O75592|MYCB2_HUMAN	E3 ubiquitin-protein ligase MYCBP2 OS=Homo sapiens OX=9606 GN=MYCBP2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null		0.00	33.0	1	1	1
PRT	sp|Q9UBQ7|GRHPR_HUMAN	Glyoxylate reductase/hydroxypyruvate reductase OS=Homo sapiens OX=9606 GN=GRHPR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	29-UNIMOD:4	0.07	32.0	2	1	0
PRT	sp|Q03135-2|CAV1_HUMAN	Isoform 2 of Caveolin-1 OS=Homo sapiens OX=9606 GN=CAV1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	2-UNIMOD:1	0.11	32.0	2	1	0
PRT	sp|Q9Y265|RUVB1_HUMAN	RuvB-like 1 OS=Homo sapiens OX=9606 GN=RUVBL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	400-UNIMOD:188	0.05	32.0	2	1	0
PRT	sp|Q02878|RL6_HUMAN	60S ribosomal protein L6 OS=Homo sapiens OX=9606 GN=RPL6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	156-UNIMOD:267	0.06	32.0	2	1	0
PRT	sp|Q03154-2|ACY1_HUMAN	Isoform 2 of Aminoacylase-1 OS=Homo sapiens OX=9606 GN=ACY1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	295-UNIMOD:267	0.04	32.0	1	1	1
PRT	sp|Q16512-3|PKN1_HUMAN	Isoform 3 of Serine/threonine-protein kinase N1 OS=Homo sapiens OX=9606 GN=PKN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	256-UNIMOD:188,263-UNIMOD:188	0.03	32.0	2	1	0
PRT	sp|P18583-8|SON_HUMAN	Isoform H of Protein SON OS=Homo sapiens OX=9606 GN=SON	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	92-UNIMOD:4,106-UNIMOD:188,107-UNIMOD:188	0.02	32.0	3	1	0
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.08	32.0	4	3	2
PRT	sp|Q8IZ83-3|A16A1_HUMAN	Isoform 3 of Aldehyde dehydrogenase family 16 member A1 OS=Homo sapiens OX=9606 GN=ALDH16A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	513-UNIMOD:188	0.02	32.0	2	1	0
PRT	sp|Q8IX01-4|SUGP2_HUMAN	Isoform 4 of SURP and G-patch domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SUGP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|P55072|TERA_HUMAN	Transitional endoplasmic reticulum ATPase OS=Homo sapiens OX=9606 GN=VCP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	209-UNIMOD:4,522-UNIMOD:4,524-UNIMOD:188	0.04	32.0	4	2	1
PRT	sp|Q12931-2|TRAP1_HUMAN	Isoform 2 of Heat shock protein 75 kDa, mitochondrial OS=Homo sapiens OX=9606 GN=TRAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|Q969H8|MYDGF_HUMAN	Myeloid-derived growth factor OS=Homo sapiens OX=9606 GN=MYDGF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	137-UNIMOD:188,145-UNIMOD:188	0.09	32.0	2	1	0
PRT	sp|P31948-3|STIP1_HUMAN	Isoform 3 of Stress-induced-phosphoprotein 1 OS=Homo sapiens OX=9606 GN=STIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	186-UNIMOD:188,198-UNIMOD:188	0.03	32.0	2	1	0
PRT	sp|P23246|SFPQ_HUMAN	Splicing factor, proline- and glutamine-rich OS=Homo sapiens OX=9606 GN=SFPQ PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	681-UNIMOD:267,44-UNIMOD:267,200-UNIMOD:28	0.06	32.0	4	3	2
PRT	sp|P27695|APEX1_HUMAN	DNA-(apurinic or apyrimidinic site) lyase OS=Homo sapiens OX=9606 GN=APEX1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.12	32.0	2	2	2
PRT	sp|Q6ZMI0-4|PPR21_HUMAN	Isoform 4 of Protein phosphatase 1 regulatory subunit 21 OS=Homo sapiens OX=9606 GN=PPP1R21	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.05	32.0	1	1	1
PRT	sp|Q9BV57|MTND_HUMAN	1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase OS=Homo sapiens OX=9606 GN=ADI1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	45-UNIMOD:188,54-UNIMOD:188	0.08	32.0	3	1	0
PRT	sp|Q15836|VAMP3_HUMAN	Vesicle-associated membrane protein 3 OS=Homo sapiens OX=9606 GN=VAMP3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.25	32.0	1	1	0
PRT	sp|Q8WYP5|ELYS_HUMAN	Protein ELYS OS=Homo sapiens OX=9606 GN=AHCTF1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	1628-UNIMOD:4,1650-UNIMOD:188	0.02	32.0	3	2	1
PRT	sp|O00232-2|PSD12_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 12 OS=Homo sapiens OX=9606 GN=PSMD12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	16-UNIMOD:35,31-UNIMOD:4	0.04	32.0	1	1	1
PRT	sp|Q9UQE7|SMC3_HUMAN	Structural maintenance of chromosomes protein 3 OS=Homo sapiens OX=9606 GN=SMC3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	579-UNIMOD:35,592-UNIMOD:188	0.01	32.0	2	1	0
PRT	sp|O75844|FACE1_HUMAN	CAAX prenyl protease 1 homolog OS=Homo sapiens OX=9606 GN=ZMPSTE24 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	314-UNIMOD:188,316-UNIMOD:188	0.03	32.0	2	1	0
PRT	sp|O75152|ZC11A_HUMAN	Zinc finger CCCH domain-containing protein 11A OS=Homo sapiens OX=9606 GN=ZC3H11A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.05	32.0	2	2	2
PRT	sp|Q8TBA6-2|GOGA5_HUMAN	Isoform 2 of Golgin subfamily A member 5 OS=Homo sapiens OX=9606 GN=GOLGA5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	59-UNIMOD:188	0.03	32.0	2	1	0
PRT	sp|Q5SW79-2|CE170_HUMAN	Isoform 2 of Centrosomal protein of 170 kDa OS=Homo sapiens OX=9606 GN=CEP170	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	2	2	2
PRT	sp|Q96M27-4|PRRC1_HUMAN	Isoform 4 of Protein PRRC1 OS=Homo sapiens OX=9606 GN=PRRC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	266-UNIMOD:188,269-UNIMOD:188	0.05	32.0	2	1	0
PRT	sp|Q96SK2-3|TM209_HUMAN	Isoform 3 of Transmembrane protein 209 OS=Homo sapiens OX=9606 GN=TMEM209	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	301-UNIMOD:4,304-UNIMOD:188,312-UNIMOD:188	0.03	32.0	2	1	0
PRT	sp|Q9BXY0|MAK16_HUMAN	Protein MAK16 homolog OS=Homo sapiens OX=9606 GN=MAK16 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	44-UNIMOD:4	0.06	32.0	1	1	1
PRT	sp|Q14444-2|CAPR1_HUMAN	Isoform 2 of Caprin-1 OS=Homo sapiens OX=9606 GN=CAPRIN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.06	32.0	1	1	1
PRT	sp|P38117|ETFB_HUMAN	Electron transfer flavoprotein subunit beta OS=Homo sapiens OX=9606 GN=ETFB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	238-UNIMOD:188,248-UNIMOD:188	0.06	32.0	5	1	0
PRT	sp|P50851-2|LRBA_HUMAN	Isoform 2 of Lipopolysaccharide-responsive and beige-like anchor protein OS=Homo sapiens OX=9606 GN=LRBA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	2024-UNIMOD:188	0.01	32.0	3	1	0
PRT	sp|O95347-2|SMC2_HUMAN	Isoform 2 of Structural maintenance of chromosomes protein 2 OS=Homo sapiens OX=9606 GN=SMC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	760-UNIMOD:188,763-UNIMOD:188	0.01	32.0	2	1	0
PRT	sp|P13798|ACPH_HUMAN	Acylamino-acid-releasing enzyme OS=Homo sapiens OX=9606 GN=APEH PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	670-UNIMOD:35,676-UNIMOD:267	0.02	32.0	4	1	0
PRT	sp|Q92878-3|RAD50_HUMAN	Isoform 3 of DNA repair protein RAD50 OS=Homo sapiens OX=9606 GN=RAD50	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	980-UNIMOD:188,987-UNIMOD:188	0.01	32.0	3	1	0
PRT	sp|Q12974-2|TP4A2_HUMAN	Isoform 2 of Protein tyrosine phosphatase type IVA 2 OS=Homo sapiens OX=9606 GN=PTP4A2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	46-UNIMOD:4,52-UNIMOD:188,57-UNIMOD:188	0.17	32.0	3	1	0
PRT	sp|P05114|HMGN1_HUMAN	Non-histone chromosomal protein HMG-14 OS=Homo sapiens OX=9606 GN=HMGN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	14-UNIMOD:188,18-UNIMOD:188	0.14	32.0	2	1	0
PRT	sp|P23528|COF1_HUMAN	Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	92-UNIMOD:188,95-UNIMOD:188	0.09	32.0	3	1	0
PRT	sp|P46777|RL5_HUMAN	60S ribosomal protein L5 OS=Homo sapiens OX=9606 GN=RPL5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	220-UNIMOD:188,221-UNIMOD:188,241-UNIMOD:188,242-UNIMOD:188,212-UNIMOD:35,236-UNIMOD:35,239-UNIMOD:35	0.09	32.0	10	2	0
PRT	sp|P30405|PPIF_HUMAN	Peptidyl-prolyl cis-trans isomerase F, mitochondrial OS=Homo sapiens OX=9606 GN=PPIF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null		0.14	32.0	1	1	1
PRT	sp|Q9Y5J1|UTP18_HUMAN	U3 small nucleolar RNA-associated protein 18 homolog OS=Homo sapiens OX=9606 GN=UTP18 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	302-UNIMOD:4,318-UNIMOD:188	0.03	32.0	2	1	0
PRT	sp|Q9NZU5|LMCD1_HUMAN	LIM and cysteine-rich domains protein 1 OS=Homo sapiens OX=9606 GN=LMCD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	null	52-UNIMOD:385,52-UNIMOD:4,58-UNIMOD:4	0.05	32.0	1	1	1
PRT	sp|Q9NVV0|TM38B_HUMAN	Trimeric intracellular cation channel type B OS=Homo sapiens OX=9606 GN=TMEM38B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	273-UNIMOD:188,283-UNIMOD:188	0.08	32.0	3	1	0
PRT	sp|P09960|LKHA4_HUMAN	Leukotriene A-4 hydrolase OS=Homo sapiens OX=9606 GN=LTA4H PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	64-UNIMOD:188,73-UNIMOD:188	0.03	32.0	2	1	0
PRT	sp|P24928|RPB1_HUMAN	DNA-directed RNA polymerase II subunit RPB1 OS=Homo sapiens OX=9606 GN=POLR2A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null		0.01	32.0	1	1	1
PRT	sp|Q96JP5-2|ZFP91_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase ZFP91 OS=Homo sapiens OX=9606 GN=ZFP91	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.09	31.0	3	2	1
PRT	sp|O75608-2|LYPA1_HUMAN	Isoform 2 of Acyl-protein thioesterase 1 OS=Homo sapiens OX=9606 GN=LYPLA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	146-UNIMOD:267	0.07	31.0	2	1	0
PRT	sp|P14324-2|FPPS_HUMAN	Isoform 2 of Farnesyl pyrophosphate synthase OS=Homo sapiens OX=9606 GN=FDPS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	287-UNIMOD:188,293-UNIMOD:188	0.05	31.0	1	1	0
PRT	sp|P54792-2|DVLP1_HUMAN	Isoform Short of Putative segment polarity protein dishevelled homolog DVL1P1 OS=Homo sapiens OX=9606 GN=DVL1P1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	631-UNIMOD:267	0.02	31.0	1	1	1
PRT	sp|Q9UBR2|CATZ_HUMAN	Cathepsin Z OS=Homo sapiens OX=9606 GN=CTSZ PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	164-UNIMOD:4,166-UNIMOD:188,170-UNIMOD:4,173-UNIMOD:4,177-UNIMOD:188	0.06	31.0	1	1	1
PRT	sp|P02786|TFR1_HUMAN	Transferrin receptor protein 1 OS=Homo sapiens OX=9606 GN=TFRC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|Q8IUI8-2|CRLF3_HUMAN	Isoform 2 of Cytokine receptor-like factor 3 OS=Homo sapiens OX=9606 GN=CRLF3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	332-UNIMOD:4	0.04	31.0	1	1	1
PRT	sp|Q99615|DNJC7_HUMAN	DnaJ homolog subfamily C member 7 OS=Homo sapiens OX=9606 GN=DNAJC7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	32-UNIMOD:188,41-UNIMOD:188	0.03	31.0	2	1	0
PRT	sp|Q13601-2|KRR1_HUMAN	Isoform 2 of KRR1 small subunit processome component homolog OS=Homo sapiens OX=9606 GN=KRR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.05	31.0	1	1	1
PRT	sp|Q8NFH4|NUP37_HUMAN	Nucleoporin Nup37 OS=Homo sapiens OX=9606 GN=NUP37 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	149-UNIMOD:4,150-UNIMOD:267	0.05	31.0	2	1	0
PRT	sp|P27694|RFA1_HUMAN	Replication protein A 70 kDa DNA-binding subunit OS=Homo sapiens OX=9606 GN=RPA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	476-UNIMOD:4,481-UNIMOD:4,486-UNIMOD:4	0.03	31.0	1	1	1
PRT	sp|Q9C040|TRIM2_HUMAN	Tripartite motif-containing protein 2 OS=Homo sapiens OX=9606 GN=TRIM2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	309-UNIMOD:188,310-UNIMOD:188	0.02	31.0	1	1	1
PRT	sp|Q8WUA4-2|TF3C2_HUMAN	Isoform 2 of General transcription factor 3C polypeptide 2 OS=Homo sapiens OX=9606 GN=GTF3C2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	476-UNIMOD:4,488-UNIMOD:267	0.03	31.0	2	1	0
PRT	sp|Q9BQG0|MBB1A_HUMAN	Myb-binding protein 1A OS=Homo sapiens OX=9606 GN=MYBBP1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	942-UNIMOD:4,949-UNIMOD:188	0.03	31.0	4	3	2
PRT	sp|Q9Y4E8-2|UBP15_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 15 OS=Homo sapiens OX=9606 GN=USP15	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	604-UNIMOD:4,605-UNIMOD:4,606-UNIMOD:188	0.02	31.0	2	1	0
PRT	sp|O00567|NOP56_HUMAN	Nucleolar protein 56 OS=Homo sapiens OX=9606 GN=NOP56 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	472-UNIMOD:4,478-UNIMOD:188,480-UNIMOD:188	0.05	31.0	2	1	0
PRT	sp|Q9UKM9-2|RALY_HUMAN	Isoform 1 of RNA-binding protein Raly OS=Homo sapiens OX=9606 GN=RALY	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	200-UNIMOD:188,206-UNIMOD:188	0.06	31.0	2	1	0
PRT	sp|P53367-3|ARFP1_HUMAN	Isoform 3 of Arfaptin-1 OS=Homo sapiens OX=9606 GN=ARFIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	180-UNIMOD:188	0.08	31.0	2	1	0
PRT	sp|Q14254|FLOT2_HUMAN	Flotillin-2 OS=Homo sapiens OX=9606 GN=FLOT2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	357-UNIMOD:35,370-UNIMOD:188	0.07	31.0	3	2	1
PRT	sp|Q99729-3|ROAA_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein A/B OS=Homo sapiens OX=9606 GN=HNRNPAB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	72-UNIMOD:35,83-UNIMOD:188	0.05	31.0	1	1	1
PRT	sp|Q8N1F8|S11IP_HUMAN	Serine/threonine-protein kinase 11-interacting protein OS=Homo sapiens OX=9606 GN=STK11IP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	227-UNIMOD:35,240-UNIMOD:267	0.01	31.0	3	1	0
PRT	sp|Q96H79|ZCCHL_HUMAN	Zinc finger CCCH-type antiviral protein 1-like OS=Homo sapiens OX=9606 GN=ZC3HAV1L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	249-UNIMOD:35,268-UNIMOD:188	0.07	31.0	5	1	0
PRT	sp|Q53GQ0|DHB12_HUMAN	Very-long-chain 3-oxoacyl-CoA reductase OS=Homo sapiens OX=9606 GN=HSD17B12 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	168-UNIMOD:35,179-UNIMOD:267	0.04	31.0	2	1	0
PRT	sp|Q12789-3|TF3C1_HUMAN	Isoform 2 of General transcription factor 3C polypeptide 1 OS=Homo sapiens OX=9606 GN=GTF3C1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	355-UNIMOD:188	0.01	31.0	2	1	0
PRT	sp|P48739|PIPNB_HUMAN	Phosphatidylinositol transfer protein beta isoform OS=Homo sapiens OX=9606 GN=PITPNB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.07	31.0	1	1	1
PRT	sp|Q9UHI6|DDX20_HUMAN	Probable ATP-dependent RNA helicase DDX20 OS=Homo sapiens OX=9606 GN=DDX20 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|P09001|RM03_HUMAN	39S ribosomal protein L3, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	70-UNIMOD:188,76-UNIMOD:188	0.04	31.0	2	1	0
PRT	sp|Q14978|NOLC1_HUMAN	Nucleolar and coiled-body phosphoprotein 1 OS=Homo sapiens OX=9606 GN=NOLC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	593-UNIMOD:188,601-UNIMOD:188	0.02	31.0	2	1	0
PRT	sp|Q9UHB6|LIMA1_HUMAN	LIM domain and actin-binding protein 1 OS=Homo sapiens OX=9606 GN=LIMA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	186-UNIMOD:188,189-UNIMOD:188	0.04	31.0	2	2	2
PRT	sp|Q15424-2|SAFB1_HUMAN	Isoform 2 of Scaffold attachment factor B1 OS=Homo sapiens OX=9606 GN=SAFB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|Q9H7E2|TDRD3_HUMAN	Tudor domain-containing protein 3 OS=Homo sapiens OX=9606 GN=TDRD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	97-UNIMOD:188	0.03	31.0	2	1	0
PRT	sp|Q9NYF8-3|BCLF1_HUMAN	Isoform 3 of Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	330-UNIMOD:188,333-UNIMOD:188	0.02	31.0	2	1	0
PRT	sp|Q92896|GSLG1_HUMAN	Golgi apparatus protein 1 OS=Homo sapiens OX=9606 GN=GLG1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	190-UNIMOD:4,269-UNIMOD:4	0.03	31.0	3	2	1
PRT	sp|Q9H9S4|CB39L_HUMAN	Calcium-binding protein 39-like OS=Homo sapiens OX=9606 GN=CAB39L PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	322-UNIMOD:188,327-UNIMOD:188	0.05	31.0	3	1	0
PRT	sp|Q92900-2|RENT1_HUMAN	Isoform 2 of Regulator of nonsense transcripts 1 OS=Homo sapiens OX=9606 GN=UPF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	775-UNIMOD:188,779-UNIMOD:188	0.01	31.0	2	1	0
PRT	sp|Q15020-4|SART3_HUMAN	Isoform 4 of Squamous cell carcinoma antigen recognized by T-cells 3 OS=Homo sapiens OX=9606 GN=SART3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.04	31.0	3	2	1
PRT	sp|P63313|TYB10_HUMAN	Thymosin beta-10 OS=Homo sapiens OX=9606 GN=TMSB10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	26-UNIMOD:188,32-UNIMOD:188	0.30	31.0	2	1	0
PRT	sp|P61106|RAB14_HUMAN	Ras-related protein Rab-14 OS=Homo sapiens OX=9606 GN=RAB14 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	170-UNIMOD:188,171-UNIMOD:188	0.15	31.0	4	2	1
PRT	sp|P50454|SERPH_HUMAN	Serpin H1 OS=Homo sapiens OX=9606 GN=SERPINH1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	250-UNIMOD:188,252-UNIMOD:188	0.03	31.0	3	1	0
PRT	sp|Q6UN15-4|FIP1_HUMAN	Isoform 4 of Pre-mRNA 3'-end-processing factor FIP1 OS=Homo sapiens OX=9606 GN=FIP1L1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.04	31.0	1	1	1
PRT	sp|Q5T8P6-5|RBM26_HUMAN	Isoform 5 of RNA-binding protein 26 OS=Homo sapiens OX=9606 GN=RBM26	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	1	1	0
PRT	sp|Q96A65-2|EXOC4_HUMAN	Isoform 2 of Exocyst complex component 4 OS=Homo sapiens OX=9606 GN=EXOC4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|P30101|PDIA3_HUMAN	Protein disulfide-isomerase A3 OS=Homo sapiens OX=9606 GN=PDIA3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	85-UNIMOD:4,92-UNIMOD:4,494-UNIMOD:188,496-UNIMOD:188	0.08	31.0	3	2	1
PRT	sp|O14639-4|ABLM1_HUMAN	Isoform 4 of Actin-binding LIM protein 1 OS=Homo sapiens OX=9606 GN=ABLIM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	42-UNIMOD:188,49-UNIMOD:188	0.04	31.0	3	1	0
PRT	sp|P35580|MYH10_HUMAN	Myosin-10 OS=Homo sapiens OX=9606 GN=MYH10 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	1238-UNIMOD:4,1227-UNIMOD:28	0.02	31.0	3	2	1
PRT	sp|P25815|S100P_HUMAN	Protein S100-P OS=Homo sapiens OX=9606 GN=S100P PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.19	31.0	1	1	1
PRT	sp|P21333|FLNA_HUMAN	Filamin-A OS=Homo sapiens OX=9606 GN=FLNA PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.01	31.0	1	1	0
PRT	sp|P62269|RS18_HUMAN	40S ribosomal protein S18 OS=Homo sapiens OX=9606 GN=RPS18 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	94-UNIMOD:188,106-UNIMOD:188	0.11	31.0	2	1	0
PRT	sp|Q8TEM1|PO210_HUMAN	Nuclear pore membrane glycoprotein 210 OS=Homo sapiens OX=9606 GN=NUP210 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	31.0	null	1082-UNIMOD:267	0.01	31.0	4	1	0
PRT	sp|P14324|FPPS_HUMAN	Farnesyl pyrophosphate synthase OS=Homo sapiens OX=9606 GN=FDPS PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.04	31.0	1	1	0
PRT	sp|P38159|RBMX_HUMAN	RNA-binding motif protein, X chromosome OS=Homo sapiens OX=9606 GN=RBMX PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.04	31.0	1	1	1
PRT	sp|Q02539|H11_HUMAN	Histone H1.1 OS=Homo sapiens OX=9606 GN=H1-1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	null		0.07	31.0	1	1	1
PRT	sp|P61764|STXB1_HUMAN	Syntaxin-binding protein 1 OS=Homo sapiens OX=9606 GN=STXBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|P11177-3|ODPB_HUMAN	Isoform 3 of Pyruvate dehydrogenase E1 component subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=PDHB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	292-UNIMOD:35,306-UNIMOD:267	0.10	30.0	3	2	1
PRT	sp|Q07666-3|KHDR1_HUMAN	Isoform 3 of KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Homo sapiens OX=9606 GN=KHDRBS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	152-UNIMOD:188	0.03	30.0	2	1	0
PRT	sp|Q92667-2|AKAP1_HUMAN	Isoform 2 of A-kinase anchor protein 1, mitochondrial OS=Homo sapiens OX=9606 GN=AKAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|Q8TAT6|NPL4_HUMAN	Nuclear protein localization protein 4 homolog OS=Homo sapiens OX=9606 GN=NPLOC4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	399-UNIMOD:4,403-UNIMOD:4,404-UNIMOD:188,413-UNIMOD:188	0.03	30.0	3	1	0
PRT	sp|P18206-2|VINC_HUMAN	Isoform 1 of Vinculin OS=Homo sapiens OX=9606 GN=VCL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	784-UNIMOD:188,792-UNIMOD:188	0.03	30.0	3	2	1
PRT	sp|Q01081-4|U2AF1_HUMAN	Isoform 4 of Splicing factor U2AF 35 kDa subunit OS=Homo sapiens OX=9606 GN=U2AF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.09	30.0	1	1	1
PRT	sp|Q8N573-2|OXR1_HUMAN	Isoform 2 of Oxidation resistance protein 1 OS=Homo sapiens OX=9606 GN=OXR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|Q9H1B7|I2BPL_HUMAN	Probable E3 ubiquitin-protein ligase IRF2BPL OS=Homo sapiens OX=9606 GN=IRF2BPL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	748-UNIMOD:188,758-UNIMOD:4,763-UNIMOD:188	0.03	30.0	1	1	1
PRT	sp|Q4G0F5|VP26B_HUMAN	Vacuolar protein sorting-associated protein 26B OS=Homo sapiens OX=9606 GN=VPS26B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.06	30.0	1	1	1
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	356-UNIMOD:188,360-UNIMOD:188,682-UNIMOD:188,683-UNIMOD:188	0.03	30.0	3	2	1
PRT	sp|Q53GS9-2|SNUT2_HUMAN	Isoform 2 of U4/U6.U5 tri-snRNP-associated protein 2 OS=Homo sapiens OX=9606 GN=USP39	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	390-UNIMOD:188	0.03	30.0	2	1	0
PRT	sp|Q8N163-2|CCAR2_HUMAN	Isoform 2 of Cell cycle and apoptosis regulator protein 2 OS=Homo sapiens OX=9606 GN=CCAR2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	417-UNIMOD:267	0.02	30.0	4	1	0
PRT	sp|O00264|PGRC1_HUMAN	Membrane-associated progesterone receptor component 1 OS=Homo sapiens OX=9606 GN=PGRMC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.08	30.0	1	1	1
PRT	sp|P09493-2|TPM1_HUMAN	Isoform 2 of Tropomyosin alpha-1 chain OS=Homo sapiens OX=9606 GN=TPM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.06	30.0	1	1	1
PRT	sp|Q06136-2|KDSR_HUMAN	Isoform 2 of 3-ketodihydrosphingosine reductase OS=Homo sapiens OX=9606 GN=KDSR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	181-UNIMOD:4,182-UNIMOD:188,188-UNIMOD:188	0.06	30.0	2	1	0
PRT	sp|Q8N9T8|KRI1_HUMAN	Protein KRI1 homolog OS=Homo sapiens OX=9606 GN=KRI1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	667-UNIMOD:4,671-UNIMOD:267	0.02	30.0	2	1	0
PRT	sp|P62277|RS13_HUMAN	40S ribosomal protein S13 OS=Homo sapiens OX=9606 GN=RPS13 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	34-UNIMOD:188,39-UNIMOD:188	0.09	30.0	2	1	0
PRT	sp|Q86W92-3|LIPB1_HUMAN	Isoform 3 of Liprin-beta-1 OS=Homo sapiens OX=9606 GN=PPFIBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	805-UNIMOD:267,809-UNIMOD:35,817-UNIMOD:267,326-UNIMOD:188,331-UNIMOD:188	0.04	30.0	3	2	1
PRT	sp|P30047|GFRP_HUMAN	GTP cyclohydrolase 1 feedback regulatory protein OS=Homo sapiens OX=9606 GN=GCHFR PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	12-UNIMOD:35	0.31	30.0	1	1	1
PRT	sp|P60842-2|IF4A1_HUMAN	Isoform 2 of Eukaryotic initiation factor 4A-I OS=Homo sapiens OX=9606 GN=EIF4A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	178-UNIMOD:35,190-UNIMOD:267	0.04	30.0	1	1	1
PRT	sp|P58546|MTPN_HUMAN	Myotrophin OS=Homo sapiens OX=9606 GN=MTPN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	19-UNIMOD:188,24-UNIMOD:188	0.12	30.0	3	1	0
PRT	sp|Q9UHX1-4|PUF60_HUMAN	Isoform 4 of Poly(U)-binding-splicing factor PUF60 OS=Homo sapiens OX=9606 GN=PUF60	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	409-UNIMOD:35,413-UNIMOD:188,427-UNIMOD:4,429-UNIMOD:188	0.09	30.0	5	3	2
PRT	sp|P83916|CBX1_HUMAN	Chromobox protein homolog 1 OS=Homo sapiens OX=9606 GN=CBX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	150-UNIMOD:188,155-UNIMOD:188	0.09	30.0	2	1	0
PRT	sp|P49792|RBP2_HUMAN	E3 SUMO-protein ligase RanBP2 OS=Homo sapiens OX=9606 GN=RANBP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	1626-UNIMOD:4,1629-UNIMOD:4,1634-UNIMOD:188,1652-UNIMOD:188,2592-UNIMOD:188,2594-UNIMOD:188	0.02	30.0	4	2	0
PRT	sp|P43007-2|SATT_HUMAN	Isoform 2 of Neutral amino acid transporter A OS=Homo sapiens OX=9606 GN=SLC1A4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	230-UNIMOD:188	0.12	30.0	1	1	1
PRT	sp|P37837|TALDO_HUMAN	Transaldolase OS=Homo sapiens OX=9606 GN=TALDO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	215-UNIMOD:188,219-UNIMOD:188	0.05	30.0	2	1	0
PRT	sp|O00566|MPP10_HUMAN	U3 small nucleolar ribonucleoprotein protein MPP10 OS=Homo sapiens OX=9606 GN=MPHOSPH10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	498-UNIMOD:188	0.02	30.0	2	1	0
PRT	sp|O94760|DDAH1_HUMAN	N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 OS=Homo sapiens OX=9606 GN=DDAH1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	247-UNIMOD:188,251-UNIMOD:188,2-UNIMOD:1,12-UNIMOD:267	0.09	30.0	4	2	0
PRT	sp|O60563|CCNT1_HUMAN	Cyclin-T1 OS=Homo sapiens OX=9606 GN=CCNT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.04	30.0	1	1	1
PRT	sp|O43290|SNUT1_HUMAN	U4/U6.U5 tri-snRNP-associated protein 1 OS=Homo sapiens OX=9606 GN=SART1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.04	30.0	2	2	2
PRT	sp|P61221|ABCE1_HUMAN	ATP-binding cassette sub-family E member 1 OS=Homo sapiens OX=9606 GN=ABCE1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	343-UNIMOD:188,344-UNIMOD:188	0.02	30.0	2	1	0
PRT	sp|Q56VL3|OCAD2_HUMAN	OCIA domain-containing protein 2 OS=Homo sapiens OX=9606 GN=OCIAD2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.09	30.0	1	1	1
PRT	sp|Q07065|CKAP4_HUMAN	Cytoskeleton-associated protein 4 OS=Homo sapiens OX=9606 GN=CKAP4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|Q9NRP0|OSTC_HUMAN	Oligosaccharyltransferase complex subunit OSTC OS=Homo sapiens OX=9606 GN=OSTC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	14-UNIMOD:4,18-UNIMOD:188	0.09	30.0	2	1	0
PRT	sp|Q9Y3B6|EMC9_HUMAN	ER membrane protein complex subunit 9 OS=Homo sapiens OX=9606 GN=EMC9 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	139-UNIMOD:267	0.07	30.0	1	1	1
PRT	sp|P27708|PYR1_HUMAN	CAD protein OS=Homo sapiens OX=9606 GN=CAD PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	30.0	null	522-UNIMOD:35,547-UNIMOD:267,1869-UNIMOD:188,1871-UNIMOD:188	0.02	30.0	2	2	2
PRT	sp|P11940|PABP1_HUMAN	Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	254-UNIMOD:188,259-UNIMOD:188	0.02	30.0	4	1	0
PRT	sp|Q92945|FUBP2_HUMAN	Far upstream element-binding protein 2 OS=Homo sapiens OX=9606 GN=KHSRP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	30.0	null	331-UNIMOD:267,162-UNIMOD:267	0.04	30.0	5	2	0
PRT	sp|P49589-3|SYCC_HUMAN	Isoform 3 of Cysteine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=CARS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	null	53-UNIMOD:28,68-UNIMOD:267	0.02	30.0	2	1	0
PRT	sp|P02765|FETUA_HUMAN	Alpha-2-HS-glycoprotein OS=Homo sapiens OX=9606 GN=AHSG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	132-UNIMOD:4,132-UNIMOD:385	0.04	30.0	3	1	0
PRT	sp|P50914|RL14_HUMAN	60S ribosomal protein L14 OS=Homo sapiens OX=9606 GN=RPL14 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	30.0	null	35-UNIMOD:267	0.06	30.0	4	1	0
PRT	sp|P33527|MRP1_HUMAN	Multidrug resistance-associated protein 1 OS=Homo sapiens OX=9606 GN=ABCC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|Q15459|SF3A1_HUMAN	Splicing factor 3A subunit 1 OS=Homo sapiens OX=9606 GN=SF3A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	495-UNIMOD:188,499-UNIMOD:188	0.02	30.0	1	1	0
PRT	sp|Q16891-3|MIC60_HUMAN	Isoform 3 of MICOS complex subunit MIC60 OS=Homo sapiens OX=9606 GN=IMMT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	237-UNIMOD:188,238-UNIMOD:188,228-UNIMOD:35	0.02	29.0	4	1	0
PRT	sp|O95470|SGPL1_HUMAN	Sphingosine-1-phosphate lyase 1 OS=Homo sapiens OX=9606 GN=SGPL1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|Q9UJC3-2|HOOK1_HUMAN	Isoform 2 of Protein Hook homolog 1 OS=Homo sapiens OX=9606 GN=HOOK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	390-UNIMOD:4,407-UNIMOD:188	0.03	29.0	2	1	0
PRT	sp|Q13347|EIF3I_HUMAN	Eukaryotic translation initiation factor 3 subunit I OS=Homo sapiens OX=9606 GN=EIF3I PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	208-UNIMOD:188,213-UNIMOD:188	0.05	29.0	2	1	0
PRT	sp|Q9ULX6-2|AKP8L_HUMAN	Isoform 2 of A-kinase anchor protein 8-like OS=Homo sapiens OX=9606 GN=AKAP8L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|Q96C01|F136A_HUMAN	Protein FAM136A OS=Homo sapiens OX=9606 GN=FAM136A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	99-UNIMOD:188,104-UNIMOD:188	0.10	29.0	2	1	0
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	28-UNIMOD:267,254-UNIMOD:267	0.11	29.0	5	3	1
PRT	sp|P04843|RPN1_HUMAN	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Homo sapiens OX=9606 GN=RPN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	587-UNIMOD:188,592-UNIMOD:188	0.02	29.0	2	1	0
PRT	sp|P53611|PGTB2_HUMAN	Geranylgeranyl transferase type-2 subunit beta OS=Homo sapiens OX=9606 GN=RABGGTB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	11-UNIMOD:188,22-UNIMOD:188	0.05	29.0	1	1	1
PRT	sp|P47813|IF1AX_HUMAN	Eukaryotic translation initiation factor 1A, X-chromosomal OS=Homo sapiens OX=9606 GN=EIF1AX PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	88-UNIMOD:188,94-UNIMOD:188	0.09	29.0	2	1	0
PRT	sp|Q9UPP1-5|PHF8_HUMAN	Isoform 5 of Histone lysine demethylase PHF8 OS=Homo sapiens OX=9606 GN=PHF8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|Q9UHG3-2|PCYOX_HUMAN	Isoform 2 of Prenylcysteine oxidase 1 OS=Homo sapiens OX=9606 GN=PCYOX1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	1	1	0
PRT	sp|Q8N5N7-2|RM50_HUMAN	Isoform 2 of 39S ribosomal protein L50, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL50	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.10	29.0	1	1	1
PRT	sp|P14209-3|CD99_HUMAN	Isoform 3 of CD99 antigen OS=Homo sapiens OX=9606 GN=CD99	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	154-UNIMOD:267	0.09	29.0	2	1	0
PRT	sp|P18621-2|RL17_HUMAN	Isoform 2 of 60S ribosomal protein L17 OS=Homo sapiens OX=9606 GN=RPL17	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	121-UNIMOD:188,129-UNIMOD:188	0.10	29.0	2	1	0
PRT	sp|Q14103-4|HNRPD_HUMAN	Isoform 4 of Heterogeneous nuclear ribonucleoprotein D0 OS=Homo sapiens OX=9606 GN=HNRNPD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	136-UNIMOD:35,134-UNIMOD:188,139-UNIMOD:188	0.05	29.0	3	1	0
PRT	sp|Q93008-1|USP9X_HUMAN	Isoform 2 of Probable ubiquitin carboxyl-terminal hydrolase FAF-X OS=Homo sapiens OX=9606 GN=USP9X	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	864-UNIMOD:4,872-UNIMOD:267,1627-UNIMOD:188,1632-UNIMOD:188	0.01	29.0	4	2	0
PRT	sp|P13667|PDIA4_HUMAN	Protein disulfide-isomerase A4 OS=Homo sapiens OX=9606 GN=PDIA4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	2	1	0
PRT	sp|P19447|ERCC3_HUMAN	General transcription and DNA repair factor IIH helicase subunit XPB OS=Homo sapiens OX=9606 GN=ERCC3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	1	1	1
PRT	sp|P31040-3|SDHA_HUMAN	Isoform 3 of Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Homo sapiens OX=9606 GN=SDHA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	463-UNIMOD:188,470-UNIMOD:188	0.03	29.0	2	1	0
PRT	sp|O95299|NDUAA_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFA10 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.05	29.0	1	1	1
PRT	sp|Q5T0N5-3|FBP1L_HUMAN	Isoform 3 of Formin-binding protein 1-like OS=Homo sapiens OX=9606 GN=FNBP1L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|P17655-2|CAN2_HUMAN	Isoform 2 of Calpain-2 catalytic subunit OS=Homo sapiens OX=9606 GN=CAPN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	263-UNIMOD:4,276-UNIMOD:188,277-UNIMOD:188	0.03	29.0	4	1	0
PRT	sp|Q8TD19|NEK9_HUMAN	Serine/threonine-protein kinase Nek9 OS=Homo sapiens OX=9606 GN=NEK9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	650-UNIMOD:188	0.01	29.0	1	1	1
PRT	sp|Q9NSK0-4|KLC4_HUMAN	Isoform 4 of Kinesin light chain 4 OS=Homo sapiens OX=9606 GN=KLC4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	1	1	1
PRT	sp|Q9Y678|COPG1_HUMAN	Coatomer subunit gamma-1 OS=Homo sapiens OX=9606 GN=COPG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|O95613-2|PCNT_HUMAN	Isoform 2 of Pericentrin OS=Homo sapiens OX=9606 GN=PCNT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	2473-UNIMOD:188,2479-UNIMOD:188	0.00	29.0	1	1	1
PRT	sp|Q9Y6W3|CAN7_HUMAN	Calpain-7 OS=Homo sapiens OX=9606 GN=CAPN7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	130-UNIMOD:188,135-UNIMOD:188	0.02	29.0	2	1	0
PRT	sp|Q15054-3|DPOD3_HUMAN	Isoform 3 of DNA polymerase delta subunit 3 OS=Homo sapiens OX=9606 GN=POLD3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	152-UNIMOD:188,155-UNIMOD:188	0.04	29.0	2	1	0
PRT	sp|Q9NTK5|OLA1_HUMAN	Obg-like ATPase 1 OS=Homo sapiens OX=9606 GN=OLA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	354-UNIMOD:188,363-UNIMOD:188,35-UNIMOD:188	0.07	29.0	3	2	1
PRT	sp|Q8IYT4|KATL2_HUMAN	Katanin p60 ATPase-containing subunit A-like 2 OS=Homo sapiens OX=9606 GN=KATNAL2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	300-UNIMOD:188	0.02	29.0	1	1	0
PRT	sp|P67936|TPM4_HUMAN	Tropomyosin alpha-4 chain OS=Homo sapiens OX=9606 GN=TPM4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	154-UNIMOD:4,162-UNIMOD:188,169-UNIMOD:188	0.07	29.0	2	1	0
PRT	sp|P61247|RS3A_HUMAN	40S ribosomal protein S3a OS=Homo sapiens OX=9606 GN=RPS3A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	29.0	null	182-UNIMOD:188,187-UNIMOD:188	0.05	29.0	5	1	0
PRT	sp|Q9H9A5|CNO10_HUMAN	CCR4-NOT transcription complex subunit 10 OS=Homo sapiens OX=9606 GN=CNOT10 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	398-UNIMOD:4,399-UNIMOD:4	0.03	29.0	1	1	0
PRT	sp|Q9Y520|PRC2C_HUMAN	Protein PRRC2C OS=Homo sapiens OX=9606 GN=PRRC2C PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	2141-UNIMOD:188,2148-UNIMOD:267	0.01	29.0	2	1	0
PRT	sp|Q92541|RTF1_HUMAN	RNA polymerase-associated protein RTF1 homolog OS=Homo sapiens OX=9606 GN=RTF1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	29.0	null	531-UNIMOD:188,533-UNIMOD:188	0.02	29.0	2	1	0
PRT	sp|Q9NX58|LYAR_HUMAN	Cell growth-regulating nucleolar protein OS=Homo sapiens OX=9606 GN=LYAR PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	247-UNIMOD:188,248-UNIMOD:267	0.06	29.0	2	1	0
PRT	sp|Q13330|MTA1_HUMAN	Metastasis-associated protein MTA1 OS=Homo sapiens OX=9606 GN=MTA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|O76021|RL1D1_HUMAN	Ribosomal L1 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RSL1D1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	426-UNIMOD:188,430-UNIMOD:188	0.06	28.0	3	2	1
PRT	sp|O15066|KIF3B_HUMAN	Kinesin-like protein KIF3B OS=Homo sapiens OX=9606 GN=KIF3B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	30-UNIMOD:188,37-UNIMOD:188	0.02	28.0	1	1	1
PRT	sp|P05455|LA_HUMAN	Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|O75165|DJC13_HUMAN	DnaJ homolog subfamily C member 13 OS=Homo sapiens OX=9606 GN=DNAJC13 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null	594-UNIMOD:188,599-UNIMOD:188	0.01	28.0	3	2	1
PRT	sp|Q99880|H2B1L_HUMAN	Histone H2B type 1-L OS=Homo sapiens OX=9606 GN=H2BC13 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	60-UNIMOD:35,63-UNIMOD:35,73-UNIMOD:267	0.13	28.0	2	1	0
PRT	sp|Q96T51|RUFY1_HUMAN	RUN and FYVE domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RUFY1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|Q13310-2|PABP4_HUMAN	Isoform 2 of Polyadenylate-binding protein 4 OS=Homo sapiens OX=9606 GN=PABPC4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	254-UNIMOD:188,259-UNIMOD:188	0.02	28.0	2	1	0
PRT	sp|Q7RTV0|PHF5A_HUMAN	PHD finger-like domain-containing protein 5A OS=Homo sapiens OX=9606 GN=PHF5A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	58-UNIMOD:4,61-UNIMOD:4,72-UNIMOD:4,75-UNIMOD:4	0.22	28.0	1	1	1
PRT	sp|O14979|HNRDL_HUMAN	Heterogeneous nuclear ribonucleoprotein D-like OS=Homo sapiens OX=9606 GN=HNRNPDL PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	204-UNIMOD:188,209-UNIMOD:188	0.07	28.0	3	2	1
PRT	sp|Q9Y3B7-2|RM11_HUMAN	Isoform 2 of 39S ribosomal protein L11, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL11	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	165-UNIMOD:188,166-UNIMOD:188	0.17	28.0	3	2	1
PRT	sp|P14222|PERF_HUMAN	Perforin-1 OS=Homo sapiens OX=9606 GN=PRF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null	393-UNIMOD:4,395-UNIMOD:4,397-UNIMOD:4,407-UNIMOD:4,408-UNIMOD:4,410-UNIMOD:267	0.04	28.0	2	1	0
PRT	sp|P07339|CATD_HUMAN	Cathepsin D OS=Homo sapiens OX=9606 GN=CTSD PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	253-UNIMOD:188,256-UNIMOD:188	0.08	28.0	2	2	2
PRT	sp|Q99798|ACON_HUMAN	Aconitate hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=ACO2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	564-UNIMOD:267	0.02	28.0	2	1	0
PRT	sp|P16144-4|ITB4_HUMAN	Isoform Beta-4D of Integrin beta-4 OS=Homo sapiens OX=9606 GN=ITGB4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	1452-UNIMOD:267	0.01	28.0	2	1	0
PRT	sp|P41240|CSK_HUMAN	Tyrosine-protein kinase CSK OS=Homo sapiens OX=9606 GN=CSK PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	347-UNIMOD:188,351-UNIMOD:188	0.03	28.0	2	1	0
PRT	sp|P48681|NEST_HUMAN	Nestin OS=Homo sapiens OX=9606 GN=NES PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|Q5T4S7-3|UBR4_HUMAN	Isoform 3 of E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	3355-UNIMOD:188,3368-UNIMOD:4,3377-UNIMOD:188	0.00	28.0	1	1	1
PRT	sp|Q14677|EPN4_HUMAN	Clathrin interactor 1 OS=Homo sapiens OX=9606 GN=CLINT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	13-UNIMOD:188,27-UNIMOD:188	0.03	28.0	2	1	0
PRT	sp|Q969G9|NKD1_HUMAN	Protein naked cuticle homolog 1 OS=Homo sapiens OX=9606 GN=NKD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	28-UNIMOD:188	0.03	28.0	2	1	0
PRT	sp|O75348|VATG1_HUMAN	V-type proton ATPase subunit G 1 OS=Homo sapiens OX=9606 GN=ATP6V1G1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	69-UNIMOD:4,75-UNIMOD:188,80-UNIMOD:188	0.13	28.0	2	1	0
PRT	sp|P49591|SYSC_HUMAN	Serine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=SARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|Q07020-2|RL18_HUMAN	Isoform 2 of 60S ribosomal protein L18 OS=Homo sapiens OX=9606 GN=RPL18	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.09	28.0	1	1	0
PRT	sp|Q9H9A5-5|CNO10_HUMAN	Isoform 5 of CCR4-NOT transcription complex subunit 10 OS=Homo sapiens OX=9606 GN=CNOT10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	105-UNIMOD:4,106-UNIMOD:4,111-UNIMOD:188,119-UNIMOD:188	0.04	28.0	1	1	0
PRT	sp|Q9Y6J9|TAF6L_HUMAN	TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L OS=Homo sapiens OX=9606 GN=TAF6L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	593-UNIMOD:267	0.03	28.0	2	1	0
PRT	sp|P32780-2|TF2H1_HUMAN	Isoform 2 of General transcription factor IIH subunit 1 OS=Homo sapiens OX=9606 GN=GTF2H1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	1	1	1
PRT	sp|P49419-4|AL7A1_HUMAN	Isoform 4 of Alpha-aminoadipic semialdehyde dehydrogenase OS=Homo sapiens OX=9606 GN=ALDH7A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	173-UNIMOD:267,163-UNIMOD:35	0.03	28.0	3	1	0
PRT	sp|Q8NEF9|SRFB1_HUMAN	Serum response factor-binding protein 1 OS=Homo sapiens OX=9606 GN=SRFBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	160-UNIMOD:267	0.06	28.0	1	1	1
PRT	sp|Q5TEU4-2|NDUF5_HUMAN	Isoform 2 of Arginine-hydroxylase NDUFAF5, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFAF5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	98-UNIMOD:4,100-UNIMOD:267	0.04	28.0	2	1	0
PRT	sp|Q16629-3|SRSF7_HUMAN	Isoform 3 of Serine/arginine-rich splicing factor 7 OS=Homo sapiens OX=9606 GN=SRSF7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	58-UNIMOD:267	0.11	28.0	3	1	0
PRT	sp|P49770|EI2BB_HUMAN	Translation initiation factor eIF-2B subunit beta OS=Homo sapiens OX=9606 GN=EIF2B2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	111-UNIMOD:188	0.04	28.0	2	1	0
PRT	sp|Q07866-8|KLC1_HUMAN	Isoform S of Kinesin light chain 1 OS=Homo sapiens OX=9606 GN=KLC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|O75367-2|H2AY_HUMAN	Isoform 1 of Core histone macro-H2A.1 OS=Homo sapiens OX=9606 GN=MACROH2A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	315-UNIMOD:267	0.03	28.0	8	1	0
PRT	sp|Q13136-2|LIPA1_HUMAN	Isoform 2 of Liprin-alpha-1 OS=Homo sapiens OX=9606 GN=PPFIA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|Q8NEV8-2|EXPH5_HUMAN	Isoform 2 of Exophilin-5 OS=Homo sapiens OX=9606 GN=EXPH5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	605-UNIMOD:188	0.01	28.0	1	1	1
PRT	sp|A6NDG6|PGP_HUMAN	Glycerol-3-phosphate phosphatase OS=Homo sapiens OX=9606 GN=PGP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	297-UNIMOD:4	0.08	28.0	1	1	1
PRT	sp|Q8IZP0-11|ABI1_HUMAN	Isoform 11 of Abl interactor 1 OS=Homo sapiens OX=9606 GN=ABI1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	33-UNIMOD:4	0.05	28.0	2	1	0
PRT	sp|Q9P016-2|THYN1_HUMAN	Isoform 2 of Thymocyte nuclear protein 1 OS=Homo sapiens OX=9606 GN=THYN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.08	28.0	1	1	1
PRT	sp|O75955-2|FLOT1_HUMAN	Isoform 2 of Flotillin-1 OS=Homo sapiens OX=9606 GN=FLOT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	34-UNIMOD:4,40-UNIMOD:267	0.03	28.0	1	1	1
PRT	sp|Q96A54|PAQR1_HUMAN	Adiponectin receptor protein 1 OS=Homo sapiens OX=9606 GN=ADIPOR1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	54-UNIMOD:4	0.07	28.0	1	1	1
PRT	sp|Q8IWZ8|SUGP1_HUMAN	SURP and G-patch domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SUGP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	264-UNIMOD:188,269-UNIMOD:188	0.02	28.0	1	1	1
PRT	sp|Q14697|GANAB_HUMAN	Neutral alpha-glucosidase AB OS=Homo sapiens OX=9606 GN=GANAB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	191-UNIMOD:188,206-UNIMOD:267	0.02	28.0	2	1	0
PRT	sp|Q02952|AKA12_HUMAN	A-kinase anchor protein 12 OS=Homo sapiens OX=9606 GN=AKAP12 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	578-UNIMOD:4	0.03	28.0	1	1	1
PRT	sp|P09622|DLDH_HUMAN	Dihydrolipoyl dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=DLD PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	166-UNIMOD:188,177-UNIMOD:188	0.04	28.0	2	1	0
PRT	sp|O15067|PUR4_HUMAN	Phosphoribosylformylglycinamidine synthase OS=Homo sapiens OX=9606 GN=PFAS PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	28.0	null	1039-UNIMOD:35,1044-UNIMOD:4	0.02	28.0	2	2	2
PRT	sp|Q9BZJ0|CRNL1_HUMAN	Crooked neck-like protein 1 OS=Homo sapiens OX=9606 GN=CRNKL1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	null	828-UNIMOD:28	0.03	28.0	1	1	1
PRT	sp|P09884|DPOLA_HUMAN	DNA polymerase alpha catalytic subunit OS=Homo sapiens OX=9606 GN=POLA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	28.0	null	829-UNIMOD:188,831-UNIMOD:188	0.01	28.0	2	1	0
PRT	sp|Q9H832|UBE2Z_HUMAN	Ubiquitin-conjugating enzyme E2 Z OS=Homo sapiens OX=9606 GN=UBE2Z PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	null	261-UNIMOD:385,261-UNIMOD:4,263-UNIMOD:4,268-UNIMOD:267,273-UNIMOD:188	0.04	28.0	1	1	1
PRT	sp|P46087|NOP2_HUMAN	Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase OS=Homo sapiens OX=9606 GN=NOP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	null	773-UNIMOD:28	0.02	28.0	1	1	1
PRT	sp|Q8N684|CPSF7_HUMAN	Cleavage and polyadenylation specificity factor subunit 7 OS=Homo sapiens OX=9606 GN=CPSF7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	140-UNIMOD:188	0.03	28.0	1	1	0
PRT	sp|P00441|SODC_HUMAN	Superoxide dismutase [Cu-Zn] OS=Homo sapiens OX=9606 GN=SOD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	129-UNIMOD:188,137-UNIMOD:188	0.10	27.0	2	1	0
PRT	sp|P56192|SYMC_HUMAN	Methionine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=MARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	866-UNIMOD:188,875-UNIMOD:188	0.01	27.0	2	1	0
PRT	sp|Q02218|ODO1_HUMAN	2-oxoglutarate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=OGDH PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	395-UNIMOD:4	0.01	27.0	1	1	1
PRT	sp|Q96GK7|FAH2A_HUMAN	Fumarylacetoacetate hydrolase domain-containing protein 2A OS=Homo sapiens OX=9606 GN=FAHD2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	93-UNIMOD:267	0.04	27.0	1	1	1
PRT	sp|Q5VTR2|BRE1A_HUMAN	E3 ubiquitin-protein ligase BRE1A OS=Homo sapiens OX=9606 GN=RNF20 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|Q9HAV4|XPO5_HUMAN	Exportin-5 OS=Homo sapiens OX=9606 GN=XPO5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	1131-UNIMOD:4,1115-UNIMOD:35	0.02	27.0	2	1	0
PRT	sp|Q13685|AAMP_HUMAN	Angio-associated migratory cell protein OS=Homo sapiens OX=9606 GN=AAMP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	423-UNIMOD:188	0.03	27.0	1	1	1
PRT	sp|Q9NWY4|HPF1_HUMAN	Histone PARylation factor 1 OS=Homo sapiens OX=9606 GN=HPF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.05	27.0	1	1	1
PRT	sp|Q8TAQ2-2|SMRC2_HUMAN	Isoform 2 of SWI/SNF complex subunit SMARCC2 OS=Homo sapiens OX=9606 GN=SMARCC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	818-UNIMOD:188,820-UNIMOD:188	0.01	27.0	2	1	0
PRT	sp|Q92616|GCN1_HUMAN	eIF-2-alpha kinase activator GCN1 OS=Homo sapiens OX=9606 GN=GCN1 PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	2280-UNIMOD:188,2285-UNIMOD:188	0.01	27.0	2	1	0
PRT	sp|Q9NY33-2|DPP3_HUMAN	Isoform 2 of Dipeptidyl peptidase 3 OS=Homo sapiens OX=9606 GN=DPP3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	307-UNIMOD:188	0.04	27.0	2	1	0
PRT	sp|Q9NV35|NUD15_HUMAN	Nucleotide triphosphate diphosphatase NUDT15 OS=Homo sapiens OX=9606 GN=NUDT15 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	110-UNIMOD:188	0.08	27.0	1	1	1
PRT	sp|P22626-2|ROA2_HUMAN	Isoform A2 of Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.05	27.0	1	1	0
PRT	sp|O75821|EIF3G_HUMAN	Eukaryotic translation initiation factor 3 subunit G OS=Homo sapiens OX=9606 GN=EIF3G PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.12	27.0	3	2	1
PRT	sp|O00233-3|PSMD9_HUMAN	Isoform 3 of 26S proteasome non-ATPase regulatory subunit 9 OS=Homo sapiens OX=9606 GN=PSMD9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	111-UNIMOD:4,118-UNIMOD:267	0.11	27.0	2	1	0
PRT	sp|Q8IYT4-2|KATL2_HUMAN	Isoform 2 of Katanin p60 ATPase-containing subunit A-like 2 OS=Homo sapiens OX=9606 GN=KATNAL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	0
PRT	sp|P50579-2|MAP2_HUMAN	Isoform 2 of Methionine aminopeptidase 2 OS=Homo sapiens OX=9606 GN=METAP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.05	27.0	1	1	1
PRT	sp|P09651-3|ROA1_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.04	27.0	1	1	1
PRT	sp|Q2NL82|TSR1_HUMAN	Pre-rRNA-processing protein TSR1 homolog OS=Homo sapiens OX=9606 GN=TSR1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	27.0	null	575-UNIMOD:28,590-UNIMOD:188	0.04	27.0	2	2	2
PRT	sp|Q96AE4|FUBP1_HUMAN	Far upstream element-binding protein 1 OS=Homo sapiens OX=9606 GN=FUBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null	118-UNIMOD:267	0.06	27.0	4	3	2
PRT	sp|Q92890-3|UFD1_HUMAN	Isoform 3 of Ubiquitin recognition factor in ER-associated degradation protein 1 OS=Homo sapiens OX=9606 GN=UFD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	58-UNIMOD:267	0.05	27.0	2	1	0
PRT	sp|P62805|H4_HUMAN	Histone H4 OS=Homo sapiens OX=9606 GN=H4C1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	56-UNIMOD:267	0.21	27.0	3	2	1
PRT	sp|Q8NI36|WDR36_HUMAN	WD repeat-containing protein 36 OS=Homo sapiens OX=9606 GN=WDR36 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	370-UNIMOD:267	0.01	27.0	2	1	0
PRT	sp|Q13509-2|TBB3_HUMAN	Isoform 2 of Tubulin beta-3 chain OS=Homo sapiens OX=9606 GN=TUBB3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	190-UNIMOD:267,185-UNIMOD:35	0.07	27.0	6	2	1
PRT	sp|Q15642-5|CIP4_HUMAN	Isoform 5 of Cdc42-interacting protein 4 OS=Homo sapiens OX=9606 GN=TRIP10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	166-UNIMOD:188,171-UNIMOD:188	0.04	27.0	1	1	1
PRT	sp|Q8IVF2-3|AHNK2_HUMAN	Isoform 3 of Protein AHNAK2 OS=Homo sapiens OX=9606 GN=AHNAK2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	889-UNIMOD:188,894-UNIMOD:188	0.03	27.0	1	1	1
PRT	sp|P04792|HSPB1_HUMAN	Heat shock protein beta-1 OS=Homo sapiens OX=9606 GN=HSPB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	37-UNIMOD:267	0.05	27.0	2	1	0
PRT	sp|Q08211|DHX9_HUMAN	ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	819-UNIMOD:188	0.02	27.0	3	2	1
PRT	sp|O43681|ASNA_HUMAN	ATPase ASNA1 OS=Homo sapiens OX=9606 GN=ASNA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|Q9HCS7|SYF1_HUMAN	Pre-mRNA-splicing factor SYF1 OS=Homo sapiens OX=9606 GN=XAB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	311-UNIMOD:35	0.02	27.0	1	1	1
PRT	sp|Q9P2K5-3|MYEF2_HUMAN	Isoform 3 of Myelin expression factor 2 OS=Homo sapiens OX=9606 GN=MYEF2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	85-UNIMOD:267	0.06	27.0	2	1	0
PRT	sp|P22307-6|NLTP_HUMAN	Isoform 6 of Non-specific lipid-transfer protein OS=Homo sapiens OX=9606 GN=SCP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	105-UNIMOD:35	0.09	27.0	1	1	1
PRT	sp|P54819-3|KAD2_HUMAN	Isoform 3 of Adenylate kinase 2, mitochondrial OS=Homo sapiens OX=9606 GN=AK2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	103-UNIMOD:267	0.05	27.0	2	1	0
PRT	sp|Q9H2P0|ADNP_HUMAN	Activity-dependent neuroprotector homeobox protein OS=Homo sapiens OX=9606 GN=ADNP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	167-UNIMOD:4,168-UNIMOD:188,169-UNIMOD:188	0.01	27.0	1	1	1
PRT	sp|Q15542-2|TAF5_HUMAN	Isoform Short of Transcription initiation factor TFIID subunit 5 OS=Homo sapiens OX=9606 GN=TAF5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	0
PRT	sp|Q14204|DYHC1_HUMAN	Cytoplasmic dynein 1 heavy chain 1 OS=Homo sapiens OX=9606 GN=DYNC1H1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	4438-UNIMOD:4,4441-UNIMOD:188,4442-UNIMOD:188	0.01	27.0	4	3	2
PRT	sp|P98171|RHG04_HUMAN	Rho GTPase-activating protein 4 OS=Homo sapiens OX=9606 GN=ARHGAP4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|O75400-2|PR40A_HUMAN	Isoform 2 of Pre-mRNA-processing factor 40 homolog A OS=Homo sapiens OX=9606 GN=PRPF40A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	169-UNIMOD:188,178-UNIMOD:188	0.02	27.0	2	1	0
PRT	sp|Q9Y3D0|CIA2B_HUMAN	Cytosolic iron-sulfur assembly component 2B OS=Homo sapiens OX=9606 GN=CIAO2B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.14	27.0	1	1	1
PRT	sp|P42704|LPPRC_HUMAN	Leucine-rich PPR motif-containing protein, mitochondrial OS=Homo sapiens OX=9606 GN=LRPPRC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	1332-UNIMOD:188,1338-UNIMOD:188	0.01	27.0	2	1	0
PRT	sp|P51610-2|HCFC1_HUMAN	Isoform 2 of Host cell factor 1 OS=Homo sapiens OX=9606 GN=HCFC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	1817-UNIMOD:4,1826-UNIMOD:4,1829-UNIMOD:188	0.01	27.0	2	1	0
PRT	sp|Q13561|DCTN2_HUMAN	Dynactin subunit 2 OS=Homo sapiens OX=9606 GN=DCTN2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	125-UNIMOD:188,132-UNIMOD:188	0.03	27.0	1	1	1
PRT	sp|Q8TEQ6|GEMI5_HUMAN	Gem-associated protein 5 OS=Homo sapiens OX=9606 GN=GEMIN5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	55-UNIMOD:267	0.01	27.0	2	1	0
PRT	sp|O43390-4|HNRPR_HUMAN	Isoform 4 of Heterogeneous nuclear ribonucleoprotein R OS=Homo sapiens OX=9606 GN=HNRNPR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	19-UNIMOD:188,25-UNIMOD:188,261-UNIMOD:188	0.05	27.0	3	2	1
PRT	sp|Q709C8-4|VP13C_HUMAN	Isoform 4 of Vacuolar protein sorting-associated protein 13C OS=Homo sapiens OX=9606 GN=VPS13C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.00	27.0	1	1	1
PRT	sp|O76094-2|SRP72_HUMAN	Isoform 2 of Signal recognition particle subunit SRP72 OS=Homo sapiens OX=9606 GN=SRP72	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|Q96EV2|RBM33_HUMAN	RNA-binding protein 33 OS=Homo sapiens OX=9606 GN=RBM33 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	1093-UNIMOD:4,1094-UNIMOD:188,1098-UNIMOD:4,1115-UNIMOD:188	0.02	27.0	1	1	1
PRT	sp|Q15007-2|FL2D_HUMAN	Isoform 2 of Pre-mRNA-splicing regulator WTAP OS=Homo sapiens OX=9606 GN=WTAP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.13	27.0	1	1	1
PRT	sp|Q13813|SPTN1_HUMAN	Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	586-UNIMOD:188,592-UNIMOD:188,1930-UNIMOD:4	0.01	27.0	2	2	2
PRT	sp|P54819|KAD2_HUMAN	Adenylate kinase 2, mitochondrial OS=Homo sapiens OX=9606 GN=AK2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.05	27.0	2	1	0
PRT	sp|P53992|SC24C_HUMAN	Protein transport protein Sec24C OS=Homo sapiens OX=9606 GN=SEC24C PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	null	390-UNIMOD:28,400-UNIMOD:188,404-UNIMOD:267	0.01	27.0	2	1	0
PRT	sp|O15427|MOT4_HUMAN	Monocarboxylate transporter 4 OS=Homo sapiens OX=9606 GN=SLC16A3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	27.0	null	453-UNIMOD:188	0.04	27.0	3	1	0
PRT	sp|Q9Y5K6|CD2AP_HUMAN	CD2-associated protein OS=Homo sapiens OX=9606 GN=CD2AP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	2	1	0
PRT	sp|P22626|ROA2_HUMAN	Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	228-UNIMOD:267	0.05	27.0	3	1	0
PRT	sp|Q16836|HCDH_HUMAN	Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=HADH PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.04	27.0	1	1	1
PRT	sp|Q9H773|DCTP1_HUMAN	dCTP pyrophosphatase 1 OS=Homo sapiens OX=9606 GN=DCTPP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	null	110-UNIMOD:385,110-UNIMOD:4,111-UNIMOD:267,121-UNIMOD:188	0.08	27.0	1	1	1
PRT	sp|P30046|DOPD_HUMAN	D-dopachrome decarboxylase OS=Homo sapiens OX=9606 GN=DDT PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	110-UNIMOD:188	0.10	27.0	3	1	0
PRT	sp|P09525|ANXA4_HUMAN	Annexin A4 OS=Homo sapiens OX=9606 GN=ANXA4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	null	173-UNIMOD:28	0.04	27.0	1	1	0
PRT	sp|P17931|LEG3_HUMAN	Galectin-3 OS=Homo sapiens OX=9606 GN=LGALS3 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	null	187-UNIMOD:28	0.06	27.0	1	1	1
PRT	sp|Q13416|ORC2_HUMAN	Origin recognition complex subunit 2 OS=Homo sapiens OX=9606 GN=ORC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	83-UNIMOD:188,93-UNIMOD:188	0.03	27.0	1	1	1
PRT	sp|P52907|CAZA1_HUMAN	F-actin-capping protein subunit alpha-1 OS=Homo sapiens OX=9606 GN=CAPZA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.06	27.0	1	1	1
PRT	sp|Q15233|NONO_HUMAN	Non-POU domain-containing octamer-binding protein OS=Homo sapiens OX=9606 GN=NONO PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	384-UNIMOD:35	0.03	27.0	1	1	1
PRT	sp|P29966|MARCS_HUMAN	Myristoylated alanine-rich C-kinase substrate OS=Homo sapiens OX=9606 GN=MARCKS PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	263-UNIMOD:188,267-UNIMOD:188	0.04	26.0	2	1	0
PRT	sp|Q9NRF8|PYRG2_HUMAN	CTP synthase 2 OS=Homo sapiens OX=9606 GN=CTPS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q9Y606-2|TRUA_HUMAN	Isoform 2 of tRNA pseudouridine synthase A OS=Homo sapiens OX=9606 GN=PUS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	309-UNIMOD:267	0.03	26.0	2	1	0
PRT	sp|Q9UIJ7-2|KAD3_HUMAN	Isoform 2 of GTP:AMP phosphotransferase AK3, mitochondrial OS=Homo sapiens OX=9606 GN=AK3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	111-UNIMOD:188,119-UNIMOD:188	0.10	26.0	1	1	1
PRT	sp|P78549-3|NTH_HUMAN	Isoform 3 of Endonuclease III-like protein 1 OS=Homo sapiens OX=9606 GN=NTHL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	282-UNIMOD:4,285-UNIMOD:4,291-UNIMOD:4	0.06	26.0	1	1	1
PRT	sp|Q86X55-1|CARM1_HUMAN	Isoform 1 of Histone-arginine methyltransferase CARM1 OS=Homo sapiens OX=9606 GN=CARM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	420-UNIMOD:4	0.02	26.0	1	1	1
PRT	sp|Q14157-4|UBP2L_HUMAN	Isoform 4 of Ubiquitin-associated protein 2-like OS=Homo sapiens OX=9606 GN=UBAP2L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|P12429|ANXA3_HUMAN	Annexin A3 OS=Homo sapiens OX=9606 GN=ANXA3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	137-UNIMOD:188,138-UNIMOD:188	0.04	26.0	1	1	1
PRT	sp|Q9H2U2|IPYR2_HUMAN	Inorganic pyrophosphatase 2, mitochondrial OS=Homo sapiens OX=9606 GN=PPA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	157-UNIMOD:188,161-UNIMOD:4,171-UNIMOD:4,176-UNIMOD:188	0.07	26.0	1	1	1
PRT	sp|P21579|SYT1_HUMAN	Synaptotagmin-1 OS=Homo sapiens OX=9606 GN=SYT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|O60763|USO1_HUMAN	General vesicular transport factor p115 OS=Homo sapiens OX=9606 GN=USO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q99873-2|ANM1_HUMAN	Isoform 2 of Protein arginine N-methyltransferase 1 OS=Homo sapiens OX=9606 GN=PRMT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	209-UNIMOD:188,219-UNIMOD:188	0.05	26.0	3	1	0
PRT	sp|Q9BZZ5-1|API5_HUMAN	Isoform 1 of Apoptosis inhibitor 5 OS=Homo sapiens OX=9606 GN=API5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	395-UNIMOD:188,396-UNIMOD:188	0.06	26.0	2	2	2
PRT	sp|P19525-2|E2AK2_HUMAN	Isoform 2 of Interferon-induced, double-stranded RNA-activated protein kinase OS=Homo sapiens OX=9606 GN=EIF2AK2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	150-UNIMOD:188,154-UNIMOD:188	0.03	26.0	2	1	0
PRT	sp|Q6P996-3|PDXD1_HUMAN	Isoform 3 of Pyridoxal-dependent decarboxylase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PDXDC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|P62249|RS16_HUMAN	40S ribosomal protein S16 OS=Homo sapiens OX=9606 GN=RPS16 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	15-UNIMOD:267	0.08	26.0	2	1	0
PRT	sp|Q8NFC6|BD1L1_HUMAN	Biorientation of chromosomes in cell division protein 1-like 1 OS=Homo sapiens OX=9606 GN=BOD1L1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	1240-UNIMOD:267	0.00	26.0	2	1	0
PRT	sp|P06576|ATPB_HUMAN	ATP synthase subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null	212-UNIMOD:188	0.02	26.0	2	1	0
PRT	sp|Q15652-2|JHD2C_HUMAN	Isoform 2 of Probable JmjC domain-containing histone demethylation protein 2C OS=Homo sapiens OX=9606 GN=JMJD1C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|P48651-3|PTSS1_HUMAN	Isoform 3 of Phosphatidylserine synthase 1 OS=Homo sapiens OX=9606 GN=PTDSS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	133-UNIMOD:267	0.05	26.0	2	1	0
PRT	sp|Q5RI15|COX20_HUMAN	Cytochrome c oxidase assembly protein COX20, mitochondrial OS=Homo sapiens OX=9606 GN=COX20 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	29-UNIMOD:4,31-UNIMOD:267	0.13	26.0	2	1	0
PRT	sp|Q9UKI2|BORG2_HUMAN	Cdc42 effector protein 3 OS=Homo sapiens OX=9606 GN=CDC42EP3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	145-UNIMOD:4,152-UNIMOD:188,156-UNIMOD:188	0.06	26.0	1	1	1
PRT	sp|Q9Y2A7|NCKP1_HUMAN	Nck-associated protein 1 OS=Homo sapiens OX=9606 GN=NCKAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	552-UNIMOD:35,556-UNIMOD:4,564-UNIMOD:267	0.01	26.0	2	1	0
PRT	sp|Q86VP1-3|TAXB1_HUMAN	Isoform 3 of Tax1-binding protein 1 OS=Homo sapiens OX=9606 GN=TAX1BP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	112-UNIMOD:188,121-UNIMOD:188	0.03	26.0	1	1	1
PRT	sp|P00492|HPRT_HUMAN	Hypoxanthine-guanine phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=HPRT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	141-UNIMOD:188	0.06	26.0	2	1	0
PRT	sp|P52732|KIF11_HUMAN	Kinesin-like protein KIF11 OS=Homo sapiens OX=9606 GN=KIF11 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q01780-2|EXOSX_HUMAN	Isoform 2 of Exosome component 10 OS=Homo sapiens OX=9606 GN=EXOSC10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	73-UNIMOD:4,79-UNIMOD:267	0.02	26.0	2	1	0
PRT	sp|Q6PGP7|TTC37_HUMAN	Tetratricopeptide repeat protein 37 OS=Homo sapiens OX=9606 GN=TTC37 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|Q96B54|ZN428_HUMAN	Zinc finger protein 428 OS=Homo sapiens OX=9606 GN=ZNF428 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	111-UNIMOD:4	0.08	26.0	1	1	1
PRT	sp|P35232|PHB_HUMAN	Prohibitin OS=Homo sapiens OX=9606 GN=PHB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	255-UNIMOD:267	0.07	26.0	1	1	1
PRT	sp|Q9UDY2-5|ZO2_HUMAN	Isoform A3 of Tight junction protein ZO-2 OS=Homo sapiens OX=9606 GN=TJP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q6GMV2|SMYD5_HUMAN	SET and MYND domain-containing protein 5 OS=Homo sapiens OX=9606 GN=SMYD5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	207-UNIMOD:188	0.03	26.0	2	1	0
PRT	sp|P60174-4|TPIS_HUMAN	Isoform 4 of Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	106-UNIMOD:188	0.08	26.0	1	1	1
PRT	sp|P49368-2|TCPG_HUMAN	Isoform 2 of T-complex protein 1 subunit gamma OS=Homo sapiens OX=9606 GN=CCT3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	480-UNIMOD:267	0.02	26.0	2	1	0
PRT	sp|Q9NQW6|ANLN_HUMAN	Anillin OS=Homo sapiens OX=9606 GN=ANLN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	491-UNIMOD:188,500-UNIMOD:188	0.02	26.0	1	1	1
PRT	sp|Q9Y3C6|PPIL1_HUMAN	Peptidyl-prolyl cis-trans isomerase-like 1 OS=Homo sapiens OX=9606 GN=PPIL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	144-UNIMOD:35	0.11	26.0	2	1	0
PRT	sp|P16383-2|GCFC2_HUMAN	Isoform 2 of GC-rich sequence DNA-binding factor 2 OS=Homo sapiens OX=9606 GN=GCFC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	557-UNIMOD:4,563-UNIMOD:188	0.02	26.0	1	1	1
PRT	sp|P04406|G3P_HUMAN	Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	247-UNIMOD:4,248-UNIMOD:267	0.04	26.0	2	1	0
PRT	sp|Q9NR12-3|PDLI7_HUMAN	Isoform 3 of PDZ and LIM domain protein 7 OS=Homo sapiens OX=9606 GN=PDLIM7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	17-UNIMOD:267	0.08	26.0	2	1	0
PRT	sp|Q0VDF9|HSP7E_HUMAN	Heat shock 70 kDa protein 14 OS=Homo sapiens OX=9606 GN=HSPA14 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	82-UNIMOD:188,88-UNIMOD:188	0.07	26.0	2	2	2
PRT	sp|P28290-2|ITPI2_HUMAN	Isoform 2 of Protein ITPRID2 OS=Homo sapiens OX=9606 GN=ITPRID2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|Q9UPN3|MACF1_HUMAN	Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	5742-UNIMOD:4,5747-UNIMOD:188,5753-UNIMOD:188	0.00	26.0	1	1	1
PRT	sp|Q86XL3|ANKL2_HUMAN	Ankyrin repeat and LEM domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ANKLE2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	203-UNIMOD:4	0.03	26.0	1	1	1
PRT	sp|O00159|MYO1C_HUMAN	Unconventional myosin-Ic OS=Homo sapiens OX=9606 GN=MYO1C PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	null	802-UNIMOD:385,802-UNIMOD:4,813-UNIMOD:267	0.01	26.0	2	1	0
PRT	sp|Q16181|SEPT7_HUMAN	Septin-7 OS=Homo sapiens OX=9606 GN=SEPTIN7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	204-UNIMOD:4	0.03	26.0	1	1	0
PRT	sp|Q58FF6|H90B4_HUMAN	Putative heat shock protein HSP 90-beta 4 OS=Homo sapiens OX=9606 GN=HSP90AB4P PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|Q6P2E9|EDC4_HUMAN	Enhancer of mRNA-decapping protein 4 OS=Homo sapiens OX=9606 GN=EDC4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	null	838-UNIMOD:4	0.01	26.0	1	1	1
PRT	sp|P49750|YLPM1_HUMAN	YLP motif-containing protein 1 OS=Homo sapiens OX=9606 GN=YLPM1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	1652-UNIMOD:188,1661-UNIMOD:267	0.01	26.0	1	1	1
PRT	sp|P68871|HBB_HUMAN	Hemoglobin subunit beta OS=Homo sapiens OX=9606 GN=HBB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.07	26.0	1	1	1
PRT	sp|P61923|COPZ1_HUMAN	Coatomer subunit zeta-1 OS=Homo sapiens OX=9606 GN=COPZ1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	39-UNIMOD:188,42-UNIMOD:188	0.08	26.0	1	1	0
PRT	sp|Q9UHG3|PCYOX_HUMAN	Prenylcysteine oxidase 1 OS=Homo sapiens OX=9606 GN=PCYOX1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	392-UNIMOD:188,406-UNIMOD:188	0.03	26.0	1	1	0
PRT	sp|Q9H0E2|TOLIP_HUMAN	Toll-interacting protein OS=Homo sapiens OX=9606 GN=TOLLIP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.06	26.0	1	1	1
PRT	sp|Q04637-7|IF4G1_HUMAN	Isoform 7 of Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|P29590-4|PML_HUMAN	Isoform PML-6 of Protein PML OS=Homo sapiens OX=9606 GN=PML	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	411-UNIMOD:267,424-UNIMOD:267	0.04	25.0	2	1	0
PRT	sp|P08133-2|ANXA6_HUMAN	Isoform 2 of Annexin A6 OS=Homo sapiens OX=9606 GN=ANXA6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	82-UNIMOD:4,90-UNIMOD:267	0.02	25.0	1	1	1
PRT	sp|Q13884-2|SNTB1_HUMAN	Isoform 2 of Beta-1-syntrophin OS=Homo sapiens OX=9606 GN=SNTB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|P78344-2|IF4G2_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 4 gamma 2 OS=Homo sapiens OX=9606 GN=EIF4G2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	342-UNIMOD:35,347-UNIMOD:267	0.02	25.0	1	1	1
PRT	sp|P49321-2|NASP_HUMAN	Isoform 2 of Nuclear autoantigenic sperm protein OS=Homo sapiens OX=9606 GN=NASP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	297-UNIMOD:188,298-UNIMOD:188	0.03	25.0	2	1	0
PRT	sp|Q9UNF1-2|MAGD2_HUMAN	Isoform 2 of Melanoma-associated antigen D2 OS=Homo sapiens OX=9606 GN=MAGED2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q9HB71-3|CYBP_HUMAN	Isoform 3 of Calcyclin-binding protein OS=Homo sapiens OX=9606 GN=CACYBP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	135-UNIMOD:188,153-UNIMOD:188	0.11	25.0	1	1	1
PRT	sp|Q96IR7|HPDL_HUMAN	4-hydroxyphenylpyruvate dioxygenase-like protein OS=Homo sapiens OX=9606 GN=HPDL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	100-UNIMOD:4	0.04	25.0	1	1	1
PRT	sp|L0R819|ASURF_HUMAN	ASNSD1 upstream open reading frame protein OS=Homo sapiens OX=9606 GN=ASDURF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.14	25.0	1	1	1
PRT	sp|P12814-2|ACTN1_HUMAN	Isoform 2 of Alpha-actinin-1 OS=Homo sapiens OX=9606 GN=ACTN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	147-UNIMOD:188,738-UNIMOD:267	0.03	25.0	2	2	2
PRT	sp|Q2TB90-3|HKDC1_HUMAN	Isoform 3 of Hexokinase HKDC1 OS=Homo sapiens OX=9606 GN=HKDC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	539-UNIMOD:267	0.02	25.0	2	1	0
PRT	sp|Q9NV06|DCA13_HUMAN	DDB1- and CUL4-associated factor 13 OS=Homo sapiens OX=9606 GN=DCAF13 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	215-UNIMOD:4,219-UNIMOD:267	0.04	25.0	1	1	1
PRT	sp|P51149|RAB7A_HUMAN	Ras-related protein Rab-7a OS=Homo sapiens OX=9606 GN=RAB7A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	79-UNIMOD:267	0.05	25.0	1	1	1
PRT	sp|Q14839|CHD4_HUMAN	Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	1643-UNIMOD:188,1647-UNIMOD:188	0.01	25.0	2	1	0
PRT	sp|Q86XP3|DDX42_HUMAN	ATP-dependent RNA helicase DDX42 OS=Homo sapiens OX=9606 GN=DDX42 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q99590|SCAFB_HUMAN	Protein SCAF11 OS=Homo sapiens OX=9606 GN=SCAF11 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|O43432-4|IF4G3_HUMAN	Isoform 4 of Eukaryotic translation initiation factor 4 gamma 3 OS=Homo sapiens OX=9606 GN=EIF4G3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	406-UNIMOD:267	0.01	25.0	1	1	1
PRT	sp|P55884|EIF3B_HUMAN	Eukaryotic translation initiation factor 3 subunit B OS=Homo sapiens OX=9606 GN=EIF3B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	228-UNIMOD:188,230-UNIMOD:188	0.02	25.0	3	1	0
PRT	sp|Q8N5C6|SRBD1_HUMAN	S1 RNA-binding domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SRBD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	247-UNIMOD:267	0.01	25.0	2	1	0
PRT	sp|Q9NZJ9|NUDT4_HUMAN	Diphosphoinositol polyphosphate phosphohydrolase 2 OS=Homo sapiens OX=9606 GN=NUDT4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	89-UNIMOD:267	0.06	25.0	2	1	0
PRT	sp|Q9Y3D8|KAD6_HUMAN	Adenylate kinase isoenzyme 6 OS=Homo sapiens OX=9606 GN=AK6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.09	25.0	1	1	1
PRT	sp|P12956|XRCC6_HUMAN	X-ray repair cross-complementing protein 6 OS=Homo sapiens OX=9606 GN=XRCC6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|O43516-2|WIPF1_HUMAN	Isoform 2 of WAS/WASL-interacting protein family member 1 OS=Homo sapiens OX=9606 GN=WIPF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q92990-2|GLMN_HUMAN	Isoform 2 of Glomulin OS=Homo sapiens OX=9606 GN=GLMN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	71-UNIMOD:267	0.03	25.0	1	1	1
PRT	sp|Q99836-3|MYD88_HUMAN	Isoform 3 of Myeloid differentiation primary response protein MyD88 OS=Homo sapiens OX=9606 GN=MYD88	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.12	25.0	1	1	1
PRT	sp|Q8WUA2|PPIL4_HUMAN	Peptidyl-prolyl cis-trans isomerase-like 4 OS=Homo sapiens OX=9606 GN=PPIL4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	212-UNIMOD:188,215-UNIMOD:188	0.03	25.0	2	1	0
PRT	sp|Q7Z2T5-2|TRM1L_HUMAN	Isoform 2 of TRMT1-like protein OS=Homo sapiens OX=9606 GN=TRMT1L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|Q8ND24-2|RN214_HUMAN	Isoform 2 of RING finger protein 214 OS=Homo sapiens OX=9606 GN=RNF214	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	38-UNIMOD:188,43-UNIMOD:188	0.03	25.0	1	1	1
PRT	sp|Q68D91-2|MBLC2_HUMAN	Isoform 2 of Metallo-beta-lactamase domain-containing protein 2 OS=Homo sapiens OX=9606 GN=MBLAC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.07	25.0	1	1	1
PRT	sp|P52701-4|MSH6_HUMAN	Isoform 4 of DNA mismatch repair protein Msh6 OS=Homo sapiens OX=9606 GN=MSH6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	1050-UNIMOD:188	0.01	25.0	2	1	0
PRT	sp|Q7Z6E9-4|RBBP6_HUMAN	Isoform 4 of E3 ubiquitin-protein ligase RBBP6 OS=Homo sapiens OX=9606 GN=RBBP6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|O14980|XPO1_HUMAN	Exportin-1 OS=Homo sapiens OX=9606 GN=XPO1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	119-UNIMOD:4,122-UNIMOD:188,124-UNIMOD:188	0.01	25.0	2	1	0
PRT	sp|Q6KC79-3|NIPBL_HUMAN	Isoform 3 of Nipped-B-like protein OS=Homo sapiens OX=9606 GN=NIPBL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	661-UNIMOD:4	0.01	25.0	1	1	1
PRT	sp|O00165-5|HAX1_HUMAN	Isoform 5 of HCLS1-associated protein X-1 OS=Homo sapiens OX=9606 GN=HAX1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	187-UNIMOD:267,194-UNIMOD:267	0.07	25.0	1	1	1
PRT	sp|Q6IQ49-3|SDE2_HUMAN	Isoform 3 of Replication stress response regulator SDE2 OS=Homo sapiens OX=9606 GN=SDE2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|Q8WVB6|CTF18_HUMAN	Chromosome transmission fidelity protein 18 homolog OS=Homo sapiens OX=9606 GN=CHTF18 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	373-UNIMOD:4,380-UNIMOD:188	0.01	25.0	1	1	1
PRT	sp|O14929-2|HAT1_HUMAN	Isoform B of Histone acetyltransferase type B catalytic subunit OS=Homo sapiens OX=9606 GN=HAT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	16-UNIMOD:4	0.06	25.0	1	1	1
PRT	sp|Q9P258|RCC2_HUMAN	Protein RCC2 OS=Homo sapiens OX=9606 GN=RCC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	361-UNIMOD:267	0.02	25.0	1	1	1
PRT	sp|Q8TAE8|G45IP_HUMAN	Growth arrest and DNA damage-inducible proteins-interacting protein 1 OS=Homo sapiens OX=9606 GN=GADD45GIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	49-UNIMOD:267	0.05	25.0	1	1	1
PRT	sp|P68363|TBA1B_HUMAN	Tubulin alpha-1B chain OS=Homo sapiens OX=9606 GN=TUBA1B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	null	85-UNIMOD:28,96-UNIMOD:188	0.03	25.0	1	1	1
PRT	sp|O95347|SMC2_HUMAN	Structural maintenance of chromosomes protein 2 OS=Homo sapiens OX=9606 GN=SMC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	68-UNIMOD:188,76-UNIMOD:188	0.02	25.0	1	1	1
PRT	sp|P02538|K2C6A_HUMAN	Keratin, type II cytoskeletal 6A OS=Homo sapiens OX=9606 GN=KRT6A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	null	279-UNIMOD:35,281-UNIMOD:188,287-UNIMOD:188	0.03	25.0	1	1	1
PRT	sp|P11171|41_HUMAN	Protein 4.1 OS=Homo sapiens OX=9606 GN=EPB41 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	68-UNIMOD:188	0.02	25.0	2	1	0
PRT	sp|P51572|BAP31_HUMAN	B-cell receptor-associated protein 31 OS=Homo sapiens OX=9606 GN=BCAP31 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	25.0	null	139-UNIMOD:28,148-UNIMOD:188,149-UNIMOD:188	0.05	25.0	2	1	0
PRT	sp|P43246|MSH2_HUMAN	DNA mismatch repair protein Msh2 OS=Homo sapiens OX=9606 GN=MSH2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	null	662-UNIMOD:28	0.02	25.0	1	1	1
PRT	sp|Q9Y3I0|RTCB_HUMAN	RNA-splicing ligase RtcB homolog OS=Homo sapiens OX=9606 GN=RTCB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	null	68-UNIMOD:28,81-UNIMOD:267	0.03	25.0	2	1	0
PRT	sp|P43686|PRS6B_HUMAN	26S proteasome regulatory subunit 6B OS=Homo sapiens OX=9606 GN=PSMC4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	204-UNIMOD:35,210-UNIMOD:4	0.03	25.0	2	1	0
PRT	sp|Q7Z4Q2|HEAT3_HUMAN	HEAT repeat-containing protein 3 OS=Homo sapiens OX=9606 GN=HEATR3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q9Y3A5|SBDS_HUMAN	Ribosome maturation protein SBDS OS=Homo sapiens OX=9606 GN=SBDS PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	119-UNIMOD:4	0.07	25.0	2	1	0
PRT	sp|Q9BUL9|RPP25_HUMAN	Ribonuclease P protein subunit p25 OS=Homo sapiens OX=9606 GN=RPP25 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.06	25.0	1	1	1
PRT	sp|Q96GQ7|DDX27_HUMAN	Probable ATP-dependent RNA helicase DDX27 OS=Homo sapiens OX=9606 GN=DDX27 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	120-UNIMOD:188,123-UNIMOD:188	0.02	24.0	1	1	1
PRT	sp|Q9P0V9-2|SEP10_HUMAN	Isoform 2 of Septin-10 OS=Homo sapiens OX=9606 GN=SEPTIN10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	215-UNIMOD:188,220-UNIMOD:188	0.02	24.0	1	1	1
PRT	sp|O75347|TBCA_HUMAN	Tubulin-specific chaperone A OS=Homo sapiens OX=9606 GN=TBCA PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	51-UNIMOD:188,52-UNIMOD:188	0.11	24.0	2	1	0
PRT	sp|Q03252|LMNB2_HUMAN	Lamin-B2 OS=Homo sapiens OX=9606 GN=LMNB2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P11171-7|41_HUMAN	Isoform 7 of Protein 4.1 OS=Homo sapiens OX=9606 GN=EPB41	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	0
PRT	sp|Q9H307|PININ_HUMAN	Pinin OS=Homo sapiens OX=9606 GN=PNN PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	137-UNIMOD:188,139-UNIMOD:188	0.02	24.0	2	1	0
PRT	sp|Q9Y2W2|WBP11_HUMAN	WW domain-binding protein 11 OS=Homo sapiens OX=9606 GN=WBP11 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	57-UNIMOD:35	0.03	24.0	2	1	0
PRT	sp|P55145|MANF_HUMAN	Mesencephalic astrocyte-derived neurotrophic factor OS=Homo sapiens OX=9606 GN=MANF PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	117-UNIMOD:4	0.07	24.0	1	1	1
PRT	sp|Q9Y5X2|SNX8_HUMAN	Sorting nexin-8 OS=Homo sapiens OX=9606 GN=SNX8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	85-UNIMOD:188,86-UNIMOD:188	0.03	24.0	1	1	1
PRT	sp|Q9NQX3|GEPH_HUMAN	Gephyrin OS=Homo sapiens OX=9606 GN=GPHN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P26373-2|RL13_HUMAN	Isoform 2 of 60S ribosomal protein L13 OS=Homo sapiens OX=9606 GN=RPL13	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.07	24.0	1	1	1
PRT	sp|O00425|IF2B3_HUMAN	Insulin-like growth factor 2 mRNA-binding protein 3 OS=Homo sapiens OX=9606 GN=IGF2BP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|P41214|EIF2D_HUMAN	Eukaryotic translation initiation factor 2D OS=Homo sapiens OX=9606 GN=EIF2D PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q15714-2|T22D1_HUMAN	Isoform 2 of TSC22 domain family protein 1 OS=Homo sapiens OX=9606 GN=TSC22D1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	78-UNIMOD:188,82-UNIMOD:188	0.08	24.0	1	1	1
PRT	sp|O15145|ARPC3_HUMAN	Actin-related protein 2/3 complex subunit 3 OS=Homo sapiens OX=9606 GN=ARPC3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.10	24.0	1	1	1
PRT	sp|P36871-3|PGM1_HUMAN	Isoform 3 of Phosphoglucomutase-1 OS=Homo sapiens OX=9606 GN=PGM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	173-UNIMOD:188	0.03	24.0	1	1	1
PRT	sp|P26045|PTN3_HUMAN	Tyrosine-protein phosphatase non-receptor type 3 OS=Homo sapiens OX=9606 GN=PTPN3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	123-UNIMOD:267	0.02	24.0	1	1	1
PRT	sp|Q15738|NSDHL_HUMAN	Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Homo sapiens OX=9606 GN=NSDHL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	86-UNIMOD:4,88-UNIMOD:267	0.03	24.0	2	1	0
PRT	sp|P11498-2|PYC_HUMAN	Isoform 2 of Pyruvate carboxylase, mitochondrial OS=Homo sapiens OX=9606 GN=PC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P38606-2|VATA_HUMAN	Isoform 2 of V-type proton ATPase catalytic subunit A OS=Homo sapiens OX=9606 GN=ATP6V1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	179-UNIMOD:267	0.02	24.0	1	1	1
PRT	sp|Q96RR1|PEO1_HUMAN	Twinkle protein, mitochondrial OS=Homo sapiens OX=9606 GN=TWNK PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	667-UNIMOD:4	0.04	24.0	1	1	1
PRT	sp|P46459-2|NSF_HUMAN	Isoform 2 of Vesicle-fusing ATPase OS=Homo sapiens OX=9606 GN=NSF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	170-UNIMOD:4,172-UNIMOD:188	0.02	24.0	2	1	0
PRT	sp|Q9UBB6-2|NCDN_HUMAN	Isoform 2 of Neurochondrin OS=Homo sapiens OX=9606 GN=NCDN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	70-UNIMOD:267	0.02	24.0	1	1	1
PRT	sp|P33121-2|ACSL1_HUMAN	Isoform 2 of Long-chain-fatty-acid--CoA ligase 1 OS=Homo sapiens OX=9606 GN=ACSL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	368-UNIMOD:267,349-UNIMOD:267	0.03	24.0	4	2	0
PRT	sp|Q9NV92|NFIP2_HUMAN	NEDD4 family-interacting protein 2 OS=Homo sapiens OX=9606 GN=NDFIP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	213-UNIMOD:4,216-UNIMOD:267,226-UNIMOD:267	0.06	24.0	2	1	0
PRT	sp|O00410|IPO5_HUMAN	Importin-5 OS=Homo sapiens OX=9606 GN=IPO5 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	50-UNIMOD:267	0.01	24.0	1	1	1
PRT	sp|Q07955-2|SRSF1_HUMAN	Isoform ASF-2 of Serine/arginine-rich splicing factor 1 OS=Homo sapiens OX=9606 GN=SRSF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	28-UNIMOD:267	0.04	24.0	3	1	0
PRT	sp|P22314-2|UBA1_HUMAN	Isoform 2 of Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q9NXG2|THUM1_HUMAN	THUMP domain-containing protein 1 OS=Homo sapiens OX=9606 GN=THUMPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.05	24.0	1	1	1
PRT	sp|P14174|MIF_HUMAN	Macrophage migration inhibitory factor OS=Homo sapiens OX=9606 GN=MIF PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	81-UNIMOD:4,87-UNIMOD:267	0.09	24.0	2	1	0
PRT	sp|Q96IJ6|GMPPA_HUMAN	Mannose-1-phosphate guanyltransferase alpha OS=Homo sapiens OX=9606 GN=GMPPA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	389-UNIMOD:4,390-UNIMOD:267	0.03	24.0	1	1	1
PRT	sp|P0DMV8-2|HS71A_HUMAN	Isoform 2 of Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	302-UNIMOD:267	0.02	24.0	2	1	0
PRT	sp|Q5T5C0-3|STXB5_HUMAN	Isoform 3 of Syntaxin-binding protein 5 OS=Homo sapiens OX=9606 GN=STXBP5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q15742-2|NAB2_HUMAN	Isoform 2 of NGFI-A-binding protein 2 OS=Homo sapiens OX=9606 GN=NAB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	183-UNIMOD:267	0.05	24.0	2	1	0
PRT	sp|Q96Q89-4|KI20B_HUMAN	Isoform 4 of Kinesin-like protein KIF20B OS=Homo sapiens OX=9606 GN=KIF20B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	210-UNIMOD:188,216-UNIMOD:188	0.01	24.0	2	1	0
PRT	sp|P50895|BCAM_HUMAN	Basal cell adhesion molecule OS=Homo sapiens OX=9606 GN=BCAM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	44-UNIMOD:35,45-UNIMOD:267	0.02	24.0	2	1	0
PRT	sp|P62241|RS8_HUMAN	40S ribosomal protein S8 OS=Homo sapiens OX=9606 GN=RPS8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	139-UNIMOD:188,140-UNIMOD:188	0.06	24.0	2	1	0
PRT	sp|Q9BZJ0-2|CRNL1_HUMAN	Isoform 2 of Crooked neck-like protein 1 OS=Homo sapiens OX=9606 GN=CRNKL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	350-UNIMOD:267,355-UNIMOD:267	0.03	24.0	2	1	0
PRT	sp|Q9BPW8|NIPS1_HUMAN	Protein NipSnap homolog 1 OS=Homo sapiens OX=9606 GN=NIPSNAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	180-UNIMOD:35,188-UNIMOD:267	0.04	24.0	2	1	0
PRT	sp|Q92841|DDX17_HUMAN	Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens OX=9606 GN=DDX17 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	330-UNIMOD:35,340-UNIMOD:267	0.02	24.0	1	1	1
PRT	sp|Q9ULC4-2|MCTS1_HUMAN	Isoform 2 of Malignant T-cell-amplified sequence 1 OS=Homo sapiens OX=9606 GN=MCTS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	138-UNIMOD:35,145-UNIMOD:188,148-UNIMOD:188	0.07	24.0	2	1	0
PRT	sp|Q9UHV9|PFD2_HUMAN	Prefoldin subunit 2 OS=Homo sapiens OX=9606 GN=PFDN2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	73-UNIMOD:35,81-UNIMOD:267	0.06	24.0	2	1	0
PRT	sp|P18440|ARY1_HUMAN	Arylamine N-acetyltransferase 1 OS=Homo sapiens OX=9606 GN=NAT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	277-UNIMOD:267	0.03	24.0	1	1	1
PRT	sp|Q99797|MIPEP_HUMAN	Mitochondrial intermediate peptidase OS=Homo sapiens OX=9606 GN=MIPEP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P09525-2|ANXA4_HUMAN	Isoform 2 of Annexin A4 OS=Homo sapiens OX=9606 GN=ANXA4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	102-UNIMOD:188,103-UNIMOD:188	0.06	24.0	2	1	0
PRT	sp|P30533|AMRP_HUMAN	Alpha-2-macroglobulin receptor-associated protein OS=Homo sapiens OX=9606 GN=LRPAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.06	24.0	1	1	1
PRT	sp|O00571-2|DDX3X_HUMAN	Isoform 2 of ATP-dependent RNA helicase DDX3X OS=Homo sapiens OX=9606 GN=DDX3X	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	424-UNIMOD:188	0.02	24.0	2	1	0
PRT	sp|O43823|AKAP8_HUMAN	A-kinase anchor protein 8 OS=Homo sapiens OX=9606 GN=AKAP8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	351-UNIMOD:4	0.03	24.0	1	1	1
PRT	sp|Q9NTI5|PDS5B_HUMAN	Sister chromatid cohesion protein PDS5 homolog B OS=Homo sapiens OX=9606 GN=PDS5B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q13618-3|CUL3_HUMAN	Isoform 3 of Cullin-3 OS=Homo sapiens OX=9606 GN=CUL3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	386-UNIMOD:188,391-UNIMOD:188	0.02	24.0	1	1	0
PRT	sp|Q9NUU7|DD19A_HUMAN	ATP-dependent RNA helicase DDX19A OS=Homo sapiens OX=9606 GN=DDX19A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	154-UNIMOD:267	0.03	24.0	2	1	0
PRT	sp|Q96DV4-2|RM38_HUMAN	Isoform 2 of 39S ribosomal protein L38, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL38	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	68-UNIMOD:4	0.09	24.0	1	1	1
PRT	sp|P00568|KAD1_HUMAN	Adenylate kinase isoenzyme 1 OS=Homo sapiens OX=9606 GN=AK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.06	24.0	1	1	1
PRT	sp|Q9H3M7-2|TXNIP_HUMAN	Isoform 2 of Thioredoxin-interacting protein OS=Homo sapiens OX=9606 GN=TXNIP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|P62304|RUXE_HUMAN	Small nuclear ribonucleoprotein E OS=Homo sapiens OX=9606 GN=SNRPE PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	14-UNIMOD:35	0.13	24.0	1	1	1
PRT	sp|O00189|AP4M1_HUMAN	AP-4 complex subunit mu-1 OS=Homo sapiens OX=9606 GN=AP4M1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	297-UNIMOD:267	0.03	24.0	1	1	1
PRT	sp|Q9NVI1-2|FANCI_HUMAN	Isoform 2 of Fanconi anemia group I protein OS=Homo sapiens OX=9606 GN=FANCI	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	837-UNIMOD:188,838-UNIMOD:188	0.01	24.0	2	1	0
PRT	sp|O94966-2|UBP19_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 19 OS=Homo sapiens OX=9606 GN=USP19	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	75-UNIMOD:267	0.05	24.0	1	1	1
PRT	sp|P61923-5|COPZ1_HUMAN	Isoform 5 of Coatomer subunit zeta-1 OS=Homo sapiens OX=9606 GN=COPZ1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.09	24.0	1	1	0
PRT	sp|P46060|RAGP1_HUMAN	Ran GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RANGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	82-UNIMOD:385,82-UNIMOD:4,91-UNIMOD:267	0.02	24.0	1	1	1
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	24.0	null	49-UNIMOD:267,60-UNIMOD:267	0.02	24.0	3	1	0
PRT	sp|Q13618|CUL3_HUMAN	Cullin-3 OS=Homo sapiens OX=9606 GN=CUL3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.02	24.0	1	1	0
PRT	sp|Q6ZNW5|GDPP1_HUMAN	GDP-D-glucose phosphorylase 1 OS=Homo sapiens OX=9606 GN=GDPGP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|P31949|S10AB_HUMAN	Protein S100-A11 OS=Homo sapiens OX=9606 GN=S100A11 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	13-UNIMOD:4,23-UNIMOD:188	0.11	24.0	1	1	1
PRT	sp|Q9NQW7|XPP1_HUMAN	Xaa-Pro aminopeptidase 1 OS=Homo sapiens OX=9606 GN=XPNPEP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	603-UNIMOD:28,605-UNIMOD:267,614-UNIMOD:267	0.02	24.0	1	1	1
PRT	sp|Q96A08|H2B1A_HUMAN	Histone H2B type 1-A OS=Homo sapiens OX=9606 GN=H2BC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	110-UNIMOD:188	0.08	24.0	6	1	0
PRT	sp|P0C0S8|H2A1_HUMAN	Histone H2A type 1 OS=Homo sapiens OX=9606 GN=H2AC11 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.08	23.0	1	1	1
PRT	sp|Q5UIP0-2|RIF1_HUMAN	Isoform 2 of Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	1560-UNIMOD:188,1565-UNIMOD:267	0.01	23.0	1	1	1
PRT	sp|Q04917|1433F_HUMAN	14-3-3 protein eta OS=Homo sapiens OX=9606 GN=YWHAH PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	42-UNIMOD:267,50-UNIMOD:188	0.09	23.0	1	1	1
PRT	sp|Q14683|SMC1A_HUMAN	Structural maintenance of chromosomes protein 1A OS=Homo sapiens OX=9606 GN=SMC1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|A0MZ66-5|SHOT1_HUMAN	Isoform 5 of Shootin-1 OS=Homo sapiens OX=9606 GN=SHTN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|P28288-2|ABCD3_HUMAN	Isoform 2 of ATP-binding cassette sub-family D member 3 OS=Homo sapiens OX=9606 GN=ABCD3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q9UNN5-2|FAF1_HUMAN	Isoform Short of FAS-associated factor 1 OS=Homo sapiens OX=9606 GN=FAF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	479-UNIMOD:188,485-UNIMOD:188	0.03	23.0	1	1	1
PRT	sp|Q9Y6M1-5|IF2B2_HUMAN	Isoform 5 of Insulin-like growth factor 2 mRNA-binding protein 2 OS=Homo sapiens OX=9606 GN=IGF2BP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	207-UNIMOD:188,215-UNIMOD:188	0.03	23.0	1	1	1
PRT	sp|Q9UNF0-2|PACN2_HUMAN	Isoform 2 of Protein kinase C and casein kinase substrate in neurons protein 2 OS=Homo sapiens OX=9606 GN=PACSIN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	177-UNIMOD:188,188-UNIMOD:188	0.04	23.0	1	1	0
PRT	sp|P49915-2|GUAA_HUMAN	Isoform 2 of GMP synthase [glutamine-hydrolyzing] OS=Homo sapiens OX=9606 GN=GMPS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q9BQA1|MEP50_HUMAN	Methylosome protein 50 OS=Homo sapiens OX=9606 GN=WDR77 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	15-UNIMOD:267	0.04	23.0	1	1	1
PRT	sp|Q969F2|NKD2_HUMAN	Protein naked cuticle homolog 2 OS=Homo sapiens OX=9606 GN=NKD2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|P49406|RM19_HUMAN	39S ribosomal protein L19, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL19 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	83-UNIMOD:267	0.03	23.0	2	1	0
PRT	sp|O75153|CLU_HUMAN	Clustered mitochondria protein homolog OS=Homo sapiens OX=9606 GN=CLUH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	727-UNIMOD:267	0.01	23.0	1	1	1
PRT	sp|Q04912-5|RON_HUMAN	Isoform RON-3 of Macrophage-stimulating protein receptor OS=Homo sapiens OX=9606 GN=MST1R	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|O75164|KDM4A_HUMAN	Lysine-specific demethylase 4A OS=Homo sapiens OX=9606 GN=KDM4A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	234-UNIMOD:4	0.02	23.0	1	1	1
PRT	sp|Q8IVS2|FABD_HUMAN	Malonyl-CoA-acyl carrier protein transacylase, mitochondrial OS=Homo sapiens OX=9606 GN=MCAT PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	352-UNIMOD:267	0.03	23.0	2	1	0
PRT	sp|P35611-5|ADDA_HUMAN	Isoform 5 of Alpha-adducin OS=Homo sapiens OX=9606 GN=ADD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|P08243-2|ASNS_HUMAN	Isoform 2 of Asparagine synthetase [glutamine-hydrolyzing] OS=Homo sapiens OX=9606 GN=ASNS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	42-UNIMOD:267	0.03	23.0	1	1	1
PRT	sp|Q16186|ADRM1_HUMAN	Proteasomal ubiquitin receptor ADRM1 OS=Homo sapiens OX=9606 GN=ADRM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q6IBS0|TWF2_HUMAN	Twinfilin-2 OS=Homo sapiens OX=9606 GN=TWF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	340-UNIMOD:267	0.04	23.0	1	1	1
PRT	sp|Q9Y6E2|BZW2_HUMAN	Basic leucine zipper and W2 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=BZW2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	224-UNIMOD:267	0.02	23.0	1	1	1
PRT	sp|P52292|IMA1_HUMAN	Importin subunit alpha-1 OS=Homo sapiens OX=9606 GN=KPNA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	315-UNIMOD:267	0.03	23.0	1	1	1
PRT	sp|Q9NZJ9-3|NUDT4_HUMAN	Isoform 3 of Diphosphoinositol polyphosphate phosphohydrolase 2 OS=Homo sapiens OX=9606 GN=NUDT4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	38-UNIMOD:267	0.09	23.0	1	1	1
PRT	sp|P78318|IGBP1_HUMAN	Immunoglobulin-binding protein 1 OS=Homo sapiens OX=9606 GN=IGBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	20-UNIMOD:267	0.03	23.0	2	1	0
PRT	sp|Q96BM9|ARL8A_HUMAN	ADP-ribosylation factor-like protein 8A OS=Homo sapiens OX=9606 GN=ARL8A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.05	23.0	1	1	1
PRT	sp|Q9NP79-2|VTA1_HUMAN	Isoform 2 of Vacuolar protein sorting-associated protein VTA1 homolog OS=Homo sapiens OX=9606 GN=VTA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	39-UNIMOD:35,48-UNIMOD:267	0.05	23.0	1	1	1
PRT	sp|Q14241|ELOA1_HUMAN	Elongin-A OS=Homo sapiens OX=9606 GN=ELOA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q9Y224|RTRAF_HUMAN	RNA transcription, translation and transport factor protein OS=Homo sapiens OX=9606 GN=RTRAF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	36-UNIMOD:188	0.05	23.0	1	1	1
PRT	sp|O94906-2|PRP6_HUMAN	Isoform 2 of Pre-mRNA-processing factor 6 OS=Homo sapiens OX=9606 GN=PRPF6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|O14737|PDCD5_HUMAN	Programmed cell death protein 5 OS=Homo sapiens OX=9606 GN=PDCD5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	53-UNIMOD:267	0.11	23.0	1	1	1
PRT	sp|Q13363-2|CTBP1_HUMAN	Isoform 2 of C-terminal-binding protein 1 OS=Homo sapiens OX=9606 GN=CTBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	25-UNIMOD:267	0.02	23.0	1	1	0
PRT	sp|Q14126|DSG2_HUMAN	Desmoglein-2 OS=Homo sapiens OX=9606 GN=DSG2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|P07948-2|LYN_HUMAN	Isoform 2 of Tyrosine-protein kinase Lyn OS=Homo sapiens OX=9606 GN=LYN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q8NI27-2|THOC2_HUMAN	Isoform 2 of THO complex subunit 2 OS=Homo sapiens OX=9606 GN=THOC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q05519-2|SRS11_HUMAN	Isoform 2 of Serine/arginine-rich splicing factor 11 OS=Homo sapiens OX=9606 GN=SRSF11	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q00688|FKBP3_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP3 OS=Homo sapiens OX=9606 GN=FKBP3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	110-UNIMOD:188,113-UNIMOD:188	0.07	23.0	1	1	1
PRT	sp|P53004|BIEA_HUMAN	Biliverdin reductase A OS=Homo sapiens OX=9606 GN=BLVRA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q9BW85|YJU2_HUMAN	Splicing factor YJU2 OS=Homo sapiens OX=9606 GN=YJU2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.05	23.0	1	1	1
PRT	sp|P07305|H10_HUMAN	Histone H1.0 OS=Homo sapiens OX=9606 GN=H1-0 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	12-UNIMOD:188,14-UNIMOD:188	0.07	23.0	1	1	1
PRT	sp|O00154-2|BACH_HUMAN	Isoform 2 of Cytosolic acyl coenzyme A thioester hydrolase OS=Homo sapiens OX=9606 GN=ACOT7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.05	23.0	1	1	1
PRT	sp|Q13131|AAPK1_HUMAN	5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Homo sapiens OX=9606 GN=PRKAA1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q5TBB1-2|RNH2B_HUMAN	Isoform 2 of Ribonuclease H2 subunit B OS=Homo sapiens OX=9606 GN=RNASEH2B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.09	23.0	1	1	1
PRT	sp|Q9BVJ6-2|UT14A_HUMAN	Isoform 2 of U3 small nucleolar RNA-associated protein 14 homolog A OS=Homo sapiens OX=9606 GN=UTP14A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	351-UNIMOD:188,354-UNIMOD:4,358-UNIMOD:188	0.03	23.0	1	1	1
PRT	sp|P23526-2|SAHH_HUMAN	Isoform 2 of Adenosylhomocysteinase OS=Homo sapiens OX=9606 GN=AHCY	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	123-UNIMOD:267	0.02	23.0	1	1	1
PRT	sp|Q14008|CKAP5_HUMAN	Cytoskeleton-associated protein 5 OS=Homo sapiens OX=9606 GN=CKAP5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.01	23.0	1	1	0
PRT	sp|Q9ULC4|MCTS1_HUMAN	Malignant T-cell-amplified sequence 1 OS=Homo sapiens OX=9606 GN=MCTS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	null	73-UNIMOD:28,74-UNIMOD:267,83-UNIMOD:267	0.07	23.0	1	1	1
PRT	sp|Q13363|CTBP1_HUMAN	C-terminal-binding protein 1 OS=Homo sapiens OX=9606 GN=CTBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	1	1	0
PRT	sp|P31946|1433B_HUMAN	14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	null	43-UNIMOD:267	0.06	23.0	1	1	1
PRT	sp|Q15542|TAF5_HUMAN	Transcription initiation factor TFIID subunit 5 OS=Homo sapiens OX=9606 GN=TAF5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	1	1	0
PRT	sp|Q15102|PA1B3_HUMAN	Platelet-activating factor acetylhydrolase IB subunit gamma OS=Homo sapiens OX=9606 GN=PAFAH1B3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	141-UNIMOD:267	0.04	23.0	1	1	1
PRT	sp|Q14166|TTL12_HUMAN	Tubulin--tyrosine ligase-like protein 12 OS=Homo sapiens OX=9606 GN=TTLL12 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	null	133-UNIMOD:28,144-UNIMOD:267	0.02	23.0	1	1	1
PRT	sp|P30040|ERP29_HUMAN	Endoplasmic reticulum resident protein 29 OS=Homo sapiens OX=9606 GN=ERP29 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	192-UNIMOD:188,196-UNIMOD:188	0.06	23.0	1	1	1
PRT	sp|P20020|AT2B1_HUMAN	Plasma membrane calcium-transporting ATPase 1 OS=Homo sapiens OX=9606 GN=ATP2B1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	564-UNIMOD:267,574-UNIMOD:188	0.01	23.0	1	1	1
PRT	sp|Q9UPQ9|TNR6B_HUMAN	Trinucleotide repeat-containing gene 6B protein OS=Homo sapiens OX=9606 GN=TNRC6B PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	null	579-UNIMOD:188	0.01	23.0	1	1	1
PRT	sp|Q9H4G0|E41L1_HUMAN	Band 4.1-like protein 1 OS=Homo sapiens OX=9606 GN=EPB41L1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	null	405-UNIMOD:28,412-UNIMOD:267,419-UNIMOD:267	0.02	23.0	1	1	1
PRT	sp|Q7L5D6|GET4_HUMAN	Golgi to ER traffic protein 4 homolog OS=Homo sapiens OX=9606 GN=GET4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	289-UNIMOD:188	0.04	23.0	1	1	1
PRT	sp|Q07020|RL18_HUMAN	60S ribosomal protein L18 OS=Homo sapiens OX=9606 GN=RPL18 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.07	23.0	1	1	0
PRT	sp|O15160|RPAC1_HUMAN	DNA-directed RNA polymerases I and III subunit RPAC1 OS=Homo sapiens OX=9606 GN=POLR1C PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	1-UNIMOD:1	0.04	23.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	VEKEEAGGGISEEEAAQYDR	1	sp|Q9UBE0-2|SAE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0		ms_run[2]:scan=4073	28.506	2	2165.9713	2165.9713	M	Q	2	22
PSM	VAPAEPQEAPDSTAAGGSASKR	2	sp|Q3LXA3-2|TKFC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0		ms_run[2]:scan=1905	15.173	2	2096.0134	2096.0134	R	M	352	374
PSM	VVQVSAGDSHTAALTDDGR	3	sp|P18754|RCC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	19-UNIMOD:267	ms_run[2]:scan=3891	27.412	2	1907.9213	1907.9213	K	V	121	140
PSM	AATGEEVSAEDLGGADLHCR	4	sp|Q9HCC0|MCCB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	19-UNIMOD:4	ms_run[2]:scan=5402	36.546	2	2056.912	2056.9120	K	K	249	269
PSM	SADESGQALLAAGHYASDEVR	5	sp|Q13813-2|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=7457	49.506	2	2145.9927	2145.9927	K	E	419	440
PSM	SCSGVEFSTSGHAYTDTGK	6	sp|Q9Y277|VDAC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	2-UNIMOD:4,19-UNIMOD:188	ms_run[2]:scan=4210	29.345	2	1995.8576	1995.8576	K	A	35	54
PSM	VDKGVVPLAGTDGETTTQGLDGLSER	7	sp|P09972|ALDOC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=7576	50.274	3	2614.3086	2614.3086	K	C	109	135
PSM	VVQVSAGDSHTAALTDDGR	8	sp|P18754|RCC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=3892	27.418	2	1897.913	1897.9130	K	V	121	140
PSM	LASEKEVVECQSTSTVGGQSVK	9	sp|Q96T23-3|RSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	10-UNIMOD:4	ms_run[2]:scan=3933	27.671	2	2322.1373	2322.1373	K	K	389	411
PSM	LCASGAGATPDTAIEEIKEK	10	sp|P53384-2|NUBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	2-UNIMOD:4,18-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=6077	40.605	2	2072.0498	2072.0498	R	M	30	50
PSM	VSPGLPSPNLENGAPAVGPVQPR	11	sp|Q9UGP4|LIMD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=7821	51.822	2	2252.1913	2252.1913	R	T	271	294
PSM	AKTGGAYGEDLGADYNLSQVCDGK	12	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	2-UNIMOD:188,21-UNIMOD:4,24-UNIMOD:188	ms_run[2]:scan=6842	45.089	2	2500.1579	2500.1579	R	V	2448	2472
PSM	FGQAATMEGIGAIGGTPPAFNR	13	sp|Q15233-2|NONO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	7-UNIMOD:35	ms_run[2]:scan=8205	54.201	2	2178.0528	2178.0528	R	A	346	368
PSM	KDENESSAPADGEGGSELQPK	14	sp|Q15554|TERF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=2115	16.477	2	2143.9505	2143.9505	R	N	375	396
PSM	KPADDQDPIDALSGDLDSCPSTTETSQNTAK	15	sp|P20810-3|ICAL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:188,19-UNIMOD:4,31-UNIMOD:188	ms_run[2]:scan=8407	55.443	3	3288.4978	3288.4978	K	D	525	556
PSM	LKETCVSGEDPTQGADLSPDEK	16	sp|Q02952-3|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	5-UNIMOD:4	ms_run[2]:scan=4436	30.719	3	2375.0798	2375.0798	K	V	361	383
PSM	NAQAIEDMVGYAQETQHEK	17	sp|Q99460-2|PSMD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	19-UNIMOD:188	ms_run[2]:scan=8187	54.091	2	2166.9947	2166.9947	K	I	525	544
PSM	NVVLPTETEVAPAKDVTLLK	18	sp|P27816-2|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=8729	57.419	2	2136.2042	2136.2042	K	E	333	353
PSM	SKDYDVYSDNDICSQESEDNFAK	19	sp|Q8N5P1|ZC3H8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	13-UNIMOD:4	ms_run[2]:scan=5977	40.001	3	2728.1082	2728.1082	R	E	70	93
PSM	VQAQHDYTATDTDELQLK	20	sp|O00499-9|BIN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=5217	35.446	2	2074.9807	2074.9807	K	A	341	359
PSM	LSELDDRADALQAGASQFETSAAK	21	sp|P63027|VAMP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0		ms_run[1]:scan=7993	52.892869999999995	2	2493.196213	2493.198326	K	L	60	84
PSM	AALAHSEEVTASQVAATK	22	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	18-UNIMOD:188	ms_run[2]:scan=4086	28.584	2	1788.9313	1788.9313	R	T	2575	2593
PSM	AALAHSEEVTASQVAATK	23	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=4089	28.605	2	1782.9112	1782.9112	R	T	2575	2593
PSM	AKTGGAYGEDLGADYNLSQVCDGK	24	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	21-UNIMOD:4	ms_run[2]:scan=6829	44.986	2	2488.1176	2488.1176	R	V	2448	2472
PSM	ATAVMPDGQFKDISLSDYK	25	sp|Q06830|PRDX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=8361	55.157	2	2085.0089	2085.0089	K	G	17	36
PSM	DKEAIQAYSESLMTSAPK	26	sp|Q8WTV0-3|SCRB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=7894	52.28	2	1967.951	1967.9510	K	G	383	401
PSM	FGQAATMEGIGAIGGTPPAFNR	27	sp|Q15233-2|NONO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	7-UNIMOD:35,22-UNIMOD:267	ms_run[2]:scan=8197	54.152	2	2188.0611	2188.0611	R	A	346	368
PSM	IVSSSDVGHDEYSTQSLVK	28	sp|Q01082|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	19-UNIMOD:188	ms_run[2]:scan=5175	35.188	2	2056.0056	2056.0056	K	K	766	785
PSM	LCASGAGATPDTAIEEIKEK	29	sp|P53384-2|NUBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	2-UNIMOD:4	ms_run[2]:scan=6076	40.599	2	2060.0096	2060.0096	R	M	30	50
PSM	QAAASATQTIAAAQHAASTPK	30	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=5318	36.038	2	1994.0181	1994.0181	K	A	923	944
PSM	SAELNKEVSTNTAMIQTSK	31	sp|P13646-2|K1C13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	6-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=4957	33.875	2	2063.0607	2063.0607	K	T	288	307
PSM	SCSGVEFSTSGHAYTDTGK	32	sp|Q9Y277|VDAC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	2-UNIMOD:4	ms_run[2]:scan=4211	29.351	2	1989.8374	1989.8374	K	A	35	54
PSM	TLVSVTKEGLELPEDEEEK	33	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=7840	51.944	2	2144.0736	2144.0736	K	K	540	559
PSM	VDQALHTQTDADPAEEYAR	34	sp|P52888|THOP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=4416	30.592	2	2128.9661	2128.9661	K	L	560	579
PSM	VDQSLHTNTSLDAASEYAK	35	sp|Q9BYT8|NEUL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	19-UNIMOD:188	ms_run[2]:scan=5214	35.424	2	2054.9852	2054.9852	K	Y	584	603
PSM	ACYLSINPQKDETLETEK	36	sp|P61163|ACTZ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	2-UNIMOD:4,10-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=6367	42.306	2	2150.0604	2150.0604	R	A	221	239
PSM	AMEVDERPTEQYSDIGGLDK	37	sp|P17980|PRS6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=6346	42.176	2	2252.0267	2252.0267	K	Q	174	194
PSM	ANVDISAPKVDTNAPDLSLEGPEGK	38	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	9-UNIMOD:188,25-UNIMOD:188	ms_run[2]:scan=7774	51.529	2	2548.3059	2548.3059	K	L	1025	1050
PSM	AVATGKMDENQFVAVTSTNAAK	39	sp|Q14195|DPYL3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=5848	39.223	2	2252.1107	2252.1107	K	I	369	391
PSM	EQIVVDLSHPGVSEDDQVSR	40	sp|O60701-3|UGDH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=6740	44.45	2	2208.0659	2208.0659	R	L	277	297
PSM	GSETDSAQDQPVKMNSLPAER	41	sp|P30419|NMT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=4621	31.838	2	2259.0437	2259.0437	K	I	68	89
PSM	GYDSAGVGFDGGNDKDWEANACK	42	sp|Q06210-2|GFPT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	22-UNIMOD:4	ms_run[2]:scan=6028	40.313	3	2431.9975	2431.9975	R	I	34	57
PSM	ISLEYSELQDKVTSAETK	43	sp|O75150-3|BRE1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	11-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=7659	50.8	2	2052.0665	2052.0665	R	V	254	272
PSM	LAETQEEISAEVAAKAER	44	sp|Q9Y383-3|LC7L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=5953	39.857	2	1943.98	1943.9800	R	V	105	123
PSM	NLDSTTVAIHDEEIYCK	45	sp|Q16527|CSRP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	16-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=6280	41.778	2	2012.9457	2012.9457	K	S	43	60
PSM	SDGGYTYDTSDLAAIKQR	46	sp|P54136-2|SYRC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=6000	40.145	2	1959.9174	1959.9174	K	L	306	324
PSM	STPKEDDSSASTSQSTR	47	sp|P23588-2|IF4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=489	6.0261	2	1782.7868	1782.7868	R	A	301	318
PSM	VIAINVDDPDAANYNDINDVKR	48	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=7401	49.12	2	2443.1979	2443.1979	K	L	156	178
PSM	QSAQLTALAAQQQAAGKEEK	49	sp|Q96A49|SYAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	1-UNIMOD:28,17-UNIMOD:188,20-UNIMOD:188	ms_run[1]:scan=6400	42.50953833333334	2	2065.0896	2065.0837	K	S	211	231
PSM	QLQQAQAAGAEQEVEKFTK	50	sp|P39748|FEN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	1-UNIMOD:28	ms_run[1]:scan=8885	58.365230000000004	2	2086.0334	2086.0326	K	R	110	129
PSM	ACYLSINPQKDETLETEK	51	sp|P61163|ACTZ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	2-UNIMOD:4	ms_run[2]:scan=6350	42.199	2	2138.0201	2138.0202	R	A	221	239
PSM	ADEHVIDQGDDGDNFYVIER	52	sp|P13861-2|KAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	20-UNIMOD:267	ms_run[2]:scan=7442	49.403	2	2316.017	2316.0170	K	G	162	182
PSM	GALVVEDNDSGVPVEETKK	53	sp|Q96PZ0|PUS7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=4798	32.907	2	1984.9953	1984.9953	R	Q	14	33
PSM	GPPGPALPATMNNSSSETR	54	sp|Q15003|CND2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	19-UNIMOD:267	ms_run[2]:scan=5041	34.378	2	1892.8926	1892.8926	M	G	2	21
PSM	GYDSAGVGFDGGNDKDWEANACK	55	sp|Q06210-2|GFPT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	15-UNIMOD:188,22-UNIMOD:4,23-UNIMOD:188	ms_run[2]:scan=6031	40.329	2	2444.0378	2444.0378	R	I	34	57
PSM	LKETCVSGEDPTQGADLSPDEK	56	sp|Q02952-3|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	2-UNIMOD:188,5-UNIMOD:4,22-UNIMOD:188	ms_run[2]:scan=4445	30.774	2	2387.1201	2387.1201	K	V	361	383
PSM	LQIASDENYKDPTNLQGK	57	sp|Q13813-2|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	10-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=5211	35.407	2	2045.0468	2045.0468	K	L	64	82
PSM	MDKNASTFEDVTQVSSAYQK	58	sp|Q14247-3|SRC8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:35	ms_run[2]:scan=6256	41.641	2	2264.0267	2264.0267	R	T	280	300
PSM	NLDSTTVAVHGEEIYCK	59	sp|P21291|CSRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	16-UNIMOD:4	ms_run[2]:scan=5648	38.003	2	1934.9044	1934.9044	K	S	43	60
PSM	NQVTATKADGGTQVIDTK	60	sp|P09622-2|DLDH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	7-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=2672	19.929	2	1857.9835	1857.9835	K	N	61	79
PSM	SAAPSTLDSSSTAPAQLGKK	61	sp|Q9Y5M8|SRPRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=3733	26.446	2	1915.9851	1915.9851	R	G	209	229
PSM	SGQAKETIPLQETSLYTQDR	62	sp|P50897-2|PPT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=6419	42.625	2	2264.1285	2264.1285	R	L	146	166
PSM	SSSADFGTFNTSQSHQTASAVSK	63	sp|P52594-2|AGFG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=4701	32.326	2	2344.0567	2344.0567	K	V	251	274
PSM	TQSSASLAASYAAQQHPQAAASYR	64	sp|Q96PK6|RBM14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	24-UNIMOD:267	ms_run[2]:scan=5136	34.954	2	2474.1814	2474.1814	R	G	518	542
PSM	TSDANETEDHLESLICK	65	sp|Q09161|NCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	16-UNIMOD:4	ms_run[2]:scan=7836	51.919	2	1960.8684	1960.8684	K	V	21	38
PSM	QVQSLTCEVDALKGTNESLER	66	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:28,7-UNIMOD:4,13-UNIMOD:188,21-UNIMOD:267	ms_run[1]:scan=9969	65.10151166666667	2	2375.1607	2375.1604	R	Q	322	343
PSM	TKSENGLEFTSSGSANTETTK	67	sp|P21796|VDAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	2-UNIMOD:188,21-UNIMOD:188	ms_run[1]:scan=3905	27.49666666666667	2	2200.028564	2200.053409	K	V	33	54
PSM	TKSENGLEFTSSGSANTETTK	68	sp|P21796|VDAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0		ms_run[1]:scan=3761	26.618068333333333	2	2188.991880	2188.013151	K	V	33	54
PSM	SIQGSSTSSSASSTLSHGEVK	69	sp|Q9P265|DIP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0		ms_run[1]:scan=3065	22.335448333333332	2	2035.960380	2035.965806	R	G	178	199
PSM	AAVGEEKDINTFVGTPVEK	70	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	7-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=6110	40.795	2	2015.0614	2015.0614	K	L	1909	1928
PSM	ADEHVIDQGDDGDNFYVIER	71	sp|P13861-2|KAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=7443	49.409	2	2306.0087	2306.0087	K	G	162	182
PSM	AGLESGAEPGDGDSDTTKK	72	sp|O60832|DKC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=1390	11.755	2	1833.8228	1833.8228	K	K	481	500
PSM	DAGEGLLAVQITDQEGKPK	73	sp|O75369-6|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	17-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=7592	50.378	2	1980.0566	1980.0566	R	R	1546	1565
PSM	DLIHDQDEDEEEEEGQR	74	sp|Q9UNZ2-4|NSF1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=3873	27.3	2	2084.8407	2084.8407	R	F	77	94
PSM	DQVTAQEIFQDNHEDGPTAK	75	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=6080	40.626	2	2242.0138	2242.0138	K	K	546	566
PSM	EGCGDDNVCNSNLKLEYK	76	sp|P23229-7|ITA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=4941	33.776	2	2113.9045	2113.9045	K	F	505	523
PSM	GIVNGAAPELPVPTGGPAVGAR	77	sp|P21281|VATB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	22-UNIMOD:267	ms_run[2]:scan=8278	54.649	2	2009.0933	2009.0933	R	E	8	30
PSM	IAEFTTNLTEEEEKSK	78	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=5818	39.046	2	1867.9051	1867.9051	R	S	1001	1017
PSM	IVSSSDVGHDEYSTQSLVK	79	sp|Q01082|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=5178	35.205	2	2049.9855	2049.9855	K	K	766	785
PSM	LQIASDENYKDPTNLQGK	80	sp|Q13813-2|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=5182	35.232	2	2033.0065	2033.0065	K	L	64	82
PSM	MGLAMGGGGGASFDR	81	sp|P52272-2|HNRPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:35,15-UNIMOD:267	ms_run[2]:scan=5265	35.733	2	1408.6103	1408.6103	R	A	568	583
PSM	MGLAMGGGGGASFDR	82	sp|P52272-2|HNRPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:35	ms_run[2]:scan=5267	35.743	2	1398.602	1398.6020	R	A	568	583
PSM	NAQAIEDMVGYAQETQHEK	83	sp|Q99460-2|PSMD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=8181	54.052	2	2160.9746	2160.9746	K	I	525	544
PSM	QAAASATQTIAAAQHAASTPK	84	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	21-UNIMOD:188	ms_run[2]:scan=5315	36.019	2	2000.0382	2000.0382	K	A	923	944
PSM	SAAPSTLDSSSTAPAQLGKK	85	sp|Q9Y5M8|SRPRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	19-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=3732	26.44	2	1928.0253	1928.0253	R	G	209	229
PSM	SSLGQSASETEEDTVSVSKK	86	sp|Q13435|SF3B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=4385	30.404	2	2067.9808	2067.9808	R	E	302	322
PSM	STLADYSAQKDLEPESDR	87	sp|Q9UKV3-5|ACINU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=5226	35.502	2	2023.9334	2023.9334	K	S	507	525
PSM	TEEKQQEPVTSTSLVFGK	88	sp|P49790-2|NU153_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=6091	40.688	2	2007.0161	2007.0161	R	K	1061	1079
PSM	TTKSPSDSGYSYETIGK	89	sp|P46821|MAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=3932	27.665	2	1819.8476	1819.8476	R	T	1912	1929
PSM	VEEPSKYGVVVCEADTGR	90	sp|Q9Y5P6|GMPPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	12-UNIMOD:4	ms_run[2]:scan=5067	34.536	2	1993.9415	1993.9415	K	I	138	156
PSM	YLSASEYGSSVDGHPEVPETK	91	sp|Q8N4X5-2|AF1L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	21-UNIMOD:188	ms_run[2]:scan=5403	36.552	2	2257.0482	2257.0482	K	D	301	322
PSM	YLSASEYGSSVDGHPEVPETK	92	sp|Q8N4X5-2|AF1L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=5409	36.589	2	2251.0281	2251.0281	K	D	301	322
PSM	QITSYGETCPGLEQYAIKK	93	sp|P50990|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:28,9-UNIMOD:4	ms_run[1]:scan=8156	53.89408833333333	2	2168.0477	2168.0454	K	F	422	441
PSM	KDDPVTNLNNAFEVAEK	94	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	1-UNIMOD:188,17-UNIMOD:188	ms_run[1]:scan=6501	43.10876	2	1915.961341	1914.972579	R	Y	217	234
PSM	QLQQAQAAGAEQEVEKFTK	95	sp|P39748|FEN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:28,16-UNIMOD:188,19-UNIMOD:188	ms_run[1]:scan=8887	58.376466666666666	2	2098.0707	2098.0728	K	R	110	129
PSM	AAGEPIKEGDNDYFTCITK	96	sp|Q99543-2|DNJC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	7-UNIMOD:188,16-UNIMOD:4,19-UNIMOD:188	ms_run[2]:scan=6593	43.63	2	2140.0185	2140.0185	K	A	125	144
PSM	ADDKLIAEEGVDSLNVK	97	sp|O95202|LETM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=7073	46.871	2	1814.9262	1814.9262	K	E	357	374
PSM	ADETKDEQFEQCVQNFNK	98	sp|O00499-9|BIN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	12-UNIMOD:4	ms_run[2]:scan=6373	42.345	2	2228.9644	2228.9644	K	Q	36	54
PSM	ATVLESEGTRESAINVAEGK	99	sp|Q9UJZ1-2|STML2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=5637	37.938	2	2060.0386	2060.0386	R	K	157	177
PSM	DCDVQGLEHDMEEINAR	100	sp|Q9UPN3-4|MACF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	2-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=8821	57.977	2	2039.8552	2039.8552	K	W	3220	3237
PSM	DKGGINLTATCPQSELDAETVK	101	sp|Q9Y295|DRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	11-UNIMOD:4	ms_run[2]:scan=6927	45.78	2	2346.1373	2346.1373	K	S	185	207
PSM	DLEAEHVEVEDTTLNR	102	sp|Q9H3K6-2|BOLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=5890	39.482	2	1868.8752	1868.8752	R	C	15	31
PSM	DQVTAQEIFQDNHEDGPTAK	103	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	20-UNIMOD:188	ms_run[2]:scan=6081	40.631	2	2248.0339	2248.0339	K	K	546	566
PSM	GCPEDAAVCAVDKNGSK	104	sp|P11717|MPRI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	2-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=3611	25.705	2	1776.7771	1776.7771	R	N	530	547
PSM	GLSEDTTEETLKESFDGSVR	105	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=8054	53.27	2	2199.0179	2199.0179	K	A	578	598
PSM	ISLEYSELQDKVTSAETK	106	sp|O75150-3|BRE1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=7658	50.794	2	2040.0263	2040.0263	R	V	254	272
PSM	KAEEDPEAADSGEPQNK	107	sp|Q9NYB0|TE2IP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=867	8.348	2	1813.7966	1813.7966	R	R	212	229
PSM	LTEDKETLQYLQQNAK	108	sp|Q9BSJ2|GCP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=5885	39.448	2	1920.9793	1920.9793	K	E	88	104
PSM	LTEELNKEATVIQDLK	109	sp|Q15075|EEA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	7-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=8020	53.061	2	1855.0341	1855.0341	R	T	196	212
PSM	MEDSVGCLETAEEVKR	110	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:35,7-UNIMOD:4	ms_run[2]:scan=4735	32.531	2	1867.8292	1867.8292	K	K	1373	1389
PSM	NLDSTTVAVHGEEIYCK	111	sp|P21291|CSRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	16-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=5645	37.986	2	1940.9245	1940.9245	K	S	43	60
PSM	NSESESNKVAAETQSPSLFGSTK	112	sp|Q9UKX7-2|NUP50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=5597	37.69	2	2397.1296	2397.1296	R	L	179	202
PSM	QSAQLTALAAQQQAAGKEEK	113	sp|Q96A49|SYAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=4566	31.499	2	2070.0705	2070.0705	K	S	211	231
PSM	SDPTSYAGYIEDLKK	114	sp|P54709|AT1B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=7830	51.88	2	1685.8148	1685.8148	R	F	98	113
PSM	SLYQSAGVAPESFEYIEAHGTGTK	115	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=8783	57.745	2	2541.2023	2541.2023	R	V	275	299
PSM	SNPSENEEKEAQSQLIK	116	sp|Q13217|DNJC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	9-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=4372	30.32	2	1941.9682	1941.9682	K	S	134	151
PSM	SSQSSVTVENASKPDFTK	117	sp|Q8ND82|Z280C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	13-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=3912	27.542	2	1922.9624	1922.9624	K	N	114	132
PSM	STELPGKNESTIEQIDK	118	sp|Q05209-2|PTN12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	7-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=4688	32.252	2	1899.9828	1899.9828	K	K	282	299
PSM	TLTSDVANLANEKEELNNK	119	sp|O75116|ROCK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=7453	49.477	2	2102.0491	2102.0491	R	L	977	996
PSM	TLTSDVANLANEKEELNNK	120	sp|O75116|ROCK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	13-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=7460	49.53	2	2114.0894	2114.0894	R	L	977	996
PSM	VLAELYVSDREGSDATGDGTK	121	sp|O43776-2|SYNC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=5821	39.062	3	2182.039	2182.0390	M	E	2	23
PSM	YYSPCEEHPAETNQNEGAESGTIR	122	sp|A5YM69|ARG35_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:4	ms_run[2]:scan=3945	27.748	3	2738.1515	2738.1515	R	Q	182	206
PSM	YYTSASGDEMVSLKDYCTR	123	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	17-UNIMOD:4	ms_run[2]:scan=6737	44.433	2	2244.9667	2244.9667	R	M	465	484
PSM	GIVNGAAPELPVPTGGPAVGAR	124	sp|P21281|VATB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	22-UNIMOD:267	ms_run[1]:scan=8404	55.425934999999996	2	2010.076318	2009.093343	R	E	8	30
PSM	AEAAEKGDVGLVAENSR	125	sp|P18858-2|DNLI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=3226	23.324	2	1714.8486	1714.8486	R	S	371	388
PSM	AEDGSVIDYELIDQDAR	126	sp|P07355|ANXA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	17-UNIMOD:267	ms_run[2]:scan=8607	56.681	2	1917.8831	1917.8831	R	D	180	197
PSM	AGNEKEEGETADTVGCCSLR	127	sp|P11387|TOP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	16-UNIMOD:4,17-UNIMOD:4	ms_run[2]:scan=3252	23.481	2	2181.9267	2181.9267	R	V	489	509
PSM	ASEAKEGEEAGPGDPLLEAVPK	128	sp|Q16543|CDC37_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=7441	49.397	2	2193.0801	2193.0801	K	T	348	370
PSM	ATAVMPDGQFKDISLSDYK	129	sp|Q06830|PRDX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	11-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=8377	55.258	2	2097.0491	2097.0491	K	G	17	36
PSM	AVEEEDKMTPEQLAIK	130	sp|O00487|PSDE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=5802	38.95	2	1829.9081	1829.9081	K	N	258	274
PSM	CADDSETANYISAHTK	131	sp|O95376|ARI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=3999	28.075	2	1787.7728	1787.7728	K	D	280	296
PSM	DLEAEHVEVEDTTLNR	132	sp|Q9H3K6-2|BOLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	16-UNIMOD:267	ms_run[2]:scan=5935	39.746	2	1878.8835	1878.8835	R	C	15	31
PSM	EALLSSAVDHGSDEVK	133	sp|P78371-2|TCPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=5277	35.795	2	1655.8002	1655.8002	R	F	92	108
PSM	EGATVYATGTHAQVEDGR	134	sp|P32322-2|P5CR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=2948	21.61	2	1860.8602	1860.8602	R	L	130	148
PSM	GATYPSEIPKEDSTTFAK	135	sp|Q8WWI1-3|LMO7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=5430	36.715	2	1940.9367	1940.9367	K	R	501	519
PSM	GLESTTLADKDGEIYCK	136	sp|P21291|CSRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	10-UNIMOD:188,16-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=5229	35.519	2	1910.9334	1910.9334	K	G	152	169
PSM	GVNCIDYYSGGDKPYLISGADDR	137	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:4	ms_run[2]:scan=7794	51.654	2	2534.1384	2534.1384	K	L	158	181
PSM	IYEFPETDDEEENKLVK	138	sp|Q16181-2|SEPT7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	14-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=7000	46.303	2	2109.0193	2109.0193	K	K	221	238
PSM	KAAAPAPEEEMDECEQALAAEPK	139	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:188,11-UNIMOD:35,14-UNIMOD:4,23-UNIMOD:188	ms_run[2]:scan=4758	32.669	3	2512.15	2512.1500	K	A	253	276
PSM	KIIEENITSAAPSNDQDGEYCPEVK	140	sp|P78362|SRPK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:188,21-UNIMOD:4,25-UNIMOD:188	ms_run[2]:scan=5918	39.646	2	2818.337	2818.3370	R	L	300	325
PSM	KPADDQDPIDALSGDLDSCPSTTETSQNTAK	141	sp|P20810-3|ICAL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	19-UNIMOD:4	ms_run[2]:scan=8349	55.083	3	3276.4576	3276.4576	K	D	525	556
PSM	MIQDGKGDVTITNDGATILK	142	sp|P50991|TCPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:35,6-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=6094	40.703	2	2117.1077	2117.1077	K	Q	60	80
PSM	NEEKTAEDYSVDENGQR	143	sp|O60488-2|ACSL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=2500	18.865	2	1982.8454	1982.8454	K	W	492	509
PSM	NVVLPTETEVAPAKDVTLLK	144	sp|P27816-2|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	14-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=8736	57.463	2	2148.2444	2148.2444	K	E	333	353
PSM	PAASITSKPATLTTTSATSK	145	sp|O43670-3|ZN207_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	8-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=3715	26.337	3	1945.077	1945.0770	K	L	260	280
PSM	SAPDTELVNVTHLNTEVK	146	sp|Q9NYV4-3|CDK12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=7666	50.846	2	1966.0007	1966.0007	K	N	455	473
PSM	SDPTSYAGYIEDLKK	147	sp|P54709|AT1B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	14-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=7827	51.863	2	1697.8551	1697.8551	R	F	98	113
PSM	SETSGPQIKELTDEEAER	148	sp|Q9Y266|NUDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=5203	35.36	2	2017.944	2017.9440	K	L	97	115
PSM	TCTTVAFTQVNSEDKGALAK	149	sp|P62424|RL7A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:4	ms_run[2]:scan=5523	37.246	2	2140.047	2140.0470	K	L	198	218
PSM	VDQALHTQTDADPAEEYAR	150	sp|P52888|THOP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	19-UNIMOD:267	ms_run[2]:scan=4415	30.586	2	2138.9744	2138.9744	K	L	560	579
PSM	VSPGLPSPNLENGAPAVGPVQPR	151	sp|Q9UGP4|LIMD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	23-UNIMOD:267	ms_run[2]:scan=7824	51.84	2	2262.1996	2262.1996	R	T	271	294
PSM	VTEGLTDVILYHQPDDK	152	sp|O60506-4|HNRPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	17-UNIMOD:188	ms_run[2]:scan=8182	54.058	2	1947.9885	1947.9885	K	K	266	283
PSM	VTQLDPKEEEVSLQGINTR	153	sp|Q9Y6W5-2|WASF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=6820	44.913	2	2155.1121	2155.1121	K	K	79	98
PSM	YAVGEECDFEVGKEK	154	sp|Q9UIG0-2|BAZ1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:4	ms_run[2]:scan=5176	35.194	2	1758.7771	1758.7771	K	M	114	129
PSM	YESGDHVAVYPANDSALVNQLGK	155	sp|P16435|NCPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	23-UNIMOD:188	ms_run[2]:scan=7711	51.135	2	2452.1966	2452.1966	R	I	314	337
PSM	QITSYGETCPGLEQYAIKK	156	sp|P50990|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:28,9-UNIMOD:4,18-UNIMOD:188,19-UNIMOD:188	ms_run[1]:scan=8180	54.045743333333334	2	2181.0882	2180.0862	K	F	422	441
PSM	TSALSDETKNNWEVSALSR	157	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	9-UNIMOD:188,19-UNIMOD:267	ms_run[1]:scan=7106	47.100051666666666	2	2124.031128	2123.046574	K	A	802	821
PSM	GIVNGAAPELPVPTGGPAVGAR	158	sp|P21281|VATB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	22-UNIMOD:267	ms_run[1]:scan=8574	56.482218333333336	2	2010.076171	2009.093343	R	E	8	30
PSM	QAAASATQTIAAAQHAASTPK	159	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:28	ms_run[1]:scan=6995	46.263954999999996	2	1976.9907	1976.9910	K	A	923	944
PSM	SIQGSSTSSSASSTLSHGEVK	160	sp|Q9P265|DIP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	21-UNIMOD:188	ms_run[1]:scan=3076	22.40711	2	2042.989416	2041.985935	R	G	178	199
PSM	EANSKADPSLNPEQLK	161	sp|Q9UNF0|PACN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0		ms_run[1]:scan=4075	28.518729999999998	2	1739.865402	1739.868993	R	K	173	189
PSM	ADDKLIAEEGVDSLNVK	162	sp|O95202|LETM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=7080	46.921	2	1826.9664	1826.9664	K	E	357	374
PSM	ALAENSGVKANEVISK	163	sp|P50990-3|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	9-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=3550	25.311	2	1640.9136	1640.9136	R	L	378	394
PSM	ALDAEEEACLHSCAGK	164	sp|Q9Y5J6|T10B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	9-UNIMOD:4,13-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=4032	28.269	2	1765.7707	1765.7707	R	L	40	56
PSM	ALELDPDNETYKSNLK	165	sp|O43765|SGTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=5789	38.87	2	1848.9105	1848.9105	K	I	185	201
PSM	APPGPAGLSGGESLLVK	166	sp|Q9NRL3-2|STRN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	17-UNIMOD:188	ms_run[2]:scan=7811	51.763	2	1554.8713	1554.8713	R	Q	103	120
PSM	ASEAKEGEEAGPGDPLLEAVPK	167	sp|Q16543|CDC37_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=7292	48.391	2	2193.0801	2193.0801	K	T	348	370
PSM	ATAPVPTVGEGYGYGHESELSQASAAAR	168	sp|Q96PK6-5|RBM14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=6494	43.064	2	2775.31	2775.3100	R	N	289	317
PSM	ATVLESEGTRESAINVAEGK	169	sp|Q9UJZ1-2|STML2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=5646	37.992	3	2060.0386	2060.0386	R	K	157	177
PSM	AVEEEDKMTPEQLAIK	170	sp|O00487|PSDE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=5798	38.924	2	1841.9483	1841.9483	K	N	258	274
PSM	DKEAIQAYSESLMTSAPK	171	sp|Q8WTV0-3|SCRB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=7897	52.297	2	1979.9913	1979.9913	K	G	383	401
PSM	DSLGAYASQDANEQGQDLGKR	172	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=4864	33.299	2	2222.02	2222.0200	R	D	892	913
PSM	DVDEAYMNKVELESR	173	sp|P05787-2|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=6099	40.735	2	1796.8251	1796.8251	K	L	227	242
PSM	DVDEAYMNKVELESR	174	sp|P05787-2|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=6275	41.753	2	1796.8251	1796.8251	K	L	227	242
PSM	EATHSSGFSGSSASVASTSSIK	175	sp|O60566-2|BUB1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	22-UNIMOD:188	ms_run[2]:scan=3809	26.905	2	2089.9859	2089.9859	R	C	561	583
PSM	EEVKEAYMGNVLQGGEGQAPTR	176	sp|P24752|THIL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=6047	40.424	2	2362.1223	2362.1223	K	Q	84	106
PSM	EKQSDDEVYAPGLDIESSLK	177	sp|Q15459-2|SF3A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=8421	55.535	2	2222.059	2222.0590	R	Q	383	403
PSM	GADFLVTEVENGGSLGSK	178	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=9469	61.973	2	1778.8687	1778.8687	K	K	189	207
PSM	GALVVEDNDSGVPVEETKK	179	sp|Q96PZ0|PUS7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	18-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=4790	32.855	2	1997.0356	1997.0356	R	Q	14	33
PSM	GCPEDAAVCAVDKNGSK	180	sp|P11717|MPRI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:4,9-UNIMOD:4,13-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=3609	25.694	2	1788.8173	1788.8173	R	N	530	547
PSM	GIVDQSQQAYQEAFEISKK	181	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=8702	57.265	2	2168.075	2168.0750	K	E	140	159
PSM	GNVGIGGSAVPPPPIK	182	sp|Q7Z739|YTHD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	16-UNIMOD:188	ms_run[2]:scan=6101	40.745	2	1464.8396	1464.8396	K	H	256	272
PSM	GPPGPALPATMNNSSSETR	183	sp|Q15003|CND2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=5048	34.422	2	1882.8843	1882.8843	M	G	2	21
PSM	GVNCIDYYSGGDKPYLISGADDR	184	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:4	ms_run[2]:scan=7792	51.643	3	2534.1384	2534.1384	K	L	158	181
PSM	GYDSAGVGFDGGNDKDWEANACK	185	sp|Q06210-2|GFPT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	22-UNIMOD:4	ms_run[2]:scan=6030	40.323	2	2431.9975	2431.9975	R	I	34	57
PSM	IAEFTTNLTEEEEKSK	186	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=5815	39.023	2	1879.9454	1879.9454	R	S	1001	1017
PSM	ITSENPDEGFKPSSGTVQELNFR	187	sp|O00763-3|ACACB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=7525	49.948	3	2551.2191	2551.2191	R	S	451	474
PSM	LDQEVAEVDKNIELLK	188	sp|Q99816-2|TS101_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	10-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=8837	58.076	2	1867.0341	1867.0341	R	K	172	188
PSM	LEQENDDLAHELVTSK	189	sp|B7ZAP0|RBG10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=6086	40.657	2	1839.885	1839.8850	R	I	26	42
PSM	LLEENVSAFKTEYDAVAEK	190	sp|Q9NTJ3-2|SMC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=8901	58.467	2	2155.0685	2155.0685	K	A	858	877
PSM	LLETPYHCEAGAATDAEATEADGADGR	191	sp|Q9BVL4|SELO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	8-UNIMOD:4,27-UNIMOD:267	ms_run[2]:scan=5638	37.944	3	2800.2121	2800.2122	K	Q	622	649
PSM	LLPSAPQTLPDGPLASPAR	192	sp|O15027-2|SC16A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=8232	54.365	2	1900.0418	1900.0418	R	V	1949	1968
PSM	LNEQASEEILKVEQK	193	sp|Q01105-3|SET_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	11-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=6017	40.25	2	1768.961	1768.9610	R	Y	33	48
PSM	LTEELNKEATVIQDLK	194	sp|Q15075|EEA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=8021	53.067	2	1842.9939	1842.9939	R	T	196	212
PSM	NGNYCVLQMDQSYKPDENEVR	195	sp|P31939-2|PUR9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:4	ms_run[2]:scan=6848	45.142	2	2558.1166	2558.1166	K	T	358	379
PSM	NLDSTTVAIHDEEIYCK	196	sp|Q16527|CSRP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	16-UNIMOD:4	ms_run[2]:scan=6286	41.817	2	2006.9255	2006.9255	K	S	43	60
PSM	QVQSLTCEVDALKGTNESLER	197	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:4	ms_run[2]:scan=8009	52.99	2	2376.1591	2376.1591	R	Q	322	343
PSM	SGGNSYGSGGASYNPGSHGGYGGGSGGGSSYQGK	198	sp|Q12906|ILF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=3341	24.041	2	3011.2302	3011.2302	R	Q	816	850
PSM	SLYQSAGVAPESFEYIEAHGTGTK	199	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	24-UNIMOD:188	ms_run[2]:scan=8782	57.739	2	2547.2225	2547.2225	R	V	275	299
PSM	SNTPILVDGKDVMPEVNK	200	sp|P06744|G6PI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	13-UNIMOD:35	ms_run[2]:scan=5454	36.862	2	1970.9983	1970.9983	R	V	107	125
PSM	SNTPILVDGKDVMPEVNK	201	sp|P06744|G6PI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	10-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=7066	46.826	2	1967.0436	1967.0436	R	V	107	125
PSM	TGQELQSACDALKDQNSK	202	sp|Q14789-4|GOGB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	9-UNIMOD:4,13-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=4664	32.105	2	2003.9621	2003.9621	K	L	312	330
PSM	TSDANETEDHLESLICK	203	sp|Q09161|NCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	16-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=7832	51.891	2	1966.8885	1966.8885	K	V	21	38
PSM	TVKQEQINTEPLEDTVLSPTK	204	sp|O15446|RPA34_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=7565	50.208	2	2381.2728	2381.2728	K	K	268	289
PSM	TYDATTHFETTCDDIK	205	sp|P50395-2|GDIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	12-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=4956	33.87	2	1922.83	1922.8300	R	N	358	374
PSM	VDQSLHTNTSLDAASEYAK	206	sp|Q9BYT8|NEUL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=5219	35.458	2	2048.9651	2048.9651	K	Y	584	603
PSM	VTEGLTDVILYHQPDDK	207	sp|O60506-4|HNRPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=8188	54.098	2	1941.9684	1941.9684	K	K	266	283
PSM	YESGDHVAVYPANDSALVNQLGK	208	sp|P16435|NCPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=7712	51.141	2	2446.1765	2446.1765	R	I	314	337
PSM	YESGDHVAVYPANDSALVNQLGK	209	sp|P16435|NCPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	23-UNIMOD:188	ms_run[2]:scan=7710	51.13	3	2452.1966	2452.1966	R	I	314	337
PSM	LQAALDDEEAGGRPAMEPGNGSLDLGGDSAGR	210	sp|Q00839|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=7317	48.556931666666664	3	3126.419181	3125.431984	R	S	38	70
PSM	QTIDNSQGAYQEAFDISKK	211	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:28,18-UNIMOD:188,19-UNIMOD:188	ms_run[1]:scan=7881	52.202218333333334	2	2137.0264	2137.0361	K	E	140	159
PSM	EGQEEVLKEVVESEGER	212	sp|Q8TAQ2|SMRC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=7616	50.529455	2	1944.921803	1944.927630	K	K	829	846
PSM	GIVNGAAPELPVPTGGPAVGAR	213	sp|P21281|VATB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=8556	56.36882666666667	2	2000.068145	1999.085074	R	E	8	30
PSM	AAESVSKPDVSEEAPGPSK	214	sp|Q9BY42|RTF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=2819	20.809	2	1895.9515	1895.9515	K	V	204	223
PSM	AEAESMYQIKYEELQSLAGK	215	sp|P05787-2|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:35	ms_run[2]:scan=8107	53.598	2	2303.0991	2303.0991	R	H	304	324
PSM	AQAVLEEDHYGMEDVK	216	sp|P36776-3|LONM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	16-UNIMOD:188	ms_run[2]:scan=5565	37.487	2	1838.8452	1838.8452	R	K	287	303
PSM	ASEVEEILDGNDEKYK	217	sp|Q12824-2|SNF5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=7649	50.74	2	1837.8582	1837.8582	K	A	84	100
PSM	CLTTDEYDGHSTYPSHQYQ	218	sp|P30043|BLVRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:4	ms_run[2]:scan=4424	30.645	2	2300.928	2300.9280	R	-	188	207
PSM	DAEMPATEKDLAEDAPWK	219	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	9-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=8014	53.02	2	2027.9549	2027.9549	R	K	25	43
PSM	DKEAIQAYSESLMTSAPK	220	sp|Q8WTV0-3|SCRB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	2-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=7886	52.231	3	1979.9913	1979.9913	K	G	383	401
PSM	DKVVEDDEDDFPTTR	221	sp|Q9Y5P4-2|CERT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=4450	30.806	2	1779.7799	1779.7799	R	S	197	212
PSM	DLDIIDNYDYSHTVK	222	sp|O75369-6|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=8055	53.276	2	1809.8421	1809.8421	K	Y	895	910
PSM	DVEVTKEEFVLAAQK	223	sp|Q9UJS0|CMC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=7067	46.832	2	1716.9337	1716.9337	K	F	246	261
PSM	DVEVTKEEFVLAAQK	224	sp|Q9UJS0|CMC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=7068	46.838	2	1704.8934	1704.8934	K	F	246	261
PSM	DVVICPDASLEDAKK	225	sp|Q99497|PARK7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:4	ms_run[2]:scan=5618	37.826	2	1658.8185	1658.8185	R	E	49	64
PSM	EKPDSDDDLDIASLVTAK	226	sp|Q86V48-2|LUZP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	2-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=8977	58.939	2	1942.9774	1942.9774	R	L	655	673
PSM	EVAYLGNEVSDEECLKR	227	sp|Q8NFW8|NEUA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	14-UNIMOD:4	ms_run[2]:scan=6027	40.307	2	2009.9364	2009.9364	K	V	367	384
PSM	EVFGDDSEISKESSGVK	228	sp|O43395|PRPF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=4960	33.892	2	1811.8425	1811.8425	K	K	93	110
PSM	GDVVLQSDHVIETLTK	229	sp|O00159-2|MYO1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	16-UNIMOD:188	ms_run[2]:scan=8633	56.841	2	1758.9459	1758.9459	K	T	955	971
PSM	GIVDQSQQAYQEAFEISKK	230	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	18-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=8701	57.259	2	2180.1152	2180.1152	K	E	140	159
PSM	GLESTTLADKDGEIYCK	231	sp|P21291|CSRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	16-UNIMOD:4	ms_run[2]:scan=5234	35.552	2	1898.8932	1898.8932	K	G	152	169
PSM	GPSAAGEQEPDKESGASVDEVAR	232	sp|P50579-3|MAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=3228	23.335	2	2285.0408	2285.0408	K	Q	47	70
PSM	GYAEVVVASENSVHK	233	sp|Q8N684-2|CPSF7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	15-UNIMOD:188	ms_run[2]:scan=5434	36.742	2	1593.8094	1593.8094	K	L	126	141
PSM	ITSENPDEGFKPSSGTVQELNFR	234	sp|O00763-3|ACACB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=7534	50.006	2	2551.2191	2551.2191	R	S	451	474
PSM	KDENESSAPADGEGGSELQPK	235	sp|Q15554|TERF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=2107	16.42	3	2143.9505	2143.9505	R	N	375	396
PSM	KVEEAEPEEFVVEK	236	sp|Q13185|CBX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=5268	35.748	2	1660.8196	1660.8196	K	V	21	35
PSM	KVEEAEPEEFVVEK	237	sp|Q13185|CBX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=5271	35.766	2	1660.8196	1660.8196	K	V	21	35
PSM	KVEEAEPEEFVVEK	238	sp|Q13185|CBX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=5270	35.762	2	1672.8598	1672.8598	K	V	21	35
PSM	LGPQASSQVVMPPLVR	239	sp|Q86YP4-2|P66A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=8458	55.765	2	1677.9236	1677.9236	K	G	234	250
PSM	LQTLVSEQPNKDVVEQMEK	240	sp|Q86UP2-2|KTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	11-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=6896	45.561	2	2226.1605	2226.1605	K	C	717	736
PSM	MGPAMGPALGAGIER	241	sp|P52272-2|HNRPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:35	ms_run[2]:scan=6115	40.827	2	1442.701	1442.7010	R	M	553	568
PSM	MIQDGKGDVTITNDGATILK	242	sp|P50991|TCPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:35	ms_run[2]:scan=6095	40.709	2	2105.0674	2105.0674	K	Q	60	80
PSM	NAQAIEDMVGYAQETQHEK	243	sp|Q99460-2|PSMD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	8-UNIMOD:35,19-UNIMOD:188	ms_run[2]:scan=4851	33.224	2	2182.9896	2182.9896	K	I	525	544
PSM	NLEAVETLGSTSTICSDKTGTLTQNR	244	sp|P05023-2|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	15-UNIMOD:4	ms_run[2]:scan=7400	49.114	3	2795.3607	2795.3607	K	M	360	386
PSM	NLNPVFGGSGPALTGLR	245	sp|P40818-2|UBP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=9510	62.234	2	1668.8948	1668.8948	R	N	658	675
PSM	QLQQAQAAGAEQEVEKFTK	246	sp|P39748-2|FEN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	16-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=7163	47.533	2	2115.0999	2115.0999	K	R	46	65
PSM	QSAQLTALAAQQQAAGKEEK	247	sp|Q96A49|SYAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	17-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=4578	31.577	2	2082.1108	2082.1108	K	S	211	231
PSM	QTIDNSQGAYQEAFDISKK	248	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=6412	42.582	2	2142.0229	2142.0229	K	E	140	159
PSM	SGTTSESGALSLEPSHIGDLQK	249	sp|Q7Z417|NUFP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	22-UNIMOD:188	ms_run[2]:scan=6956	45.986	2	2219.1013	2219.1013	K	A	582	604
PSM	SNPSENEEKEAQSQLIK	250	sp|Q13217|DNJC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=4371	30.314	2	1929.928	1929.9280	K	S	134	151
PSM	SSPVDLVTATDQKVEK	251	sp|P29218-2|IMPA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=6106	40.774	2	1715.8941	1715.8941	K	M	37	53
PSM	TAEELMNFSKGEENLMDAQVK	252	sp|P50990-3|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	16-UNIMOD:35	ms_run[2]:scan=7908	52.37	3	2399.0985	2399.0985	K	A	188	209
PSM	TEIIPDRDGSDPYQEPK	253	sp|Q99447-2|PCY2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=4821	33.048	2	1958.9222	1958.9222	K	R	232	249
PSM	TGQEVVFVAEPDNKNVYK	254	sp|P04844-2|RPN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=5948	39.823	2	2036.0215	2036.0215	K	F	411	429
PSM	TITLEVEPSDTIENVKAK	255	sp|P62987|RL40_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	16-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=7199	47.758	2	1998.0924	1998.0924	K	I	12	30
PSM	TQVEASEESALNHLQNPGDAAEGR	256	sp|Q9Y605|MOFA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=6420	42.632	3	2522.1633	2522.1633	K	A	69	93
PSM	TTSPPEVSGYSYEKTER	257	sp|P46821|MAP1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=4077	28.53	2	1929.8956	1929.8956	K	S	1963	1980
PSM	TYDATTHFETTCDDIK	258	sp|P50395-2|GDIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	12-UNIMOD:4	ms_run[2]:scan=4953	33.85	2	1916.8098	1916.8098	R	N	358	374
PSM	VEKAPQETYADIGGLDNQIQEIK	259	sp|P62191-2|PRS4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:188,23-UNIMOD:188	ms_run[2]:scan=8565	56.424	3	2570.3267	2570.3267	K	E	103	126
PSM	VEPADASGTEKAFEPATGR	260	sp|P49189|AL9A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=4597	31.694	2	1931.9225	1931.9225	R	V	20	39
PSM	VTVGDITCTGEGTSKK	261	sp|O75569-3|PRKRA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	8-UNIMOD:4	ms_run[2]:scan=3883	27.362	2	1651.8087	1651.8087	R	L	45	61
PSM	AAGEPIKEGDNDYFTCITK	262	sp|Q99543|DNJC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	16-UNIMOD:4	ms_run[1]:scan=6596	43.64655666666666	2	2127.983619	2127.978286	K	A	125	144
PSM	DVAEAKPELSLLGDGDH	263	sp|Q2TAA2|IAH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=7602	50.44044	2	1764.847731	1764.853008	R	-	232	249
PSM	QLAPAPGGTHVVALVPAR	264	sp|Q562E7|WDR81_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:28	ms_run[1]:scan=8076	53.399771666666666	2	1735.9717	1735.9728	R	W	44	62
PSM	AAESVSKPDVSEEAPGPSK	265	sp|Q9BY42|RTF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=2818	20.803	2	1883.9113	1883.9113	K	V	204	223
PSM	ADAGKEGNNPAENGDAK	266	sp|P05204|HMGN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	5-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=539	6.3337	2	1668.7742	1668.7742	K	T	60	77
PSM	AGNEKEEGETADTVGCCSLR	267	sp|P11387|TOP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	16-UNIMOD:4,17-UNIMOD:4	ms_run[2]:scan=3246	23.448	3	2181.9267	2181.9267	R	V	489	509
PSM	AKTGGAYGEDLGADYNLSQVCDGK	268	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	21-UNIMOD:4	ms_run[2]:scan=6828	44.981	3	2488.1176	2488.1176	R	V	2448	2472
PSM	ALELDPDNETYKSNLK	269	sp|O43765|SGTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	12-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=5788	38.864	2	1860.9508	1860.9508	K	I	185	201
PSM	ALSETVVEESDPKPAFSK	270	sp|Q8IWT6|LRC8A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=5757	38.671	2	1932.968	1932.9680	R	M	172	190
PSM	ALVSGKPAESSAVAATEK	271	sp|O95182|NDUA7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=3289	23.719	2	1714.9101	1714.9101	K	K	75	93
PSM	AMEALATAEQACKEK	272	sp|Q9P2E9|RRBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	12-UNIMOD:4	ms_run[2]:scan=4661	32.088	2	1649.7753	1649.7753	K	L	1027	1042
PSM	AMEVDERPTEQYSDIGGLDK	273	sp|P17980|PRS6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	7-UNIMOD:267,20-UNIMOD:188	ms_run[2]:scan=6355	42.231	3	2268.0551	2264.0669	K	Q	174	194
PSM	AQAVLEEDHYGMEDVK	274	sp|P36776-3|LONM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=5568	37.51	2	1832.8251	1832.8251	R	K	287	303
PSM	ASEAKEGEEAGPGDPLLEAVPK	275	sp|Q16543|CDC37_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=7298	48.43	3	2193.0801	2193.0801	K	T	348	370
PSM	ASEAKEGEEAGPGDPLLEAVPK	276	sp|Q16543|CDC37_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	5-UNIMOD:188,22-UNIMOD:188	ms_run[2]:scan=7300	48.442	2	2205.1204	2205.1204	K	T	348	370
PSM	CADDSETANYISAHTK	277	sp|O95376|ARI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:4	ms_run[2]:scan=4003	28.097	2	1781.7526	1781.7526	K	D	280	296
PSM	DASDDLDDLNFFNQKK	278	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=9672	63.245	2	1883.8537	1883.8537	K	K	65	81
PSM	DCAVKPCQSDEVPDGIK	279	sp|Q96HE7|ERO1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=4324	30.037	2	1916.8608	1916.8608	R	S	98	115
PSM	DLDIIDNYDYSHTVK	280	sp|O75369-6|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:188	ms_run[2]:scan=8048	53.231	2	1815.8622	1815.8622	K	Y	895	910
PSM	DSQFLVSSVTDDDFGKK	281	sp|Q6ZNB6-2|NFXL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=8094	53.512	2	1886.8898	1886.8898	K	D	194	211
PSM	DVDAAYMNKVELEAK	282	sp|P13647|K2C5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	9-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=6410	42.571	2	1706.8588	1706.8588	K	V	278	293
PSM	DVEVTKEEFAQSAIR	283	sp|O75746-2|CMC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=5922	39.669	2	1720.8632	1720.8632	K	Y	138	153
PSM	EAKPGAAEPEVGVPSSLSPSSPSSSWTETDVEER	284	sp|Q6L8Q7-2|PDE12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=7929	52.497	3	3498.6274	3498.6274	K	V	200	234
PSM	EGKPTIVEEDDPELFK	285	sp|O75937|DNJC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=6924	45.758	2	1844.9044	1844.9044	K	Q	144	160
PSM	EGSASTEVLRTEAEQCK	286	sp|O75643|U520_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	16-UNIMOD:4	ms_run[2]:scan=3839	27.095	2	1893.8738	1893.8738	R	N	754	771
PSM	EKEAEDGIIAYDDCGVK	287	sp|O75534-2|CSDE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:188,14-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=5295	35.898	2	1922.897	1922.8970	K	L	420	437
PSM	ETEVGDPAGNELAEPEAKR	288	sp|Q96G46-2|DUS3L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=4299	29.884	2	2010.9494	2010.9494	R	I	56	75
PSM	GDVVLQSDHVIETLTK	289	sp|O00159-2|MYO1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=8640	56.885	2	1752.9258	1752.9258	K	T	955	971
PSM	IAAESSENVDCPENPKIK	290	sp|Q32MZ4-3|LRRF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	11-UNIMOD:4	ms_run[2]:scan=3344	24.057	2	1999.9521	1999.9521	K	L	578	596
PSM	IEQVDKEDEITEK	291	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=2812	20.769	2	1574.7675	1574.7675	K	K	445	458
PSM	ILEQEEEEEQAGKPGEPSK	292	sp|Q9BXP5-5|SRRT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=3221	23.29	2	2126.0015	2126.0015	R	K	231	250
PSM	IYEFPETDDEEENKLVK	293	sp|Q16181-2|SEPT7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=7008	46.363	2	2096.979	2096.9790	K	K	221	238
PSM	KAAAPAPEEEMDECEQALAAEPK	294	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	11-UNIMOD:35,14-UNIMOD:4	ms_run[2]:scan=4759	32.674	3	2500.1098	2500.1098	K	A	253	276
PSM	KAAAPAPEEEMDECEQALAAEPK	295	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	14-UNIMOD:4	ms_run[2]:scan=7120	47.216	2	2484.1149	2484.1149	K	A	253	276
PSM	KDENESSAPADGEGGSELQPK	296	sp|Q15554|TERF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=2138	16.632	3	2155.9908	2155.9908	R	N	375	396
PSM	LDQEVAEVDKNIELLK	297	sp|Q99816-2|TS101_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=8836	58.07	2	1854.9939	1854.9939	R	K	172	188
PSM	LEQENDDLAHELVTSK	298	sp|B7ZAP0|RBG10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	16-UNIMOD:188	ms_run[2]:scan=6083	40.641	2	1845.9052	1845.9052	R	I	26	42
PSM	LFIYNPTTGEFLGR	299	sp|P54709|AT1B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	14-UNIMOD:267	ms_run[2]:scan=10770	70.066	2	1636.8489	1636.8489	K	T	18	32
PSM	LNEQASEEILKVEQK	300	sp|Q01105-3|SET_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=6019	40.259	2	1756.9207	1756.9207	R	Y	33	48
PSM	LSEIDVSSEGVKGAK	301	sp|Q96C19|EFHD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	12-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=4226	29.447	2	1529.834	1529.8340	R	S	177	192
PSM	LTEDKETLQYLQQNAK	302	sp|Q9BSJ2|GCP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	5-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=5886	39.454	2	1933.0195	1933.0195	K	E	88	104
PSM	LTGSSAQEEASGVALGEAPDHSYESLR	303	sp|Q13011|ECH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=6862	45.274	3	2760.2838	2760.2838	R	V	33	60
PSM	LYLDELEGGGNPGASCKDTSGEIK	304	sp|Q9HD26-2|GOPC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	16-UNIMOD:4,17-UNIMOD:188,24-UNIMOD:188	ms_run[2]:scan=7220	47.902	3	2521.2045	2521.2045	R	V	385	409
PSM	MEDSVGCLETAEEVKR	305	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	7-UNIMOD:4	ms_run[2]:scan=5381	36.418	2	1851.8343	1851.8343	K	K	1373	1389
PSM	NADQVEKNIVDTEAK	306	sp|O60437|PEPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	7-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=4449	30.8	2	1684.8671	1684.8671	K	M	37	52
PSM	NAYNQGLECDHGDDEGGDDGVSPK	307	sp|Q14571|ITPR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	9-UNIMOD:4	ms_run[2]:scan=3663	26.03	2	2548.0045	2548.0045	K	D	2079	2103
PSM	NEEPSEEEIDAPKPK	308	sp|Q9NR30|DDX21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=2957	21.664	2	1722.8351	1722.8351	K	K	117	132
PSM	NQDECIVALHDCNGDVNK	309	sp|Q5T6F2|UBAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	5-UNIMOD:4,12-UNIMOD:4,18-UNIMOD:188	ms_run[2]:scan=4643	31.978	2	2105.9202	2105.9202	K	A	67	85
PSM	QIEETKPLLGGDVSAPEGTK	310	sp|Q8IY22|CMIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=5582	37.595	2	2068.0688	2068.0688	R	M	15	35
PSM	SADESGQALLAAGHYASDEVR	311	sp|Q13813-2|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=7452	49.471	3	2145.9927	2145.9927	K	E	419	440
PSM	SDILKDPPSEANSIQSANATTK	312	sp|Q8N488|RYBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=5124	34.876	2	2286.1339	2286.1339	K	T	115	137
PSM	SGTTSESGALSLEPSHIGDLQK	313	sp|Q7Z417|NUFP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=6959	46.008	2	2213.0812	2213.0812	K	A	582	604
PSM	SLYVAEYHSEPVEDEKP	314	sp|P26196|DDX6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	16-UNIMOD:188	ms_run[2]:scan=5662	38.092	2	1996.9361	1996.9361	K	-	467	484
PSM	SSVKTPETVVPTAPELQPSTSTDQPVTPEPTSQATR	315	sp|Q14676-3|MDC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=6980	46.159	3	3762.88	3762.8800	R	G	1153	1189
PSM	TAEELMNFSKGEENLMDAQVK	316	sp|P50990-3|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:35	ms_run[2]:scan=8082	53.439	2	2399.0985	2399.0985	K	A	188	209
PSM	TAEELMNFSKGEENLMDAQVK	317	sp|P50990-3|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	10-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=9374	61.376	3	2395.1438	2395.1438	K	A	188	209
PSM	TALINSTGEGSHCSSSGDPAEYNLR	318	sp|P02545-3|LMNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:4,25-UNIMOD:267	ms_run[2]:scan=5412	36.606	3	2632.1699	2632.1699	R	S	528	553
PSM	TEDEVLTSKGDAWAK	319	sp|Q9BQ61|TRIR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	9-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=5063	34.513	2	1660.8347	1660.8347	K	Y	138	153
PSM	TGQEYKPGNPPAEIGQNISSNSSASILESK	320	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:188,30-UNIMOD:188	ms_run[2]:scan=7318	48.563	3	3114.5508	3114.5508	K	S	795	825
PSM	TIGGGDDSFNTFFSETGAGK	321	sp|P68363-2|TBA1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	20-UNIMOD:188	ms_run[2]:scan=9933	64.871	2	2012.9059	2012.9059	K	H	41	61
PSM	TLSDDLDEAAKEFQEK	322	sp|Q9H0A0-2|NAT10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=9928	64.836	2	1837.8582	1837.8582	K	H	860	876
PSM	TLSDDLDEAAKEFQEK	323	sp|Q9H0A0-2|NAT10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	11-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=9927	64.829	2	1849.8984	1849.8984	K	H	860	876
PSM	TLTTVQGIADDYDKK	324	sp|P41567|EIF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=6055	40.472	2	1666.8414	1666.8414	K	K	43	58
PSM	TTDMAPSKETEMALAK	325	sp|P27816-2|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	8-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=4629	31.886	2	1734.8571	1734.8571	K	D	247	263
PSM	TTSLCAGPSASKNEYEK	326	sp|Q9BWU0|NADAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	5-UNIMOD:4	ms_run[2]:scan=2516	18.964	2	1841.8465	1841.8465	K	S	726	743
PSM	TVKQEQINTEPLEDTVLSPTK	327	sp|O15446|RPA34_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=7579	50.293	2	2369.2326	2369.2326	K	K	268	289
PSM	VIDPVTGKPCAGTTYLESPLSSETTQLSK	328	sp|Q9Y2R5|RT17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	10-UNIMOD:4	ms_run[2]:scan=8806	57.885	3	3078.5431	3078.5431	K	N	91	120
PSM	VISSIEQKTDTSDK	329	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	8-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=1999	15.754	2	1561.8238	1561.8238	R	K	61	75
PSM	VKEGYVPQEEVPVYENK	330	sp|Q9BRP8-2|PYM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=5438	36.765	2	2005.9997	2005.9997	R	Y	31	48
PSM	VLQATVVAVGSGSK	331	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	14-UNIMOD:188	ms_run[2]:scan=4892	33.48	2	1320.7708	1320.7708	K	G	41	55
PSM	VVESPDFSKDEDYLGK	332	sp|Q9Y6Y8|S23IP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=6401	42.516	2	1826.8574	1826.8574	K	V	923	939
PSM	YADLTEDQLPSCESLKDTIAR	333	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	12-UNIMOD:4	ms_run[2]:scan=8223	54.308	3	2424.1479	2424.1479	R	A	142	163
PSM	YEEIVKEVSTYIK	334	sp|P68104-2|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=8926	58.623	2	1599.8396	1599.8396	R	K	146	159
PSM	YESGDHVAVYPANDSALVNQLGK	335	sp|P16435|NCPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=7701	51.073	3	2446.1765	2446.1765	R	I	314	337
PSM	YYSPCEEHPAETNQNEGSESGTIR	336	sp|Q12774|ARHG5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	5-UNIMOD:4,24-UNIMOD:267	ms_run[2]:scan=3773	26.688	3	2764.1546	2764.1546	R	Q	182	206
PSM	YYTSASGDEMVSLKDYCTR	337	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	10-UNIMOD:35,17-UNIMOD:4	ms_run[2]:scan=5444	36.803	2	2260.9616	2260.9616	R	M	465	484
PSM	DAGEGLLAVQITDQEGKPK	338	sp|O75369|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=7577	50.280586666666665	2	1970.022026	1968.016385	R	R	1546	1565
PSM	IAEFTTNLTEEEEKSK	339	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=5890	39.481565	2	1867.908319	1867.905104	R	S	1001	1017
PSM	IVDGKVVSETNDTK	340	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	5-UNIMOD:188,14-UNIMOD:188	ms_run[1]:scan=2206	17.034546666666667	2	1515.796786	1515.818311	R	V	413	427
PSM	LQAALDDEEAGGRPAMEPGNGSLDLGGDSAGR	341	sp|Q00839|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=7467	49.57696333333334	3	3126.422825	3125.431984	R	S	38	70
PSM	QVQSLTCEVDALKGTNESLER	342	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:28,7-UNIMOD:4	ms_run[1]:scan=9959	65.03760666666666	2	2359.1328	2359.1320	R	Q	322	343
PSM	NGPLEVAGAAVSAGHGLPAK	343	sp|O75367|H2AY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	20-UNIMOD:188	ms_run[1]:scan=8269	54.592319999999994	2	1821.964255	1820.984025	K	F	252	272
PSM	SLLEGQEDHYNNLSASK	344	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=5200	35.34263166666666	2	1904.875318	1903.891185	R	V	382	399
PSM	DVAEAKPELSLLGDGDH	345	sp|Q2TAA2|IAH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	6-UNIMOD:188	ms_run[1]:scan=7601	50.434465	2	1770.867903	1770.873137	R	-	232	249
PSM	TLLVSTSAVDNNEAQKK	346	sp|Q5T8P6|RBM26_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	16-UNIMOD:188,17-UNIMOD:188	ms_run[1]:scan=4470	30.924665	2	1829.989042	1828.993315	K	K	710	727
PSM	QIEETKPLLGGDVSAPEGTK	347	sp|Q8IY22|CMIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:28	ms_run[1]:scan=7549	50.099575	2	2051.0471	2051.0417	R	M	15	35
PSM	SSSLEMTPYNTPQLSPATTPANKK	348	sp|Q14C86|GAPD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=6492	43.051946666666666	2	2563.272704	2562.263569	K	N	452	476
PSM	AATGEEVSAEDLGGADLHCR	349	sp|Q9HCC0|MCCB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	19-UNIMOD:4	ms_run[2]:scan=5399	36.527	3	2056.912	2056.9120	K	K	249	269
PSM	AEAESMYQIKYEELQSLAGK	350	sp|P05787-2|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:35,10-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=8106	53.592	2	2315.1394	2315.1394	R	H	304	324
PSM	AFGPGLQGGSAGSPAR	351	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	16-UNIMOD:267	ms_run[2]:scan=4341	30.142	2	1438.7192	1438.7192	K	F	1072	1088
PSM	AGVYPEKDQAENEDGAQENTFSMDPQLER	352	sp|P50570-3|DYN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	23-UNIMOD:35	ms_run[2]:scan=5711	38.396	3	3283.4211	3283.4211	R	Q	619	648
PSM	ANELPQPPVPEPANAGK	353	sp|P78347-2|GTF2I_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=5840	39.175	2	1727.8842	1727.8842	K	R	286	303
PSM	ASEAKEGEEAGPGDPLLEAVPK	354	sp|Q16543|CDC37_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7446	49.432	3	2193.0801	2193.0801	K	T	348	370
PSM	ATAPVPTVGEGYGYGHESELSQASAAAR	355	sp|Q96PK6-5|RBM14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	28-UNIMOD:267	ms_run[2]:scan=6503	43.12	2	2785.3183	2785.3183	R	N	289	317
PSM	DAGEGLLAVQITDPEGKPK	356	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=8101	53.558	2	1937.0106	1937.0106	K	K	1574	1593
PSM	DASDDLDDLNFFNQKK	357	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	15-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=9667	63.209	2	1895.894	1895.8940	K	K	65	81
PSM	DGKTLNDELEIIEGMK	358	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:188,15-UNIMOD:35,16-UNIMOD:188	ms_run[2]:scan=9017	59.182	2	1831.9276	1831.9276	K	F	203	219
PSM	DKLNINPEDGMADYSDPSYVK	359	sp|Q99459|CDC5L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7537	50.025	2	2370.0686	2370.0686	R	Q	446	467
PSM	DLEDKEGEIQAGAK	360	sp|Q13409-6|DC1I2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=3269	23.595	2	1513.7663	1513.7663	R	L	225	239
PSM	DTSASAVAVGLKQGK	361	sp|P40939|ECHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	12-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=3819	26.972	2	1442.8132	1442.8132	K	V	520	535
PSM	DTSEDIEELVEPVAAHGPK	362	sp|Q99460-2|PSMD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9570	62.603	2	2034.9746	2034.9746	K	I	885	904
PSM	DVDEAYMNKVELESR	363	sp|P05787-2|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	7-UNIMOD:35	ms_run[2]:scan=4697	32.307	2	1812.82	1812.8200	K	L	227	242
PSM	EAGELKPEEEITVGPVQK	364	sp|P53618|COPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=5864	39.323	2	1964.0505	1964.0505	K	L	496	514
PSM	EDKLECSEELGDLVK	365	sp|P53675-2|CLH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:4	ms_run[2]:scan=7104	47.088	2	1762.8295	1762.8295	K	T	454	469
PSM	GGVTGSPEASISGSKGDLK	366	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	15-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=3811	26.922	2	1757.9198	1757.9198	K	S	5726	5745
PSM	ICDQISDAVLDAHLQQDPDAK	367	sp|P31153|METK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:4	ms_run[2]:scan=7899	52.315	3	2351.1063	2351.1063	K	V	33	54
PSM	IDEIKNDNVQDTAEQK	368	sp|P25445-6|TNR6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=2776	20.549	2	1870.9311	1870.9311	K	V	238	254
PSM	KAAAPAPEEEMDECEQALAAEPK	369	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	11-UNIMOD:35,14-UNIMOD:4	ms_run[2]:scan=4764	32.7	2	2500.1098	2500.1098	K	A	253	276
PSM	KAEEATEAQEVVEATPEGACTEPR	370	sp|O75683|SURF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	20-UNIMOD:4	ms_run[2]:scan=5419	36.65	2	2601.1864	2601.1864	R	E	170	194
PSM	LASEKEVVECQSTSTVGGQSVK	371	sp|Q96T23-3|RSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	10-UNIMOD:4	ms_run[2]:scan=3918	27.581	3	2322.1373	2322.1373	K	K	389	411
PSM	LLQTAATAAQQGGQANHPTAAVVTEK	372	sp|P40763-3|STAT3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=4668	32.133	3	2575.3354	2575.3354	R	Q	115	141
PSM	LLQTAATAAQQGGQANHPTAAVVTEK	373	sp|P40763-3|STAT3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	26-UNIMOD:188	ms_run[2]:scan=4679	32.2	2	2581.3556	2581.3556	R	Q	115	141
PSM	MGPAMGPALGAGIER	374	sp|P52272-2|HNRPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:35,15-UNIMOD:267	ms_run[2]:scan=6116	40.831	2	1452.7093	1452.7093	R	M	553	568
PSM	MGPAMGPALGAGIER	375	sp|P52272-2|HNRPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=6826	44.966	2	1426.7061	1426.7061	R	M	553	568
PSM	MKSSSSVTTSETQPCTPSSSDYSDLQR	376	sp|P50552|VASP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:35,15-UNIMOD:4	ms_run[2]:scan=4393	30.457	3	2981.2866	2981.2866	R	V	320	347
PSM	MNPGDLQWMTAGR	377	sp|O00625|PIR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:35,13-UNIMOD:267	ms_run[2]:scan=7721	51.199	2	1501.6681	1501.6681	K	G	85	98
PSM	NLNPVFGGSGPALTGLR	378	sp|P40818-2|UBP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	17-UNIMOD:267	ms_run[2]:scan=9509	62.228	2	1678.903	1678.9030	R	N	658	675
PSM	NSVKVDELSLYSVPEGQSK	379	sp|Q9BUR5-2|MIC26_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7268	48.233	2	2078.0532	2078.0532	K	Y	33	52
PSM	QLQQAQAAGAEQEVEKFTK	380	sp|P39748-2|FEN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7124	47.239	2	2103.0596	2103.0596	K	R	46	65
PSM	SAADDSEAKSNELTR	381	sp|P12270-2|TPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=1317	11.303	2	1592.7278	1592.7278	K	A	291	306
PSM	SAPDTELVNVTHLNTEVK	382	sp|Q9NYV4-3|CDK12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	18-UNIMOD:188	ms_run[2]:scan=7667	50.852	2	1972.0209	1972.0209	K	N	455	473
PSM	SATKVTADVINAAEK	383	sp|O43175|SERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=4794	32.884	2	1528.8499	1528.8499	R	L	55	70
PSM	SAVEAQNEVTENPKQK	384	sp|Q32MZ4-3|LRRF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=1413	11.901	2	1770.8748	1770.8748	K	I	562	578
PSM	SDQDYILKEGDLVK	385	sp|Q9UQ80-2|PA2G4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=6917	45.716	2	1621.8199	1621.8199	K	I	40	54
PSM	SHVEDGDIAGAPASSPEAPPAEQDPVQLK	386	sp|Q9P2E9|RRBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=6003	40.163	3	2911.3836	2911.3836	K	T	1263	1292
PSM	SNTPILVDGKDVMPEVNK	387	sp|P06744|G6PI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	10-UNIMOD:188,13-UNIMOD:35,18-UNIMOD:188	ms_run[2]:scan=5442	36.791	2	1983.0386	1983.0386	R	V	107	125
PSM	SSEEQQQDVSEFTHK	388	sp|Q96RU2-3|UBP28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=3396	24.375	2	1777.7755	1777.7755	R	L	248	263
PSM	SSPGQPEAGPEGAQERPSQAAPAVEAEGPGSSQAPR	389	sp|P40222|TXLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=4280	29.769	3	3483.6251	3483.6251	K	K	18	54
PSM	TAEELMNFSKGEENLMDAQVK	390	sp|P50990-3|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	16-UNIMOD:35	ms_run[2]:scan=7912	52.392	2	2399.0985	2399.0985	K	A	188	209
PSM	TATPEIVDNKDGTVTVR	391	sp|O75369-6|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=5076	34.59	2	1814.9374	1814.9374	K	Y	1747	1764
PSM	TDQAQKAEGAGDAK	392	sp|P05204|HMGN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=479	5.9706	2	1400.6934	1400.6934	K	-	77	91
PSM	TEDEVLTSKGDAWAK	393	sp|Q9BQ61|TRIR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=5054	34.459	2	1648.7944	1648.7944	K	Y	138	153
PSM	TGQEYKPGNPPAEIGQNISSNSSASILESK	394	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7328	48.629	3	3102.5106	3102.5106	K	S	795	825
PSM	TLTTVQGIADDYDKK	395	sp|P41567|EIF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=6053	40.461	2	1678.8816	1678.8816	K	K	43	58
PSM	TQQQVEAEVTNIKK	396	sp|Q9H9Q2-2|CSN7B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=4172	29.106	2	1614.8577	1614.8577	R	T	98	112
PSM	TQSSASLAASYAAQQHPQAAASYR	397	sp|Q96PK6|RBM14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=5135	34.948	2	2464.1731	2464.1731	R	G	518	542
PSM	TQVEASEESALNHLQNPGDAAEGR	398	sp|Q9Y605|MOFA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=6425	42.658	2	2522.1633	2522.1633	K	A	69	93
PSM	TTKIPCDSPQSDPVDTPTSTK	399	sp|P46013|KI67_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:188,6-UNIMOD:4,21-UNIMOD:188	ms_run[2]:scan=3704	26.272	3	2286.1088	2286.1088	K	Q	1246	1267
PSM	TYVDPHTYEDPNQAVLK	400	sp|P29317|EPHA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	17-UNIMOD:188	ms_run[2]:scan=5764	38.718	2	1994.9681	1994.9681	K	F	587	604
PSM	VAQPTITDNKDGTVTVR	401	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=4441	30.75	2	1813.9534	1813.9534	K	Y	1807	1824
PSM	VAVEYLDPSPEVQKK	402	sp|O43684-2|BUB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=5432	36.732	2	1700.8985	1700.8985	R	K	203	218
PSM	VFQSSTSQEQVYNDCAKK	403	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	15-UNIMOD:4	ms_run[2]:scan=3257	23.516	2	2117.9688	2117.9688	R	I	51	69
PSM	VLQATVVAVGSGSK	404	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=4893	33.485	2	1314.7507	1314.7507	K	G	41	55
PSM	VQSTADIFGDEEGDLFKEK	405	sp|Q641Q2-2|WAC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9449	61.852	2	2127.0008	2127.0008	K	A	476	495
PSM	VVSSIEQKTEGAEK	406	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	8-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=1886	15.063	2	1515.8183	1515.8183	R	K	61	75
PSM	YEEALSQLEESVKEER	407	sp|Q8N8A6|DDX51_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=8234	54.377	2	1937.9218	1937.9218	R	K	646	662
PSM	YVQLPADEVDTQLLQDAARK	408	sp|Q9Y333|LSM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9350	61.222	2	2272.1699	2272.1699	R	E	69	89
PSM	IISANGCKVDNSSLTGESEPQTR	409	sp|P05023|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	7-UNIMOD:4	ms_run[1]:scan=4546	31.37765	3	2463.157788	2462.170731	R	S	205	228
PSM	LQAALDDEEAGGRPAMEPGNGSLDLGGDSAGR	410	sp|Q00839|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	16-UNIMOD:35	ms_run[1]:scan=6384	42.41298833333334	3	3142.419301	3141.426899	R	S	38	70
PSM	QTIDNSQGAYQEAFDISKK	411	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:28	ms_run[1]:scan=7859	52.06178	2	2124.9877	2124.9959	K	E	140	159
PSM	TSALSDETKNNWEVSALSR	412	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	9-UNIMOD:188,19-UNIMOD:267	ms_run[1]:scan=7092	47.000535	2	2124.031128	2123.046574	K	A	802	821
PSM	CLTTDEYDGHSTYPSHQYQ	413	sp|P30043|BLVRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=6630	43.84663	2	2283.9062	2283.9010	R	-	188	207
PSM	AEAESMYQIKYEELQSLAGK	414	sp|P05787-2|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:35	ms_run[2]:scan=8100	53.552	3	2303.0991	2303.0991	R	H	304	324
PSM	AEAGPEGVAPAPEGEKK	415	sp|Q9Y4L1|HYOU1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	16-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=1906	15.179	2	1647.8507	1647.8507	K	Q	670	687
PSM	AEETSSPVIGELWSPDQTAEASHVSR	416	sp|Q86XL3-2|ANKL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=8883	58.353	3	2782.3046	2782.3046	R	Y	483	509
PSM	AGAAGGPEEEAEKPVK	417	sp|Q8WW12-2|PCNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	13-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=1500	12.521	2	1550.7979	1550.7979	R	T	17	33
PSM	AIDSSNLKDDYSTAQR	418	sp|Q5JVF3-3|PCID2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=3902	27.48	2	1782.8384	1782.8384	R	V	171	187
PSM	APGPWDPLASAAGLK	419	sp|O75190-4|DNJB6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:188	ms_run[2]:scan=10256	66.871	2	1455.7817	1455.7817	R	E	239	254
PSM	DCAVKPCQSDEVPDGIK	420	sp|Q96HE7|ERO1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:4,5-UNIMOD:188,7-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=4333	30.092	2	1928.9011	1928.9011	R	S	98	115
PSM	DGKNATTDALTSVLTK	421	sp|Q12955-6|ANK3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7377	48.963	2	1633.8523	1633.8523	R	I	666	682
PSM	DGSNKSGAEEQGPIDGPSK	422	sp|O43493-6|TGON2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=1371	11.629	2	1871.8497	1871.8497	K	S	121	140
PSM	DQTKAQAAAPASVPAQAPK	423	sp|P47914|RL29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=2585	19.389	2	1848.9694	1848.9694	K	R	131	150
PSM	DTSEDIEELVEPVAAHGPK	424	sp|Q99460-2|PSMD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	19-UNIMOD:188	ms_run[2]:scan=9567	62.585	2	2040.9947	2040.9947	K	I	885	904
PSM	DYTSGAMLTGELKK	425	sp|P23381|SYWC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	13-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=6029	40.318	2	1524.7897	1524.7897	K	A	419	433
PSM	EGATVYATGTHAQVEDGR	426	sp|P32322-2|P5CR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	18-UNIMOD:267	ms_run[2]:scan=2945	21.587	2	1870.8685	1870.8685	R	L	130	148
PSM	ENLSDEDKLNNAK	427	sp|Q14651|PLSI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=2236	17.219	2	1488.7056	1488.7056	R	Y	573	586
PSM	EQLDPDELETITMHK	428	sp|Q9NYU2-2|UGGG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	13-UNIMOD:35	ms_run[2]:scan=7522	49.925	2	1813.8404	1813.8404	R	I	620	635
PSM	EQTEGEYSSLEHESAR	429	sp|O43837-2|IDH3B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=3525	25.156	2	1850.7919	1850.7919	R	G	165	181
PSM	EVEAQLPEKVEYVIK	430	sp|P51532-5|SMCA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7638	50.673	2	1772.956	1772.9560	K	C	983	998
PSM	FLPMFLSDNPNPK	431	sp|O15118-2|NPC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10288	67.063	2	1518.7541	1518.7541	R	C	680	693
PSM	GLESTTLADKDGEIYCK	432	sp|P21291|CSRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	10-UNIMOD:188,16-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=5306	35.965	2	1910.9334	1910.9334	K	G	152	169
PSM	GPSAAGEQEPDKESGASVDEVAR	433	sp|P50579-3|MAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=3212	23.236	3	2285.0408	2285.0408	K	Q	47	70
PSM	GSLGSQGAKDEPEEELQK	434	sp|Q13428-2|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	9-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=3369	24.213	2	1912.9417	1912.9417	K	G	1329	1347
PSM	GTVPDDAVEALADSLGKK	435	sp|P20810-3|ICAL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10257	66.877	2	1784.9156	1784.9156	K	E	309	327
PSM	IIPGFMCQGGDFTR	436	sp|Q9Y536|PAL4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:35,7-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=7431	49.332	2	1623.7413	1623.7413	R	H	56	70
PSM	IIPGFMCQGGDFTR	437	sp|Q9Y536|PAL4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:35,7-UNIMOD:4	ms_run[2]:scan=7432	49.337	2	1613.733	1613.7330	R	H	56	70
PSM	IIPGFMCQGGDFTR	438	sp|Q9Y536|PAL4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:4	ms_run[2]:scan=8710	57.314	2	1597.7381	1597.7381	R	H	56	70
PSM	IIPGFMCQGGDFTR	439	sp|Q9Y536|PAL4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:4	ms_run[2]:scan=8882	58.348	2	1597.7381	1597.7381	R	H	56	70
PSM	IQAGEVSQPSKEQLEK	440	sp|Q9BRP8-2|PYM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	11-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=3092	22.503	2	1781.9562	1781.9562	R	L	170	186
PSM	IVADKDYSVTANSK	441	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=2452	18.559	2	1509.7675	1509.7675	K	I	78	92
PSM	KAAAPAPEEEMDECEQALAAEPK	442	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:4	ms_run[2]:scan=6987	46.209	2	2484.1149	2484.1149	K	A	253	276
PSM	KIIEENITSAAPSNDQDGEYCPEVK	443	sp|P78362|SRPK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	21-UNIMOD:4	ms_run[2]:scan=5910	39.598	2	2806.2967	2806.2967	R	L	300	325
PSM	LQAALDDEEAGGRPAMEPGNGSLDLGGDSAGR	444	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	16-UNIMOD:35	ms_run[2]:scan=6320	42.02	3	3141.4269	3141.4269	R	S	38	70
PSM	LQTLVSEQPNKDVVEQMEK	445	sp|Q86UP2-2|KTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6875	45.372	2	2214.1202	2214.1202	K	C	717	736
PSM	MGLAMGGGGGASFDR	446	sp|P52272-2|HNRPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:35,5-UNIMOD:35,15-UNIMOD:267	ms_run[2]:scan=3533	25.207	2	1424.6052	1424.6052	R	A	568	583
PSM	NPFGNAGLLLGEAGK	447	sp|P49748-2|ACADV_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:188	ms_run[2]:scan=9865	64.44	2	1462.7876	1462.7876	K	Q	471	486
PSM	NQVTATKADGGTQVIDTK	448	sp|P09622-2|DLDH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=2673	19.935	2	1845.9432	1845.9432	K	N	61	79
PSM	NTVSQSISGDPEIDKK	449	sp|Q9BY44-2|EIF2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=3642	25.904	2	1716.853	1716.8530	R	I	307	323
PSM	QITSYGETCPGLEQYAIKK	450	sp|P50990-3|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	9-UNIMOD:4	ms_run[2]:scan=6497	43.081	2	2185.0725	2185.0725	K	F	349	368
PSM	SGCENPPIVSKDWDNEYCSNECVVK	451	sp|O94842-3|TOX4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:4,11-UNIMOD:188,18-UNIMOD:4,22-UNIMOD:4,25-UNIMOD:188	ms_run[2]:scan=7133	47.302	3	2997.2982	2997.2982	R	H	549	574
PSM	SIAEEQYSDLEKEK	452	sp|O75116|ROCK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	12-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=4713	32.401	2	1679.8293	1679.8293	R	I	930	944
PSM	SLYVAEYHSEPVEDEKP	453	sp|P26196|DDX6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=5667	38.124	3	1990.916	1990.9160	K	-	467	484
PSM	SNASTLESHETEEPAAK	454	sp|Q9UJA5-4|TRM6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=2013	15.836	2	1799.8174	1799.8174	K	K	302	319
PSM	SPDVGLYGVIPECGETYHSDLAEAK	455	sp|P46940|IQGA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	13-UNIMOD:4	ms_run[2]:scan=8912	58.532	3	2706.2483	2706.2483	R	K	648	673
PSM	SQPDPVDTPTSSKPQSK	456	sp|P46013|KI67_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	13-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=1329	11.371	2	1809.9147	1809.9147	R	R	1496	1513
PSM	SSPVDLVTATDQKVEK	457	sp|P29218-2|IMPA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	13-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=6109	40.789	2	1727.9344	1727.9344	K	M	37	53
PSM	STELPGKNESTIEQIDK	458	sp|Q05209-2|PTN12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=4691	32.27	2	1887.9426	1887.9426	K	K	282	299
PSM	TDQAQKAEGAGDAK	459	sp|P05204|HMGN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=480	5.9759	2	1388.6532	1388.6532	K	-	77	91
PSM	TEISDKITSELVSK	460	sp|Q14008-2|CKAP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7086	46.962	2	1548.8247	1548.8247	R	I	855	869
PSM	TEISDKITSELVSK	461	sp|Q14008-2|CKAP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=7085	46.956	2	1560.8649	1560.8649	R	I	855	869
PSM	TEMEDLMSSKDDVGK	462	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	10-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=5755	38.662	2	1695.7734	1695.7734	R	S	1504	1519
PSM	TENLNDDEKLNNAK	463	sp|P13796|PLSL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=1931	15.333	2	1616.7642	1616.7642	K	Y	571	585
PSM	TQQQVEAEVTNIKK	464	sp|Q9H9Q2-2|CSN7B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	13-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=4173	29.111	2	1626.898	1626.8980	R	T	98	112
PSM	TSSNADKSLQESLQK	465	sp|Q13464|ROCK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=2961	21.687	2	1634.8111	1634.8111	R	T	416	431
PSM	TTDMAPSKETEMALAK	466	sp|P27816-2|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=4634	31.92	2	1722.8168	1722.8168	K	D	247	263
PSM	TTETQVLVASAQKK	467	sp|P12081-3|HARS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	13-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=3836	27.078	2	1514.8707	1514.8707	R	L	346	360
PSM	TTKSPSDSGYSYETIGK	468	sp|P46821|MAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=3928	27.642	3	1819.8476	1819.8476	R	T	1912	1929
PSM	VFQSSTSQEQVYNDCAKK	469	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:4,17-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=3250	23.47	2	2130.009	2130.0090	R	I	51	69
PSM	VIQQSLEQEEAEHK	470	sp|O75116|ROCK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=3326	23.945	2	1666.8162	1666.8162	K	A	696	710
PSM	VVNQGTGKDLDPNNVIIEQEER	471	sp|Q9NP64-2|NO40_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6063	40.522	3	2466.235	2466.2350	K	R	65	87
PSM	YAVGEECDFEVGKEK	472	sp|Q9UIG0-2|BAZ1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:4,13-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=5172	35.171	2	1770.8173	1770.8173	K	M	114	129
PSM	YISLIYTNYEAGKDDYVK	473	sp|P09211|GSTP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=8611	56.71	2	2154.0521	2154.0521	K	A	104	122
PSM	YSVDIPLDKTVVNK	474	sp|P61353|RL27_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6978	46.147	2	1589.8665	1589.8665	R	D	85	99
PSM	ALAENSGVKANEVISK	475	sp|P50990|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=3804	26.87614166666667	2	1629.856501	1628.873350	R	L	451	467
PSM	IISANGCKVDNSSLTGESEPQTR	476	sp|P05023|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	7-UNIMOD:4	ms_run[1]:scan=4548	31.387845000000002	2	2463.157870	2462.170731	R	S	205	228
PSM	THSVNGITEEADPTIYSGK	477	sp|O75534|CSDE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	19-UNIMOD:188	ms_run[1]:scan=5376	36.382601666666666	2	2024.965452	2023.979394	K	V	582	601
PSM	NGPLEVAGAAVSAGHGLPAK	478	sp|O75367|H2AY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=8261	54.543634999999995	2	1815.943566	1814.963896	K	F	252	272
PSM	KAAAPAPEEEMDECEQALAAEPK	479	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	1-UNIMOD:188,14-UNIMOD:4,23-UNIMOD:188	ms_run[1]:scan=6986	46.203131666666664	2	2496.154640	2496.155114	K	A	253	276
PSM	SLLEGQEDHYNNLSASK	480	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	17-UNIMOD:188	ms_run[1]:scan=5093	34.69244833333333	2	1910.896300	1909.911314	R	V	382	399
PSM	NQDECVIALHDCNGDVNR	481	sp|Q14157|UBP2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	5-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=4961	33.898228333333336	2	2129.891062	2127.906200	K	A	64	82
PSM	LANYTNLSQGVVEHEEDEESR	482	sp|Q9Y666|S12A7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=6577	43.53895333333333	3	2418.099715	2418.093526	K	R	89	110
PSM	FGGNPGGFGNQGGFGNSR	483	sp|Q13148|TADBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=6044	40.406753333333334	2	1726.748607	1725.760780	R	G	276	294
PSM	VLVNDAQKVTEGQQER	484	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	8-UNIMOD:188,16-UNIMOD:267	ms_run[1]:scan=3386	24.31495333333333	2	1829.948128	1828.961388	R	L	312	328
PSM	VLVNDAQKVTEGQQER	485	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=3388	24.326023333333335	2	1813.917735	1812.932990	R	L	312	328
PSM	IISTTASKTETPIVSK	486	sp|O95292|VAPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	8-UNIMOD:188,16-UNIMOD:188	ms_run[1]:scan=3571	25.448485	2	1686.976620	1686.980625	K	S	140	156
PSM	GTYTTDDSPSDIAEIRLDK	487	sp|O75592|MYCB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=7082	46.93304666666667	2	2096.976330	2095.990959	K	V	1801	1820
PSM	AATGEEVSAEDLGGADLHCR	488	sp|Q9HCC0|MCCB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	19-UNIMOD:4	ms_run[1]:scan=5418	36.644373333333334	2	2056.885095	2056.911997	K	K	249	269
PSM	AADCEVEQWDSDEPIPAKELER	489	sp|Q9UBQ7|GRHPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:4	ms_run[2]:scan=7962	52.704	3	2586.1544	2586.1544	R	G	26	48
PSM	ADDKLIAEEGVDSLNVK	490	sp|O95202|LETM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=7081	46.927	3	1826.9664	1826.9664	K	E	357	374
PSM	ADELSEKQVYDAHTK	491	sp|Q03135-2|CAV1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:1	ms_run[2]:scan=4574	31.549	2	1774.8374	1774.8374	M	E	2	17
PSM	AKTGGAYGEDLGADYNLSQVCDGK	492	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:188,21-UNIMOD:4,24-UNIMOD:188	ms_run[2]:scan=6837	45.045	3	2500.1579	2500.1579	R	V	2448	2472
PSM	ALDAEEEACLHSCAGK	493	sp|Q9Y5J6|T10B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	9-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=4030	28.257	2	1759.7505	1759.7505	R	L	40	56
PSM	AQTEGINISEEALNHLGEIGTK	494	sp|Q9Y265|RUVB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	22-UNIMOD:188	ms_run[2]:scan=9869	64.469	2	2329.1857	2329.1857	R	T	379	401
PSM	ASITPGTILIILTGR	495	sp|Q02878|RL6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=12807	91.581	2	1524.9239	1524.9239	R	H	142	157
PSM	AVEEEDKMTPEQLAIK	496	sp|O00487|PSDE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:188,8-UNIMOD:35,16-UNIMOD:188	ms_run[2]:scan=4398	30.486	2	1857.9433	1857.9433	K	N	258	274
PSM	AVGVPALGFSPMNR	497	sp|Q03154-2|ACY1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:267	ms_run[2]:scan=9069	59.497	2	1424.7474	1424.7474	R	T	282	296
PSM	AVSEAQEKLTESNQK	498	sp|Q16512-3|PKN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=1822	14.643	2	1660.8268	1660.8268	K	L	249	264
PSM	CADDSETANYISAHTK	499	sp|O95376|ARI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=3998	28.069	3	1787.7728	1787.7728	K	D	280	296
PSM	CVSVQTDPTDEIPTKK	500	sp|P18583-8|SON_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:4,15-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=4396	30.475	2	1828.9279	1828.9279	R	S	92	108
PSM	DGPNALTPPPTTPEWIK	501	sp|P05023-2|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	17-UNIMOD:188	ms_run[2]:scan=8648	56.936	2	1838.951	1838.9510	R	F	75	92
PSM	DHTLEDEDVIQIVK	502	sp|Q9Y295|DRG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:188	ms_run[2]:scan=7930	52.504	2	1658.8459	1658.8459	K	K	353	367
PSM	DKGGINLTATCPQSELDAETVK	503	sp|Q9Y295|DRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:188,11-UNIMOD:4,22-UNIMOD:188	ms_run[2]:scan=6923	45.752	2	2358.1776	2358.1776	K	S	185	207
PSM	DSETGENIRQAASSLQQASLK	504	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7544	50.071	3	2232.0982	2232.0982	K	L	626	647
PSM	DSGPPPSTVSEAEFEDIMKR	505	sp|Q8N684-2|CPSF7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9143	59.954	2	2191.0103	2191.0103	R	N	315	335
PSM	DSSGNLHGYVAEGGAK	506	sp|Q8IZ83-3|A16A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	16-UNIMOD:188	ms_run[2]:scan=2967	21.726	2	1566.737	1566.7370	R	D	498	514
PSM	DYDVDHPGEADSVLR	507	sp|Q8IX01-4|SUGP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=5410	36.595	2	1686.7485	1686.7485	R	G	190	205
PSM	DYTSGAMLTGELKK	508	sp|P23381|SYWC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6037	40.365	2	1512.7494	1512.7494	K	A	419	433
PSM	EASKQADVNLVNAK	509	sp|O43175|SERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=2537	19.091	2	1485.7787	1485.7787	K	L	381	395
PSM	EDEEESLNEVGYDDIGGCRK	510	sp|P55072|TERA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	18-UNIMOD:4	ms_run[2]:scan=6065	40.533	2	2312.9703	2312.9703	R	Q	192	212
PSM	EGIVTATEQEVKEDIAK	511	sp|Q12931-2|TRAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8854	58.181	2	1858.9524	1858.9524	R	L	397	414
PSM	EGKPTIVEEDDPELFK	512	sp|O75937|DNJC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7058	46.771	2	1844.9044	1844.9044	K	Q	144	160
PSM	ESDVPLKTEEFEVTK	513	sp|Q969H8|MYDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6038	40.37	2	1749.8673	1749.8673	R	T	131	146
PSM	ETKPEPMEEDLPENK	514	sp|P31948-3|STIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=3935	27.687	2	1784.8138	1784.8138	K	K	184	199
PSM	FGQGGAGPVGGQGPR	515	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	15-UNIMOD:267	ms_run[2]:scan=2870	21.133	2	1350.6668	1350.6668	R	G	667	682
PSM	FGQGGAGPVGGQGPR	516	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=2871	21.138	2	1340.6585	1340.6585	R	G	667	682
PSM	GAVAEDGDELRTEPEAK	517	sp|P27695|APEX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=3192	23.116	2	1785.8381	1785.8381	K	K	8	25
PSM	GFGFVDFNSEEDAK	518	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:188	ms_run[2]:scan=9217	60.408	2	1566.6934	1566.6934	K	A	611	625
PSM	GVVDEQANSAALKEQLK	519	sp|Q6ZMI0-4|PPR21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=5043	34.389	2	1798.9425	1798.9425	K	M	30	47
PSM	IIPGFMCQGGDFTR	520	sp|Q9Y536|PAL4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=8709	57.31	2	1607.7464	1607.7464	R	H	56	70
PSM	ISLEYSELQDKVTSAETK	521	sp|O75150-3|BRE1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7651	50.753	3	2040.0263	2040.0263	R	V	254	272
PSM	ITESVAETAQTIKK	522	sp|Q96A49|SYAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=3788	26.778	2	1529.8703	1529.8703	K	S	72	86
PSM	KAAAPAPEEEMDECEQALAAEPK	523	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:188,11-UNIMOD:35,14-UNIMOD:4,23-UNIMOD:188	ms_run[2]:scan=4763	32.694	2	2512.15	2512.1500	K	A	253	276
PSM	LDADKYENDPELEK	524	sp|Q9BV57|MTND_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=4189	29.21	2	1689.8136	1689.8136	K	I	41	55
PSM	LGAGEGGEASVSPEKTSTTSK	525	sp|Q13428-2|TCOF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=2035	15.969	2	1991.9647	1991.9647	K	G	1290	1311
PSM	LGPQASSQVVMPPLVR	526	sp|Q86YP4-2|P66A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	16-UNIMOD:267	ms_run[2]:scan=8434	55.612	2	1687.9319	1687.9319	K	G	234	250
PSM	LLETPYHCEAGAATDAEATEADGADGR	527	sp|Q9BVL4|SELO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	8-UNIMOD:4	ms_run[2]:scan=5651	38.02	3	2790.2039	2790.2039	K	Q	622	649
PSM	LQAALDDEEAGGRPAMEPGNGSLDLGGDSAGR	528	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:267,16-UNIMOD:35,32-UNIMOD:267	ms_run[2]:scan=6351	42.205	3	3161.4434	3161.4434	R	S	38	70
PSM	LSELDDRADALQAGASQFETSAAK	529	sp|Q15836|VAMP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7992	52.888	3	2493.1983	2493.1983	K	L	43	67
PSM	LVCSGENDNHGQIANLPSAVTSDQK	530	sp|Q8WYP5|ELYS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:4	ms_run[2]:scan=5762	38.702	2	2653.2402	2653.2402	K	S	1626	1651
PSM	MEDSVGCLETAEEVKR	531	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:35,7-UNIMOD:4	ms_run[2]:scan=4728	32.487	3	1867.8292	1867.8292	K	K	1373	1389
PSM	MEVDYSATVDQRLPECAK	532	sp|O00232-2|PSD12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=5703	38.347	2	2126.9613	2126.9613	K	L	16	34
PSM	MNLPGEVTFLPLNK	533	sp|Q9UQE7|SMC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:35	ms_run[2]:scan=9782	63.929	2	1587.8331	1587.8331	K	L	579	593
PSM	MNLPGEVTFLPLNK	534	sp|Q9UQE7|SMC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:35,14-UNIMOD:188	ms_run[2]:scan=9783	63.934	2	1593.8532	1593.8532	K	L	579	593
PSM	NASMNTQHGTATEVAVETTTPK	535	sp|Q9UIG0-2|BAZ1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=3950	27.776	2	2287.075	2287.0750	K	Q	960	982
PSM	NEEEGNSEEIKAK	536	sp|O75844|FACE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	11-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=861	8.3167	2	1487.7142	1487.7142	R	V	304	317
PSM	NEEPSEEEIDAPKPK	537	sp|Q9NR30|DDX21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=2935	21.525	2	1710.7948	1710.7948	K	K	117	132
PSM	NGETVPIDEQFDKEK	538	sp|P33176|KINH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=5037	34.355	2	1759.8667	1759.8667	R	A	370	385
PSM	NLQEGNEVDSQSSIRTEAK	539	sp|O75152|ZC11A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=3240	23.411	2	2104.0033	2104.0033	K	E	522	541
PSM	NTDYTELHQQNTDLIYQTGPK	540	sp|Q8TBA6-2|GOGA5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6251	41.608	2	2478.1663	2478.1663	K	S	39	60
PSM	NTVSQSISGDPEIDKK	541	sp|Q9BY44-2|EIF2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	15-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=3641	25.899	2	1728.8933	1728.8933	R	I	307	323
PSM	SAEEEAADLPTKPTK	542	sp|Q8WW12-2|PCNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=3078	22.418	2	1585.7835	1585.7835	R	I	53	68
PSM	SAVEAQNEVTENPKQK	543	sp|Q32MZ4-3|LRRF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=1425	11.987	2	1782.9151	1782.9151	K	I	562	578
PSM	SEIGEKQDTELQEK	544	sp|Q5SW79-2|CE170_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=2096	16.352	2	1632.7843	1632.7843	R	E	569	583
PSM	SGGELDIVVTSNKEVK	545	sp|Q96M27-4|PRRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=5607	37.754	2	1673.8836	1673.8836	K	V	254	270
PSM	SIAEEQYSDLEKEK	546	sp|O75116|ROCK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=4716	32.418	2	1667.789	1667.7890	R	I	930	944
PSM	SLYVAEYHSEPVEDEKP	547	sp|P26196|DDX6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=5660	38.08	2	1990.916	1990.9160	K	-	467	484
PSM	SNTPILVDGKDVMPEVNK	548	sp|P06744|G6PI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:35	ms_run[2]:scan=5446	36.815	2	1970.9983	1970.9983	R	V	107	125
PSM	SQAPCANKDEADLSSK	549	sp|Q96SK2-3|TM209_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:4,8-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=1466	12.286	2	1731.8136	1731.8136	R	Q	297	313
PSM	SSCPLANSQYATIKEEK	550	sp|Q9BXY0|MAK16_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:4	ms_run[2]:scan=4675	32.172	2	1924.92	1924.9200	R	G	42	59
PSM	SSGPPPPSGSSGSEAAAGAGAAAPASQHPATGTGAVQTEAMK	551	sp|Q14444-2|CAPR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=4310	29.948	3	3702.718	3702.7180	K	Q	14	56
PSM	TAGVKVETTEDLVAK	552	sp|P38117|ETFB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=4533	31.296	2	1559.8407	1559.8407	R	L	234	249
PSM	TAVEHATDEDILAK	553	sp|P50851-2|LRBA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=4207	29.328	2	1511.7468	1511.7468	K	G	2011	2025
PSM	TIEESEETLKNTK	554	sp|O95347-2|SMC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	10-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=3090	22.493	2	1532.7972	1532.7972	K	E	751	764
PSM	TITLEVEPSDTIENVKAK	555	sp|P62987|RL40_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7205	47.795	2	1986.0521	1986.0521	K	I	12	30
PSM	TPLLLMLGQEDR	556	sp|P13798|ACPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:35	ms_run[2]:scan=9061	59.449	2	1400.7334	1400.7334	K	R	665	677
PSM	TTELVNKDLDIYYK	557	sp|Q92878-3|RAD50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=7148	47.411	2	1725.9228	1725.9228	R	T	974	988
PSM	TVKQEQINTEPLEDTVLSPTK	558	sp|O15446|RPA34_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7574	50.263	3	2369.2326	2369.2326	K	K	268	289
PSM	VCDATYDKAPVEK	559	sp|Q12974-2|TP4A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:4	ms_run[2]:scan=2055	16.092	2	1494.7024	1494.7024	R	E	45	58
PSM	VDQSAVGFEYQGKTEK	560	sp|Q14247-3|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=4152	28.981	2	1796.8984	1796.8984	R	H	132	148
PSM	VESDLKGPEVDIEGPEGK	561	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=5710	38.39	3	1908.9719	1908.9719	K	L	4484	4502
PSM	VIAINVDDPDAANYNDINDVKR	562	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7405	49.148	3	2443.1979	2443.1979	K	L	156	178
PSM	VSSAEGAAKEEPK	563	sp|P05114|HMGN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=756	7.6856	2	1301.6463	1301.6463	K	R	6	19
PSM	VVQVSAGDSHTAALTDDGR	564	sp|P18754|RCC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	19-UNIMOD:267	ms_run[2]:scan=3887	27.386	3	1907.9213	1907.9213	K	V	121	140
PSM	YALYDATYETKESK	565	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=4992	34.087	2	1680.7883	1680.7883	R	K	82	96
PSM	YEEIVKEVSTYIK	566	sp|P68104-2|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=8927	58.628	2	1611.8798	1611.8798	R	K	146	159
PSM	YLMEEDEDAYKK	567	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=4260	29.65	2	1532.6705	1532.6705	R	Q	210	222
PSM	IVADKDYSVTANSK	568	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=2608	19.533776666666665	2	1510.755756	1509.767488	K	I	78	92
PSM	GSGDPSSSSSSGNPLVYLDVDANGKPLGR	569	sp|P30405|PPIF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=9479	62.03419	3	2832.343359	2832.352595	K	V	33	62
PSM	KAAAPAPEEEMDECEQALAAEPK	570	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	1-UNIMOD:188,14-UNIMOD:4,23-UNIMOD:188	ms_run[1]:scan=7156	47.469625	2	2496.154640	2496.155114	K	A	253	276
PSM	GIVNGAAPELPVPTGGPAVGAR	571	sp|P21281|VATB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=8397	55.380476666666674	2	2000.068054	1999.085074	R	E	8	30
PSM	TGQEYKPGNPPAEIGQNISSNSSASILESK	572	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=7529	49.97199833333333	3	3105.490667	3102.510552	K	S	795	825
PSM	ACFSANGEEVLATSTHSK	573	sp|Q9Y5J1|UTP18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	2-UNIMOD:4,18-UNIMOD:188	ms_run[1]:scan=5692	38.27632	2	1914.871635	1913.888470	K	V	301	319
PSM	TKSENGLEFTSSGSANTETTK	574	sp|P21796|VDAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=3758	26.600076666666666	3	2188.991409	2188.013151	K	V	33	54
PSM	CSQEDHCLTSDLEDDRK	575	sp|Q9NZU5|LMCD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:385,1-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=5484	37.03572833333333	3	2089.8310	2089.8312	K	I	52	69
PSM	QAAASATQTIAAAQHAASTPK	576	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:28,21-UNIMOD:188	ms_run[1]:scan=6993	46.247476666666664	2	1983.0104	1983.0112	K	A	923	944
PSM	FGGNPGGFGNQGGFGNSR	577	sp|Q13148|TADBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	18-UNIMOD:267	ms_run[1]:scan=6045	40.41262833333333	2	1736.756318	1735.769049	R	G	276	294
PSM	SPSNGVGSLASKPVDVASDNVK	578	sp|Q9NVV0|TM38B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	12-UNIMOD:188,22-UNIMOD:188	ms_run[1]:scan=5771	38.76034166666667	2	2140.106070	2139.121035	K	K	262	284
PSM	DLTIEKVVINGQEVK	579	sp|P09960|LKHA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	6-UNIMOD:188,15-UNIMOD:188	ms_run[1]:scan=7731	51.25971166666666	2	1696.964909	1695.980959	K	Y	59	74
PSM	NEQNGAAAHVIAEDVK	580	sp|P24928|RPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=4471	30.93068333333333	2	1665.799020	1664.811812	R	L	293	309
PSM	IIPGFMCQGGDFTR	581	sp|Q9Y536|PAL4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	7-UNIMOD:4	ms_run[1]:scan=9116	59.78850166666667	2	1598.723278	1597.738119	R	H	56	70
PSM	AAPEEPQQRPPEAVAAAPAGTTSSR	582	sp|Q96JP5-2|ZFP91_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=3623	25.784	3	2488.2306	2488.2306	K	V	24	49
PSM	ACYLSINPQKDETLETEK	583	sp|P61163|ACTZ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:4,10-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=6356	42.236	3	2150.0604	2150.0604	R	A	221	239
PSM	AEAESMYQIKYEELQSLAGK	584	sp|P05787-2|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	10-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=8961	58.843	2	2299.1445	2299.1445	R	H	304	324
PSM	AEAGPEGVAPAPEGEKK	585	sp|Q9Y4L1|HYOU1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=1895	15.114	2	1635.8104	1635.8104	K	Q	670	687
PSM	AEETSSPVIGELWSPDQTAEASHVSR	586	sp|Q86XL3-2|ANKL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	26-UNIMOD:267	ms_run[2]:scan=8890	58.399	3	2792.3128	2792.3128	R	Y	483	509
PSM	ASEVEEILDGNDEKYK	587	sp|Q12824-2|SNF5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=7644	50.708	2	1849.8984	1849.8984	K	A	84	100
PSM	ASFPQGPIGGANR	588	sp|O75608-2|LYPA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:267	ms_run[2]:scan=4923	33.668	2	1280.6501	1280.6501	R	D	134	147
PSM	ATPEQYQILKENYGQK	589	sp|P14324-2|FPPS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	10-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=5680	38.202	2	1920.9984	1920.9984	R	E	278	294
PSM	AYTVVGGPPGGPPVR	590	sp|P54792-2|DVLP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	15-UNIMOD:267	ms_run[2]:scan=5358	36.276	2	1432.7702	1432.7702	K	E	617	632
PSM	DQECDKFNQCGTCNEFK	591	sp|Q9UBR2|CATZ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:4,6-UNIMOD:188,10-UNIMOD:4,13-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=4218	29.396	2	2190.8807	2190.8807	K	E	161	178
PSM	DSAQNSVIIVDKNGR	592	sp|P02786|TFR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=3635	25.859	2	1614.8325	1614.8325	K	L	194	209
PSM	DSIGVCAEKQDGYDSLQR	593	sp|Q8IUI8-2|CRLF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:4	ms_run[2]:scan=4950	33.833	3	2039.9218	2039.9218	R	D	327	345
PSM	DTHDQLSEPSEVR	594	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=2869	21.127	2	1511.6852	1511.6852	K	S	3800	3813
PSM	DVDEAYMNKVELESR	595	sp|P05787-2|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6100	40.74	3	1796.8251	1796.8251	K	L	227	242
PSM	DVVICPDASLEDAKK	596	sp|Q99497|PARK7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	5-UNIMOD:4,14-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=5649	38.009	2	1670.8588	1670.8588	R	E	49	64
PSM	EAETFKEQGNAYYAK	597	sp|Q99615|DNJC7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=3468	24.81	2	1747.8053	1747.8053	R	K	27	42
PSM	EASTETKIDVASIK	598	sp|Q13601-2|KRR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=4492	31.056	2	1490.7828	1490.7828	K	E	277	291
PSM	EGQEIASVSDDHTCR	599	sp|Q8NFH4|NUP37_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=2211	17.066	2	1712.7299	1712.7299	K	I	136	151
PSM	ENCMYQACPTQDCNKK	600	sp|P27694|RFA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:4,8-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=2018	15.869	2	2045.8064	2045.8064	K	V	474	490
PSM	ENDQLDFIVETEGLKK	601	sp|Q9C040|TRIM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	15-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=8942	58.723	2	1888.9821	1888.9821	R	S	295	311
PSM	ETENVKSSEEIESAFR	602	sp|Q13813-2|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5909	39.592	2	1853.8643	1853.8643	R	A	2404	2420
PSM	EVVAEVVKAPQVVAEAAK	603	sp|O60832|DKC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	8-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=7536	50.019	2	1848.0759	1848.0759	K	T	426	444
PSM	FCPSGAWELPGTPR	604	sp|Q8WUA4-2|TF3C2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:4	ms_run[2]:scan=8676	57.105	2	1573.7347	1573.7347	K	K	475	489
PSM	GNTAEGCVHETQEK	605	sp|Q9BQG0|MBB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:4	ms_run[2]:scan=818	8.0586	2	1558.6682	1558.6682	K	Q	936	950
PSM	GSLGSQGAKDEPEEELQK	606	sp|Q13428-2|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=3377	24.261	2	1900.9014	1900.9014	K	G	1329	1347
PSM	IIPGFMCQGGDFTR	607	sp|Q9Y536|PAL4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:35,7-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=7281	48.322	2	1623.7413	1623.7413	R	H	56	70
PSM	IIPGFMCQGGDFTR	608	sp|Q9Y536|PAL4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=8881	58.344	2	1607.7464	1607.7464	R	H	56	70
PSM	IIPGFMCQGGDFTR	609	sp|Q9Y536|PAL4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=8720	57.366	3	1607.7464	1607.7464	R	H	56	70
PSM	ILCFYGPPGVGK	610	sp|P36776-3|LONM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:4,12-UNIMOD:188	ms_run[2]:scan=8219	54.281	2	1312.6945	1312.6945	K	T	322	334
PSM	ISTETEETEGSLHCCK	611	sp|Q9Y4E8-2|UBP15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:4,15-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=2637	19.711	2	1885.8129	1885.8129	K	D	591	607
PSM	IVSSSDVGHDEYSTQSLVK	612	sp|Q01082|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	19-UNIMOD:188	ms_run[2]:scan=5167	35.139	3	2056.0056	2056.0056	K	K	766	785
PSM	LAALALASSENSSSTPEECEEMSEKPK	613	sp|O00567|NOP56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	19-UNIMOD:4	ms_run[2]:scan=6431	42.699	3	2894.3161	2894.3161	R	K	454	481
PSM	LEQIAAEQKANPDGK	614	sp|Q9UKM9-2|RALY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=2300	17.602	2	1622.8667	1622.8667	R	K	192	207
PSM	LKTPGVDAPSWLEEQ	615	sp|P53367-3|ARFP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8749	57.538	2	1668.8359	1668.8359	K	-	179	194
PSM	LYQPEYQEVSTEEQREEISGK	616	sp|Q9Y4L1|HYOU1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5931	39.719	2	2541.1871	2541.1871	K	L	754	775
PSM	MALVLEALPQIAAK	617	sp|Q14254|FLOT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:35	ms_run[2]:scan=10203	66.546	2	1482.848	1482.8480	K	I	357	371
PSM	MFVGGLSWDTSK	618	sp|Q99729-3|ROAA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:35,12-UNIMOD:188	ms_run[2]:scan=7973	52.771	2	1348.6429	1348.6429	K	K	72	84
PSM	MGLAMGGGGGASFDR	619	sp|P52272-2|HNRPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:35,5-UNIMOD:35	ms_run[2]:scan=3532	25.201	2	1414.5969	1414.5969	R	A	568	583
PSM	MGPSGAALGVLILR	620	sp|Q8N1F8|S11IP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:35	ms_run[2]:scan=10152	66.236	2	1369.7752	1369.7752	R	G	227	241
PSM	MLENTDNSSPSTEHSQGLEK	621	sp|Q96H79|ZCCHL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:35	ms_run[2]:scan=1939	15.382	2	2218.9648	2218.9648	K	Q	249	269
PSM	MLENTDNSSPSTEHSQGLEK	622	sp|Q96H79|ZCCHL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:35,20-UNIMOD:188	ms_run[2]:scan=1940	15.388	2	2224.9849	2224.9849	K	Q	249	269
PSM	MTQLVLPGMVER	623	sp|Q53GQ0|DHB12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:35	ms_run[2]:scan=8214	54.255	2	1388.7156	1388.7156	K	S	168	180
PSM	NDHDDDEDEEVISK	624	sp|Q12789-3|TF3C1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:188	ms_run[2]:scan=1965	15.541	2	1664.6745	1664.6745	R	T	342	356
PSM	NETGGGEGIEVLKNEPYEK	625	sp|P48739|PIPNB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5869	39.351	2	2061.9855	2061.9855	K	D	32	51
PSM	NQDECIVALHDCNGDVNK	626	sp|Q5T6F2|UBAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	5-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=4648	32.006	2	2099.9001	2099.9001	K	A	67	85
PSM	NQVTATKADGGTQVIDTK	627	sp|P09622-2|DLDH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=2679	19.973	3	1857.9835	1857.9835	K	N	61	79
PSM	NSESESNKVAAETQSPSLFGSTK	628	sp|Q9UKX7-2|NUP50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	8-UNIMOD:188,23-UNIMOD:188	ms_run[2]:scan=5591	37.653	2	2409.1698	2409.1698	R	L	179	202
PSM	NSVQTPVENSTNSQHQVK	629	sp|Q9UHI6|DDX20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=1719	14.003	2	1995.961	1995.9610	K	E	548	566
PSM	QEEEMMAKEEELVK	630	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	8-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=5783	38.837	2	1733.8254	1733.8254	R	V	843	857
PSM	QITSYGETCPGLEQYAIKK	631	sp|P50990-3|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:4,18-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=6500	43.103	2	2197.1128	2197.1128	K	F	349	368
PSM	QLVSDEDKAQLASK	632	sp|P09001|RM03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	8-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=2993	21.887	2	1542.8292	1542.8292	K	L	63	77
PSM	QNEAAKEAETPQAK	633	sp|Q14978|NOLC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=808	7.9965	2	1513.7372	1513.7372	K	K	588	602
PSM	SATKVTADVINAAEK	634	sp|O43175|SERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=4799	32.913	2	1516.8097	1516.8097	R	L	55	70
PSM	SEISENTDASGKIEK	635	sp|Q9UHB6|LIMA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	12-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=2150	16.708	2	1618.8089	1618.8089	K	Y	175	190
PSM	SEPVKEESSELEQPFAQDTSSVGPDR	636	sp|Q15424-2|SAFB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6804	44.789	3	2847.3046	2847.3046	K	K	158	184
PSM	SLSDSESDDSKSK	637	sp|Q13185|CBX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=596	6.6911	2	1383.6001	1383.6001	K	K	93	106
PSM	SNIGTEGGPPPFVPFGQK	638	sp|Q9H7E2|TDRD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8703	57.271	2	1827.9155	1827.9155	R	C	80	98
PSM	SSFYPDGGDQETAKTGK	639	sp|Q9NYF8-3|BCLF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=2978	21.791	2	1798.8412	1798.8412	R	F	317	334
PSM	STITEIKECADEPVGK	640	sp|Q92896|GSLG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:4	ms_run[2]:scan=5028	34.301	2	1775.8611	1775.8611	K	G	182	198
PSM	TAEELMNFSKGEENLMDAQVK	641	sp|P50990-3|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	10-UNIMOD:188,16-UNIMOD:35,21-UNIMOD:188	ms_run[2]:scan=7938	52.553	2	2411.1387	2411.1387	K	A	188	209
PSM	TAGVKVETTEDLVAK	642	sp|P38117|ETFB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	5-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=4553	31.421	2	1571.8809	1571.8809	R	L	234	249
PSM	TDDEQFADEKNYLIK	643	sp|Q9H9S4|CB39L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	10-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=6474	42.946	2	1839.8929	1839.8929	R	Q	313	328
PSM	TDDEQFADEKNYLIK	644	sp|Q9H9S4|CB39L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6469	42.915	2	1827.8527	1827.8527	R	Q	313	328
PSM	TEAANVEKITTK	645	sp|Q92900-2|RENT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	8-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=2305	17.635	2	1315.7386	1315.7386	R	L	768	780
PSM	TEGSLEDWDIAVQKTETR	646	sp|Q15020-4|SART3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8271	54.604	2	2076.9964	2076.9964	R	L	519	537
PSM	TEMEDLMSSKDDVGK	647	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:35	ms_run[2]:scan=3512	25.072	2	1699.7281	1699.7281	R	S	1504	1519
PSM	TETQEKNTLPTK	648	sp|P63313|TYB10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=947	8.8228	2	1388.7147	1388.7147	K	E	21	33
PSM	TGENVEDAFLEAAKK	649	sp|P61106|RAB14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=7941	52.571	2	1632.8398	1632.8398	K	I	157	172
PSM	TGLYNYYDDEKEK	650	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	11-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=4731	32.509	2	1648.7659	1648.7659	R	L	240	253
PSM	TGNSEKETALPSTK	651	sp|Q6UN15-4|FIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=1218	10.642	2	1461.7311	1461.7311	R	A	226	240
PSM	TLLVSTSAVDNNEAQKK	652	sp|Q5T8P6-5|RBM26_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=4468	30.914	2	1816.9531	1816.9531	K	K	237	254
PSM	TLSTSDDVEDRENEK	653	sp|Q96A65-2|EXOC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=1864	14.927	2	1736.7701	1736.7701	R	G	30	45
PSM	TQSSASLAASYAAQQHPQAAASYR	654	sp|Q96PK6|RBM14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	24-UNIMOD:267	ms_run[2]:scan=5127	34.898	3	2474.1814	2474.1814	R	G	518	542
PSM	TTETQVLVASAQKK	655	sp|P12081-3|HARS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=3838	27.089	2	1502.8304	1502.8304	R	L	346	360
PSM	TYVDPHTYEDPNQAVLK	656	sp|P29317|EPHA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5761	38.696	2	1988.948	1988.9480	K	F	587	604
PSM	VAVEYLDPSPEVQKK	657	sp|O43684-2|BUB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=5427	36.699	2	1712.9388	1712.9388	R	K	203	218
PSM	VDCTANTNTCNKYGVSGYPTLK	658	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=5352	36.244	3	2462.1206	2462.1206	K	I	83	105
PSM	VDNEILDYKDLAAIPK	659	sp|O14639-4|ABLM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=9282	60.797	2	1828.0021	1828.0021	K	V	34	50
PSM	VEEEEERNQILQNEK	660	sp|P35580|MYH10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=3360	24.157	2	1885.9017	1885.9017	R	K	931	946
PSM	VEKAPQETYADIGGLDNQIQEIK	661	sp|P62191-2|PRS4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8567	56.436	3	2558.2864	2558.2864	K	E	103	126
PSM	VEKEEAGGGISEEEAAQYDR	662	sp|Q9UBE0-2|SAE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=4071	28.497	3	2165.9713	2165.9713	M	Q	2	22
PSM	VIQQSLEQEEAEHK	663	sp|O75116|ROCK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:188	ms_run[2]:scan=3317	23.889	2	1672.8364	1672.8364	K	A	696	710
PSM	VISSIEQKTDTSDK	664	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=1993	15.714	2	1549.7835	1549.7835	R	K	61	75
PSM	YADLTEDQLPSCESLKDTIAR	665	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	12-UNIMOD:4	ms_run[2]:scan=8226	54.326	2	2424.1479	2424.1479	R	A	142	163
PSM	YALYDATYETKESK	666	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	11-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=4982	34.028	2	1692.8285	1692.8285	R	K	82	96
PSM	YESLTDPSKLDSGK	667	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=4465	30.9	2	1538.7464	1538.7464	R	E	61	75
PSM	YLMEEDEDAYKK	668	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	11-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=4252	29.603	2	1544.7107	1544.7107	R	Q	210	222
PSM	YSGSEGSTQTLTKGELK	669	sp|P25815|S100P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=3527	25.167	2	1784.8792	1784.8792	R	V	18	35
PSM	AFGPGLQGGSAGSPAR	670	sp|P21333|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=4346	30.16834166666667	2	1428.713438	1428.710976	K	F	1072	1088
PSM	ALAENSGVKANEVISK	671	sp|P50990|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	9-UNIMOD:188,16-UNIMOD:188	ms_run[1]:scan=3803	26.870351666666668	2	1641.893459	1640.913608	R	L	451	467
PSM	ANVDISAPKVDTNAPDLSLEGPEGK	672	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	9-UNIMOD:188,25-UNIMOD:188	ms_run[1]:scan=7764	51.46529666666667	3	2549.304213	2548.305935	K	L	1025	1050
PSM	QLDDKDEEINQQSQLVEK	673	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:28,5-UNIMOD:188,18-UNIMOD:188	ms_run[1]:scan=5954	39.86365833333333	2	2153.0547	2153.0522	K	L	431	449
PSM	NQDECVIALHDCNGDVNR	674	sp|Q14157|UBP2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	5-UNIMOD:4,12-UNIMOD:4,18-UNIMOD:267	ms_run[1]:scan=4962	33.904363333333336	2	2138.896965	2137.914469	K	A	64	82
PSM	DGKYSQVLANGLDNK	675	sp|P62269|RS18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	3-UNIMOD:188,15-UNIMOD:188	ms_run[1]:scan=4911	33.59451666666667	2	1633.836835	1632.851008	K	L	92	107
PSM	INSAPQQIEVFPPFR	676	sp|Q8TEM1|PO210_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=10105	65.95294666666666	2	1741.916219	1741.915155	R	L	1068	1083
PSM	YYSPCEEHPAETNQNEGSESGTIR	677	sp|Q12774|ARHG5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	5-UNIMOD:4	ms_run[1]:scan=3760	26.611901666666665	3	2755.142269	2754.146367	R	Q	182	206
PSM	ATPEQYQILKENYGQK	678	sp|P14324|FPPS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=5682	38.213975	2	1908.971674	1908.958142	R	E	344	360
PSM	DDGYSTKDSYSSR	679	sp|P38159|RBMX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=1182	10.430365	2	1479.615953	1479.611381	R	D	211	224
PSM	ALAAAGYDVEKNNSR	680	sp|Q02539|H11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0		ms_run[1]:scan=3273	23.618116666666666	2	1578.7612	1577.7792	K	I	68	83
PSM	IIPGFMCQGGDFTR	681	sp|Q9Y536|PAL4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	7-UNIMOD:4	ms_run[1]:scan=9227	60.469033333333336	2	1598.723278	1597.738119	R	H	56	70
PSM	DIMEDTIEDKLDTK	682	sp|P61764|STXB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=7960	52.686615	2	1664.772063	1664.781483	K	H	484	498
PSM	AADCEVEQWDSDEPIPAKELER	683	sp|Q9UBQ7|GRHPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:4	ms_run[2]:scan=7968	52.738	2	2586.1544	2586.1544	R	G	26	48
PSM	AEAESMYQIKYEELQSLAGK	684	sp|P05787-2|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8960	58.837	2	2287.1042	2287.1042	R	H	304	324
PSM	AMEALATAEQACKEK	685	sp|Q9P2E9|RRBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:4,13-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=4663	32.099	2	1661.8155	1661.8156	K	L	1027	1042
PSM	ASITPGTILIILTGR	686	sp|Q02878|RL6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	15-UNIMOD:267	ms_run[2]:scan=12806	91.576	2	1534.9322	1534.9322	R	H	142	157
PSM	DAHSQGEVVSCLEK	687	sp|Q92896|GSLG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:4	ms_run[2]:scan=4038	28.302	2	1557.7093	1557.7093	K	G	259	273
PSM	DAINQGMDEELERDEK	688	sp|P11177-3|ODPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5547	37.386	2	1890.8265	1890.8265	R	V	37	53
PSM	DDEENYLDLFSHK	689	sp|Q07666-3|KHDR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9468	61.967	2	1623.7053	1623.7053	K	N	140	153
PSM	DDSTKLELALTGGEAK	690	sp|Q92667-2|AKAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7295	48.409	2	1646.8363	1646.8363	R	S	126	142
PSM	DECLLPCKDAPELGYAK	691	sp|Q8TAT6|NPL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:4,7-UNIMOD:4,8-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=7259	48.173	2	1989.9579	1989.9579	R	E	397	414
PSM	DGKLVSESSDVLPK	692	sp|P05787-2|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=5209	35.398	2	1484.8125	1484.8125	R	-	498	512
PSM	DLEDKEGEIQAGAK	693	sp|Q13409-6|DC1I2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=3272	23.613	2	1501.726	1501.7260	R	L	225	239
PSM	DSETGENIRQAASSLQQASLK	694	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7546	50.082	2	2232.0982	2232.0982	K	L	626	647
PSM	DTSASAVAVGLKQGK	695	sp|P40939|ECHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=3815	26.945	2	1430.7729	1430.7729	K	V	520	535
PSM	EASKQADVNLVNAK	696	sp|O43175|SERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=2541	19.118	2	1497.819	1497.8190	K	L	381	395
PSM	EAVKAASDELSK	697	sp|P18206-2|VINC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=1757	14.264	2	1246.6405	1246.6405	R	T	781	793
PSM	EDKLECSEELGDLVK	698	sp|P53675-2|CLH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:188,6-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=7096	47.032	2	1774.8698	1774.8698	K	T	454	469
PSM	EEDAEKAVIDLNNR	699	sp|Q01081-4|U2AF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5284	35.834	2	1614.7849	1614.7849	R	W	47	61
PSM	EGQEIASVSDDHTCR	700	sp|Q8NFH4|NUP37_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:4	ms_run[2]:scan=2213	17.078	2	1702.7217	1702.7217	K	I	136	151
PSM	EQNQDSQTEAEELRK	701	sp|Q8N573-2|OXR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=1689	13.784	2	1803.8235	1803.8235	K	L	483	498
PSM	ESIKAQGATGEVYCPSGEK	702	sp|Q9H1B7|I2BPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:188,14-UNIMOD:4,19-UNIMOD:188	ms_run[2]:scan=3529	25.179	2	2021.9767	2021.9767	R	C	745	764
PSM	ETTGTGPNVYHENDTIAK	703	sp|Q4G0F5|VP26B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=3282	23.675	2	1945.9017	1945.9017	R	Y	213	231
PSM	EVEEDEYKAFYK	704	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5488	37.06	2	1548.6984	1548.6984	K	S	349	361
PSM	EYLSEEVQAVHK	705	sp|Q53GS9-2|SNUT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=4781	32.805	2	1430.7042	1430.7042	R	N	379	391
PSM	FAEFQYLQPGPPR	706	sp|Q8N163-2|CCAR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8538	56.258	2	1548.7725	1548.7725	R	R	405	418
PSM	FAEFQYLQPGPPR	707	sp|Q8N163-2|CCAR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:267	ms_run[2]:scan=8547	56.313	2	1558.7808	1558.7808	R	R	405	418
PSM	FGQAATMEGIGAIGGTPPAFNR	708	sp|Q15233-2|NONO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9426	61.702	2	2162.0579	2162.0579	R	A	346	368
PSM	FYGPEGPYGVFAGR	709	sp|O00264|PGRC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8999	59.074	2	1515.7147	1515.7147	K	D	106	120
PSM	GYDSAGVGFDGGNDKDWEANACK	710	sp|Q06210-2|GFPT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	15-UNIMOD:188,22-UNIMOD:4,23-UNIMOD:188	ms_run[2]:scan=6034	40.351	3	2444.0378	2444.0378	R	I	34	57
PSM	IEQVDKEDEITEK	711	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=2796	20.672	2	1586.8078	1586.8078	K	K	445	458
PSM	IGEEEIQKPEEK	712	sp|Q15459-2|SF3A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	8-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=2418	18.339	2	1439.7546	1439.7546	K	V	423	435
PSM	IGGIGTVPVGR	713	sp|P68104-2|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:267	ms_run[2]:scan=5163	35.118	2	1034.6112	1034.6112	K	V	235	246
PSM	IIPGFMCQGGDFTR	714	sp|Q9Y536|PAL4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:35,7-UNIMOD:4	ms_run[2]:scan=7282	48.328	2	1613.733	1613.7330	R	H	56	70
PSM	ILCFYGPPGVGK	715	sp|P36776-3|LONM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:4	ms_run[2]:scan=8221	54.292	2	1306.6744	1306.6744	K	T	322	334
PSM	IQAGEVSQPSKEQLEK	716	sp|Q9BRP8-2|PYM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=3084	22.457	2	1769.9159	1769.9159	R	L	170	186
PSM	KAAAPAPEEEMDECEQALAAEPK	717	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:4	ms_run[2]:scan=6990	46.231	3	2484.1149	2484.1149	K	A	253	276
PSM	KAAAPAPEEEMDECEQALAAEPK	718	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:4	ms_run[2]:scan=7127	47.262	3	2484.1149	2484.1149	K	A	253	276
PSM	LEEAEKAADESER	719	sp|P09493-2|TPM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=1263	10.91	2	1475.674	1475.6740	K	G	57	70
PSM	LEQIAAEQKANPDGK	720	sp|Q9UKM9-2|RALY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=2308	17.656	2	1610.8264	1610.8264	R	K	192	207
PSM	LGMSADPDNEDATDKVNK	721	sp|O75152|ZC11A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=3452	24.707	2	1918.8578	1918.8578	R	V	335	353
PSM	LISETTSVCKPEQVAK	722	sp|Q06136-2|KDSR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	9-UNIMOD:4,10-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=3736	26.464	2	1800.9694	1800.9694	R	Q	173	189
PSM	LLEENVSAFKTEYDAVAEK	723	sp|Q9NTJ3-2|SMC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8899	58.456	3	2155.0685	2155.0685	K	A	858	877
PSM	LLGPTVMLGGCEFSR	724	sp|Q8N9T8|KRI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:4	ms_run[2]:scan=9956	65.013	2	1635.8113	1635.8113	R	Q	657	672
PSM	LLPSAPQTLPDGPLASPAR	725	sp|O15027-2|SC16A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	19-UNIMOD:267	ms_run[2]:scan=8233	54.371	2	1910.0501	1910.0501	R	V	1949	1968
PSM	LNEQASEEILKVEQK	726	sp|Q01105-3|SET_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=6016	40.245	3	1768.961	1768.9610	R	Y	33	48
PSM	LTSDDVKEQIYK	727	sp|P62277|RS13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=4448	30.795	2	1437.7351	1437.7351	K	L	28	40
PSM	LYEEDDLDRLEQMEDSEGTVR	728	sp|Q86W92-3|LIPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	9-UNIMOD:267,13-UNIMOD:35,21-UNIMOD:267	ms_run[2]:scan=7477	49.645	3	2577.1291	2577.1291	R	Q	797	818
PSM	MEVGPTMVGDEQSDPELMQHLGASK	729	sp|P30047|GFRP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:35	ms_run[2]:scan=7760	51.437	3	2701.2034	2701.2034	R	R	12	37
PSM	MFVLDEADEMLSR	730	sp|P60842-2|IF4A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:35,13-UNIMOD:267	ms_run[2]:scan=10092	65.87	2	1580.709	1580.7090	K	G	178	191
PSM	MGPAMGPALGAGIER	731	sp|P52272-2|HNRPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	5-UNIMOD:35	ms_run[2]:scan=5613	37.794	2	1442.701	1442.7010	R	M	553	568
PSM	MGPAMGPALGAGIER	732	sp|P52272-2|HNRPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	15-UNIMOD:267	ms_run[2]:scan=6846	45.126	2	1436.7144	1436.7144	R	M	553	568
PSM	MLENTDNSSPSTEHSQGLEK	733	sp|Q96H79|ZCCHL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	20-UNIMOD:188	ms_run[2]:scan=2738	20.322	2	2208.99	2208.9900	K	Q	249	269
PSM	MNPGDLQWMTAGR	734	sp|O00625|PIR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:35	ms_run[2]:scan=7719	51.188	2	1491.6599	1491.6599	K	G	85	98
PSM	NGDLDEVKDYVAK	735	sp|P58546|MTPN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5785	38.848	2	1464.7096	1464.7096	K	G	12	25
PSM	NLEAVETLGSTSTICSDKTGTLTQNR	736	sp|P05023-2|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	15-UNIMOD:4	ms_run[2]:scan=7414	49.207	2	2795.3607	2795.3607	K	M	360	386
PSM	NMVDPKDIDDDLEGEVTEECGK	737	sp|Q9UHX1-4|PUF60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:35,6-UNIMOD:188,20-UNIMOD:4,22-UNIMOD:188	ms_run[2]:scan=7681	50.941	3	2535.1031	2535.1031	R	F	408	430
PSM	NMVDPKDIDDDLEGEVTEECGK	738	sp|Q9UHX1-4|PUF60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	20-UNIMOD:4	ms_run[2]:scan=8566	56.43	3	2507.068	2507.0680	R	F	408	430
PSM	NSDEADLVPAKEANVK	739	sp|P83916|CBX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=3834	27.062	2	1710.8827	1710.8827	K	C	140	156
PSM	NSDIEQSSDSKVK	740	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=889	8.4848	2	1435.6791	1435.6791	K	N	2582	2595
PSM	NSVTPDMMEEMYKK	741	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6446	42.787	2	1701.7412	1701.7412	K	A	229	243
PSM	PAASITSKPATLTTTSATSK	742	sp|O43670-3|ZN207_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=3716	26.343	3	1933.0368	1933.0368	K	L	260	280
PSM	QAQEYEALLNIK	743	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8695	57.22	2	1418.7405	1418.7405	R	V	359	371
PSM	QEEEMMAKEEELVK	744	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5782	38.832	2	1721.7852	1721.7852	R	V	843	857
PSM	QTIDNSQGAYQEAFDISKK	745	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6409	42.566	3	2142.0229	2142.0229	K	E	140	159
PSM	QTIDNSQGAYQEAFDISKK	746	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	18-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=6418	42.621	3	2154.0632	2154.0632	K	E	140	159
PSM	SAELNKEVSTNTAMIQTSK	747	sp|P13646-2|K1C13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=4958	33.881	3	2063.0607	2063.0607	K	T	288	307
PSM	SDQDYILKEGDLVK	748	sp|Q9UQ80-2|PA2G4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6791	44.707	2	1621.8199	1621.8199	K	I	40	54
PSM	SDQDYILKEGDLVK	749	sp|Q9UQ80-2|PA2G4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	8-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=6806	44.805	2	1633.8602	1633.8602	K	I	40	54
PSM	SDQDYILKEGDLVK	750	sp|Q9UQ80-2|PA2G4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	8-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=6932	45.823	2	1633.8602	1633.8602	K	I	40	54
PSM	SEEETSPLVTHQNPAGPVASAPELESK	751	sp|P43007-2|SATT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	27-UNIMOD:188	ms_run[2]:scan=6296	41.876	3	2809.3713	2809.3713	K	E	204	231
PSM	SEEQLKEEGIEYK	752	sp|P09622-2|DLDH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=3852	27.172	2	1580.757	1580.7570	K	V	306	319
PSM	SEEQLKEEGIEYK	753	sp|P09622-2|DLDH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=3854	27.188	2	1592.7972	1592.7972	K	V	306	319
PSM	SGGELDIVVTSNKEVK	754	sp|Q96M27-4|PRRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=5606	37.748	2	1685.9238	1685.9238	K	V	254	270
PSM	SNTPILVDGKDVMPEVNK	755	sp|P06744|G6PI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7060	46.782	2	1955.0034	1955.0034	R	V	107	125
PSM	SSPGQPEAGPEGAQERPSQAAPAVEAEGPGSSQAPR	756	sp|P40222|TXLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	16-UNIMOD:267,36-UNIMOD:267	ms_run[2]:scan=4305	29.92	3	3503.6416	3503.6416	K	K	18	54
PSM	STGDVPHTSVTGDSGSGK	757	sp|P40818-2|UBP8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	18-UNIMOD:188	ms_run[2]:scan=1414	11.907	2	1693.7851	1693.7851	K	A	507	525
PSM	SYEPLEDPGVKSVTK	758	sp|P37837|TALDO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5005	34.163	2	1647.8356	1647.8356	K	I	205	220
PSM	TAEEENPEHVEIQK	759	sp|O00566|MPP10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:188	ms_run[2]:scan=2823	20.837	2	1657.7891	1657.7891	K	M	485	499
PSM	TAEELMNFSKGEENLMDAQVK	760	sp|P50990-3|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	10-UNIMOD:188,16-UNIMOD:35,21-UNIMOD:188	ms_run[2]:scan=7935	52.537	3	2411.1387	2411.1387	K	A	188	209
PSM	TAEELMNFSKGEENLMDAQVK	761	sp|P50990-3|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:35,10-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=8111	53.621	2	2411.1387	2411.1387	K	A	188	209
PSM	TAEELMNFSKGEENLMDAQVK	762	sp|P50990-3|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9366	61.324	3	2383.1036	2383.1036	K	A	188	209
PSM	TAEELMNFSKGEENLMDAQVK	763	sp|P50990-3|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	10-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=9379	61.404	2	2395.1438	2395.1438	K	A	188	209
PSM	TEMEDLMSSKDDVGK	764	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5746	38.606	2	1683.7332	1683.7332	R	S	1504	1519
PSM	TGENVEDAFLEAAKK	765	sp|P61106|RAB14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7944	52.592	2	1620.7995	1620.7995	K	I	157	172
PSM	TIEESEETLKNTK	766	sp|O95347-2|SMC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=3093	22.509	2	1520.757	1520.7570	K	E	751	764
PSM	TPEEYPESAKVYEK	767	sp|O94760|DDAH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	10-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=3616	25.74	2	1680.8285	1680.8285	R	L	238	252
PSM	TPEEYPESAKVYEK	768	sp|O94760|DDAH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=3617	25.745	2	1668.7883	1668.7883	R	L	238	252
PSM	TSENLALTGVDHSLPQDGSNAFISQK	769	sp|O60563|CCNT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8253	54.494	2	2728.3304	2728.3304	R	Q	351	377
PSM	TSSGDASSLSIEETNKLR	770	sp|O43290|SNUT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5144	35.005	2	1893.928	1893.9280	K	A	110	128
PSM	TTKSPSDSGYSYETIGK	771	sp|P46821|MAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=3919	27.587	3	1831.8878	1831.8878	R	T	1912	1929
PSM	TTSLCAGPSASKNEYEK	772	sp|Q9BWU0|NADAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	5-UNIMOD:4,12-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=2508	18.915	2	1853.8868	1853.8868	K	S	726	743
PSM	VAETANEEEVKK	773	sp|P61221|ABCE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=843	8.2119	2	1357.7128	1357.7128	K	M	333	345
PSM	VALAGLLGFGLGK	774	sp|Q56VL3|OCAD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=12073	80.644	2	1214.7387	1214.7387	K	V	87	100
PSM	VASLEESEGNKQDLK	775	sp|Q07065|CKAP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=2455	18.581	2	1645.8159	1645.8159	K	A	273	288
PSM	VDQALHTQTDADPAEEYAR	776	sp|P52888|THOP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	19-UNIMOD:267	ms_run[2]:scan=4413	30.575	3	2138.9744	2138.9744	K	L	560	579
PSM	VPFLVLECPNLK	777	sp|Q9NRP0|OSTC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	8-UNIMOD:4	ms_run[2]:scan=10615	69.102	2	1427.7847	1427.7847	R	L	7	19
PSM	VPPVIVLENQGLR	778	sp|Q9Y3B6|EMC9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:267	ms_run[2]:scan=8686	57.164	2	1442.8485	1442.8485	R	W	127	140
PSM	MAEIGEHVAPSEAANSLEQAQAAAER	779	sp|P27708|PYR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:35,26-UNIMOD:267	ms_run[1]:scan=5726	38.47853833333333	3	2706.246006	2705.259041	R	L	522	548
PSM	AVDEMNGKELNGK	780	sp|P11940|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=2439	18.478263333333334	2	1404.656110	1403.671479	K	Q	247	260
PSM	ADAGKEGNNPAENGDAK	781	sp|P05204|HMGN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=519	6.210021666666667	2	1657.721921	1656.733956	K	T	60	77
PSM	IGGGIDVPVPR	782	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	11-UNIMOD:267	ms_run[1]:scan=6392	42.459626666666665	2	1088.622615	1088.621763	R	H	321	332
PSM	DGKYSQVLANGLDNK	783	sp|P62269|RS18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=4906	33.56192333333333	2	1621.796902	1620.810750	K	L	92	107
PSM	QLSAPPADPQLFHVAR	784	sp|P49589-3|SYCC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:28,16-UNIMOD:267	ms_run[1]:scan=8956	58.809693333333335	2	1738.9007	1738.9025	R	W	53	69
PSM	EGKPTIVEEDDPELFK	785	sp|O75937|DNJC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:188,16-UNIMOD:188	ms_run[1]:scan=6919	45.727805	2	1857.948473	1856.944633	K	Q	144	160
PSM	CDSSPDSAEDVRK	786	sp|P02765|FETUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:4	ms_run[1]:scan=864	8.332488333333334	2	1464.616414	1464.615087	K	V	132	145
PSM	TAVEHATDEDILAK	787	sp|P50851-2|LRBA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	14-UNIMOD:188	ms_run[1]:scan=4208	29.333775	2	1517.758100	1517.766881	K	G	2011	2025
PSM	LVAIVDVIDQNR	788	sp|P50914|RL14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=9507	62.20969833333333	2	1353.760199	1353.761615	K	A	24	36
PSM	ESSKVDANEEVEALIVK	789	sp|P33527|MRP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=7841	51.950163333333336	2	1859.951500	1858.952388	K	S	287	304
PSM	QAQEYEALLNIK	790	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	12-UNIMOD:188	ms_run[1]:scan=8691	57.197046666666665	2	1426.763290	1424.760674	R	V	359	371
PSM	IIPGFMCQGGDFTR	791	sp|Q9Y536|PAL4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	7-UNIMOD:4	ms_run[1]:scan=9289	60.84410666666667	2	1598.722223	1597.738119	R	H	56	70
PSM	IGEEEIQKPEEK	792	sp|Q15459|SF3A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	8-UNIMOD:188,12-UNIMOD:188	ms_run[1]:scan=2396	18.183416666666666	2	1439.753983	1439.754648	K	V	488	500
PSM	AAMDNSEIAGEKK	793	sp|Q16891-3|MIC60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=1326	11.356	2	1362.6449	1362.6449	K	S	226	239
PSM	ADEHVIDQGDDGDNFYVIER	794	sp|P13861-2|KAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	20-UNIMOD:267	ms_run[2]:scan=7436	49.362	3	2316.017	2316.0170	K	G	162	182
PSM	AEAESMYQIKYEELQSLAGK	795	sp|P05787-2|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8968	58.885	3	2287.1042	2287.1042	R	H	304	324
PSM	AGLESGAEPGDGDSDTTKK	796	sp|O60832|DKC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	18-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=1391	11.761	2	1845.8631	1845.8631	K	K	481	500
PSM	AGLGHPAAFGR	797	sp|O94760|DDAH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:1,11-UNIMOD:267	ms_run[2]:scan=5235	35.558	2	1104.5704	1104.5704	M	A	2	13
PSM	APGPWDPLASAAGLK	798	sp|O75190-4|DNJB6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10233	66.727	2	1449.7616	1449.7616	R	E	239	254
PSM	ASGTVYSGEEKLTELLVK	799	sp|O95470|SGPL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9669	63.221	2	1923.0201	1923.0201	R	A	145	163
PSM	AVSEAQEKLTESNQK	800	sp|Q16512-3|PKN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	8-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=1819	14.627	2	1672.8671	1672.8671	K	L	249	264
PSM	CIACQNPGKQNQTTSAVSTPASSETSK	801	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:4,4-UNIMOD:4,9-UNIMOD:188,27-UNIMOD:188	ms_run[2]:scan=2826	20.859	3	2863.3479	2863.3479	K	A	1626	1653
PSM	CSQVQQDHLNQTDASATK	802	sp|Q9UJC3-2|HOOK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:4,18-UNIMOD:188	ms_run[2]:scan=1469	12.302	2	2035.9325	2035.9325	R	S	390	408
PSM	DAGEGLLAVQITDPEGKPK	803	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	17-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=8090	53.489	2	1949.0508	1949.0508	K	K	1574	1593
PSM	DCAVKPCQSDEVPDGIK	804	sp|Q96HE7|ERO1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:4,5-UNIMOD:188,7-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=4339	30.131	3	1928.9011	1928.9011	R	S	98	115
PSM	DDEENYLDLFSHK	805	sp|Q07666-3|KHDR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:188	ms_run[2]:scan=9466	61.956	2	1629.7254	1629.7254	K	N	140	153
PSM	DEKTDTLEDLFPTTK	806	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=9172	60.131	2	1763.8868	1763.8868	K	I	467	482
PSM	DKGGINLTATCPQSELDAETVK	807	sp|Q9Y295|DRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:188,11-UNIMOD:4,22-UNIMOD:188	ms_run[2]:scan=6943	45.901	3	2358.1776	2358.1776	K	S	185	207
PSM	DKGGINLTATCPQSELDAETVK	808	sp|Q9Y295|DRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:4	ms_run[2]:scan=6926	45.774	3	2346.1373	2346.1373	K	S	185	207
PSM	DLEAEHVEVEDTTLNR	809	sp|Q9H3K6-2|BOLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	16-UNIMOD:267	ms_run[2]:scan=5908	39.587	3	1878.8835	1878.8835	R	C	15	31
PSM	DMTMFVTASKDNTAK	810	sp|Q13347|EIF3I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	10-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=6128	40.893	2	1670.8047	1670.8047	R	L	199	214
PSM	DQDLTQEIAMEHFVK	811	sp|Q9ULX6-2|AKP8L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8590	56.574	2	1802.8509	1802.8509	R	K	402	417
PSM	DSIDAGSKELQVK	812	sp|Q96C01|F136A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=3840	27.101	2	1388.7147	1388.7147	K	Q	92	105
PSM	DSIDAGSKELQVK	813	sp|Q96C01|F136A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	8-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=3845	27.134	2	1400.755	1400.7550	K	Q	92	105
PSM	DSSGNLHGYVAEGGAK	814	sp|Q8IZ83-3|A16A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=2966	21.721	2	1560.7168	1560.7168	R	D	498	514
PSM	DSYVGDEAQSKR	815	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=1141	10.186	2	1353.6161	1353.6161	K	G	51	63
PSM	DTYIENEKLISGK	816	sp|P04843|RPN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	8-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=5274	35.779	2	1520.8125	1520.8125	K	R	580	593
PSM	DTYIENEKLISGK	817	sp|P04843|RPN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5275	35.784	2	1508.7722	1508.7722	K	R	580	593
PSM	DVIIKSDAPDTLLLEK	818	sp|P53611|PGTB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	5-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=8463	55.792	3	1781.0225	1781.0225	K	H	7	23
PSM	DYQDNKADVILK	819	sp|P47813|IF1AX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=4361	30.256	2	1420.7198	1420.7198	R	Y	83	95
PSM	EAGELKPEEEITVGPVQK	820	sp|P53618|COPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5863	39.317	2	1952.0102	1952.0102	K	L	496	514
PSM	EALPDHEDEIPETVR	821	sp|Q9UPP1-5|PHF8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5199	35.337	2	1748.8217	1748.8217	K	T	411	426
PSM	EATNPPVIQEEKPK	822	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=2542	19.124	2	1590.8656	1590.8656	R	K	483	497
PSM	EEVKEAYMGNVLQGGEGQAPTR	823	sp|P24752|THIL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	8-UNIMOD:35	ms_run[2]:scan=4645	31.989	3	2378.1172	2378.1172	K	Q	84	106
PSM	EGATVYATGTHAQVEDGR	824	sp|P32322-2|P5CR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=2947	21.605	3	1860.8602	1860.8602	R	L	130	148
PSM	EKEDPEPSTDGTYVWK	825	sp|Q9UHG3-2|PCYOX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5096	34.709	2	1879.8476	1879.8476	R	I	314	330
PSM	EKEPVVVETVEEK	826	sp|Q8N5N7-2|RM50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=4352	30.204	2	1513.7876	1513.7876	K	K	33	46
PSM	ENAEQGEVDMESHR	827	sp|P14209-3|CD99_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	14-UNIMOD:267	ms_run[2]:scan=2194	16.966	2	1639.6772	1639.6772	K	N	141	155
PSM	ENAEQGEVDMESHR	828	sp|P14209-3|CD99_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=2193	16.96	2	1629.6689	1629.6689	K	N	141	155
PSM	EQIVPKPEEEVAQK	829	sp|P18621-2|RL17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=3779	26.725	2	1622.8516	1622.8516	K	K	116	130
PSM	EQIVPKPEEEVAQK	830	sp|P18621-2|RL17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	6-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=3781	26.736	2	1634.8918	1634.8918	K	K	116	130
PSM	EQTEGEYSSLEHESAR	831	sp|O43837-2|IDH3B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	16-UNIMOD:267	ms_run[2]:scan=3522	25.138	2	1860.8001	1860.8001	R	G	165	181
PSM	ESESVDKVMDQK	832	sp|Q14103-4|HNRPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=2780	20.577	2	1393.6395	1393.6395	K	E	128	140
PSM	EVVAEVVKAPQVVAEAAK	833	sp|O60832|DKC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	8-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=7518	49.902	3	1848.0759	1848.0759	K	T	426	444
PSM	EYINECDSDYHEER	834	sp|Q93008-1|USP9X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	6-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=3176	23.018	2	1867.7194	1867.7194	R	T	859	873
PSM	GQAVDYEGSRTQEEIVAK	835	sp|P13667|PDIA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=4054	28.397	2	1978.9596	1978.9596	K	V	146	164
PSM	GYAEVVVASENSVHK	836	sp|Q8N684-2|CPSF7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5433	36.737	2	1587.7893	1587.7893	K	L	126	141
PSM	HYEDEEDDEEDAPGNDPQEAVPSAAGK	837	sp|P19447|ERCC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=4132	28.864	3	2913.1697	2913.1697	R	Q	18	45
PSM	IDEYDYSKPIQGQQK	838	sp|P31040-3|SDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=3990	28.017	2	1810.8737	1810.8737	R	K	456	471
PSM	IDEYDYSKPIQGQQK	839	sp|P31040-3|SDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	8-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=3991	28.023	2	1822.914	1822.9140	R	K	456	471
PSM	IGFVGFPSVGK	840	sp|Q9Y295|DRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:188	ms_run[2]:scan=9264	60.687	2	1112.6326	1112.6326	R	S	67	78
PSM	ISTETEETEGSLHCCK	841	sp|Q9Y4E8-2|UBP15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	14-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=2639	19.722	2	1879.7928	1879.7928	K	D	591	607
PSM	ITESVAETAQTIKK	842	sp|Q96A49|SYAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=3787	26.773	2	1517.8301	1517.8301	K	S	72	86
PSM	ITSAYLQDIENAYKK	843	sp|O95299|NDUAA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8751	57.549	2	1755.9043	1755.9043	K	T	229	244
PSM	KAAAPAPEEEMDECEQALAAEPK	844	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:188,14-UNIMOD:4,23-UNIMOD:188	ms_run[2]:scan=7119	47.211	3	2496.1551	2496.1551	K	A	253	276
PSM	KAEEATEAQEVVEATPEGACTEPR	845	sp|O75683|SURF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:188,20-UNIMOD:4,24-UNIMOD:267	ms_run[2]:scan=5443	36.797	2	2617.2148	2613.2267	R	E	170	194
PSM	LDNDTNATKADVEK	846	sp|Q5T0N5-3|FBP1L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=1118	10.051	2	1532.7318	1532.7318	R	A	157	171
PSM	LEICNLTPDTLTSDTYKK	847	sp|P17655-2|CAN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	4-UNIMOD:4,17-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=8273	54.617	2	2123.0859	2123.0859	R	W	260	278
PSM	LGINLLGGPLGGK	848	sp|Q8TD19|NEK9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:188	ms_run[2]:scan=10284	67.041	2	1213.749	1213.7490	R	Q	638	651
PSM	LISETTSVCKPEQVAK	849	sp|Q06136-2|KDSR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	9-UNIMOD:4	ms_run[2]:scan=3717	26.349	2	1788.9291	1788.9292	R	Q	173	189
PSM	LVAIVDVIDQNR	850	sp|P50914|RL14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:267	ms_run[2]:scan=9518	62.285	2	1363.7699	1363.7699	K	A	24	36
PSM	LVAIVDVIDQNR	851	sp|P50914|RL14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9519	62.29	2	1353.7616	1353.7616	K	A	24	36
PSM	LVCSGENDNHGQIANLPSAVTSDQK	852	sp|Q8WYP5|ELYS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:4,25-UNIMOD:188	ms_run[2]:scan=5752	38.639	3	2659.2603	2659.2603	K	S	1626	1651
PSM	MGPSGAALGVLILR	853	sp|Q8N1F8|S11IP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:35,14-UNIMOD:267	ms_run[2]:scan=10155	66.253	2	1379.7834	1379.7834	R	G	227	241
PSM	MLENTDNSSPSTEHSQGLEK	854	sp|Q96H79|ZCCHL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=2735	20.306	2	2202.9699	2202.9699	K	Q	249	269
PSM	MLLADQGQSWK	855	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:35	ms_run[2]:scan=5276	35.79	2	1291.6231	1291.6231	R	E	20	31
PSM	MLLADQGQSWK	856	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:35,11-UNIMOD:188	ms_run[2]:scan=5282	35.823	2	1297.6432	1297.6432	R	E	20	31
PSM	NAQAIEDMVGYAQETQHEK	857	sp|Q99460-2|PSMD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	19-UNIMOD:188	ms_run[2]:scan=8178	54.034	3	2166.9947	2166.9947	K	I	525	544
PSM	NIVSAFGIIPR	858	sp|Q96PZ0|PUS7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:267	ms_run[2]:scan=10489	68.312	2	1195.6953	1195.6953	K	N	459	470
PSM	NPDDITNEEYGEFYK	859	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	15-UNIMOD:188	ms_run[2]:scan=7159	47.501	2	1838.7942	1838.7942	R	S	300	315
PSM	NPFGNAGLLLGEAGK	860	sp|P49748-2|ACADV_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9864	64.434	2	1456.7674	1456.7674	K	Q	471	486
PSM	QAQENLHDQVQEQK	861	sp|Q15075|EEA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=1191	10.485	2	1693.802	1693.8020	K	A	593	607
PSM	QLDDKDEEINQQSQLVEK	862	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	5-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=4510	31.161	2	2170.0792	2170.0792	K	L	431	449
PSM	QLVSDEDKAQLASK	863	sp|P09001|RM03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=2992	21.882	2	1530.789	1530.7890	K	L	63	77
PSM	SEQAVAQLEEEKK	864	sp|Q9NSK0-4|KLC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=3071	22.375	2	1487.7468	1487.7468	R	H	133	146
PSM	SIQFVDWCPTGFK	865	sp|P68363-2|TBA1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	8-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=10715	69.721	2	1589.7644	1589.7644	R	V	224	237
PSM	SLYQSAGVAPESFEYIEAHGTGTK	866	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	24-UNIMOD:188	ms_run[2]:scan=8774	57.69	3	2547.2225	2547.2225	R	V	275	299
PSM	SYELPDGQVITIGNER	867	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9125	59.844	2	1789.8846	1789.8846	K	F	239	255
PSM	TAGVKVETTEDLVAK	868	sp|P38117|ETFB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	5-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=4547	31.383	3	1571.8809	1571.8809	R	L	234	249
PSM	TEADAEKTFEEK	869	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	7-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=2483	18.768	2	1408.6761	1408.6761	K	Q	438	450
PSM	TEADAEKTFEEK	870	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=2484	18.772	2	1396.6358	1396.6358	K	Q	438	450
PSM	TEEKQQEPVTSTSLVFGK	871	sp|P49790-2|NU153_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6089	40.677	3	2007.0161	2007.0161	R	K	1061	1079
PSM	TEGSLEDWDIAVQKTETR	872	sp|Q15020-4|SART3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8283	54.678	3	2076.9964	2076.9964	R	L	519	537
PSM	TEMEDLMSSKDDVGK	873	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	10-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=5748	38.618	3	1695.7734	1695.7734	R	S	1504	1519
PSM	TESTPITAVKQPEK	874	sp|Q9Y678|COPG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=2727	20.257	2	1527.8144	1527.8144	R	V	591	605
PSM	TGQEVVFVAEPDNKNVYK	875	sp|P04844-2|RPN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	14-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=5958	39.888	2	2048.0617	2048.0617	K	F	411	429
PSM	TLSEEQEKANSVQK	876	sp|O95613-2|PCNT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	8-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=1290	11.12	2	1601.8299	1601.8299	K	L	2466	2480
PSM	TPLLLMLGQEDR	877	sp|P13798|ACPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:267	ms_run[2]:scan=10794	70.22	2	1394.7467	1394.7467	K	R	665	677
PSM	TSYETADKVLQNK	878	sp|Q9Y6W3|CAN7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=4014	28.161	2	1495.7518	1495.7518	K	L	123	136
PSM	TTDMAPSKETEMALAK	879	sp|P27816-2|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=4632	31.909	3	1722.8168	1722.8168	K	D	247	263
PSM	TTELVNKDLDIYYK	880	sp|Q92878-3|RAD50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7135	47.319	2	1713.8825	1713.8825	R	T	974	988
PSM	VAETANEEEVKK	881	sp|P61221|ABCE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=844	8.2166	2	1345.6725	1345.6725	K	M	333	345
PSM	VCDATYDKAPVEK	882	sp|Q12974-2|TP4A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:4,8-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=2048	16.049	2	1506.7427	1506.7427	R	E	45	58
PSM	VEKEEAGGGISEEEAAQYDR	883	sp|Q9UBE0-2|SAE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:188,20-UNIMOD:267	ms_run[2]:scan=4070	28.491	2	2181.9997	2178.0115	M	Q	2	22
PSM	VINEPTAAALAYGLDKSEDK	884	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8228	54.337	2	2104.0688	2104.0688	R	V	219	239
PSM	VNLDSEQAVKEEK	885	sp|Q15054-3|DPOD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=2683	19.993	2	1487.7468	1487.7468	K	I	143	156
PSM	VQAQHDYTATDTDELQLK	886	sp|O00499-9|BIN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5225	35.497	3	2074.9807	2074.9807	K	A	341	359
PSM	YEDFKEEGSENAVK	887	sp|Q9NTK5|OLA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	5-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=3050	22.241	2	1655.7718	1655.7718	K	A	350	364
PSM	GVVDSEDLPLNISR	888	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	14-UNIMOD:267	ms_run[1]:scan=8128	53.724275	2	1522.787855	1522.786656	R	E	387	401
PSM	GLLLYGPPGTGK	889	sp|Q8IYT4|KATL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	12-UNIMOD:188	ms_run[1]:scan=6698	44.224745	2	1177.679958	1177.680239	K	T	289	301
PSM	IVADKDYSVTANSK	890	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	5-UNIMOD:188,14-UNIMOD:188	ms_run[1]:scan=2620	19.60864	2	1522.795886	1521.807746	K	I	78	92
PSM	VDQSLHTNTSLDAASEYAK	891	sp|Q9BYT8|NEUL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	19-UNIMOD:188	ms_run[1]:scan=5213	35.41813	3	2056.004579	2054.985207	K	Y	584	603
PSM	CGDLEEELKNVTNNLK	892	sp|P67936|TPM4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:4,9-UNIMOD:188,16-UNIMOD:188	ms_run[1]:scan=8011	53.002575	2	1887.926480	1886.944650	K	S	154	170
PSM	EVQTNDLKEVVNK	893	sp|P61247|RS3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=4461	30.873081666666664	2	1515.779402	1514.794037	R	L	175	188
PSM	LAECCIAANKGTSEQETK	894	sp|Q9H9A5|CNO10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	4-UNIMOD:4,5-UNIMOD:4	ms_run[1]:scan=2182	16.898093333333332	3	2009.919217	2008.919391	R	G	395	413
PSM	DAQQVEPEGQEKPSPATVR	895	sp|Q9Y520|PRC2C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=2703	20.110235	2	2065.016743	2065.007612	K	S	2130	2149
PSM	AMAEDLGDQDKAK	896	sp|Q92541|RTF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	11-UNIMOD:188,13-UNIMOD:188	ms_run[1]:scan=1891	15.087231666666668	2	1402.685936	1402.680102	K	Q	521	534
PSM	GQEADLEAGGEEVPEANGSAGKR	897	sp|Q9NX58|LYAR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	22-UNIMOD:188,23-UNIMOD:267	ms_run[1]:scan=4313	29.970923333333335	3	2287.051301	2286.069495	K	S	226	249
PSM	IEELNKTANGNVEAK	898	sp|Q13330|MTA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0		ms_run[1]:scan=2327	17.76897166666667	2	1629.8212	1628.8362	R	V	27	42
PSM	AAESETPGKSPEK	899	sp|O76021|RL1D1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	9-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=561	6.4739	2	1341.6815	1341.6815	K	K	418	431
PSM	AAMDNSEIAGEKK	900	sp|Q16891-3|MIC60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=1346	11.477	2	1374.6852	1374.6852	K	S	226	239
PSM	AASYDKVVDVDVK	901	sp|O15066|KIF3B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=4914	33.612	2	1419.7648	1419.7648	K	L	25	38
PSM	ACYLSINPQKDETLETEK	902	sp|P61163|ACTZ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:4	ms_run[2]:scan=6347	42.182	3	2138.0201	2138.0202	R	A	221	239
PSM	ADEHVIDQGDDGDNFYVIER	903	sp|P13861-2|KAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7440	49.391	3	2306.0087	2306.0087	K	G	162	182
PSM	AEAAEKGDVGLVAENSR	904	sp|P18858-2|DNLI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:188,17-UNIMOD:267	ms_run[2]:scan=3224	23.312	2	1730.877	1726.8888	R	S	371	388
PSM	AEAESMYQIKYEELQSLAGK	905	sp|P05787-2|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:35,10-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=8098	53.541	3	2315.1394	2315.1394	R	H	304	324
PSM	AELMEISEDKTK	906	sp|P05455|LA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4255	29.619	2	1392.6806	1392.6806	K	I	77	89
PSM	AENEKIQNEQLEK	907	sp|P12270-2|TPR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=1744	14.183	2	1571.7791	1571.7791	K	L	687	700
PSM	AGGEELDEGVAKDNAK	908	sp|Q32MZ4-3|LRRF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=2071	16.195	2	1601.7533	1601.7533	R	I	635	651
PSM	AGGEELDEGVAKDNAK	909	sp|Q32MZ4-3|LRRF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=2072	16.201	2	1613.7936	1613.7936	R	I	635	651
PSM	AGLGHPAAFGR	910	sp|O94760|DDAH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:1	ms_run[2]:scan=5236	35.563	2	1094.5621	1094.5621	M	A	2	13
PSM	AIIEEGDKEIATK	911	sp|O75165|DJC13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=3700	26.246	2	1415.7508	1415.7508	K	M	587	600
PSM	AMGIMNSFVNDIFER	912	sp|Q99880|H2B1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:35,5-UNIMOD:35,15-UNIMOD:267	ms_run[2]:scan=10755	69.97	2	1784.8101	1784.8101	K	I	59	74
PSM	ANVDISAPKVDTNAPDLSLEGPEGK	913	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7775	51.535	3	2536.2657	2536.2657	K	L	1025	1050
PSM	AQNAESSLQQKNEAITSFEGK	914	sp|Q96T51|RUFY1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5751	38.633	2	2279.103	2279.1030	K	T	470	491
PSM	AQTEGINISEEALNHLGEIGTK	915	sp|Q9Y265|RUVB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9878	64.525	2	2323.1656	2323.1656	R	T	379	401
PSM	ASDPGLPAEEPKEK	916	sp|P27708|PYR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=2377	18.056	2	1478.7655	1478.7655	R	S	1858	1872
PSM	ASQPDLVDTPTSSKPQPK	917	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	14-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=3184	23.068	2	1907.0039	1907.0039	R	R	1739	1757
PSM	ATAVMPDGQFKDISLSDYK	918	sp|Q06830|PRDX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	5-UNIMOD:35,11-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=7502	49.801	2	2113.044	2113.0440	K	G	17	36
PSM	AVEEMNGKEISGK	919	sp|Q13310-2|PABP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=1978	15.625	2	1390.6762	1390.6762	K	I	247	260
PSM	CSQVQQDHLNQTDASATK	920	sp|Q9UJC3-2|HOOK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:4	ms_run[2]:scan=1472	12.324	2	2029.9123	2029.9123	R	S	390	408
PSM	CVICGGPGVSDAYYCKECTIQEK	921	sp|Q7RTV0|PHF5A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:4,4-UNIMOD:4,15-UNIMOD:4,18-UNIMOD:4	ms_run[2]:scan=6020	40.264	3	2693.1594	2693.1594	R	D	58	81
PSM	DAASVDKVLELK	922	sp|O14979|HNRDL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6663	44.036	2	1286.7082	1286.7082	K	E	198	210
PSM	DAASVDKVLELK	923	sp|O14979|HNRDL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	7-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=6664	44.04	2	1298.7484	1298.7484	K	E	198	210
PSM	DADSSISVLEIHSQK	924	sp|Q96T23-3|RSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6222	41.422	2	1627.8053	1627.8053	K	A	260	275
PSM	DEKTDTLEDLFPTTK	925	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9189	60.237	2	1751.8465	1751.8465	K	I	467	482
PSM	DEPNSTPEKTEQFYR	926	sp|O76021|RL1D1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=3872	27.293	2	1839.8275	1839.8275	K	K	101	116
PSM	DGKLVSESSDVLPK	927	sp|P05787-2|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5046	34.411	2	1472.7722	1472.7722	R	-	498	512
PSM	DGSNKSGAEEQGPIDGPSK	928	sp|O43493-6|TGON2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=1380	11.689	3	1871.8497	1871.8497	K	S	121	140
PSM	DGSNKSGAEEQGPIDGPSK	929	sp|O43493-6|TGON2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	5-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=1393	11.773	2	1883.89	1883.8900	K	S	121	140
PSM	DKLNINPEDGMADYSDPSYVK	930	sp|Q99459|CDC5L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7535	50.013	3	2370.0686	2370.0686	R	Q	446	467
PSM	DLSSEELAAFQKER	931	sp|Q9Y3B7-2|RM11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7221	47.908	2	1621.7948	1621.7948	K	A	132	146
PSM	DMDDEESWIKEK	932	sp|Q13813-2|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	10-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=5998	40.134	2	1535.6852	1535.6852	R	K	1777	1789
PSM	DMELPTEKEVALVK	933	sp|P27816-2|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	8-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=7714	51.153	2	1612.8785	1612.8785	K	D	305	319
PSM	DPCQCVCHGSAVTTQDCCPR	934	sp|P14222|PERF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:4,5-UNIMOD:4,7-UNIMOD:4,17-UNIMOD:4,18-UNIMOD:4,20-UNIMOD:267	ms_run[2]:scan=3067	22.347	2	2416.9315	2416.9315	R	Q	391	411
PSM	DPDAQPGGELMLGGTDSKYYK	935	sp|P07339|CATD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	18-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=6938	45.86	2	2253.0662	2253.0662	R	G	236	257
PSM	DQTKAQAAAPASVPAQAPK	936	sp|P47914|RL29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	4-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=2584	19.383	2	1861.0096	1861.0096	K	R	131	150
PSM	DSSGQHVDVSPTSQR	937	sp|Q99798|ACON_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=1370	11.624	2	1598.7285	1598.7285	K	L	550	565
PSM	DVDEAYMNKVELESR	938	sp|P05787-2|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6276	41.757	3	1796.8251	1796.8251	K	L	227	242
PSM	DYSTLTSVSSHDSR	939	sp|P16144-4|ITB4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=3976	27.932	2	1553.6958	1553.6958	R	L	1439	1453
PSM	EASSTQDTGKLPVK	940	sp|P41240|CSK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=1899	15.135	2	1459.7518	1459.7518	K	W	338	352
PSM	EATNPPVIQEEKPK	941	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=2527	19.029	2	1578.8253	1578.8253	R	K	483	497
PSM	EAVCEVALDYKK	942	sp|Q01082|SPTB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	4-UNIMOD:4,11-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=4765	32.706	2	1435.742	1435.7420	K	K	2259	2271
PSM	EGPSLGPPPVASALSR	943	sp|O75150-3|BRE1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7738	51.304	2	1533.8151	1533.8151	R	A	618	634
PSM	EIQDSQVPLEKETLK	944	sp|P48681|NEST_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5249	35.636	2	1755.9254	1755.9254	K	S	533	548
PSM	EKDGETSGSQEDQLCTALVNQLNK	945	sp|Q5T4S7-3|UBR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:188,15-UNIMOD:4,24-UNIMOD:188	ms_run[2]:scan=8661	57.014	3	2675.2747	2675.2747	K	F	3354	3378
PSM	ELVDKATNVVMNYSEIESK	946	sp|Q14677|EPN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	5-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=8440	55.65	3	2180.1074	2180.1074	R	V	9	28
PSM	EVQTNDLKEVVNK	947	sp|P61247|RS3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4037	28.298	2	1514.794	1514.7940	R	L	175	188
PSM	FCPSGAWELPGTPR	948	sp|Q8WUA4-2|TF3C2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=8677	57.111	2	1583.743	1583.7430	K	K	475	489
PSM	FQPASAPAEDCISSSTEPKPDPK	949	sp|Q14008-2|CKAP5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:4	ms_run[2]:scan=4690	32.264	2	2458.1322	2458.1322	K	K	1103	1126
PSM	GLQAPLASGGPVLGR	950	sp|Q969G9|NKD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7304	48.47	2	1391.7885	1391.7885	R	E	415	430
PSM	GNPTVEVDLFTSK	951	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:188	ms_run[2]:scan=8332	54.978	2	1411.729	1411.7290	R	G	16	29
PSM	GNTAEGCVHETQEK	952	sp|Q9BQG0|MBB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	7-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=817	8.0529	2	1564.6883	1564.6883	K	Q	936	950
PSM	GQPDVVVKEDEEYK	953	sp|P24752|THIL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=3660	26.013	2	1633.7835	1633.7835	K	R	244	258
PSM	GSCSTEVEKETQEK	954	sp|O75348|VATG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:4,9-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=1099	9.9407	2	1622.7496	1622.7496	R	M	67	81
PSM	GSEKSDDNSYDEK	955	sp|P49591|SYSC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=570	6.5299	2	1472.5903	1472.5903	K	Y	254	267
PSM	GTVPDDAVEALADSLGKK	956	sp|P20810-3|ICAL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	17-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=10248	66.821	2	1796.9559	1796.9559	K	E	309	327
PSM	IAGPGLGSGVR	957	sp|O75369-6|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=3739	26.486	2	982.55598	982.5560	K	A	1426	1437
PSM	IGGGIDVPVPR	958	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:267	ms_run[2]:scan=6244	41.565	2	1088.6218	1088.6218	R	H	321	332
PSM	ILTFDQLALDSPK	959	sp|Q07020-2|RL18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10196	66.501	2	1459.7922	1459.7922	K	G	91	104
PSM	IMEGPAFNFLDAPAVR	960	sp|P11177-3|ODPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:35,16-UNIMOD:267	ms_run[2]:scan=10608	69.057	2	1772.8795	1772.8795	R	V	291	307
PSM	LAECCIAANKGTSEQETK	961	sp|Q9H9A5-5|CNO10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	4-UNIMOD:4,5-UNIMOD:4,10-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=2179	16.877	3	2020.9596	2020.9596	R	G	102	120
PSM	LFQTAFPAPYGPSPASR	962	sp|Q9Y6J9|TAF6L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8852	58.165	2	1805.9101	1805.9101	R	Y	577	594
PSM	LKETCVSGEDPTQGADLSPDEK	963	sp|Q02952-3|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:188,5-UNIMOD:4,22-UNIMOD:188	ms_run[2]:scan=4431	30.69	3	2387.1201	2387.1201	K	V	361	383
PSM	LKTPGVDAPSWLEEQ	964	sp|P53367-3|ARFP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:188	ms_run[2]:scan=8763	57.625	2	1674.856	1674.8560	K	-	179	194
PSM	LQESIEYEDLGKNNSVK	965	sp|P32780-2|TF2H1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5448	36.826	2	1964.9691	1964.9691	K	T	238	255
PSM	LTSDDVKEQIYK	966	sp|P62277|RS13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	7-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=4447	30.791	2	1449.7754	1449.7754	K	L	28	40
PSM	MIGGPILPSER	967	sp|P49419-4|AL7A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:267	ms_run[2]:scan=6470	42.922	2	1178.6357	1178.6357	R	S	163	174
PSM	MIQDGKGDVTITNDGATILK	968	sp|P50991|TCPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:35	ms_run[2]:scan=6090	40.683	3	2105.0674	2105.0674	K	Q	60	80
PSM	MTQLVLPGMVER	969	sp|Q53GQ0|DHB12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:35,12-UNIMOD:267	ms_run[2]:scan=8216	54.266	2	1398.7239	1398.7239	K	S	168	180
PSM	NASEDNHSENTLYSNDNGSNLQR	970	sp|Q8NEF9|SRFB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	23-UNIMOD:267	ms_run[2]:scan=3390	24.338	3	2588.0999	2588.0999	K	E	138	161
PSM	NDHDDDEDEEVISK	971	sp|Q12789-3|TF3C1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=1966	15.547	2	1658.6544	1658.6544	R	T	342	356
PSM	NFPLALDLGCGR	972	sp|Q5TEU4-2|NDUF5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	10-UNIMOD:4	ms_run[2]:scan=10121	66.054	2	1331.6656	1331.6656	R	G	89	101
PSM	NPPAFTELQLPR	973	sp|Q6L8Q7-2|PDE12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:267	ms_run[2]:scan=9034	59.286	2	1391.7437	1391.7437	R	Y	160	172
PSM	NPPGFAFVEFEDPR	974	sp|Q16629-3|SRSF7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10606	69.046	2	1620.7573	1620.7573	R	D	45	59
PSM	NSVTPDMMEEMYKK	975	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=6445	42.782	2	1713.7815	1713.7815	K	A	229	243
PSM	SAADDSEAKSNELTR	976	sp|P12270-2|TPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=1318	11.309	3	1592.7278	1592.7278	K	A	291	306
PSM	SAEEEAADLPTKPTK	977	sp|Q8WW12-2|PCNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=3089	22.488	2	1597.8238	1597.8238	R	I	53	68
PSM	SDESDQQESLHK	978	sp|P49770|EI2BB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:188	ms_run[2]:scan=753	7.6705	2	1407.6209	1407.6209	R	L	100	112
PSM	SDESDQQESLHK	979	sp|P49770|EI2BB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=754	7.6757	2	1401.6008	1401.6008	R	L	100	112
PSM	SEQSVAQLEEEKK	980	sp|Q07866-8|KLC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=2530	19.047	2	1503.7417	1503.7417	K	H	134	147
PSM	SGGGGGGGFGR	981	sp|P13647|K2C5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:267	ms_run[2]:scan=933	8.747	2	874.3921	874.3921	R	V	38	49
PSM	SIAFPSIGSGR	982	sp|O75367-2|H2AY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6871	45.343	2	1090.5771	1090.5771	K	N	305	316
PSM	SLDMDSIIAEVK	983	sp|P05787-2|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:188	ms_run[2]:scan=10569	68.813	2	1325.6844	1325.6844	R	A	281	293
PSM	SMENEDKEETVAK	984	sp|Q9UPN3-4|MACF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	7-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=1046	9.5891	2	1520.7067	1520.7067	K	M	1035	1048
PSM	SMENEDKEETVAK	985	sp|Q9UPN3-4|MACF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=1055	9.6543	2	1508.6665	1508.6665	K	M	1035	1048
PSM	SSDGSLSHEEDLAK	986	sp|Q13136-2|LIPA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=2661	19.861	2	1473.6583	1473.6583	R	V	238	252
PSM	SSELVSQQDSSPVEVHINK	987	sp|Q8NEV8-2|EXPH5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	19-UNIMOD:188	ms_run[2]:scan=5379	36.406	3	2088.0431	2088.0431	K	E	587	606
PSM	STITEIKECADEPVGK	988	sp|Q92896|GSLG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	9-UNIMOD:4	ms_run[2]:scan=5030	34.312	3	1775.8611	1775.8611	K	G	182	198
PSM	TAEELMNFSKGEENLMDAQVK	989	sp|P50990-3|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:35	ms_run[2]:scan=8080	53.428	3	2399.0985	2399.0985	K	A	188	209
PSM	TAGVKVETTEDLVAK	990	sp|P38117|ETFB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4538	31.327	3	1559.8407	1559.8407	R	L	234	249
PSM	TEAANVEKITTK	991	sp|Q92900-2|RENT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=2316	17.707	2	1303.6983	1303.6983	R	L	768	780
PSM	TGENVEDAFLEAAKK	992	sp|P61106|RAB14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	14-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=7936	52.543	3	1632.8398	1632.8398	K	I	157	172
PSM	TGQEYKPGNPPAEIGQNISSNSSASILESK	993	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:188,30-UNIMOD:188	ms_run[2]:scan=7341	48.734	3	3114.5508	3114.5508	K	S	795	825
PSM	TILTLTGVSTLGDVKNNQESDCVSK	994	sp|A6NDG6|PGP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	22-UNIMOD:4	ms_run[2]:scan=8765	57.637	3	2678.3433	2678.3433	K	K	276	301
PSM	TLVSVTKEGLELPEDEEEK	995	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7837	51.926	3	2144.0736	2144.0736	K	K	540	559
PSM	TPLLLMLGQEDR	996	sp|P13798|ACPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:35,12-UNIMOD:267	ms_run[2]:scan=9060	59.443	2	1410.7416	1410.7416	K	R	665	677
PSM	TPLLLMLGQEDR	997	sp|P13798|ACPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10803	70.275	2	1384.7384	1384.7384	K	R	665	677
PSM	TVQSLEIDLDSMR	998	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9584	62.693	2	1505.7396	1505.7396	R	N	302	315
PSM	TYDATTHFETTCDDIK	999	sp|P50395-2|GDIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:4	ms_run[2]:scan=4955	33.865	3	1916.8098	1916.8098	R	N	358	374
PSM	VADYCENNYIQATDKR	1000	sp|Q8IZP0-11|ABI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	5-UNIMOD:4	ms_run[2]:scan=4531	31.285	2	1958.8792	1958.8792	R	K	29	45
PSM	VEDSNPQKTSATK	1001	sp|Q9P016-2|THYN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=451	5.7934	2	1403.6892	1403.6892	K	N	35	48
PSM	VFVLPCIQQIQR	1002	sp|O75955-2|FLOT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=10046	65.587	2	1509.8365	1509.8365	R	I	29	41
PSM	VGINYQPPTVVPGGDLAK	1003	sp|P68363-2|TBA1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	18-UNIMOD:188	ms_run[2]:scan=8028	53.11	2	1829.9983	1829.9983	K	V	237	255
PSM	VIANPPKAEEEQTCPVPQEEEEEVR	1004	sp|Q96A54|PAQR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	14-UNIMOD:4	ms_run[2]:scan=4907	33.568	3	2906.3604	2906.3604	R	V	41	66
PSM	VLALPEPSPAAPTLR	1005	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	15-UNIMOD:267	ms_run[2]:scan=8142	53.813	2	1540.8852	1540.8852	K	S	1018	1033
PSM	VNLDSEQAVKEEK	1006	sp|Q15054-3|DPOD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	10-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=2685	20.005	2	1499.787	1499.7870	K	I	143	156
PSM	VSPPEDEEVKNLAEK	1007	sp|Q8IWZ8|SUGP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	10-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=4692	32.277	2	1694.8766	1694.8766	K	L	255	270
PSM	VSQGSKDPAEGDGAQPEETPR	1008	sp|Q14697|GANAB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:188,21-UNIMOD:267	ms_run[2]:scan=1374	11.651	2	2170.0109	2166.0228	R	D	186	207
PSM	VTQLDPKEEEVSLQGINTR	1009	sp|Q9Y6W5-2|WASF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	7-UNIMOD:188,19-UNIMOD:267	ms_run[2]:scan=6812	44.856	2	2171.1405	2167.1523	K	K	79	98
PSM	VTVGDITCTGEGTSKK	1010	sp|O75569-3|PRKRA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	8-UNIMOD:4,15-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=3893	27.423	2	1663.849	1663.8490	R	L	45	61
PSM	VVSSIEQKTEGAEK	1011	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=1888	15.072	2	1503.7781	1503.7781	R	K	61	75
PSM	YESLTDPSKLDSGK	1012	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	9-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=4456	30.844	2	1550.7867	1550.7867	R	E	61	75
PSM	YLMEEDEDAYKK	1013	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:35	ms_run[2]:scan=2636	19.705	2	1548.6654	1548.6654	R	Q	210	222
PSM	YSVDIPLDKTVVNK	1014	sp|P61353|RL27_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	9-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=6975	46.125	2	1601.9067	1601.9067	R	D	85	99
PSM	IVDGKVVSETNDTK	1015	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1996	15.732013333333333	2	1504.762205	1503.778053	R	V	413	427
PSM	CPPGVVPACHNSK	1016	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:385,1-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=3742	26.502831666666665	2	1404.6228	1404.6273	R	D	634	647
PSM	QGGLGPMNIPLVSDPKR	1017	sp|Q06830|PRDX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:28,16-UNIMOD:188,17-UNIMOD:267	ms_run[1]:scan=9855	64.376715	2	1776.9519	1776.9522	K	T	94	111
PSM	QGGLGPMNIPLVSDPKR	1018	sp|Q06830|PRDX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:28,7-UNIMOD:35,16-UNIMOD:188,17-UNIMOD:267	ms_run[1]:scan=7972	52.765384999999995	2	1792.9444	1792.9471	K	T	94	111
PSM	GGGDEESGEHTQVPADSPDSQEEQKGESSASSPEEPEEITCLEK	1019	sp|Q02952|AKA12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	41-UNIMOD:4	ms_run[1]:scan=5820	39.055765	4	4671.971696	4671.963837	R	G	538	582
PSM	IGFVGFPSVGK	1020	sp|Q9Y295|DRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=9267	60.707771666666666	2	1106.611466	1106.612431	R	S	67	78
PSM	DGQVINETSQHHDDLE	1021	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=3923	27.608103333333332	2	1836.770216	1835.792199	R	-	451	467
PSM	NQVTATKADGGTQVIDTK	1022	sp|P09622|DLDH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=2670	19.918638333333334	3	1845.950540	1845.943220	K	N	160	178
PSM	FGEPVLAGFAR	1023	sp|O15067|PUR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=8856	58.19274166666666	2	1163.625255	1162.613494	K	S	396	407
PSM	EVQTNDLKEVVNK	1024	sp|P61247|RS3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	8-UNIMOD:188,13-UNIMOD:188	ms_run[1]:scan=4460	30.86748	2	1527.819426	1526.834295	R	L	175	188
PSM	TAVEHATDEDILAK	1025	sp|P50851-2|LRBA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	14-UNIMOD:188	ms_run[1]:scan=4216	29.384903333333334	2	1517.794217	1517.766881	K	G	2011	2025
PSM	QQQEKEDAEHHPDEDVDESES	1026	sp|Q9BZJ0|CRNL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:28	ms_run[1]:scan=2270	17.421848333333333	2	2462.9547	2462.9577	K	-	828	849
PSM	LVAIVDVIDQNR	1027	sp|P50914|RL14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	12-UNIMOD:267	ms_run[1]:scan=9546	62.457121666666666	2	1363.768618	1363.769884	K	A	24	36
PSM	SPSNGVGSLASKPVDVASDNVK	1028	sp|Q9NVV0|TM38B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=5765	38.724511666666665	3	2128.065911	2127.080777	K	K	262	284
PSM	GQEADLEAGGEEVPEANGSAGKR	1029	sp|Q9NX58|LYAR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=4306	29.92571	3	2271.023704	2270.041097	K	S	226	249
PSM	LGDEDEEIDGDTNKYK	1030	sp|P09884|DPOLA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=3872	27.29342	2	1839.821468	1839.801033	K	K	816	832
PSM	CPCPEPLRGVMEK	1031	sp|Q9H832|UBE2Z_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:385,1-UNIMOD:4,3-UNIMOD:4,8-UNIMOD:267,13-UNIMOD:188	ms_run[1]:scan=7494	49.751575	2	1570.7301	1570.7272	K	S	261	274
PSM	QNDTPKGPQPPTVSPIR	1032	sp|P46087|NOP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:28	ms_run[1]:scan=5401	36.539638333333336	2	1813.9327	1813.9317	K	S	773	790
PSM	TETQEKNTLPTK	1033	sp|P63313|TYB10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	6-UNIMOD:188,12-UNIMOD:188	ms_run[1]:scan=951	8.849246666666666	2	1400.754314	1400.754982	K	E	21	33
PSM	GYAEVVVASENSVHK	1034	sp|Q8N684|CPSF7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	15-UNIMOD:188	ms_run[1]:scan=4463	30.883784999999996	2	1594.813601	1593.809415	K	L	126	141
PSM	IIPGFMCQGGDFTR	1035	sp|Q9Y536|PAL4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	7-UNIMOD:4,14-UNIMOD:267	ms_run[1]:scan=9114	59.77720333333333	2	1608.732862	1607.746388	R	H	56	70
PSM	IIPGFMCQGGDFTR	1036	sp|Q9Y536|PAL4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	7-UNIMOD:4,14-UNIMOD:267	ms_run[1]:scan=9287	60.833105	2	1608.733873	1607.746388	R	H	56	70
PSM	AAMDNSEIAGEKK	1037	sp|Q16891-3|MIC60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:35,12-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=765	7.7366	2	1390.6801	1390.6801	K	S	226	239
PSM	ADDLGKGGNEESTK	1038	sp|P00441|SODC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=699	7.3256	2	1431.688	1431.6880	K	T	124	138
PSM	ADDLGKGGNEESTK	1039	sp|P00441|SODC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=702	7.3422	2	1419.6478	1419.6478	K	T	124	138
PSM	ADETKDEQFEQCVQNFNK	1040	sp|O00499-9|BIN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:4	ms_run[2]:scan=6371	42.329	3	2228.9644	2228.9644	K	Q	36	54
PSM	ADKNEVAAEVAK	1041	sp|P56192|SYMC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=1478	12.367	2	1243.6408	1243.6408	K	L	864	876
PSM	ADKNEVAAEVAK	1042	sp|P56192|SYMC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=1487	12.43	2	1255.6811	1255.6811	K	L	864	876
PSM	AEQFYCGDTEGKK	1043	sp|Q02218|ODO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:4	ms_run[2]:scan=2166	16.807	2	1531.6613	1531.6613	K	V	390	403
PSM	AGAAGGPEEEAEKPVK	1044	sp|Q8WW12-2|PCNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=1455	12.199	2	1538.7577	1538.7577	R	T	17	33
PSM	AIDSSNLKDDYSTAQR	1045	sp|Q5JVF3-3|PCID2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3911	27.536	3	1782.8384	1782.8384	R	V	171	187
PSM	ALAAQLPVLPR	1046	sp|Q96GK7|FAH2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:267	ms_run[2]:scan=8225	54.32	2	1157.716	1157.7160	R	S	83	94
PSM	AMAEDLGDQDKAK	1047	sp|Q92541|RTF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=1890	15.082	2	1390.6398	1390.6398	K	Q	521	534
PSM	AVEEEDKMTPEQLAIK	1048	sp|O00487|PSDE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5801	38.945	3	1829.9081	1829.9081	K	N	258	274
PSM	AVEEQIEYLQKK	1049	sp|Q5VTR2|BRE1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4971	33.96	2	1476.7824	1476.7824	R	L	706	718
PSM	AVMEQIPEIQKDSLDQFDCK	1050	sp|Q9HAV4|XPO5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	19-UNIMOD:4	ms_run[2]:scan=8823	57.989	2	2393.1243	2393.1243	R	L	1113	1133
PSM	CIACQNPGKQNQTTSAVSTPASSETSK	1051	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:4,4-UNIMOD:4	ms_run[2]:scan=2842	20.965	3	2851.3076	2851.3076	K	A	1626	1653
PSM	DAKEIPSATQSPISK	1052	sp|Q9BQG0|MBB1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3718	26.355	2	1570.8203	1570.8203	K	K	1153	1168
PSM	DASLVVTTSGDHK	1053	sp|Q13685|AAMP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:188	ms_run[2]:scan=2614	19.57	2	1334.6773	1334.6773	K	A	411	424
PSM	DCAVKPCQSDEVPDGIK	1054	sp|Q96HE7|ERO1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=4321	30.02	3	1916.8608	1916.8608	R	S	98	115
PSM	DDVFGYPQQFEDKPALSK	1055	sp|Q93008-1|USP9X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=8167	53.961	2	2095.0301	2095.0301	R	T	1615	1633
PSM	DDVFGYPQQFEDKPALSK	1056	sp|Q93008-1|USP9X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8157	53.9	2	2082.9898	2082.9898	R	T	1615	1633
PSM	DECLLPCKDAPELGYAK	1057	sp|Q8TAT6|NPL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=7245	48.081	3	1977.9176	1977.9176	R	E	397	414
PSM	DGKLVSESSDVLPK	1058	sp|P05787-2|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=5038	34.361	2	1484.8125	1484.8125	R	-	498	512
PSM	DGKLVSESSDVLPK	1059	sp|P05787-2|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5216	35.44	2	1472.7722	1472.7722	R	-	498	512
PSM	DQVTAQEIFQDNHEDGPTAK	1060	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	20-UNIMOD:188	ms_run[2]:scan=6079	40.621	3	2248.0339	2248.0339	K	K	546	566
PSM	DSPDEFPVYVGINEAKK	1061	sp|Q9NWY4|HPF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8129	53.73	2	1906.9313	1906.9313	R	N	134	151
PSM	DSSGQHVDVSPTSQR	1062	sp|Q99798|ACON_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	15-UNIMOD:267	ms_run[2]:scan=1376	11.663	2	1608.7367	1608.7367	K	L	550	565
PSM	DVDAAYMNKVELEAK	1063	sp|P13647|K2C5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	7-UNIMOD:35,9-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=4903	33.545	2	1722.8537	1722.8537	K	V	278	293
PSM	DVDEAYMNKVELESR	1064	sp|P05787-2|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	7-UNIMOD:35	ms_run[2]:scan=4698	32.312	3	1812.82	1812.8200	K	L	227	242
PSM	DYQDNKADVILK	1065	sp|P47813|IF1AX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=4358	30.241	2	1432.7601	1432.7601	R	Y	83	95
PSM	EGGGAIEEEAKEK	1066	sp|Q8TAQ2-2|SMRC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=1403	11.838	2	1345.6361	1345.6361	R	T	808	821
PSM	EGGGAIEEEAKEK	1067	sp|Q8TAQ2-2|SMRC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=1412	11.896	2	1357.6764	1357.6764	R	T	808	821
PSM	EGVLTGSPEQKEEAAK	1068	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=2423	18.371	2	1683.8718	1683.8718	R	A	2270	2286
PSM	ESDVPLKTEEFEVTK	1069	sp|Q969H8|MYDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	7-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=6039	40.376	2	1761.9075	1761.9075	R	T	131	146
PSM	ESESVDKVMDQK	1070	sp|Q14103-4|HNRPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	9-UNIMOD:35	ms_run[2]:scan=916	8.6474	2	1409.6344	1409.6344	K	E	128	140
PSM	EYINECDSDYHEER	1071	sp|Q93008-1|USP9X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:4	ms_run[2]:scan=3177	23.024	2	1857.7112	1857.7112	R	T	859	873
PSM	EYLSEEVQAVHK	1072	sp|Q53GS9-2|SNUT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:188	ms_run[2]:scan=4778	32.788	2	1436.7243	1436.7243	R	N	379	391
PSM	FLPMFLSDNPNPK	1073	sp|O15118-2|NPC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:188	ms_run[2]:scan=10286	67.053	2	1524.7742	1524.7742	R	C	680	693
PSM	FWKGPSEAPSGQA	1074	sp|Q9NY33-2|DPP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4750	32.621	2	1360.6412	1360.6412	R	-	305	318
PSM	GEVDVTHDSEPK	1075	sp|Q9NV35|NUD15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:188	ms_run[2]:scan=1236	10.743	2	1317.6144	1317.6144	K	N	99	111
PSM	GFGFVDFNSEEDAK	1076	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9215	60.397	2	1560.6733	1560.6733	K	A	611	625
PSM	GGGGNFGPGPGSNFR	1077	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4682	32.218	2	1376.6222	1376.6222	R	G	202	217
PSM	GIPLATGDTSPEPELLPGAPLPPPK	1078	sp|O75821|EIF3G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9982	65.181	2	2463.3261	2463.3261	K	E	33	58
PSM	GIVNGAAPELPVPTGGPAVGAR	1079	sp|P21281|VATB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8262	54.55	2	1999.0851	1999.0851	R	E	8	30
PSM	GLESTTLADKDGEIYCK	1080	sp|P21291|CSRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:188,16-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=5243	35.604	3	1910.9334	1910.9334	K	G	152	169
PSM	GLLGCNIIPLQR	1081	sp|O00233-3|PSMD9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	5-UNIMOD:4	ms_run[2]:scan=9627	62.961	2	1352.7598	1352.7598	K	-	107	119
PSM	GLLLYGPPGTGK	1082	sp|Q8IYT4-2|KATL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6701	44.239	2	1171.6601	1171.6601	K	T	217	229
PSM	GPSAGEQEPDKESGASVDEVAR	1083	sp|P50579-2|MAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3059	22.297	3	2214.0036	2214.0036	K	Q	47	69
PSM	GQPDVVVKEDEEYK	1084	sp|P24752|THIL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	8-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=3655	25.982	2	1645.8238	1645.8238	K	R	244	258
PSM	GVLFYGPPGCGK	1085	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:4,12-UNIMOD:188	ms_run[2]:scan=6625	43.821	2	1256.6319	1256.6319	K	T	513	525
PSM	IAEFTTNLTEEEEKSK	1086	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5813	39.013	3	1867.9051	1867.9051	R	S	1001	1017
PSM	IAGPGLGSGVR	1087	sp|O75369-6|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:267	ms_run[2]:scan=3725	26.396	2	992.56425	992.5642	K	A	1426	1437
PSM	IEVIEIMTDR	1088	sp|P09651-3|ROA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9233	60.506	2	1217.6326	1217.6326	K	G	131	141
PSM	IFQFQNFTNTR	1089	sp|Q2NL82|TSR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8742	57.496	2	1414.6993	1414.6993	R	K	527	538
PSM	IGGNEGIDVPIPR	1090	sp|Q96AE4|FUBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7360	48.853	2	1335.7147	1335.7147	R	F	272	285
PSM	IIMPPSALDQLSR	1091	sp|Q92890-3|UFD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9045	59.35	2	1439.7806	1439.7806	K	L	46	59
PSM	IIMPPSALDQLSR	1092	sp|Q92890-3|UFD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:267	ms_run[2]:scan=9048	59.366	2	1449.7889	1449.7889	K	L	46	59
PSM	ISGLIYEETR	1093	sp|P62805|H4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5981	40.029	2	1179.6136	1179.6136	R	G	47	57
PSM	IVADKDYSVTANSK	1094	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	5-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=2451	18.553	2	1521.8077	1521.8077	K	I	78	92
PSM	IWIFDGPTGEGR	1095	sp|Q8NI36|WDR36_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:267	ms_run[2]:scan=9854	64.371	2	1356.6702	1356.6702	R	L	359	371
PSM	KAAAPAPEEEMDECEQALAAEPK	1096	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:188,14-UNIMOD:4,23-UNIMOD:188	ms_run[2]:scan=6983	46.181	3	2496.1551	2496.1551	K	A	253	276
PSM	KVEEAEPEEFVVEK	1097	sp|Q13185|CBX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5273	35.775	3	1660.8196	1660.8196	K	V	21	35
PSM	LAVNMVPFPR	1098	sp|Q13509-2|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=8841	58.099	2	1152.6353	1152.6353	K	L	181	191
PSM	LCASGAGATPDTAIEEIKEK	1099	sp|P53384-2|NUBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:4,18-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=6062	40.515	3	2072.0498	2072.0498	R	M	30	50
PSM	LDADKYENDPELEK	1100	sp|Q9BV57|MTND_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4185	29.184	3	1677.7734	1677.7734	K	I	41	55
PSM	LDQDINATKADVEK	1101	sp|Q15642-5|CIP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	9-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=3179	23.036	2	1570.8241	1570.8241	R	A	158	172
PSM	LEGDLSLADKDVTAK	1102	sp|Q8IVF2-3|AHNK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=5303	35.944	2	1585.8602	1585.8602	R	D	880	895
PSM	LEGLTDEINFLR	1103	sp|P05787-2|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10812	70.333	2	1418.7405	1418.7405	R	Q	242	254
PSM	LEICNLTPDTLTSDTYKK	1104	sp|P17655-2|CAN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	4-UNIMOD:4,17-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=8282	54.672	3	2123.0859	2123.0859	R	W	260	278
PSM	LEICNLTPDTLTSDTYKK	1105	sp|P17655-2|CAN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	4-UNIMOD:4	ms_run[2]:scan=8286	54.701	3	2111.0456	2111.0456	R	W	260	278
PSM	LFDQAFGLPR	1106	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=9232	60.501	2	1172.6218	1172.6218	R	L	28	38
PSM	LGGIGQFLAK	1107	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8309	54.834	2	1002.5862	1002.5862	R	A	810	820
PSM	LLNFPTIVER	1108	sp|O43681|ASNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9761	63.802	2	1200.6867	1200.6867	R	G	176	186
PSM	METASELGREEEDDVDLELR	1109	sp|Q9HCS7|SYF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:35	ms_run[2]:scan=7663	50.824	3	2351.0435	2351.0435	K	L	311	331
PSM	MGPGIGAILER	1110	sp|Q9P2K5-3|MYEF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:267	ms_run[2]:scan=8512	56.094	2	1122.6095	1122.6095	R	S	75	86
PSM	MGPGIGAILER	1111	sp|Q9P2K5-3|MYEF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8520	56.143	2	1112.6012	1112.6012	R	S	75	86
PSM	MNPQSAFFQGK	1112	sp|P22307-6|NLTP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:35	ms_run[2]:scan=5173	35.177	2	1269.5812	1269.5812	K	L	105	116
PSM	NASMNTQHGTATEVAVETTTPK	1113	sp|Q9UIG0-2|BAZ1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	22-UNIMOD:188	ms_run[2]:scan=3958	27.826	2	2293.0952	2293.0952	K	Q	960	982
PSM	NGDLDEVKDYVAK	1114	sp|P58546|MTPN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	8-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=5786	38.853	2	1476.7499	1476.7499	K	G	12	25
PSM	NGFLLDGFPR	1115	sp|P54819-3|KAD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:267	ms_run[2]:scan=10104	65.948	2	1144.5905	1144.5905	K	T	94	104
PSM	NMVDPKDIDDDLEGEVTEECGK	1116	sp|Q9UHX1-4|PUF60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:35,20-UNIMOD:4	ms_run[2]:scan=7677	50.916	3	2523.0629	2523.0629	R	F	408	430
PSM	NPPGFAFVEFEDPR	1117	sp|Q16629-3|SRSF7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:267	ms_run[2]:scan=10607	69.052	2	1630.7655	1630.7655	R	D	45	59
PSM	NSDEADLVPAKEANVK	1118	sp|P83916|CBX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3850	27.161	2	1698.8424	1698.8424	K	C	140	156
PSM	NSSYFVEWIPNNVK	1119	sp|Q13509-2|TBB3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10534	68.588	2	1695.8257	1695.8257	K	V	265	279
PSM	NTDYTELHQQNTDLIYQTGPK	1120	sp|Q8TBA6-2|GOGA5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	21-UNIMOD:188	ms_run[2]:scan=6237	41.518	2	2484.1864	2484.1864	K	S	39	60
PSM	QADSVEQAVYYCKK	1121	sp|Q9H2P0|ADNP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:4,13-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=4250	29.591	2	1699.8278	1699.8278	K	C	156	170
PSM	QASDLSLIDKESDDVLER	1122	sp|Q15542-2|TAF5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8398	55.387	2	2031.996	2031.9960	K	I	509	527
PSM	QDLADVVQVCEGKK	1123	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:4,13-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=5768	38.743	2	1599.8329	1599.8329	R	K	4429	4443
PSM	QEIEAETDRVTGTNK	1124	sp|P50570-3|DYN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3151	22.864	2	1689.817	1689.8170	R	G	99	114
PSM	QTIETEEVNKTLK	1125	sp|P98171|RHG04_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3877	27.324	2	1531.8094	1531.8094	R	A	372	385
PSM	SADESGQALLAAGHYASDEVR	1126	sp|Q13813-2|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	21-UNIMOD:267	ms_run[2]:scan=7447	49.438	3	2156.001	2156.0010	K	E	419	440
PSM	SDAGLESDTAMKK	1127	sp|Q9NR30|DDX21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=1872	14.977	2	1351.6289	1351.6289	R	G	7	20
PSM	SDSGKPYYYNSQTK	1128	sp|O75400-2|PR40A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	5-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=1837	14.757	2	1648.7772	1648.7772	K	E	165	179
PSM	SEEQLKEEGIEYK	1129	sp|P09622-2|DLDH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3857	27.203	3	1580.757	1580.7570	K	V	306	319
PSM	SGERPVTAGEEDEQVPDSIDAR	1130	sp|Q9Y3D0|CIA2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4780	32.799	2	2356.0779	2356.0779	R	E	23	45
PSM	SIAFPSIGSGR	1131	sp|O75367-2|H2AY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:267	ms_run[2]:scan=6916	45.711	2	1100.5854	1100.5854	K	N	305	316
PSM	SIAFPSIGSGR	1132	sp|O75367-2|H2AY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:267	ms_run[2]:scan=7197	47.747	2	1100.5854	1100.5854	K	N	305	316
PSM	SNPSENEEKEAQSQLIK	1133	sp|Q13217|DNJC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4368	30.297	3	1929.928	1929.9280	K	S	134	151
PSM	SNTPILVDGKDVMPEVNK	1134	sp|P06744|G6PI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7072	46.865	3	1955.0034	1955.0034	R	V	107	125
PSM	SSQLLEPAVEETTKK	1135	sp|Q8WYP5|ELYS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4933	33.727	2	1658.8727	1658.8727	K	E	1846	1861
PSM	SYVSEKDVTSAK	1136	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=2224	17.145	2	1312.6511	1312.6511	K	A	1327	1339
PSM	SYVSEKDVTSAK	1137	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=2226	17.161	2	1324.6913	1324.6913	K	A	1327	1339
PSM	TAEEENPEHVEIQK	1138	sp|O00566|MPP10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=2810	20.753	2	1651.7689	1651.7689	K	M	485	499
PSM	TAEELMNFSKGEENLMDAQVK	1139	sp|P50990-3|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:188,16-UNIMOD:35,21-UNIMOD:188	ms_run[2]:scan=7904	52.342	2	2411.1387	2411.1387	K	A	188	209
PSM	TAEELMNFSKGEENLMDAQVK	1140	sp|P50990-3|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9381	61.415	2	2383.1036	2383.1036	K	A	188	209
PSM	TCLPGFPGAPCAIK	1141	sp|P51610-2|HCFC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:4,11-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=8210	54.228	2	1493.7466	1493.7466	K	I	1816	1830
PSM	TEEKQQEPVTSTSLVFGK	1142	sp|P49790-2|NU153_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	4-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=6084	40.646	3	2019.0563	2019.0563	R	K	1061	1079
PSM	TEKEESTEVLK	1143	sp|P20810-3|ICAL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=1373	11.646	2	1303.691	1303.6910	K	A	133	144
PSM	TEMEDLMSSKDDVGK	1144	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:35,10-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=3520	25.121	2	1711.7683	1711.7683	R	S	1504	1519
PSM	TGLYNYYDDEKEK	1145	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4733	32.52	2	1636.7257	1636.7257	R	L	240	253
PSM	TQVEASEESALNHLQNPGDAAEGR	1146	sp|Q9Y605|MOFA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	24-UNIMOD:267	ms_run[2]:scan=6406	42.544	3	2532.1716	2532.1716	K	A	69	93
PSM	TSYETADKVLQNK	1147	sp|Q9Y6W3|CAN7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	8-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=4017	28.183	2	1507.7921	1507.7921	K	L	123	136
PSM	TTKIPCDSPQSDPVDTPTSTK	1148	sp|P46013|KI67_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:4	ms_run[2]:scan=3690	26.189	3	2274.0686	2274.0686	K	Q	1246	1267
PSM	TTVKESATEEK	1149	sp|Q13561|DCTN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	4-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=615	6.8072	2	1233.6491	1233.6491	K	L	122	133
PSM	TVTEYKIDEDGK	1150	sp|O75821|EIF3G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=2898	21.303	2	1396.6722	1396.6722	K	K	66	78
PSM	VDKGVVPLAGTDGETTTQGLDGLSER	1151	sp|P09972|ALDOC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7586	50.338	2	2614.3086	2614.3086	K	C	109	135
PSM	VDNEILDYKDLAAIPK	1152	sp|O14639-4|ABLM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9292	60.862	2	1815.9618	1815.9618	K	V	34	50
PSM	VDQSAVGFEYQGKTEK	1153	sp|Q14247-3|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4156	29.009	2	1784.8581	1784.8581	R	H	132	148
PSM	VGPGAGESPGTPPFR	1154	sp|Q8TEQ6|GEMI5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4828	33.086	2	1424.7048	1424.7048	R	V	41	56
PSM	VLALPEPSPAAPTLR	1155	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	15-UNIMOD:267	ms_run[2]:scan=8147	53.841	3	1540.8852	1540.8852	K	S	1018	1033
PSM	VQESTKGPDEAK	1156	sp|O43390-4|HNRPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=560	6.4685	2	1287.6307	1287.6307	K	I	14	26
PSM	VSEEIQKEIQDLEK	1157	sp|Q709C8-4|VP13C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8208	54.217	2	1686.8676	1686.8676	K	T	378	392
PSM	VSQGSKDPAEGDGAQPEETPR	1158	sp|Q14697|GANAB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=1356	11.537	2	2153.9825	2153.9825	R	D	186	207
PSM	VTGDSQPKEQGQGDLK	1159	sp|O76094-2|SRP72_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=907	8.5921	2	1685.822	1685.8220	K	K	476	492
PSM	VVECKPQPCVVSVEGLSSSTTDAQLK	1160	sp|Q96EV2|RBM33_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	4-UNIMOD:4,5-UNIMOD:188,9-UNIMOD:4,26-UNIMOD:188	ms_run[2]:scan=7361	48.859	3	2829.4291	2829.4291	R	S	1090	1116
PSM	VVQVSAGDSHTAALTDDGR	1161	sp|P18754|RCC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3890	27.407	3	1897.913	1897.9130	K	V	121	140
PSM	YALYDATYETKESK	1162	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=4993	34.093	3	1692.8285	1692.8285	R	K	82	96
PSM	YEDFKEEGSENAVK	1163	sp|Q9NTK5|OLA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3058	22.291	2	1643.7315	1643.7315	K	A	350	364
PSM	YTDATSKYESVMK	1164	sp|Q13217|DNJC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4262	29.658	2	1521.7021	1521.7021	R	T	284	297
PSM	YTDLNSNDVTGLRESEEK	1165	sp|Q15007-2|FL2D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5079	34.607	2	2068.9549	2068.9549	K	L	44	62
PSM	DSDELKSWVNEK	1166	sp|Q13813|SPTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	6-UNIMOD:188,12-UNIMOD:188	ms_run[1]:scan=5939	39.76932333333333	2	1461.724730	1460.718596	R	M	581	593
PSM	YLMEEDEDAYKK	1167	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:35,11-UNIMOD:188,12-UNIMOD:188	ms_run[1]:scan=2626	19.644991666666666	2	1561.698480	1560.705649	R	Q	210	222
PSM	QVQSLTCEVDALKGTNESLER	1168	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:28,7-UNIMOD:4	ms_run[1]:scan=9970	65.10772666666668	3	2359.1317	2359.1320	R	Q	322	343
PSM	AVDEMNGKELNGK	1169	sp|P11940|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	8-UNIMOD:188,13-UNIMOD:188	ms_run[1]:scan=2447	18.526513333333334	2	1416.697410	1415.711737	K	Q	247	260
PSM	FLATPPNGNFADAVFR	1170	sp|O75165|DJC13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=10356	67.47679166666666	2	1735.871322	1735.868205	R	F	361	377
PSM	DPCQCVCHGSAVTTQDCCPR	1171	sp|P14222|PERF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:4,5-UNIMOD:4,7-UNIMOD:4,17-UNIMOD:4,18-UNIMOD:4,20-UNIMOD:267	ms_run[1]:scan=3038	22.165538333333334	3	2416.922231	2416.931459	R	Q	391	411
PSM	TAGVKVETTEDLVAK	1172	sp|P38117|ETFB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=4646	31.994603333333334	2	1559.842259	1559.840653	R	L	234	249
PSM	NGFLLDGFPR	1173	sp|P54819|KAD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=10112	65.998615	2	1134.582636	1134.582194	K	T	94	104
PSM	NGFLLDGFPR	1174	sp|P54819|KAD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=10283	67.03597166666667	2	1134.582636	1134.582194	K	T	94	104
PSM	QAQVPLAAVIKPLAR	1175	sp|P53992|SC24C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:28	ms_run[1]:scan=10659	69.374105	2	1558.9342	1556.9402	K	L	390	405
PSM	AEPEKNGEVVHTPETSV	1176	sp|O15427|MOT4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	5-UNIMOD:188	ms_run[1]:scan=4031	28.263081666666665	2	1828.876112	1827.894601	K	-	449	466
PSM	INGEVSSISSKFETEPVSK	1177	sp|Q9Y5K6|CD2AP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=6892	45.52451333333334	2	2038.009616	2037.026616	K	L	426	445
PSM	GGGGNFGPGPGSNFR	1178	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	15-UNIMOD:267	ms_run[1]:scan=5187	35.26044666666667	2	1387.616151	1386.630430	R	G	214	229
PSM	MGPSGAALGVLILR	1179	sp|Q8N1F8|S11IP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=10907	70.93948499999999	2	1354.768131	1353.780242	R	G	227	241
PSM	GDASKEDIDTAMK	1180	sp|Q16836|HCDH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=2294	17.569303333333334	2	1379.620406	1379.623860	R	L	237	250
PSM	CRVDLPLAVLSK	1181	sp|Q9H773|DCTP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:267,12-UNIMOD:188	ms_run[1]:scan=10799	70.24658000000001	2	1368.7788	1368.7765	R	M	110	122
PSM	FFPLESWQIGK	1182	sp|P30046|DOPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	11-UNIMOD:188	ms_run[1]:scan=11217	72.97617333333332	2	1356.719362	1356.717352	R	I	100	111
PSM	FFPLESWQIGK	1183	sp|P30046|DOPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=11238	73.14319833333333	2	1350.699755	1350.697223	R	I	100	111
PSM	QDAQDLYEAGEKK	1184	sp|P09525|ANXA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:28	ms_run[1]:scan=4800	32.91837833333333	2	1476.6756	1476.6727	R	W	173	186
PSM	QSVFPFESGKPFK	1185	sp|P17931|LEG3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:28	ms_run[1]:scan=9784	63.939919999999994	2	1479.7399	1479.7393	R	I	187	200
PSM	DVQESLKNGSATGGGNK	1186	sp|Q13416|ORC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	7-UNIMOD:188,17-UNIMOD:188	ms_run[1]:scan=1882	15.035348333333333	2	1673.828963	1672.841900	R	V	77	94
PSM	KEASDPQPEEADGGLK	1187	sp|P52907|CAZA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1910	15.20674	2	1670.782710	1669.779509	R	S	103	119
PSM	MGQMAMGGAMGINNR	1188	sp|Q15233|NONO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:35	ms_run[1]:scan=5221	35.46979666666667	2	1553.647514	1553.657108	R	G	384	399
PSM	AAEEPSKVEEK	1189	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	7-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=718	7.4458	2	1227.6386	1227.6386	K	K	257	268
PSM	AAEEPSKVEEK	1190	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=717	7.4404	2	1215.5983	1215.5983	K	K	257	268
PSM	AAMDNSEIAGEKK	1191	sp|Q16891-3|MIC60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	3-UNIMOD:35	ms_run[2]:scan=769	7.7578	2	1378.6398	1378.6398	K	S	226	239
PSM	ADAGKEGNNPAENGDAK	1192	sp|P05204|HMGN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=538	6.3278	2	1656.734	1656.7340	K	T	60	77
PSM	ADDKLIAEEGVDSLNVK	1193	sp|O95202|LETM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7075	46.888	3	1814.9262	1814.9262	K	E	357	374
PSM	ADGILVPGGFGIR	1194	sp|Q9NRF8|PYRG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9710	63.481	2	1270.7034	1270.7034	K	G	364	377
PSM	AGFAGDDAPR	1195	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=2163	16.792	2	975.44101	975.4410	K	A	19	29
PSM	AIIEEGDKEIATK	1196	sp|O75165|DJC13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	8-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=3699	26.241	2	1427.791	1427.7910	K	M	587	600
PSM	AMEVDERPTEQYSDIGGLDK	1197	sp|P17980|PRS6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6342	42.15	3	2252.0267	2252.0267	K	Q	174	194
PSM	AMGIMNSFVNDIFER	1198	sp|Q99880|H2B1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:35,5-UNIMOD:35	ms_run[2]:scan=10752	69.953	2	1774.8018	1774.8018	K	I	59	74
PSM	APGLGLVLER	1199	sp|Q9Y606-2|TRUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:267	ms_run[2]:scan=8117	53.659	2	1033.6159	1033.6159	K	V	300	310
PSM	ASFPQGPIGGANR	1200	sp|O75608-2|LYPA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4932	33.721	2	1270.6418	1270.6418	R	D	134	147
PSM	AYEDQTKPVLEYYQK	1201	sp|Q9UIJ7-2|KAD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	7-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=5696	38.303	3	1885.9501	1885.9501	K	K	105	120
PSM	CHACLNQALCPAAQGL	1202	sp|P78549-3|NTH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:4,4-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=7211	47.833	2	1782.7964	1782.7964	R	-	282	298
PSM	CLFQSPLFAK	1203	sp|Q86X55-1|CARM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:4	ms_run[2]:scan=9861	64.418	2	1209.6216	1209.6216	R	A	420	430
PSM	CVSVQTDPTDEIPTKK	1204	sp|P18583-8|SON_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:4,15-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=4390	30.434	3	1828.9279	1828.9279	R	S	92	108
PSM	DADSSISVLEIHSQK	1205	sp|Q96T23-3|RSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	15-UNIMOD:188	ms_run[2]:scan=6236	41.512	2	1633.8255	1633.8255	K	A	260	275
PSM	DECLLPCKDAPELGYAK	1206	sp|Q8TAT6|NPL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	3-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=7252	48.125	2	1977.9176	1977.9176	R	E	397	414
PSM	DGGQTESNEEGKENR	1207	sp|Q14157-4|UBP2L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=403	5.4717	2	1648.6925	1648.6925	K	D	110	125
PSM	DISQAYYTVYKK	1208	sp|P12429|ANXA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=5809	38.993	2	1489.7856	1489.7856	K	S	127	139
PSM	DKEAIQAYSESLMTSAPK	1209	sp|Q8WTV0-3|SCRB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7884	52.22	3	1967.951	1967.9510	K	G	383	401
PSM	DKSTNCFGDNDPIDVCEIGSK	1210	sp|Q9H2U2|IPYR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:188,6-UNIMOD:4,16-UNIMOD:4,21-UNIMOD:188	ms_run[2]:scan=7320	48.575	3	2382.0506	2382.0506	K	I	156	177
PSM	DLQSAEKEEQEK	1211	sp|P21579|SYT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=1684	13.757	2	1432.6682	1432.6682	R	L	262	274
PSM	DMDDEESWIKEK	1212	sp|Q13813-2|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5992	40.094	2	1523.645	1523.6450	R	K	1777	1789
PSM	DMELPTEKEVALVK	1213	sp|P27816-2|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7715	51.158	2	1600.8382	1600.8382	K	D	305	319
PSM	DSEQVAELKQELATLK	1214	sp|O60763|USO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9639	63.034	2	1800.9469	1800.9469	R	S	783	799
PSM	DVAIKEPLVDVVDPK	1215	sp|Q99873-2|ANM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=8161	53.927	3	1647.9486	1647.9486	K	Q	205	220
PSM	DVDAAYMNKVELEAK	1216	sp|P13647|K2C5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	9-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=6411	42.576	3	1706.8588	1706.8588	K	V	278	293
PSM	EAALVQQEEEKAEQR	1217	sp|Q15020-4|SART3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4266	29.682	2	1756.8592	1756.8592	K	K	551	566
PSM	EAVKAASDELSK	1218	sp|P18206-2|VINC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	4-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=1759	14.275	2	1258.6808	1258.6808	R	T	781	793
PSM	ENLSDEDKLNNAK	1219	sp|Q14651|PLSI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	8-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=2218	17.111	2	1500.7459	1500.7459	R	Y	573	586
PSM	EQLDPDELETITMHK	1220	sp|Q9NYU2-2|UGGG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8170	53.983	2	1797.8455	1797.8455	R	I	620	635
PSM	EQLDPDELETITMHK	1221	sp|Q9NYU2-2|UGGG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	15-UNIMOD:188	ms_run[2]:scan=8171	53.989	2	1803.8656	1803.8656	R	I	620	635
PSM	ETVQTTEDQILKR	1222	sp|P18206-2|VINC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5039	34.367	2	1559.8155	1559.8155	K	D	60	73
PSM	EVEEDEYKAFYK	1223	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	8-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=5480	37.013	2	1560.7387	1560.7387	K	S	349	361
PSM	EVEELILTESKK	1224	sp|Q9BZZ5-1|API5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5973	39.979	2	1416.7712	1416.7712	K	V	98	110
PSM	EVQTNDLKEVVNK	1225	sp|P61247|RS3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	8-UNIMOD:188	ms_run[2]:scan=4124	28.814	2	1520.8142	1520.8142	R	L	175	188
PSM	EYEAEGIAKDGAK	1226	sp|Q9HCC0|MCCB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=2338	17.831	2	1379.6569	1379.6569	R	M	412	425
PSM	EYSIGTGSTKQEAK	1227	sp|P19525-2|E2AK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=1793	14.472	2	1497.7311	1497.7311	K	Q	141	155
PSM	FDGILGMAYPR	1228	sp|P07339|CATD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9874	64.497	2	1238.6118	1238.6118	K	I	195	206
PSM	FGQAATMEGIGAIGGTPPAFNR	1229	sp|Q15233-2|NONO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	22-UNIMOD:267	ms_run[2]:scan=9434	61.754	2	2172.0661	2172.0661	R	A	346	368
PSM	FSPLMTAAVLGTR	1230	sp|Q6P996-3|PDXD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10080	65.8	2	1362.733	1362.7330	R	G	368	381
PSM	GLLGCNIIPLQR	1231	sp|O00233-3|PSMD9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=9626	62.955	2	1362.7681	1362.7681	K	-	107	119
PSM	GNPTVEVDLFTSK	1232	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8333	54.984	2	1405.7089	1405.7089	R	G	16	29
PSM	GPLQSVQVFGR	1233	sp|P62249|RS16_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:267	ms_run[2]:scan=7746	51.356	2	1196.6541	1196.6541	K	K	5	16
PSM	GSCSTEVEKETQEK	1234	sp|O75348|VATG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	3-UNIMOD:4	ms_run[2]:scan=1100	9.9465	2	1610.7094	1610.7094	R	M	67	81
PSM	GTTEVNIDSETVHR	1235	sp|Q8NFC6|BD1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	14-UNIMOD:267	ms_run[2]:scan=3486	24.917	2	1566.7513	1566.7513	R	M	1227	1241
PSM	IEQVDKEDEITEK	1236	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=2803	20.715	3	1574.7675	1574.7675	K	K	445	458
PSM	IGLFGGAGVGK	1237	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:188	ms_run[2]:scan=6733	44.417	2	980.57504	980.5750	K	T	202	213
PSM	IIDNSSEQKPENELK	1238	sp|Q15652-2|JHD2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=2746	20.371	2	1742.8687	1742.8687	R	N	169	184
PSM	IIPGFMCQGGDFTR	1239	sp|Q9Y536|PAL4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	7-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=9052	59.393	2	1607.7464	1607.7464	R	H	56	70
PSM	IIPGFMCQGGDFTR	1240	sp|Q9Y536|PAL4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	7-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=8891	58.406	3	1607.7464	1607.7464	R	H	56	70
PSM	ILFIGGITAPTVR	1241	sp|P48651-3|PTSS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10657	69.357	2	1356.8129	1356.8129	R	Q	121	134
PSM	ILFIGGITAPTVR	1242	sp|P48651-3|PTSS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:267	ms_run[2]:scan=10661	69.385	2	1366.8212	1366.8212	R	Q	121	134
PSM	INSAPQQIEVFPPFR	1243	sp|Q8TEM1|PO210_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	15-UNIMOD:267	ms_run[2]:scan=10113	66.004	2	1751.9234	1751.9234	R	L	1068	1083
PSM	ISGLIYEETR	1244	sp|P62805|H4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:267	ms_run[2]:scan=5982	40.035	2	1189.6218	1189.6218	R	G	47	57
PSM	KVEEAEPEEFVVEK	1245	sp|Q13185|CBX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=5272	35.77	3	1672.8598	1672.8598	K	V	21	35
PSM	LAVNMVPFPR	1246	sp|Q13509-2|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:35,10-UNIMOD:267	ms_run[2]:scan=7310	48.508	2	1168.6302	1168.6302	K	L	181	191
PSM	LAVNMVPFPR	1247	sp|Q13509-2|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8845	58.126	2	1142.627	1142.6270	K	L	181	191
PSM	LCASGAGATPDTAIEEIKEK	1248	sp|P53384-2|NUBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:4	ms_run[2]:scan=6066	40.539	3	2060.0096	2060.0096	R	M	30	50
PSM	LDQEVAEVDKNIELLK	1249	sp|Q99816-2|TS101_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8830	58.032	3	1854.9939	1854.9939	R	K	172	188
PSM	LGLPPLTPEQQEALQK	1250	sp|Q9UHX1-4|PUF60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8138	53.786	2	1760.9672	1760.9672	K	A	11	27
PSM	LLGFLDVENTPCAR	1251	sp|Q5RI15|COX20_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:4	ms_run[2]:scan=10326	67.293	2	1603.8028	1603.8028	K	H	18	32
PSM	LLGPTVMLGGCEFSR	1252	sp|Q8N9T8|KRI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=9950	64.979	2	1645.8196	1645.8196	R	Q	657	672
PSM	LQTLVSEQPNKDVVEQMEK	1253	sp|Q86UP2-2|KTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=6867	45.316	3	2226.1605	2226.1605	K	C	717	736
PSM	LSCEPVMEEKAQEK	1254	sp|Q9UKI2|BORG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	3-UNIMOD:4,10-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=3007	21.977	2	1688.8152	1688.8152	R	S	143	157
PSM	LTEELNKEATVIQDLK	1255	sp|Q15075|EEA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8019	53.055	3	1842.9939	1842.9939	R	T	196	212
PSM	LYLDELEGGGNPGASCKDTSGEIK	1256	sp|Q9HD26-2|GOPC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	16-UNIMOD:4,17-UNIMOD:188,24-UNIMOD:188	ms_run[2]:scan=7228	47.952	2	2521.2045	2521.2045	R	V	385	409
PSM	MFQQCLELPSQSR	1257	sp|Q9Y2A7|NCKP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:35,5-UNIMOD:4	ms_run[2]:scan=6221	41.416	2	1638.7494	1638.7494	K	Y	552	565
PSM	MGGFGSIIQLYPGGGPVR	1258	sp|Q9UJA5-4|TRM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:35,18-UNIMOD:267	ms_run[2]:scan=10670	69.441	2	1830.9326	1830.9326	R	A	51	69
PSM	MGPAMGPALGAGIER	1259	sp|P52272-2|HNRPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:35,15-UNIMOD:267	ms_run[2]:scan=5619	37.832	2	1452.7093	1452.7093	R	M	553	568
PSM	MGPAMGPALGAGIER	1260	sp|P52272-2|HNRPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6957	45.992	2	1426.7061	1426.7061	R	M	553	568
PSM	NEEEGNSEEIKAK	1261	sp|O75844|FACE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=858	8.2955	2	1475.674	1475.6740	R	V	304	317
PSM	NEEKTAEDYSVDENGQR	1262	sp|O60488-2|ACSL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	4-UNIMOD:188,17-UNIMOD:267	ms_run[2]:scan=2498	18.853	2	1998.8738	1994.8856	K	W	492	509
PSM	NSDIEQSSDSKVK	1263	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=888	8.4791	2	1447.7193	1447.7193	K	N	2582	2595
PSM	NSVTPDMMEEMYKK	1264	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	8-UNIMOD:35,13-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=4443	30.763	2	1729.7764	1729.7764	K	A	229	243
PSM	NTEIENTKLMSEVQTLK	1265	sp|Q86VP1-3|TAXB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	8-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=7915	52.409	2	1989.0491	1989.0491	K	N	105	122
PSM	NVLIVEDIIDTGK	1266	sp|P00492|HPRT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10935	71.121	2	1427.7872	1427.7872	K	T	129	142
PSM	QAAASATQTIAAAQHAASTPK	1267	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	21-UNIMOD:188	ms_run[2]:scan=5300	35.928	3	2000.0382	2000.0382	K	A	923	944
PSM	QDLADVVQVCEGKK	1268	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:4	ms_run[2]:scan=5766	38.731	2	1587.7927	1587.7927	R	K	4429	4443
PSM	QEVQDLQASLKEEK	1269	sp|Q15075|EEA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4773	32.754	2	1643.8366	1643.8366	R	W	90	104
PSM	QGLETDNKELACEVK	1270	sp|P35580|MYH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:4	ms_run[2]:scan=4388	30.422	2	1732.8302	1732.8302	K	V	1227	1242
PSM	SDGGYTYDTSDLAAIKQR	1271	sp|P54136-2|SYRC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6004	40.17	3	1959.9174	1959.9174	K	L	306	324
PSM	SDLQNKTQELETTQK	1272	sp|P52732|KIF11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3159	22.915	2	1761.8745	1761.8745	K	H	452	467
PSM	SEEQLKEEGIEYK	1273	sp|P09622-2|DLDH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	6-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=3856	27.198	3	1592.7972	1592.7972	K	V	306	319
PSM	SFPGFQAFCETQGDR	1274	sp|Q01780-2|EXOSX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	9-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=9263	60.681	2	1755.755	1755.7550	R	L	65	80
PSM	SGPGLIGLGIK	1275	sp|Q6PGP7|TTC37_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8191	54.114	2	1010.6124	1010.6124	K	A	271	282
PSM	SGQAKETIPLQETSLYTQDR	1276	sp|P50897-2|PPT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:188,20-UNIMOD:267	ms_run[2]:scan=6429	42.687	2	2280.1569	2276.1687	R	L	146	166
PSM	SIAFPSIGSGR	1277	sp|O75367-2|H2AY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:267	ms_run[2]:scan=7052	46.734	2	1100.5854	1100.5854	K	N	305	316
PSM	SIAFPSIGSGR	1278	sp|O75367-2|H2AY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7007	46.358	2	1090.5771	1090.5771	K	N	305	316
PSM	SIAFPSIGSGR	1279	sp|O75367-2|H2AY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7297	48.425	2	1090.5771	1090.5771	K	N	305	316
PSM	SLSDSESDDSKSK	1280	sp|Q13185|CBX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=613	6.796	2	1395.6404	1395.6404	K	K	93	106
PSM	SLYQSAGVAPESFEYIEAHGTGTK	1281	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8781	57.734	3	2541.2023	2541.2023	R	V	275	299
PSM	SNIGTEGGPPPFVPFGQK	1282	sp|Q9H7E2|TDRD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	18-UNIMOD:188	ms_run[2]:scan=8696	57.226	2	1833.9357	1833.9357	R	C	80	98
PSM	SPLGEAPPGTPPCR	1283	sp|Q96B54|ZN428_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:4	ms_run[2]:scan=4191	29.221	2	1434.6925	1434.6925	R	L	99	113
PSM	SQAPCANKDEADLSSK	1284	sp|Q96SK2-3|TM209_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:4	ms_run[2]:scan=1464	12.27	2	1719.7734	1719.7734	R	Q	297	313
PSM	SQPDPVDTPTSSKPQSK	1285	sp|P46013|KI67_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=1331	11.381	2	1797.8745	1797.8745	R	R	1496	1513
PSM	SRNITYLPAGQSVLLQLPQ	1286	sp|P35232|PHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:267	ms_run[2]:scan=10806	70.291	2	2107.1665	2107.1665	R	-	254	273
PSM	STGDIAGTVVPETNKEPR	1287	sp|Q9UDY2-5|ZO2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4581	31.594	2	1869.9432	1869.9432	K	Y	461	479
PSM	STPAEDDSRDSQVK	1288	sp|Q9UHB6|LIMA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=747	7.6313	2	1533.6907	1533.6907	R	S	336	350
PSM	SVQATTENKELK	1289	sp|Q13011|ECH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=1088	9.8753	2	1346.7042	1346.7042	K	T	310	322
PSM	TANEEEEIVHK	1290	sp|Q6GMV2|SMYD5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=1972	15.586	2	1297.615	1297.6150	K	L	197	208
PSM	TATPQQAQEVHEK	1291	sp|P60174-4|TPIS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:188	ms_run[2]:scan=880	8.43	2	1471.7362	1471.7362	K	L	94	107
PSM	TAVETAVLLLR	1292	sp|P49368-2|TCPG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:267	ms_run[2]:scan=9974	65.13	2	1194.7211	1194.7211	K	I	470	481
PSM	TEISDKITSELVSK	1293	sp|Q14008-2|CKAP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	6-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=7087	46.967	3	1560.8649	1560.8649	R	I	855	869
PSM	TQSLPVTEKVTENQIPAK	1294	sp|Q9NQW6|ANLN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	9-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=5195	35.309	2	1994.1087	1994.1087	K	N	483	501
PSM	VGINYQPPTVVPGGDLAK	1295	sp|P68363-2|TBA1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8022	53.073	2	1823.9781	1823.9781	K	V	237	255
PSM	VGMVETNSQDRPVDDVK	1296	sp|Q9Y3C6|PPIL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3828	27.028	2	1887.8996	1887.8996	R	I	142	159
PSM	VGPGAGESPGTPPFR	1297	sp|Q8TEQ6|GEMI5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	15-UNIMOD:267	ms_run[2]:scan=4814	33.005	2	1434.7131	1434.7131	R	V	41	56
PSM	VILEEHSTCENEVSK	1298	sp|P16383-2|GCFC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	9-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=2994	21.893	2	1778.8452	1778.8452	R	S	549	564
PSM	VKEGYVPQEEVPVYENK	1299	sp|Q9BRP8-2|PYM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5435	36.748	3	2005.9997	2005.9997	R	Y	31	48
PSM	VPTANVSVVDLTCR	1300	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:4	ms_run[2]:scan=7288	48.363	2	1529.7872	1529.7872	R	L	235	249
PSM	VSSAEGAAKEEPK	1301	sp|P05114|HMGN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	9-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=755	7.6813	2	1313.6866	1313.6866	K	R	6	19
PSM	VVLEGPAPWGFR	1302	sp|Q9NR12-3|PDLI7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:267	ms_run[2]:scan=9689	63.352	2	1336.7167	1336.7167	K	L	6	18
PSM	YDDPEVQKDIK	1303	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=2912	21.385	2	1348.6511	1348.6511	R	N	128	139
PSM	YEEIVKEVSTYIK	1304	sp|P68104-2|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	6-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=8918	58.572	3	1611.8798	1611.8798	R	K	146	159
PSM	YEIDTGEETKFVNPEDVAR	1305	sp|Q0VDF9|HSP7E_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7540	50.044	2	2211.0332	2211.0332	R	L	100	119
PSM	YTPEEEQELEKR	1306	sp|P28290-2|ITPI2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3126	22.708	2	1549.726	1549.7260	K	V	622	634
PSM	TATPEIVDNKDGTVTVR	1307	sp|O75369|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0		ms_run[1]:scan=4441	30.750359999999997	2	1816.9562	1814.9372	K	Y	1771	1788
PSM	SEIFGTCGEEQKTVLQEK	1308	sp|Q9UPN3|MACF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	7-UNIMOD:4,12-UNIMOD:188,18-UNIMOD:188	ms_run[1]:scan=6002	40.15726666666667	2	2094.049900	2094.034194	R	T	5736	5754
PSM	LQAALDDEEAGGRPAMEPGNGSLDLGGDSAGR	1309	sp|Q00839|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=7484	49.690815	4	3126.422403	3125.431984	R	S	38	70
PSM	QGQQQAGGDGKTEQK	1310	sp|Q00839-2|HNRPU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28,11-UNIMOD:188,15-UNIMOD:188	ms_run[1]:scan=416	5.553441666666666	2	1553.7486	1553.7467	R	G	205	220
PSM	GLESTTLADKDGEIYCK	1311	sp|P21291|CSRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	10-UNIMOD:188,16-UNIMOD:4,17-UNIMOD:188	ms_run[1]:scan=5657	38.05722	2	1911.9192	1910.9332	K	G	152	169
PSM	VPDGMVGFIIGR	1312	sp|Q96AE4|FUBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=10652	69.32905166666667	2	1259.671351	1259.669628	K	G	107	119
PSM	AGATASKEPPLYYGVCPVYEDVPAR	1313	sp|Q86XL3|ANKL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	16-UNIMOD:4	ms_run[1]:scan=8450	55.71250666666666	3	2710.310364	2709.310853	R	N	188	213
PSM	CPENAFFLDHVR	1314	sp|O00159|MYO1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=10041	65.56064333333333	2	1486.6671	1486.6658	R	T	802	814
PSM	QGLETDNKELACEVK	1315	sp|P35580|MYH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28,12-UNIMOD:4	ms_run[1]:scan=5733	38.52476166666666	2	1715.8049	1715.8031	K	V	1227	1242
PSM	ADALQAGASQFETSAAK	1316	sp|P63027|VAMP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=7992	52.88759833333333	2	1664.772063	1664.800579	R	L	67	84
PSM	AAGEPIKEGDNDYFTCITK	1317	sp|Q99543|DNJC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	16-UNIMOD:4	ms_run[1]:scan=6586	43.58972833333333	3	2127.982753	2127.978286	K	A	125	144
PSM	ADTLTPEECQQFKK	1318	sp|Q16181|SEPT7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	9-UNIMOD:4	ms_run[1]:scan=3672	26.083658333333336	2	1693.796647	1693.798136	K	Q	196	210
PSM	SLLSVTKEGLELPEDEEEK	1319	sp|Q58FF6|H90B4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0		ms_run[1]:scan=7837	51.925670000000004	3	2144.0694	2144.0731	K	K	440	459
PSM	INSAPQQIEVFPPFR	1320	sp|Q8TEM1|PO210_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=9944	64.937825	2	1741.916219	1741.915155	R	L	1068	1083
PSM	ETCSTLAESPRNGLQEK	1321	sp|Q6P2E9|EDC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	3-UNIMOD:4	ms_run[1]:scan=3491	24.949986666666668	2	1919.8872	1918.9052	R	H	836	853
PSM	GGGGNFGPGPGSNFR	1322	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=4919	33.645606666666666	2	1377.607348	1376.622161	R	G	214	229
PSM	DISTNKVEQIPYGER	1323	sp|P49750|YLPM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	6-UNIMOD:188,15-UNIMOD:267	ms_run[1]:scan=5232	35.535855	2	1763.900682	1763.902476	R	I	1647	1662
PSM	LLVVYPWTQR	1324	sp|P68871|HBB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=9941	64.92156833333334	2	1273.715868	1273.718293	R	F	32	42
PSM	IGLFGGAGVGK	1325	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=6734	44.42022333333333	2	974.554644	974.554916	K	T	202	213
PSM	YYDDTYPSVKEQK	1326	sp|P61923|COPZ1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	10-UNIMOD:188,13-UNIMOD:188	ms_run[1]:scan=3406	24.43392	2	1646.787311	1646.786676	K	A	30	43
PSM	DLTIEKVVINGQEVK	1327	sp|P09960|LKHA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0		ms_run[1]:scan=7739	51.30987666666667	2	1684.9242	1683.9402	K	Y	59	74
PSM	EKEDPEPSTDGTYVWK	1328	sp|Q9UHG3|PCYOX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	2-UNIMOD:188,16-UNIMOD:188	ms_run[1]:scan=5085	34.644740000000006	2	1892.894405	1891.887847	R	I	391	407
PSM	LGYAVYETPTAHNGAK	1329	sp|Q9H0E2|TOLIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=4889	33.458101666666664	2	1691.817005	1690.831485	R	N	81	97
PSM	AALSEEELEKK	1330	sp|Q04637-7|IF4G1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2896	21.292	2	1245.6452	1245.6452	K	S	1040	1051
PSM	AEAESMYQIKYEELQSLAGK	1331	sp|P05787-2|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=8959	58.832	3	2299.1445	2299.1445	R	H	304	324
PSM	AEPEKNGEVVHTPETSV	1332	sp|O15427|MOT4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	5-UNIMOD:188	ms_run[2]:scan=3454	24.718	2	1827.8946	1827.8946	K	-	449	466
PSM	AGFAGDDAPR	1333	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:267	ms_run[2]:scan=2157	16.753	2	985.44928	985.4493	K	A	19	29
PSM	ALSETVVEESDPKPAFSK	1334	sp|Q8IWT6|LRC8A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5756	38.666	3	1932.968	1932.9680	R	M	172	190
PSM	APPGPAGLSGGESLLVK	1335	sp|Q9NRL3-2|STRN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7805	51.725	2	1548.8512	1548.8512	R	Q	103	120
PSM	ASPEAASTPRDPIDVDLPEEAER	1336	sp|P29590-4|PML_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7354	48.814	3	2464.1718	2464.1718	K	V	402	425
PSM	AVEEMNGKEISGK	1337	sp|Q13310-2|PABP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	8-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=1984	15.66	2	1402.7165	1402.7165	K	I	247	260
PSM	CLIEILASR	1338	sp|P08133-2|ANXA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:4,9-UNIMOD:267	ms_run[2]:scan=9258	60.655	2	1083.5986	1083.5986	K	T	82	91
PSM	DADETKEWIEEK	1339	sp|Q13813-2|SPTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4969	33.949	2	1491.6729	1491.6729	R	N	1241	1253
PSM	DAGEGLLAVQITDQEGKPK	1340	sp|O75369-6|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7583	50.321	3	1968.0164	1968.0164	R	R	1546	1565
PSM	DATHDEAVQALK	1341	sp|Q13884-2|SNTB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2915	21.401	2	1296.631	1296.6310	R	R	170	182
PSM	DGKLVSESSDVLPK	1342	sp|P05787-2|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=5060	34.491	3	1484.8125	1484.8125	R	-	498	512
PSM	DIDDDLEGEVTEECGKFGAVNR	1343	sp|Q9UHX1-4|PUF60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	14-UNIMOD:4	ms_run[2]:scan=8931	58.651	3	2467.0809	2467.0809	K	V	414	436
PSM	DLDFANDANKVLATTVK	1344	sp|Q14571|ITPR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9793	63.995	2	1833.9472	1833.9472	R	K	441	458
PSM	DLGVFIPAPMAQGMR	1345	sp|P78344-2|IF4G2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:35,15-UNIMOD:267	ms_run[2]:scan=9378	61.398	2	1627.809	1627.8090	K	S	333	348
PSM	DQTKAQAAAPASVPAQAPK	1346	sp|P47914|RL29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2595	19.451	3	1848.9694	1848.9694	K	R	131	150
PSM	DVYDKVDYLSSLGK	1347	sp|Q14254|FLOT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8292	54.736	2	1600.7985	1600.7985	K	T	156	170
PSM	DYSTLTSVSSHDSR	1348	sp|P16144-4|ITB4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	14-UNIMOD:267	ms_run[2]:scan=3971	27.905	2	1563.704	1563.7040	R	L	1439	1453
PSM	EADLAAQEEAAKK	1349	sp|Q9Y3B7-2|RM11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=1708	13.92	2	1384.7237	1384.7237	K	-	154	167
PSM	EAEGSSAEYKK	1350	sp|P49321-2|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=543	6.3621	2	1197.5513	1197.5513	K	E	288	299
PSM	EAMEADLKAAAEAAAEAK	1351	sp|Q9UNF1-2|MAGD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8572	56.465	3	1788.8564	1788.8564	R	A	459	477
PSM	EGKPTIVEEDDPELFK	1352	sp|O75937|DNJC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=7057	46.765	2	1856.9446	1856.9446	K	Q	144	160
PSM	EGLELPEDEEEKK	1353	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=4633	31.914	2	1555.7656	1555.7656	K	K	547	560
PSM	EGVLTGSPEQKEEAAK	1354	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2430	18.419	2	1671.8315	1671.8315	R	A	2270	2286
PSM	EKPSYDTETDPSEGLMNVLK	1355	sp|Q9HB71-3|CYBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=8943	58.729	3	2264.0921	2264.0921	K	K	134	154
PSM	EKQSDDEVYAPGLDIESSLK	1356	sp|Q15459-2|SF3A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8415	55.495	3	2222.059	2222.0590	R	Q	383	403
PSM	ELAALGCSVPVPPVR	1357	sp|Q96IR7|HPDL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	7-UNIMOD:4	ms_run[2]:scan=8345	55.056	2	1563.8443	1563.8443	R	V	94	109
PSM	ESESVDKVMDQK	1358	sp|Q14103-4|HNRPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	7-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=2795	20.666	2	1405.6798	1405.6798	K	E	128	140
PSM	ETENVKSSEEIESAFR	1359	sp|Q13813-2|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5901	39.544	3	1853.8643	1853.8643	R	A	2404	2420
PSM	ETKPEPMEEDLPENK	1360	sp|P31948-3|STIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=3936	27.693	2	1796.8541	1796.8541	K	K	184	199
PSM	EVEAQLPEKVEYVIK	1361	sp|P51532-5|SMCA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	9-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=7640	50.685	2	1784.9963	1784.9963	K	C	983	998
PSM	EVQTNDLKEVVNK	1362	sp|P61247|RS3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	8-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=4035	28.289	2	1526.8343	1526.8343	R	L	175	188
PSM	EYQEIENLDKTK	1363	sp|L0R819|ASURF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4673	32.162	2	1508.7359	1508.7359	K	I	82	94
PSM	FAIQDISVEETSAK	1364	sp|P12814-2|ACTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	14-UNIMOD:188	ms_run[2]:scan=7858	52.056	2	1542.7873	1542.7873	R	E	134	148
PSM	FLALDLGGTNFR	1365	sp|Q2TB90-3|HKDC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10464	68.155	2	1322.6983	1322.6983	K	V	528	540
PSM	FNPIETFLLGSCASDR	1366	sp|Q9NV06|DCA13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=12373	84.896	2	1835.8752	1835.8752	K	N	204	220
PSM	FQSLGVAFYR	1367	sp|P51149|RAB7A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:267	ms_run[2]:scan=8596	56.613	2	1196.6218	1196.6218	R	G	70	80
PSM	FVIGGPQGDAGLTGR	1368	sp|P31153|METK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6632	43.858	2	1443.747	1443.7470	R	K	250	265
PSM	FWKGPSEAPSGQA	1369	sp|Q9NY33-2|DPP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:188	ms_run[2]:scan=4751	32.626	2	1366.6613	1366.6613	R	-	305	318
PSM	GAADVEKVEEK	1370	sp|Q14839|CHD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	7-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=1222	10.669	2	1185.628	1185.6280	K	S	1637	1648
PSM	GAADVEKVEEK	1371	sp|Q14839|CHD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=1224	10.678	2	1173.5877	1173.5877	K	S	1637	1648
PSM	GFGFGGFAISAGK	1372	sp|Q86XP3|DDX42_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10101	65.925	2	1214.6084	1214.6084	R	K	13	26
PSM	GGDPLEKQDQISGLSQSEVK	1373	sp|Q99590|SCAFB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5631	37.901	3	2114.0491	2114.0491	K	T	519	539
PSM	GPDFTPAFADFGR	1374	sp|O43432-4|IF4G3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:267	ms_run[2]:scan=9880	64.536	2	1406.6494	1406.6494	R	Q	394	407
PSM	GPLQSVQVFGR	1375	sp|P62249|RS16_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7744	51.339	2	1186.6459	1186.6459	K	K	5	16
PSM	GQAVDYEGSRTQEEIVAK	1376	sp|P13667|PDIA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4061	28.438	3	1978.9596	1978.9596	K	V	146	164
PSM	GSETDSAQDQPVKMNSLPAER	1377	sp|P30419|NMT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:188,21-UNIMOD:267	ms_run[2]:scan=4618	31.821	2	2275.0721	2271.0840	K	I	68	89
PSM	GSETDSAQDQPVKMNSLPAER	1378	sp|P30419|NMT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4624	31.859	3	2259.0437	2259.0437	K	I	68	89
PSM	GTTEVNIDSETVHR	1379	sp|Q8NFC6|BD1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3482	24.894	2	1556.7431	1556.7431	R	M	1227	1241
PSM	GVLFYGPPGCGK	1380	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:4	ms_run[2]:scan=6616	43.769	2	1250.6118	1250.6118	K	T	513	525
PSM	IIPGFMCQGGDFTR	1381	sp|Q9Y536|PAL4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	7-UNIMOD:4	ms_run[2]:scan=8892	58.411	3	1597.7381	1597.7381	R	H	56	70
PSM	INSAPQQIEVFPPFR	1382	sp|Q8TEM1|PO210_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	15-UNIMOD:267	ms_run[2]:scan=9951	64.985	2	1751.9234	1751.9234	R	L	1068	1083
PSM	ITNDFYPEEDGKTK	1383	sp|P55884|EIF3B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=4273	29.724	2	1667.8081	1667.8081	K	G	217	231
PSM	ITNDFYPEEDGKTK	1384	sp|P55884|EIF3B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4278	29.758	2	1655.7679	1655.7679	K	G	217	231
PSM	ITNDFYPEEDGKTK	1385	sp|P55884|EIF3B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:188	ms_run[2]:scan=4291	29.837	2	1661.788	1661.7880	K	G	217	231
PSM	LAALALASSENSSSTPEECEEMSEKPK	1386	sp|O00567|NOP56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	19-UNIMOD:4,25-UNIMOD:188,27-UNIMOD:188	ms_run[2]:scan=6430	42.693	3	2906.3564	2906.3564	R	K	454	481
PSM	LAVNMVPFPR	1387	sp|Q13509-2|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:267	ms_run[2]:scan=9011	59.145	2	1152.6353	1152.6353	K	L	181	191
PSM	LDADKYENDPELEK	1388	sp|Q9BV57|MTND_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4184	29.178	2	1677.7734	1677.7734	K	I	41	55
PSM	LEICNLTPDTLTSDTYKK	1389	sp|P17655-2|CAN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	4-UNIMOD:4	ms_run[2]:scan=8287	54.707	2	2111.0456	2111.0456	R	W	260	278
PSM	LFNDDNTIPFIIR	1390	sp|Q8N5C6|SRBD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11443	74.756	2	1576.8249	1576.8249	R	Y	235	248
PSM	LFQTAFPAPYGPSPASR	1391	sp|Q9Y6J9|TAF6L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	17-UNIMOD:267	ms_run[2]:scan=8867	58.258	2	1815.9183	1815.9183	R	Y	577	594
PSM	LGGIGQFLAK	1392	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:188	ms_run[2]:scan=8306	54.818	2	1008.6063	1008.6063	R	A	810	820
PSM	LLGIFENQDR	1393	sp|Q9NZJ9|NUDT4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8432	55.601	2	1203.6248	1203.6248	R	K	80	90
PSM	LLPNILLTGTPGVGK	1394	sp|Q9Y3D8|KAD6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10481	68.262	2	1491.9025	1491.9025	M	T	2	17
PSM	LTGSSAQEEASGVALGEAPDHSYESLR	1395	sp|Q13011|ECH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	27-UNIMOD:267	ms_run[2]:scan=6868	45.322	3	2770.2921	2770.2921	R	V	33	60
PSM	LYEEDDLDRLEQMEDSEGTVR	1396	sp|Q86W92-3|LIPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:35	ms_run[2]:scan=7469	49.589	3	2557.1126	2557.1126	R	Q	797	818
PSM	MALVLEALPQIAAK	1397	sp|Q14254|FLOT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:35,14-UNIMOD:188	ms_run[2]:scan=10199	66.518	2	1488.8681	1488.8681	K	I	357	371
PSM	MGGFGSIIQLYPGGGPVR	1398	sp|Q9UJA5-4|TRM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:35	ms_run[2]:scan=10655	69.345	2	1820.9243	1820.9243	R	A	51	69
PSM	MIGGPILPSER	1399	sp|P49419-4|AL7A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:35,11-UNIMOD:267	ms_run[2]:scan=5647	37.998	2	1194.6306	1194.6306	R	S	163	174
PSM	MLENTDNSSPSTEHSQGLEK	1400	sp|Q96H79|ZCCHL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:35	ms_run[2]:scan=1936	15.36	3	2218.9648	2218.9648	K	Q	249	269
PSM	NEEKTAEDYSVDENGQR	1401	sp|O60488-2|ACSL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2499	18.859	3	1982.8454	1982.8454	K	W	492	509
PSM	NGDLDEVKDYVAK	1402	sp|P58546|MTPN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	8-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=5819	39.051	2	1476.7499	1476.7499	K	G	12	25
PSM	NGFLLDGFPR	1403	sp|P54819-3|KAD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:267	ms_run[2]:scan=10274	66.98	2	1144.5905	1144.5905	K	T	94	104
PSM	NIVSAFGIIPR	1404	sp|Q96PZ0|PUS7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10491	68.323	2	1185.687	1185.6870	K	N	459	470
PSM	NIYVLQELDNPGAK	1405	sp|P12956|XRCC6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9314	61.002	2	1572.8148	1572.8148	K	R	101	115
PSM	NLSLSSSTPPLPSPGR	1406	sp|O43516-2|WIPF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7165	47.545	2	1608.8471	1608.8471	R	S	338	354
PSM	NMGWNLVGPVVR	1407	sp|Q92990-2|GLMN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:267	ms_run[2]:scan=9767	63.835	2	1350.7106	1350.7106	K	C	60	72
PSM	NSVTPDMMEEMYKK	1408	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:35	ms_run[2]:scan=4710	32.38	2	1717.7361	1717.7361	K	A	229	243
PSM	NTGIICTIGPASR	1409	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	6-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=5855	39.268	2	1368.7059	1368.7059	R	S	44	57
PSM	NVLIVEDIIDTGK	1410	sp|P00492|HPRT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:188	ms_run[2]:scan=10927	71.07	2	1433.8073	1433.8073	K	T	129	142
PSM	NWMNSLGVNPR	1411	sp|P13796|PLSL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8334	54.99	2	1286.619	1286.6190	R	V	402	413
PSM	QLQQAQAAGAEQEVEKFTK	1412	sp|P39748-2|FEN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7115	47.163	3	2103.0596	2103.0596	K	R	46	65
PSM	QQQEEAEKPLQVAAVDSSVPR	1413	sp|Q99836-3|MYD88_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5851	39.24	2	2308.1659	2308.1659	K	T	120	141
PSM	QTIDNSQGAYQEAFDISKK	1414	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	18-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=6427	42.675	2	2154.0632	2154.0632	K	E	140	159
PSM	QVQSLTCEVDALKGTNESLER	1415	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	7-UNIMOD:4	ms_run[2]:scan=8007	52.981	3	2376.1591	2376.1591	R	Q	322	343
PSM	QVTDAETKPK	1416	sp|O43684-2|BUB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=588	6.6426	2	1115.5823	1115.5823	R	S	315	325
PSM	SAEEVEEIKAEK	1417	sp|Q8WUA2|PPIL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	9-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=2507	18.91	2	1372.7124	1372.7124	R	E	204	216
PSM	SAEEVEEIKAEK	1418	sp|Q8WUA2|PPIL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2510	18.927	2	1360.6722	1360.6722	R	E	204	216
PSM	SDDILEEGEKNLGNIK	1419	sp|Q7Z2T5-2|TRM1L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8364	55.174	2	1772.8792	1772.8792	K	V	181	197
PSM	SDEGLPDGLSTKDSAQK	1420	sp|Q8ND24-2|RN214_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=4030	28.257	2	1758.8674	1758.8674	K	Q	27	44
PSM	SDGGYTYDTSDLAAIKQR	1421	sp|P54136-2|SYRC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	16-UNIMOD:188,18-UNIMOD:267	ms_run[2]:scan=5999	40.139	3	1975.9458	1971.9577	K	L	306	324
PSM	SDILKDPPSEANSIQSANATTK	1422	sp|Q8N488|RYBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5092	34.686	3	2286.1339	2286.1339	K	T	115	137
PSM	SDSGKPYYYNSQTK	1423	sp|O75400-2|PR40A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=1861	14.911	2	1636.7369	1636.7369	K	E	165	179
PSM	SIQFVDWCPTGFK	1424	sp|P68363-2|TBA1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	8-UNIMOD:4	ms_run[2]:scan=10725	69.783	2	1583.7442	1583.7443	R	V	224	237
PSM	SLGDGIFWIQER	1425	sp|Q68D91-2|MBLC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11068	71.964	2	1419.7147	1419.7147	K	F	11	23
PSM	SPPPGMGLNQNR	1426	sp|P23246|SFPQ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:267	ms_run[2]:scan=3105	22.585	2	1276.6222	1276.6222	R	G	33	45
PSM	SSFYPDGGDQETAKTGK	1427	sp|Q9NYF8-3|BCLF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2979	21.797	2	1786.801	1786.8010	R	F	317	334
PSM	SSGPTSLFAVTVAPPGAR	1428	sp|Q00839-2|HNRPU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9486	62.08	2	1713.905	1713.9050	K	Q	187	205
PSM	STVDAEAVHK	1429	sp|P52701-4|MSH6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:188	ms_run[2]:scan=924	8.6954	2	1061.5449	1061.5449	R	L	1041	1051
PSM	SVQATTENKELK	1430	sp|Q13011|ECH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	9-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=1089	9.8808	2	1358.7444	1358.7444	K	T	310	322
PSM	TANEEEEIVHK	1431	sp|Q6GMV2|SMYD5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:188	ms_run[2]:scan=1971	15.58	2	1303.6351	1303.6351	K	L	197	208
PSM	TANLAEANASEEDKIK	1432	sp|Q7Z6E9-4|RBBP6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3566	25.41	2	1702.8374	1702.8374	K	A	117	133
PSM	TDDEQFADEKNYLIK	1433	sp|Q9H9S4|CB39L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=6465	42.893	3	1839.8929	1839.8929	R	Q	313	328
PSM	TGEEKYVEESK	1434	sp|O95202|LETM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	5-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=1173	10.377	2	1309.644	1309.6440	K	A	593	604
PSM	TGEEKYVEESK	1435	sp|O95202|LETM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=1174	10.383	2	1297.6038	1297.6038	K	A	593	604
PSM	TINEVENQILTR	1436	sp|P12814-2|ACTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:267	ms_run[2]:scan=7227	47.946	2	1438.7655	1438.7655	R	D	727	739
PSM	TSSDPTCVEKEK	1437	sp|O14980|XPO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	7-UNIMOD:4	ms_run[2]:scan=877	8.4077	2	1379.6239	1379.6239	K	V	113	125
PSM	TTECKQNESTIVEPK	1438	sp|Q6KC79-3|NIPBL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	4-UNIMOD:4	ms_run[2]:scan=1761	14.285	2	1762.8407	1762.8407	R	Q	658	673
PSM	TVKQEQINTEPLEDTVLSPTK	1439	sp|O15446|RPA34_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=7593	50.384	3	2381.2728	2381.2728	K	K	268	289
PSM	TVVDSEGRTETTVTR	1440	sp|O00165-5|HAX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	8-UNIMOD:267,15-UNIMOD:267	ms_run[2]:scan=2062	16.137	2	1669.8386	1669.8386	R	H	180	195
PSM	VAEVAPEERENVAVAK	1441	sp|Q6IQ49-3|SDE2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3307	23.827	2	1709.8948	1709.8948	R	L	259	275
PSM	VAEVEGEQVDNKAK	1442	sp|O95202|LETM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=1300	11.196	2	1514.7577	1514.7577	K	L	452	466
PSM	VALLCGPPGLGK	1443	sp|Q8WVB6|CTF18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	5-UNIMOD:4,12-UNIMOD:188	ms_run[2]:scan=7519	49.908	2	1186.6839	1186.6839	K	T	369	381
PSM	VDENFDCVEADDVEGKIR	1444	sp|O14929-2|HAT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	7-UNIMOD:4	ms_run[2]:scan=6909	45.664	3	2108.9321	2108.9321	K	Q	10	28
PSM	VEEPSKYGVVVCEADTGR	1445	sp|Q9Y5P6|GMPPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:4	ms_run[2]:scan=5058	34.48	3	1993.9415	1993.9415	K	I	138	156
PSM	VFSWGFGGYGR	1446	sp|Q9P258|RCC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:267	ms_run[2]:scan=9926	64.824	2	1241.5857	1241.5857	R	L	351	362
PSM	VIQQSLEQEEAEHK	1447	sp|O75116|ROCK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	14-UNIMOD:188	ms_run[2]:scan=3331	23.979	3	1672.8364	1672.8364	K	A	696	710
PSM	VLALPEPSPAAPTLR	1448	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8118	53.665	2	1530.877	1530.8770	K	S	1018	1033
PSM	VLFASQEIPASPFR	1449	sp|O75369-6|FLNB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	14-UNIMOD:267	ms_run[2]:scan=9836	64.261	2	1570.8383	1570.8383	K	V	823	837
PSM	VPIDGPPIDIGR	1450	sp|P11717|MPRI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:267	ms_run[2]:scan=7303	48.464	2	1257.6957	1257.6957	K	V	1715	1727
PSM	VPIDGPPIDIGR	1451	sp|P11717|MPRI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7305	48.475	2	1247.6874	1247.6874	K	V	1715	1727
PSM	VPTANVSVVDLTCR	1452	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=7284	48.34	2	1539.7954	1539.7954	R	L	235	249
PSM	VTQLDPKEEEVSLQGINTR	1453	sp|Q9Y6W5-2|WASF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6815	44.877	3	2155.1121	2155.1121	K	K	79	98
PSM	WPDPEDLLTPR	1454	sp|Q8TAE8|G45IP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:267	ms_run[2]:scan=10576	68.852	2	1347.6698	1347.6698	R	W	39	50
PSM	IVDGKVVSETNDTK	1455	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0		ms_run[1]:scan=2269	17.416283333333336	2	1504.7602	1503.7772	R	V	413	427
PSM	CPPGVVPACHNSK	1456	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:385,1-UNIMOD:4,9-UNIMOD:4,13-UNIMOD:188	ms_run[1]:scan=3743	26.508433333333333	2	1410.6429	1410.6474	R	D	634	647
PSM	QLFHPEQLITGK	1457	sp|P68363|TBA1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28,12-UNIMOD:188	ms_run[1]:scan=9996	65.271455	2	1398.7598	1398.7598	R	E	85	97
PSM	DISTNYYASQKK	1458	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	11-UNIMOD:188,12-UNIMOD:188	ms_run[1]:scan=2742	20.349504999999997	2	1428.725281	1428.728767	K	T	672	684
PSM	DGQVINETSQHHDDLE	1459	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=3656	25.987655	2	1836.774131	1835.792199	R	-	451	467
PSM	AVDEMNGKELNGK	1460	sp|P11940|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	8-UNIMOD:188,13-UNIMOD:188	ms_run[1]:scan=2675	19.945204999999998	2	1416.697503	1415.711737	K	Q	247	260
PSM	EGQEEVLKEVVESEGER	1461	sp|Q8TAQ2|SMRC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	8-UNIMOD:188,17-UNIMOD:267	ms_run[1]:scan=7622	50.569825	3	1960.948944	1960.956028	K	K	829	846
PSM	ASNLQDLVYKNGQAGITK	1462	sp|O95347|SMC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	10-UNIMOD:188,18-UNIMOD:188	ms_run[1]:scan=6271	41.72672333333333	2	1932.037678	1931.051498	R	A	59	77
PSM	QLSAPPADPQLFHVAR	1463	sp|P49589-3|SYCC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28	ms_run[1]:scan=8954	58.798625	2	1728.8923	1728.8942	R	W	53	69
PSM	QAQVPLAAVIKPLAR	1464	sp|P53992|SC24C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28,11-UNIMOD:188,15-UNIMOD:267	ms_run[1]:scan=10651	69.32337666666668	2	1572.9697	1572.9681	K	L	390	405
PSM	DVDAAYMNKVELQAK	1465	sp|P02538|K2C6A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	7-UNIMOD:35,9-UNIMOD:188,15-UNIMOD:188	ms_run[1]:scan=4903	33.54506833333333	2	1722.8562	1721.8692	K	A	273	288
PSM	SPSNGVGSLASKPVDVASDNVK	1466	sp|Q9NVV0|TM38B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	12-UNIMOD:188,22-UNIMOD:188	ms_run[1]:scan=5758	38.677615	3	2140.105573	2139.121035	K	K	262	284
PSM	ASNGDTPTHEDLTK	1467	sp|P11171|41_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1385	11.722895	2	1485.662696	1484.674316	K	N	55	69
PSM	QAESASEAAKK	1468	sp|P51572|BAP31_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28,10-UNIMOD:188,11-UNIMOD:188	ms_run[1]:scan=740	7.584569999999999	2	1113.5704	1113.5700	K	Y	139	150
PSM	QMFHIITGPNMGGK	1469	sp|P43246|MSH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28	ms_run[1]:scan=9572	62.62043666666667	2	1512.7202	1512.7212	K	S	662	676
PSM	QIGNVAALPGIVHR	1470	sp|Q9Y3I0|RTCB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28	ms_run[1]:scan=9259	60.660016666666664	2	1426.8027	1426.8040	K	S	68	82
PSM	GVLMYGPPGCGK	1471	sp|P43686|PRS6B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:35,10-UNIMOD:4	ms_run[1]:scan=6616	43.769259999999996	2	1250.581627	1250.578765	R	T	201	213
PSM	LGPLLLDPSLAVR	1472	sp|Q7Z4Q2|HEAT3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=11121	72.318675	2	1362.825351	1362.823487	R	E	84	97
PSM	DIATIVADKCVNPETK	1473	sp|Q9Y3A5|SBDS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	10-UNIMOD:4	ms_run[1]:scan=6121	40.854015000000004	2	1773.874995	1772.897850	R	R	110	126
PSM	NVPGLAILLSK	1474	sp|Q9BUL9|RPP25_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=10871	70.70770999999999	2	1123.697804	1123.696495	K	D	131	142
PSM	AAESETPGKSPEK	1475	sp|O76021|RL1D1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=562	6.4795	2	1329.6412	1329.6412	K	K	418	431
PSM	AAESVSKPDVSEEAPGPSK	1476	sp|Q9BY42|RTF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2817	20.797	3	1883.9113	1883.9113	K	V	204	223
PSM	AATTLDEKIEK	1477	sp|Q96GQ7|DDX27_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	8-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=2329	17.781	2	1229.6906	1229.6906	R	V	113	124
PSM	ADLEAQRDVTYEEAK	1478	sp|P61106|RAB14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3740	26.491	2	1736.8217	1736.8217	K	Q	126	141
PSM	ADTLTPEECQQFKK	1479	sp|Q16181-2|SEPT7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:4,13-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=3670	26.073	2	1705.8384	1705.8384	K	Q	195	209
PSM	ADTVSKTELQK	1480	sp|Q9P0V9-2|SEP10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	6-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=1114	10.031	2	1230.6858	1230.6858	K	F	210	221
PSM	AEDGENYDIKK	1481	sp|O75347|TBCA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=1281	11.057	2	1292.6287	1292.6287	R	Q	42	53
PSM	AEDGENYDIKK	1482	sp|O75347|TBCA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=1286	11.093	2	1280.5885	1280.5885	R	Q	42	53
PSM	AELDEVNKSAK	1483	sp|Q03252|LMNB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=1255	10.858	2	1202.6143	1202.6143	R	K	126	137
PSM	ALVSGKPAESSAVAATEK	1484	sp|O95182|NDUA7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3277	23.646	3	1714.9101	1714.9101	K	K	75	93
PSM	ASNGDTPTHEDLTK	1485	sp|P11171-7|41_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=1180	10.419	2	1484.6743	1484.6743	K	N	55	69
PSM	ASPEAASTPRDPIDVDLPEEAER	1486	sp|P29590-4|PML_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:267,23-UNIMOD:267	ms_run[2]:scan=7375	48.952	3	2484.1883	2484.1883	K	V	402	425
PSM	AVMEQIPEIQKDSLDQFDCK	1487	sp|Q9HAV4|XPO5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:35,19-UNIMOD:4	ms_run[2]:scan=7882	52.208	3	2409.1192	2409.1192	R	L	1113	1133
PSM	CVSVQTDPTDEIPTKK	1488	sp|P18583-8|SON_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:4	ms_run[2]:scan=4395	30.469	2	1816.8877	1816.8877	R	S	92	108
PSM	DGKTLNDELEIIEGMK	1489	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	15-UNIMOD:35	ms_run[2]:scan=9008	59.128	2	1819.8873	1819.8873	K	F	203	219
PSM	DLIQDQNMDEKGK	1490	sp|Q9H307|PININ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=3351	24.103	2	1544.7543	1544.7543	R	Q	127	140
PSM	DMEKLDEMEFNPVQQPQLNEK	1491	sp|Q9Y2W2|WBP11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8737	57.469	3	2561.1778	2561.1778	R	V	56	77
PSM	DMTMFVTASKDNTAK	1492	sp|Q13347|EIF3I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6127	40.887	2	1658.7644	1658.7644	R	L	199	214
PSM	DSQICELKYDK	1493	sp|P55145|MANF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	5-UNIMOD:4	ms_run[2]:scan=3940	27.716	2	1397.6497	1397.6497	K	Q	113	124
PSM	DTHDQLSEPSEVR	1494	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	13-UNIMOD:267	ms_run[2]:scan=2862	21.084	2	1521.6935	1521.6935	K	S	3800	3813
PSM	DTVQVELIPEKK	1495	sp|Q9Y5X2|SNX8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=5713	38.407	2	1409.8169	1409.8169	R	G	75	87
PSM	DVDEAYMNKVELESR	1496	sp|P05787-2|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:188,15-UNIMOD:267	ms_run[2]:scan=6097	40.726	2	1812.8535	1808.8653	K	L	227	242
PSM	DVEVTKEEFVLAAQK	1497	sp|Q9UJS0|CMC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	6-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=7048	46.709	3	1716.9337	1716.9337	K	F	246	261
PSM	DVTPEATKEVIER	1498	sp|Q9NQX3|GEPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4354	30.215	2	1485.7675	1485.7675	R	E	94	107
PSM	EAAEQDVEKK	1499	sp|P26373-2|RL13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=624	6.8633	2	1145.5564	1145.5564	K	K	154	164
PSM	EADLAAQEEAAKK	1500	sp|Q9Y3B7-2|RM11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=1707	13.914	2	1372.6834	1372.6834	K	-	154	167
PSM	EAETFKEQGNAYYAK	1501	sp|Q99615|DNJC7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	6-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=3493	24.961	2	1759.8456	1759.8456	R	K	27	42
PSM	EALEVDWSSEKAK	1502	sp|Q9UBE0-2|SAE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=5349	36.222	2	1502.7655	1502.7655	K	A	218	231
PSM	EAQDIKFTEEIPLK	1503	sp|O00425|IF2B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7762	51.448	2	1659.872	1659.8720	K	I	267	281
PSM	EDKSLSEAPEDTSTR	1504	sp|P41214|EIF2D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=1701	13.861	2	1663.7537	1663.7537	R	G	234	249
PSM	EEVEVLKEQIK	1505	sp|Q15714-2|T22D1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	7-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=5045	34.405	2	1354.7747	1354.7747	R	E	72	83
PSM	ETKDTDIVDEAIYYFK	1506	sp|O15145|ARPC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11487	75.05	2	1948.9306	1948.9306	R	A	35	51
PSM	EVVAEVVKAPQVVAEAAK	1507	sp|O60832|DKC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7508	49.84	3	1836.0357	1836.0357	K	T	426	444
PSM	FAEFQYLQPGPPR	1508	sp|Q8N163-2|CCAR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8561	56.397	3	1548.7725	1548.7725	R	R	405	418
PSM	FAEFQYLQPGPPR	1509	sp|Q8N163-2|CCAR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	13-UNIMOD:267	ms_run[2]:scan=8562	56.402	3	1558.7808	1558.7808	R	R	405	418
PSM	FFGNLMDASK	1510	sp|P36871-3|PGM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:188	ms_run[2]:scan=8193	54.124	2	1134.5475	1134.5475	K	L	164	174
PSM	FFIPDPNTLQQEQTR	1511	sp|P26045|PTN3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	15-UNIMOD:267	ms_run[2]:scan=9075	59.531	2	1842.914	1842.9140	R	H	109	124
PSM	FFLGDLCSR	1512	sp|Q15738|NSDHL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	7-UNIMOD:4	ms_run[2]:scan=8985	58.988	2	1113.5277	1113.5277	R	Q	80	89
PSM	FIGPSPEVVR	1513	sp|P11498-2|PYC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5642	37.965	2	1099.6026	1099.6026	R	K	138	148
PSM	FLALDLGGTNFR	1514	sp|Q2TB90-3|HKDC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:267	ms_run[2]:scan=10475	68.222	2	1332.7066	1332.7066	K	V	528	540
PSM	FTMVQVWPVR	1515	sp|P38606-2|VATA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:267	ms_run[2]:scan=10498	68.367	2	1271.6724	1271.6724	K	Q	170	180
PSM	GALVVEDNDSGVPVEETKK	1516	sp|Q96PZ0|PUS7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4796	32.895	3	1984.9953	1984.9953	R	Q	14	33
PSM	GATTQNSEICSGQAPTPDQPDTSKR	1517	sp|Q96RR1|PEO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:4	ms_run[2]:scan=2974	21.77	3	2645.1987	2645.1987	K	S	658	683
PSM	GILLYGPPGCGK	1518	sp|P46459-2|NSF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:4	ms_run[2]:scan=6672	44.084	2	1230.6431	1230.6431	K	T	161	173
PSM	GILLYGPPGCGK	1519	sp|P46459-2|NSF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:4,12-UNIMOD:188	ms_run[2]:scan=6675	44.099	2	1236.6632	1236.6632	K	T	161	173
PSM	IEQVDKEDEITEK	1520	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	6-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=2789	20.63	3	1586.8078	1586.8078	K	K	445	458
PSM	IFDAVGFTFPNR	1521	sp|Q9UBB6-2|NCDN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:267	ms_run[2]:scan=10340	67.379	2	1392.7066	1392.7066	R	L	59	71
PSM	IGFFQGDIR	1522	sp|P33121-2|ACSL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8281	54.667	2	1051.5451	1051.5451	K	L	341	350
PSM	IGGGIDVPVPR	1523	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6413	42.588	2	1078.6135	1078.6135	R	H	321	332
PSM	IGGIGTVPVGR	1524	sp|P68104-2|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5160	35.097	2	1024.6029	1024.6029	K	V	235	246
PSM	IIPGFMCQGGDFTR	1525	sp|Q9Y536|PAL4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	6-UNIMOD:35,7-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=7290	48.379	3	1623.7413	1623.7413	R	H	56	70
PSM	IIPGFMCQGGDFTR	1526	sp|Q9Y536|PAL4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	7-UNIMOD:4	ms_run[2]:scan=9053	59.399	2	1597.7381	1597.7381	R	H	56	70
PSM	IISTTASKTETPIVSK	1527	sp|O95292|VAPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3572	25.454	2	1674.9404	1674.9404	K	S	140	156
PSM	IMEGPAFNFLDAPAVR	1528	sp|P11177-3|ODPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	16-UNIMOD:267	ms_run[2]:scan=11383	74.233	2	1756.8846	1756.8846	R	V	291	307
PSM	IQEEECPPRDDFSDADQLR	1529	sp|Q9NV92|NFIP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	6-UNIMOD:4	ms_run[2]:scan=5578	37.568	2	2319.0074	2319.0074	R	V	208	227
PSM	IQEEECPPRDDFSDADQLR	1530	sp|Q9NV92|NFIP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	6-UNIMOD:4,9-UNIMOD:267,19-UNIMOD:267	ms_run[2]:scan=5599	37.703	2	2339.0239	2339.0239	R	V	208	227
PSM	ITFLLQAIR	1531	sp|O00410|IPO5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267	ms_run[2]:scan=10762	70.016	2	1083.668	1083.6680	K	N	42	51
PSM	IVLQIDNAR	1532	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267	ms_run[2]:scan=5479	37.008	2	1050.6061	1050.6061	R	L	150	159
PSM	IWIFDGPTGEGR	1533	sp|Q8NI36|WDR36_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9915	64.757	2	1346.6619	1346.6619	R	L	359	371
PSM	IYVGNLPPDIR	1534	sp|Q07955-2|SRSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:267	ms_run[2]:scan=7285	48.346	2	1265.7007	1265.7007	R	T	18	29
PSM	LAETQEEISAEVAAKAER	1535	sp|Q9Y383-3|LC7L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5945	39.806	3	1943.98	1943.9800	R	V	105	123
PSM	LAGTQPLEVLEAVQR	1536	sp|P22314-2|UBA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10215	66.617	2	1622.8992	1622.8992	R	S	639	654
PSM	LAVNMVPFPR	1537	sp|Q13509-2|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	5-UNIMOD:35,10-UNIMOD:267	ms_run[2]:scan=7151	47.433	2	1168.6302	1168.6302	K	L	181	191
PSM	LEDDAKDNQQK	1538	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=472	5.926	2	1302.6052	1302.6052	K	A	3419	3430
PSM	LEGLTDEINFLR	1539	sp|P05787-2|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:267	ms_run[2]:scan=10807	70.297	2	1428.7488	1428.7488	R	Q	242	254
PSM	LESADKSDQNNTAEGK	1540	sp|Q9NXG2|THUM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=553	6.423	2	1705.7755	1705.7755	K	N	289	305
PSM	LLCGLLAER	1541	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:4	ms_run[2]:scan=8149	53.852	2	1043.5798	1043.5798	K	L	79	88
PSM	LLCGLLAER	1542	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:4,9-UNIMOD:267	ms_run[2]:scan=8152	53.873	2	1053.588	1053.5880	K	L	79	88
PSM	LLGAALPLLTK	1543	sp|Q9BQG0|MBB1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10364	67.529	2	1108.722	1108.7220	R	E	308	319
PSM	LLGFLDVENTPCAR	1544	sp|Q5RI15|COX20_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=10325	67.287	2	1613.8111	1613.8111	K	H	18	32
PSM	LLPAITILGCR	1545	sp|Q96IJ6|GMPPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:4,11-UNIMOD:267	ms_run[2]:scan=10641	69.263	2	1235.7299	1235.7299	K	V	380	391
PSM	LLQDFFNGR	1546	sp|P0DMV8-2|HS71A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267	ms_run[2]:scan=8807	57.891	2	1118.5748	1118.5748	K	D	294	303
PSM	LLQPVIVSPSGTILR	1547	sp|Q5T5C0-3|STXB5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9591	62.738	2	1591.9661	1591.9661	R	L	786	801
PSM	LQQQLTQAAQELAAEKEK	1548	sp|Q15075|EEA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6991	46.236	3	2026.0695	2026.0695	K	I	996	1014
PSM	LSPLPGGPGAGDPR	1549	sp|Q15742-2|NAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	14-UNIMOD:267	ms_run[2]:scan=4771	32.743	2	1299.6811	1299.6811	K	I	170	184
PSM	LSPLPGGPGAGDPR	1550	sp|Q15742-2|NAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4772	32.749	2	1289.6728	1289.6728	K	I	170	184
PSM	LSSEQEKEEIASK	1551	sp|Q96Q89-4|KI20B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=1804	14.537	2	1476.7308	1476.7308	R	S	204	217
PSM	LSVPPLVEVMR	1552	sp|P50895|BCAM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:35,11-UNIMOD:267	ms_run[2]:scan=8263	54.556	2	1264.7089	1264.7089	R	G	35	46
PSM	LTPEEEEILNKK	1553	sp|P62241|RS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4920	33.651	2	1441.7664	1441.7664	K	R	129	141
PSM	LVESDAEAEAVREVYER	1554	sp|Q9BZJ0-2|CRNL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7500	49.788	2	1963.9487	1963.9487	R	A	339	356
PSM	MGPNIYELR	1555	sp|Q9BPW8|NIPS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:35,9-UNIMOD:267	ms_run[2]:scan=6013	40.224	2	1117.5465	1117.5465	R	T	180	189
PSM	MGPSYCLPPTFPK	1556	sp|O15067|PUR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:35,6-UNIMOD:4	ms_run[2]:scan=7562	50.187	2	1509.6996	1509.6996	R	A	1039	1052
PSM	MIGGPILPSER	1557	sp|P49419-4|AL7A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6475	42.952	2	1168.6274	1168.6274	R	S	163	174
PSM	MLDMGFEPQIR	1558	sp|Q92841|DDX17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:35,11-UNIMOD:267	ms_run[2]:scan=8079	53.423	2	1361.6347	1361.6347	R	K	330	341
PSM	MSAEDIEKVNK	1559	sp|Q9ULC4-2|MCTS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:35	ms_run[2]:scan=1655	13.575	2	1278.6126	1278.6126	K	G	138	149
PSM	MVGGVLVER	1560	sp|Q9UHV9|PFD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:35	ms_run[2]:scan=3983	27.975	2	974.5219	974.5219	R	T	73	82
PSM	MVGGVLVER	1561	sp|Q9UHV9|PFD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:35,9-UNIMOD:267	ms_run[2]:scan=3984	27.98	2	984.53017	984.5302	R	T	73	82
PSM	NFPLALDLGCGR	1562	sp|Q5TEU4-2|NDUF5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=10115	66.015	2	1341.6739	1341.6739	R	G	89	101
PSM	NIFNISLQR	1563	sp|P18440|ARY1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:267	ms_run[2]:scan=9119	59.805	2	1113.617	1113.6170	K	K	269	278
PSM	NSESESNKVAAETQSPSLFGSTK	1564	sp|Q9UKX7-2|NUP50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	8-UNIMOD:188,23-UNIMOD:188	ms_run[2]:scan=5670	38.141	3	2409.1698	2409.1698	R	L	179	202
PSM	NSTTDILKETQEK	1565	sp|Q99797|MIPEP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4340	30.136	2	1505.7573	1505.7573	R	F	594	607
PSM	QDAQDLYEAGEKK	1566	sp|P09525-2|ANXA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=2958	21.67	2	1505.7401	1505.7401	R	W	91	104
PSM	QVTDAETKPK	1567	sp|O43684-2|BUB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	8-UNIMOD:188,10-UNIMOD:188	ms_run[2]:scan=587	6.6373	2	1127.6225	1127.6225	R	S	315	325
PSM	QVTSNSLSGTQEDGLDDPRLEK	1568	sp|P30533|AMRP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5392	36.483	2	2388.1405	2388.1405	R	L	132	154
PSM	SETDKETSLVK	1569	sp|Q5SW79-2|CE170_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=1537	12.768	2	1235.6245	1235.6245	K	Q	634	645
PSM	SFLLDLLNATGK	1570	sp|O00571-2|DDX3X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:188	ms_run[2]:scan=12312	84.011	2	1296.7385	1296.7385	R	D	413	425
PSM	SFLLDLLNATGK	1571	sp|O00571-2|DDX3X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=12313	84.016	2	1290.7184	1290.7184	R	D	413	425
PSM	SFPGFQAFCETQGDR	1572	sp|Q01780-2|EXOSX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:4	ms_run[2]:scan=9271	60.73	2	1745.7468	1745.7468	R	L	65	80
PSM	SGDEEFKGEDELCDSGR	1573	sp|O43823|AKAP8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	13-UNIMOD:4	ms_run[2]:scan=4544	31.361	2	1928.7694	1928.7694	R	Q	339	356
PSM	SGPPAPEEEEEEERQSGNTEQK	1574	sp|Q9NTI5|PDS5B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2345	17.873	2	2456.0575	2456.0575	K	S	1319	1341
PSM	SNPSENEEKEAQSQLIK	1575	sp|Q13217|DNJC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=4370	30.309	3	1941.9682	1941.9682	K	S	134	151
PSM	SSPVDLVTATDQKVEK	1576	sp|P29218-2|IMPA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6118	40.841	3	1715.8941	1715.8941	K	M	37	53
PSM	SSSADFGTFNTSQSHQTASAVSK	1577	sp|P52594-2|AGFG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	23-UNIMOD:188	ms_run[2]:scan=4700	32.321	3	2350.0769	2350.0769	K	V	251	274
PSM	SSSDPQAQKYIAESK	1578	sp|Q0VDF9|HSP7E_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=2648	19.778	2	1649.8299	1649.8299	R	C	74	89
PSM	STANVLEETTVKK	1579	sp|Q96T23-3|RSF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3846	27.139	2	1418.7617	1418.7617	R	E	14	27
PSM	SVSDDSEKNMISK	1580	sp|Q13618-3|CUL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	8-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=2155	16.741	2	1450.7012	1450.7012	K	L	379	392
PSM	TAAFVLAMLSR	1581	sp|Q9NUU7|DD19A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:267	ms_run[2]:scan=11529	75.356	2	1188.6564	1188.6564	K	V	144	155
PSM	TAVETAVLLLR	1582	sp|P49368-2|TCPG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9979	65.165	2	1184.7129	1184.7129	K	I	470	481
PSM	TEAEQCKNLELK	1583	sp|O75643|U520_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	6-UNIMOD:4,7-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=2478	18.735	2	1473.7536	1473.7536	R	D	764	776
PSM	TEDEVLTSKGDAWAK	1584	sp|Q9BQ61|TRIR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5055	34.464	3	1648.7944	1648.7944	K	Y	138	153
PSM	TEKEESTEVLK	1585	sp|P20810-3|ICAL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=1365	11.593	2	1291.6507	1291.6507	K	A	133	144
PSM	TEKEESTEVLK	1586	sp|P20810-3|ICAL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=1378	11.674	3	1291.6507	1291.6507	K	A	133	144
PSM	TEMEDLMSSKDDVGK	1587	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5749	38.623	3	1683.7332	1683.7332	R	S	1504	1519
PSM	TIGGGDDSFNTFFSETGAGK	1588	sp|P68363-2|TBA1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9917	64.768	2	2006.8858	2006.8858	K	H	41	61
PSM	TSSDPTCVEKEK	1589	sp|O14980|XPO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	7-UNIMOD:4,10-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=875	8.3965	2	1391.6641	1391.6641	K	V	113	125
PSM	TVQSLEIDLDSMR	1590	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:35,13-UNIMOD:267	ms_run[2]:scan=7569	50.231	2	1531.7427	1531.7427	R	N	302	315
PSM	VADSSKGPDEAK	1591	sp|O60506-4|HNRPQ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	6-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=485	6.0005	2	1214.6182	1214.6182	K	I	112	124
PSM	VAEGQVTCPYLPPFPAR	1592	sp|Q96DV4-2|RM38_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	8-UNIMOD:4	ms_run[2]:scan=8849	58.148	2	1900.9506	1900.9506	R	G	61	78
PSM	VCDATYDKAPVEK	1593	sp|Q12974-2|TP4A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:4	ms_run[2]:scan=2056	16.098	3	1494.7024	1494.7024	R	E	45	58
PSM	VDDNEETIKK	1594	sp|P00568|KAD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=852	8.2631	2	1189.5826	1189.5826	R	R	139	149
PSM	VDNEILDYKDLAAIPK	1595	sp|O14639-4|ABLM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9283	60.804	3	1815.9618	1815.9618	K	V	34	50
PSM	VDQSLHTNTSLDAASEYAK	1596	sp|Q9BYT8|NEUL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5218	35.452	3	2048.9651	2048.9651	K	Y	584	603
PSM	VGGTSDVEVNEKK	1597	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=1032	9.4869	2	1360.6834	1360.6834	K	D	406	419
PSM	VGGTSDVEVNEKK	1598	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=1031	9.4813	2	1372.7237	1372.7237	K	D	406	419
PSM	VGGTSDVEVNEKK	1599	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=1045	9.5836	3	1372.7237	1372.7237	K	D	406	419
PSM	VGMVETNSQDRPVDDVK	1600	sp|Q9Y3C6|PPIL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:35	ms_run[2]:scan=2559	19.228	2	1903.8946	1903.8946	R	I	142	159
PSM	VILDLPLVIGSR	1601	sp|Q9H3M7-2|TXNIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11731	76.975	2	1293.802	1293.8020	K	S	233	245
PSM	VLQPTVFPVVPR	1602	sp|P33121-2|ACSL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:267	ms_run[2]:scan=8838	58.082	2	1360.8106	1360.8106	K	L	357	369
PSM	VMVQPINLIFR	1603	sp|P62304|RUXE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:35	ms_run[2]:scan=10917	71.008	2	1344.7588	1344.7588	K	Y	13	24
PSM	VPDGMVGLIIGR	1604	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:267	ms_run[2]:scan=10373	67.586	2	1235.6935	1235.6935	R	G	151	163
PSM	VPFLVLECPNLK	1605	sp|Q9NRP0|OSTC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	8-UNIMOD:4,12-UNIMOD:188	ms_run[2]:scan=10614	69.097	2	1433.8048	1433.8048	R	L	7	19
PSM	VQESTKGPDEAK	1606	sp|O43390-4|HNRPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	6-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=569	6.5244	2	1299.6709	1299.6709	K	I	14	26
PSM	YADLTEDQLPSCESLKDTIAR	1607	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:4,16-UNIMOD:188,21-UNIMOD:267	ms_run[2]:scan=8308	54.827	2	2440.1763	2436.1881	R	A	142	163
PSM	YLMEEDEDAYKK	1608	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:35	ms_run[2]:scan=2643	19.751	3	1548.6654	1548.6654	R	Q	210	222
PSM	YQLSDDLPSPLPFR	1609	sp|O00189|AP4M1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	14-UNIMOD:267	ms_run[2]:scan=10746	69.912	2	1656.8387	1656.8387	R	L	284	298
PSM	YTSIPTSVEESGKK	1610	sp|Q9NVI1-2|FANCI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3545	25.278	2	1524.7672	1524.7672	R	E	825	839
PSM	YVAQAGLEPLASGDPSASASHAAGITGSR	1611	sp|O94966-2|UBP19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	29-UNIMOD:267	ms_run[2]:scan=6918	45.722	3	2750.3499	2750.3499	R	H	47	76
PSM	YYDDTYPSVKEQK	1612	sp|P61923-5|COPZ1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3432	24.59	2	1634.7464	1634.7464	K	A	30	43
PSM	VNDVCTNGQDLIKK	1613	sp|Q13813|SPTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:4	ms_run[1]:scan=3798	26.83792	2	1603.784140	1602.803556	R	N	1926	1940
PSM	DGPNALTPPPTTPEWIK	1614	sp|P05023|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=8656	56.98605	2	1833.930562	1832.930865	R	F	75	92
PSM	QLDDKDEEINQQSQLVEK	1615	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28	ms_run[1]:scan=4525	31.246581666666664	2	2141.0180	2141.0119	K	L	431	449
PSM	NQVTATKADGGTQVIDTK	1616	sp|P09622|DLDH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	7-UNIMOD:188,18-UNIMOD:188	ms_run[1]:scan=2667	19.89633166666667	3	1857.989913	1857.983478	K	N	160	178
PSM	CHWSDMFTGR	1617	sp|P46060|RAGP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:385,1-UNIMOD:4,10-UNIMOD:267	ms_run[1]:scan=9222	60.44184333333334	2	1288.4966	1288.4988	R	L	82	92
PSM	AAGEPIKEGDNDYFTCITK	1618	sp|Q99543|DNJC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	7-UNIMOD:188,16-UNIMOD:4,19-UNIMOD:188	ms_run[1]:scan=6558	43.42973166666666	3	2140.022097	2140.018544	K	A	125	144
PSM	VPDGMVGLIIGR	1619	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	12-UNIMOD:267	ms_run[1]:scan=10418	67.86929666666667	2	1235.694649	1235.693547	R	G	151	163
PSM	QGTPLIAFSLLPHEQK	1620	sp|Q2NL82|TSR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28,16-UNIMOD:188	ms_run[1]:scan=12035	80.15723666666668	2	1766.9696	1766.9657	R	M	575	591
PSM	CGDLEEELKNVTNNLK	1621	sp|P67936|TPM4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:4	ms_run[1]:scan=8012	53.008696666666665	2	1875.887006	1874.904392	K	S	154	170
PSM	DAQQVEPEGQEKPSPATVR	1622	sp|Q9Y520|PRC2C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	12-UNIMOD:188,19-UNIMOD:267	ms_run[1]:scan=2722	20.223983333333333	2	2081.046204	2081.036010	K	S	2130	2149
PSM	NGRVEIIANDQGNR	1623	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:267,14-UNIMOD:267	ms_run[1]:scan=3721	26.376179999999998	3	1575.781880	1574.802804	K	I	47	61
PSM	CDSSPDSAEDVRK	1624	sp|P02765|FETUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1934	15.349316666666665	2	1447.5878	1447.5880	K	V	132	145
PSM	SVSDDSEKNMISK	1625	sp|Q13618|CUL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=2164	16.796781666666668	2	1439.662425	1438.660974	K	L	445	458
PSM	GPGPDLESLISR	1626	sp|Q6ZNW5|GDPP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=9043	59.33906666666666	2	1240.642995	1239.645916	R	V	261	273
PSM	QIGNVAALPGIVHR	1627	sp|Q9Y3I0|RTCB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28,14-UNIMOD:267	ms_run[1]:scan=9256	60.638333333333335	2	1436.8108	1436.8122	K	S	68	82
PSM	CIESLIAVFQK	1628	sp|P31949|S10AB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:4,11-UNIMOD:188	ms_run[1]:scan=11305	73.65385500000001	2	1312.721384	1312.715638	R	Y	13	24
PSM	QGRQEALEWLIR	1629	sp|Q9NQW7|XPP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28,3-UNIMOD:267,12-UNIMOD:267	ms_run[1]:scan=10726	69.78904833333333	2	1500.7973	1500.7947	K	E	603	615
PSM	LLLPGELAK	1630	sp|Q96A08|H2B1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=7196	47.743359999999996	2	952.595432	952.595718	R	H	102	111
PSM	LLLPGELAK	1631	sp|Q96A08|H2B1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	9-UNIMOD:188	ms_run[1]:scan=7809	51.75264333333333	2	958.614649	958.615847	R	H	102	111
PSM	NGRVEIIANDQGNR	1632	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=3759	26.606245	2	1555.766214	1554.786266	K	I	47	61
PSM	DIATIVADKCVNPETK	1633	sp|Q9Y3A5|SBDS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	10-UNIMOD:4	ms_run[1]:scan=6122	40.85926	3	1773.872597	1772.897850	R	R	110	126
PSM	VLVNDAQKVTEGQQER	1634	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=3379	24.271915	3	1813.916540	1812.932990	R	L	312	328
PSM	AAESVSKPDVSEEAPGPSK	1635	sp|Q9BY42|RTF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	7-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=2816	20.791	3	1895.9515	1895.9515	K	V	204	223
PSM	AAPEEPQQRPPEAVAAAPAGTTSSR	1636	sp|Q96JP5-2|ZFP91_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3633	25.847	2	2488.2306	2488.2306	K	V	24	49
PSM	ADELSEKQVYDAHTK	1637	sp|Q03135-2|CAV1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:1	ms_run[2]:scan=4570	31.526	3	1774.8374	1774.8374	M	E	2	17
PSM	AEPEKNGEVVHTPETSV	1638	sp|O15427|MOT4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3480	24.883	2	1821.8745	1821.8745	K	-	449	466
PSM	AGLQFPVGR	1639	sp|P0C0S8|H2A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6455	42.838	2	943.52395	943.5240	R	V	22	31
PSM	AGNEKEEGETADTVGCCSLR	1640	sp|P11387|TOP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	5-UNIMOD:188,16-UNIMOD:4,17-UNIMOD:4,20-UNIMOD:267	ms_run[2]:scan=3260	23.539	2	2197.9551	2193.9669	R	V	489	509
PSM	APGLGLVLER	1641	sp|Q9Y606-2|TRUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8112	53.627	2	1023.6077	1023.6077	K	V	300	310
PSM	ASEDTTSGSPPKK	1642	sp|Q9BZZ5-1|API5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	12-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=419	5.5704	2	1315.6658	1315.6658	R	S	384	397
PSM	ASQGLLSSIENSESDSSEAKEEGSR	1643	sp|Q5UIP0-2|RIF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	20-UNIMOD:188,25-UNIMOD:267	ms_run[2]:scan=6981	46.165	3	2612.202	2608.2139	R	K	1541	1566
PSM	AVASPEATVSQTDENKAR	1644	sp|Q641Q2-2|WAC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=2586	19.395	2	1872.9177	1872.9177	K	A	495	513
PSM	AVFVDLEPTVIDEVR	1645	sp|P68363-2|TBA1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=10900	70.894	2	1700.8985	1700.8985	R	T	65	80
PSM	AVTELNEPLSNEDRNLLSVAYK	1646	sp|Q04917|1433F_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	14-UNIMOD:267,22-UNIMOD:188	ms_run[2]:scan=9312	60.99	3	2490.2937	2486.3055	K	N	29	51
PSM	DAVTYTEHAK	1647	sp|P62805|H4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=1274	10.992	2	1133.5353	1133.5353	R	R	69	79
PSM	DKVVEDDEDDFPTTR	1648	sp|Q9Y5P4-2|CERT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	2-UNIMOD:188,15-UNIMOD:267	ms_run[2]:scan=4459	30.861	2	1795.8083	1791.8202	R	S	197	212
PSM	DLEAEHVEVEDTTLNR	1649	sp|Q9H3K6-2|BOLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5899	39.534	3	1868.8752	1868.8752	R	C	15	31
PSM	DLIHDQDEDEEEEEGQR	1650	sp|Q9UNZ2-4|NSF1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3875	27.312	3	2084.8407	2084.8407	R	F	77	94
PSM	DLIQDQNMDEKGK	1651	sp|Q9H307|PININ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3352	24.108	2	1532.7141	1532.7141	R	Q	127	140
PSM	DLTLEENQVKK	1652	sp|Q14683|SMC1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3613	25.717	2	1315.6983	1315.6983	R	Y	364	375
PSM	DMEKLDEMEFNPVQQPQLNEK	1653	sp|Q9Y2W2|WBP11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	2-UNIMOD:35	ms_run[2]:scan=7945	52.597	3	2577.1727	2577.1727	R	V	56	77
PSM	DNSTMGYMAAKK	1654	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=2536	19.085	2	1327.6303	1327.6303	R	H	621	633
PSM	DQIVSVQEEKK	1655	sp|A0MZ66-5|SHOT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=2031	15.942	2	1301.6827	1301.6827	R	I	89	100
PSM	DQVIYPDGREDQK	1656	sp|P28288-2|ABCD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=2626	19.645	2	1561.7372	1561.7372	R	R	411	424
PSM	DQVTAQEIFQDNHEDGPTAK	1657	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6088	40.673	3	2242.0138	2242.0138	K	K	546	566
PSM	DSDLSHVQNK	1658	sp|O60506-4|HNRPQ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:188	ms_run[2]:scan=931	8.7311	2	1147.5565	1147.5565	K	S	82	92
PSM	DSGEKVVEIVK	1659	sp|O43290|SNUT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3989	28.012	2	1201.6554	1201.6554	R	K	520	531
PSM	DVAIKEPLVDVVDPK	1660	sp|Q99873-2|ANM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	5-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=8163	53.939	2	1647.9486	1647.9486	K	Q	205	220
PSM	DVAIKEPLVDVVDPK	1661	sp|Q99873-2|ANM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8174	54.006	2	1635.9083	1635.9083	K	Q	205	220
PSM	DVTQLDPNKSLLEVK	1662	sp|Q9UNN5-2|FAF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=7587	50.344	2	1709.9602	1709.9602	R	L	471	486
PSM	DYIPVDQEELRDYVK	1663	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8329	54.956	2	1880.9156	1880.9156	K	A	2880	2895
PSM	EADETKLAEEIPLK	1664	sp|Q9Y6M1-5|IF2B2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	6-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=7015	46.412	2	1596.8649	1596.8649	K	I	202	216
PSM	EAEGSSAEYKK	1665	sp|P49321-2|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=542	6.3567	2	1209.5916	1209.5916	K	E	288	299
PSM	EANSKADPSLNPEQLK	1666	sp|Q9UNF0-2|PACN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	5-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=4067	28.47	2	1751.9093	1751.9093	R	K	173	189
PSM	EASSTQDTGKLPVK	1667	sp|P41240|CSK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=1907	15.185	2	1471.7921	1471.7921	K	W	338	352
PSM	EFSYLDEEEKEK	1668	sp|Q99543-2|DNJC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=4989	34.066	2	1556.7285	1556.7285	R	A	226	238
PSM	ELVDKATNVVMNYSEIESK	1669	sp|Q14677|EPN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8441	55.656	3	2168.0671	2168.0671	R	V	9	28
PSM	ESQSVEEALKK	1670	sp|P49915-2|GUAA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=2279	17.477	2	1246.6405	1246.6405	R	L	180	191
PSM	ETPPPLVPPAAR	1671	sp|Q9BQA1|MEP50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	12-UNIMOD:267	ms_run[2]:scan=5210	35.403	2	1253.7007	1253.7007	K	E	4	16
PSM	ETSDGEKETIQK	1672	sp|Q86W92-3|LIPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	7-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=744	7.6148	2	1375.687	1375.6870	K	T	320	332
PSM	EYSIGTGSTKQEAK	1673	sp|P19525-2|E2AK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=1788	14.441	2	1509.7714	1509.7714	K	Q	141	155
PSM	FAVFGLGNK	1674	sp|P16435|NCPR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8504	56.043	2	951.5178	951.5178	K	T	168	177
PSM	FAVGIVIGR	1675	sp|Q96AE4|FUBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8236	54.389	2	930.56509	930.5651	R	N	285	294
PSM	FFLGDLCSR	1676	sp|Q15738|NSDHL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	7-UNIMOD:4,9-UNIMOD:267	ms_run[2]:scan=8984	58.983	2	1123.536	1123.5360	R	Q	80	89
PSM	FGPGSPPVQAK	1677	sp|Q969F2|NKD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3428	24.563	2	1083.5713	1083.5713	R	Q	260	271
PSM	FLSPEFIPR	1678	sp|P49406|RM19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:267	ms_run[2]:scan=8721	57.371	2	1114.605	1114.6050	R	R	75	84
PSM	FLSPEFIPR	1679	sp|P49406|RM19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8722	57.376	2	1104.5968	1104.5968	R	R	75	84
PSM	FNPDIFSPGVR	1680	sp|O75153|CLU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:267	ms_run[2]:scan=8622	56.774	2	1257.6381	1257.6381	R	F	717	728
PSM	GDGAAGFTLPGFR	1681	sp|Q04912-5|RON_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9505	62.199	2	1264.62	1264.6200	R	F	846	859
PSM	GDVVLQSDHVIETLTK	1682	sp|O00159-2|MYO1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	16-UNIMOD:188	ms_run[2]:scan=8629	56.819	3	1758.9459	1758.9459	K	T	955	971
PSM	GFFPGSAQSCEAFLR	1683	sp|O75164|KDM4A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:4	ms_run[2]:scan=9650	63.104	2	1672.7668	1672.7668	K	H	225	240
PSM	GFPQTFEVGPGR	1684	sp|Q8IVS2|FABD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	12-UNIMOD:267	ms_run[2]:scan=7653	50.765	2	1300.644	1300.6440	R	Q	341	353
PSM	GFPQTFEVGPGR	1685	sp|Q8IVS2|FABD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7487	49.708	2	1290.6357	1290.6357	R	Q	341	353
PSM	GIPLATGDTSPEPELLPGAPLPPPK	1686	sp|O75821|EIF3G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9988	65.221	3	2463.3261	2463.3261	K	E	33	58
PSM	GLLPQLLGVAPEK	1687	sp|Q9UJS0|CMC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=10647	69.295	2	1333.7969	1333.7969	R	A	393	406
PSM	GLSEDTTEETLKESFDGSVR	1688	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8046	53.22	3	2199.0179	2199.0179	K	A	578	598
PSM	GSDSIAYDKGEK	1689	sp|P35611-5|ADDA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=1137	10.161	2	1268.5885	1268.5885	R	L	132	144
PSM	GSLGSQGAKDEPEEELQK	1690	sp|Q13428-2|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=3359	24.151	3	1912.9417	1912.9417	K	G	1329	1347
PSM	GSLGSQGAKDEPEEELQK	1691	sp|Q13428-2|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3361	24.163	3	1900.9014	1900.9014	K	G	1329	1347
PSM	GVLFYGPPGCGK	1692	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:4	ms_run[2]:scan=6626	43.826	2	1250.6118	1250.6118	K	T	513	525
PSM	IGFFQGDIR	1693	sp|P33121-2|ACSL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:267	ms_run[2]:scan=8280	54.661	2	1061.5533	1061.5533	K	L	341	350
PSM	IGIVGLPNVGK	1694	sp|Q9NTK5|OLA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:188	ms_run[2]:scan=8081	53.434	2	1071.6748	1071.6748	K	S	25	36
PSM	IISTTASKTETPIVSK	1695	sp|O95292|VAPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3576	25.482	3	1674.9404	1674.9404	K	S	140	156
PSM	ILEQEEEEEQAGKPGEPSK	1696	sp|Q9BXP5-5|SRRT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3199	23.16	3	2126.0015	2126.0015	R	K	231	250
PSM	INGEVSSISSKFETEPVSK	1697	sp|Q9Y5K6|CD2AP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6394	42.47	3	2037.0266	2037.0266	K	L	426	445
PSM	IVADKDYSVTANSK	1698	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=2448	18.532	3	1509.7675	1509.7675	K	I	78	92
PSM	IVLQIDNAR	1699	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5474	36.976	2	1040.5978	1040.5978	R	L	150	159
PSM	IYVGNLPPDIR	1700	sp|Q07955-2|SRSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7706	51.102	2	1255.6925	1255.6925	R	T	18	29
PSM	IYVGNLPPDIR	1701	sp|Q07955-2|SRSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:267	ms_run[2]:scan=7438	49.374	2	1265.7007	1265.7007	R	T	18	29
PSM	LAVVDPLFGMQPIR	1702	sp|P08243-2|ASNS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	14-UNIMOD:267	ms_run[2]:scan=11628	76.122	2	1564.8675	1564.8675	R	V	29	43
PSM	LEQENDDLAHELVTSK	1703	sp|B7ZAP0|RBG10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	16-UNIMOD:188	ms_run[2]:scan=6082	40.636	3	1845.9052	1845.9052	R	I	26	42
PSM	LFDQAFGLPR	1704	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9231	60.496	2	1162.6135	1162.6135	R	L	28	38
PSM	LFFWMQEPK	1705	sp|Q16186|ADRM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11311	73.694	2	1224.6002	1224.6002	R	T	105	114
PSM	LFIYNPTTGEFLGR	1706	sp|P54709|AT1B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=10774	70.088	2	1626.8406	1626.8406	K	T	18	32
PSM	LFNDDNTIPFIIR	1707	sp|Q8N5C6|SRBD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	13-UNIMOD:267	ms_run[2]:scan=11450	74.8	2	1586.8332	1586.8332	R	Y	235	248
PSM	LGDEDEEIDGDTNKYK	1708	sp|P09884|DPOLA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	14-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=3876	27.318	3	1851.8413	1851.8413	K	K	816	832
PSM	LIRGPGENGDDS	1709	sp|Q6IBS0|TWF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	3-UNIMOD:267	ms_run[2]:scan=1777	14.38	2	1238.5767	1238.5767	R	-	338	350
PSM	LLELFPVNR	1710	sp|Q9Y6E2|BZW2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:267	ms_run[2]:scan=9851	64.355	2	1109.6472	1109.6472	R	Q	216	225
PSM	LLGASELPIVTPALR	1711	sp|P52292|IMA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	15-UNIMOD:267	ms_run[2]:scan=10578	68.869	2	1558.9322	1558.9322	K	A	301	316
PSM	LLGIFENQDR	1712	sp|Q9NZJ9|NUDT4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:267	ms_run[2]:scan=8433	55.606	2	1213.6331	1213.6331	R	K	80	90
PSM	LLGIFEQNQDR	1713	sp|Q9NZJ9-3|NUDT4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:267	ms_run[2]:scan=8325	54.934	2	1341.6916	1341.6916	R	K	28	39
PSM	LLQDFFNGR	1714	sp|P0DMV8-2|HS71A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8829	58.027	2	1108.5665	1108.5665	K	D	294	303
PSM	LNEQASEEILKVEQK	1715	sp|Q01105-3|SET_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6018	40.254	3	1756.9207	1756.9207	R	Y	33	48
PSM	LPELFETGR	1716	sp|P78318|IGBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:267	ms_run[2]:scan=7947	52.609	2	1070.5636	1070.5636	R	Q	12	21
PSM	LPELFETGR	1717	sp|P78318|IGBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7991	52.883	2	1060.5553	1060.5553	R	Q	12	21
PSM	LQIASDENYKDPTNLQGK	1718	sp|Q13813-2|SPTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5180	35.221	3	2033.0065	2033.0065	K	L	64	82
PSM	LSSEQEKEEIASK	1719	sp|Q96Q89-4|KI20B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	7-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=1806	14.548	2	1488.771	1488.7710	R	S	204	217
PSM	LSVPPLVEVMR	1720	sp|P50895|BCAM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:267	ms_run[2]:scan=10616	69.108	2	1248.7139	1248.7139	R	G	35	46
PSM	LTEELNKEATVIQDLK	1721	sp|Q15075|EEA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	7-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=8018	53.049	3	1855.0341	1855.0341	R	T	196	212
PSM	LTPEEEEILNKK	1722	sp|P62241|RS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=4915	33.617	2	1453.8067	1453.8067	K	R	129	141
PSM	LVESDAEAEAVREVYER	1723	sp|Q9BZJ0-2|CRNL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	12-UNIMOD:267,17-UNIMOD:267	ms_run[2]:scan=7509	49.846	2	1983.9652	1983.9652	R	A	339	356
PSM	LWDIGGQPR	1724	sp|Q96BM9|ARL8A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6148	40.999	2	1040.5403	1040.5403	K	F	69	78
PSM	MFLYADNEDR	1725	sp|Q9NP79-2|VTA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:35,10-UNIMOD:267	ms_run[2]:scan=4808	32.967	2	1298.5477	1298.5477	K	A	39	49
PSM	MFQQCLELPSQSR	1726	sp|Q9Y2A7|NCKP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:35,5-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=6219	41.4	2	1648.7577	1648.7577	K	Y	552	565
PSM	MGPNIYELR	1727	sp|Q9BPW8|NIPS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:35	ms_run[2]:scan=5991	40.089	2	1107.5383	1107.5383	R	T	180	189
PSM	MLLQSSEGR	1728	sp|O75643|U520_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:35	ms_run[2]:scan=1955	15.481	2	1035.5019	1035.5019	R	C	1367	1376
PSM	MSAEDIEKVNK	1729	sp|Q9ULC4-2|MCTS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:35,8-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=1666	13.643	2	1290.6528	1290.6528	K	G	138	149
PSM	NAEPDEQDFEKSNSR	1730	sp|Q14241|ELOA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=2456	18.586	2	1764.7551	1764.7551	R	K	107	122
PSM	NDKEAAGEGPALYEDPPDQK	1731	sp|P27695|APEX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=4127	28.831	3	2142.9706	2142.9706	K	T	33	53
PSM	NFIVWLEDQK	1732	sp|Q9Y224|RTRAF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:188	ms_run[2]:scan=11440	74.739	2	1296.681	1296.6810	R	I	27	37
PSM	NLATTVTEEILEK	1733	sp|O43390-4|HNRPR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	13-UNIMOD:188	ms_run[2]:scan=11306	73.659	2	1465.7971	1465.7971	R	S	249	262
PSM	NLDSTTVAVHGEEIYCK	1734	sp|P21291|CSRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	16-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=5644	37.981	3	1940.9245	1940.9245	K	S	43	60
PSM	NPGLWLESVR	1735	sp|O94906-2|PRP6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8933	58.662	2	1169.6193	1169.6193	K	L	736	746
PSM	NPPGFAFVEFEDPR	1736	sp|Q16629-3|SRSF7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=10626	69.169	3	1620.7573	1620.7573	R	D	45	59
PSM	NQDECIVALHDCNGDVNK	1737	sp|Q5T6F2|UBAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	5-UNIMOD:4,12-UNIMOD:4,18-UNIMOD:188	ms_run[2]:scan=4639	31.95	3	2105.9202	2105.9202	K	A	67	85
PSM	NSILAQVLDQSAR	1738	sp|O14737|PDCD5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	13-UNIMOD:267	ms_run[2]:scan=10236	66.743	2	1423.7659	1423.7659	R	A	41	54
PSM	PGETEEPRPPEQQDQEGGEAAK	1739	sp|Q96JP5-2|ZFP91_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=1987	15.677	2	2378.0622	2378.0622	M	A	2	24
PSM	PLVALLDGR	1740	sp|Q13363-2|CTBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:267	ms_run[2]:scan=8341	55.035	2	962.57883	962.5788	R	D	17	26
PSM	QAESASEAAKK	1741	sp|P51572|BAP31_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:188,11-UNIMOD:188	ms_run[2]:scan=395	5.4222	2	1130.597	1130.5970	K	Y	139	150
PSM	QDAQDLYEAGEKK	1742	sp|P09525-2|ANXA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=2950	21.622	2	1493.6998	1493.6998	R	W	91	104
PSM	QESTSVLLQQSEKK	1743	sp|Q14126|DSG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3629	25.818	2	1603.8417	1603.8417	R	L	549	563
PSM	QGTIFLAGPPLVK	1744	sp|Q9HCC0|MCCB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9655	63.138	2	1339.7864	1339.7864	K	A	236	249
PSM	QGTIFLAGPPLVK	1745	sp|Q9HCC0|MCCB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	13-UNIMOD:188	ms_run[2]:scan=9678	63.279	2	1345.8065	1345.8065	K	A	236	249
PSM	QLAPLLPSLAPSSAR	1746	sp|O14979|HNRDL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9547	62.463	2	1519.8722	1519.8722	R	Q	37	52
PSM	QLLAPGNSAGAFLIR	1747	sp|P07948-2|LYN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9726	63.583	2	1526.8569	1526.8569	R	E	121	136
PSM	QLSFISPPTPQPK	1748	sp|O43395|PRPF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7379	48.974	2	1438.782	1438.7820	K	T	159	172
PSM	QNEAAKEAETPQAK	1749	sp|Q14978|NOLC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	6-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=807	7.9908	2	1525.7775	1525.7775	K	K	588	602
PSM	QSAQLTALAAQQQAAGKEEK	1750	sp|Q96A49|SYAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=4564	31.488	3	2070.0705	2070.0705	K	S	211	231
PSM	SDESSTEETDKSR	1751	sp|Q8NI27-2|THOC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=421	5.5874	2	1469.6118	1469.6118	K	E	40	53
PSM	SDQDYILKEGDLVK	1752	sp|Q9UQ80-2|PA2G4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6929	45.793	3	1621.8199	1621.8199	K	I	40	54
PSM	SDTSSKEIEEAMK	1753	sp|Q05519-2|SRS11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3806	26.887	2	1453.6606	1453.6606	K	R	212	225
PSM	SEETLDEGPPKYTK	1754	sp|Q00688|FKBP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=3178	23.03	2	1604.7972	1604.7972	K	S	100	114
PSM	SIAFPSIGSGR	1755	sp|O75367-2|H2AY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:267	ms_run[2]:scan=6794	44.724	2	1100.5854	1100.5854	K	N	305	316
PSM	SIAFPSIGSGR	1756	sp|O75367-2|H2AY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7144	47.384	2	1090.5771	1090.5771	K	N	305	316
PSM	SLDMDSIIAEVK	1757	sp|P05787-2|K2C8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=10533	68.582	2	1319.6643	1319.6643	R	A	281	293
PSM	SPLSWIEEK	1758	sp|P53004|BIEA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8818	57.961	2	1087.555	1087.5550	K	G	211	220
PSM	SSLGQSASETEEDTVSVSKK	1759	sp|Q13435|SF3B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=4375	30.342	3	2067.9808	2067.9808	R	E	302	322
PSM	SSSADFGTFNTSQSHQTASAVSK	1760	sp|P52594-2|AGFG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=4705	32.353	3	2344.0567	2344.0567	K	V	251	274
PSM	STLADYSAQKDLEPESDR	1761	sp|Q9UKV3-5|ACINU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:188,18-UNIMOD:267	ms_run[2]:scan=5222	35.475	2	2039.9618	2035.9737	K	S	507	525
PSM	STVDAEAVHK	1762	sp|P52701-4|MSH6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=925	8.7004	2	1055.5247	1055.5247	R	L	1041	1051
PSM	SYELPDGQVITIGNER	1763	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	16-UNIMOD:267	ms_run[2]:scan=9126	59.85	2	1799.8929	1799.8929	K	F	239	255
PSM	SYEPLEDPGVKSVTK	1764	sp|P37837|TALDO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=5006	34.169	2	1659.8758	1659.8758	K	I	205	220
PSM	TAAFVLAMLSR	1765	sp|Q9NUU7|DD19A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11525	75.328	2	1178.6482	1178.6482	K	V	144	155
PSM	TCLPGFPGAPCAIK	1766	sp|P51610-2|HCFC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	2-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=8202	54.18	2	1487.7265	1487.7265	K	I	1816	1830
PSM	TCTTVAFTQVNSEDKGALAK	1767	sp|P62424|RL7A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	2-UNIMOD:4	ms_run[2]:scan=5522	37.241	3	2140.047	2140.0470	K	L	198	218
PSM	TDPENTDYTMEHGATR	1768	sp|Q9BW85|YJU2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=2809	20.746	2	1836.7585	1836.7585	K	N	91	107
PSM	TENSTSAPAAKPK	1769	sp|P07305|H10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=490	6.032	2	1312.7026	1312.7026	M	R	2	15
PSM	TGAEGAVLDEAKNINK	1770	sp|P33176|KINH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	12-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=5669	38.135	3	1640.8772	1640.8772	K	S	241	257
PSM	TGLYNYYDDEKEK	1771	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=4734	32.526	3	1636.7257	1636.7257	R	L	240	253
PSM	TTELVNKDLDIYYK	1772	sp|Q92878-3|RAD50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	7-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=7140	47.357	3	1725.9228	1725.9228	R	T	974	988
PSM	TYDPSGDSTLPTCSKK	1773	sp|Q9Y2X3|NOP58_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	13-UNIMOD:4,15-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=2990	21.87	2	1767.8388	1767.8388	K	R	427	443
PSM	VADYCENNYIQATDKR	1774	sp|Q8IZP0-11|ABI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	5-UNIMOD:4	ms_run[2]:scan=4539	31.333	3	1958.8792	1958.8792	R	K	29	45
PSM	VAVEYLDPSPEVQKK	1775	sp|O43684-2|BUB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	14-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=5416	36.634	3	1712.9388	1712.9388	R	K	203	218
PSM	VKEGYVPQEEVPVYENK	1776	sp|Q9BRP8-2|PYM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	2-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=5455	36.868	3	2018.0399	2018.0399	R	Y	31	48
PSM	VLEVPPVVYSR	1777	sp|O00154-2|BACH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7896	52.292	2	1256.7129	1256.7129	K	Q	131	142
PSM	VLQPTVFPVVPR	1778	sp|P33121-2|ACSL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8832	58.044	2	1350.8024	1350.8024	K	L	357	369
PSM	VPDGMVGFIIGR	1779	sp|Q96AE4|FUBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	12-UNIMOD:267	ms_run[2]:scan=10646	69.29	2	1269.6779	1269.6779	K	G	107	119
PSM	VPFLVAETPR	1780	sp|Q13131|AAPK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7486	49.703	2	1127.6339	1127.6339	R	A	375	385
PSM	VQSTAFFSGDQASTDKEEDYIR	1781	sp|Q5TBB1-2|RNH2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7204	47.79	3	2493.1296	2493.1296	R	Y	189	211
PSM	VQTLEELEELGKEECFQNK	1782	sp|Q9BVJ6-2|UT14A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	12-UNIMOD:188,15-UNIMOD:4,19-UNIMOD:188	ms_run[2]:scan=9394	61.504	3	2334.1452	2334.1452	R	E	340	359
PSM	VVLEGPAPWGFR	1783	sp|Q9NR12-3|PDLI7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9691	63.362	2	1326.7085	1326.7085	K	L	6	18
PSM	YAVGEECDFEVGKEK	1784	sp|Q9UIG0-2|BAZ1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	7-UNIMOD:4,13-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=5174	35.183	3	1770.8173	1770.8173	K	M	114	129
PSM	YLMEEDEDAYKK	1785	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	3-UNIMOD:35,11-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=2652	19.806	3	1560.7056	1560.7056	R	Q	210	222
PSM	YPQLLPGIR	1786	sp|P23526-2|SAHH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:267	ms_run[2]:scan=8515	56.11	2	1065.621	1065.6210	K	G	115	124
PSM	YPSPFFVFGEK	1787	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11430	74.624	2	1316.6441	1316.6441	K	I	1038	1049
PSM	YTSIPTSVEESGKK	1788	sp|Q9NVI1-2|FANCI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	13-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=3544	25.273	2	1536.8074	1536.8074	R	E	825	839
PSM	QGPGPGGPKGGK	1789	sp|P23246|SFPQ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28	ms_run[1]:scan=690	7.267035000000001	2	1018.5191	1018.5191	K	M	200	212
PSM	CPENAFFLDHVR	1790	sp|O00159|MYO1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:385,1-UNIMOD:4,12-UNIMOD:267	ms_run[1]:scan=10098	65.90838333333333	2	1496.6743	1496.6741	R	T	802	814
PSM	KDDPVTNLNNAFEVAEK	1791	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:188,17-UNIMOD:188	ms_run[1]:scan=7873	52.151781666666665	3	1915.947848	1914.972579	R	Y	217	234
PSM	AVDEMNGKELNGK	1792	sp|P11940|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	8-UNIMOD:188,13-UNIMOD:188	ms_run[1]:scan=2290	17.54220666666667	2	1416.695402	1415.711737	K	Q	247	260
PSM	TENLNDDEKLNNAK	1793	sp|P13796|PLSL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1932	15.338541666666666	3	1617.764923	1616.764193	K	Y	571	585
PSM	TEISDKITSELVSK	1794	sp|Q14008|CKAP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=7069	46.84393333333333	2	1548.825983	1548.824668	R	I	855	869
PSM	NQDECVIALHDCNGDVNR	1795	sp|Q14157|UBP2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=4959	33.88607666666667	3	2128.887396	2127.906200	K	A	64	82
PSM	ACFSANGEEVLATSTHSK	1796	sp|Q9Y5J1|UTP18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	2-UNIMOD:4	ms_run[1]:scan=5682	38.213975	2	1908.8522	1907.8682	K	V	301	319
PSM	QREGPFYPTLR	1797	sp|Q9ULC4|MCTS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28,2-UNIMOD:267,11-UNIMOD:267	ms_run[1]:scan=6973	46.10955	2	1365.6942	1365.6939	R	L	73	84
PSM	NGRVEIIANDQGNR	1798	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	3-UNIMOD:267,14-UNIMOD:267	ms_run[1]:scan=3707	26.287631666666666	2	1575.7822	1574.8022	K	I	47	61
PSM	CDSSPDSAEDVRK	1799	sp|P02765|FETUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:4	ms_run[1]:scan=870	8.37025	3	1464.614922	1464.615087	K	V	132	145
PSM	DVAEAKPELSLLGDGDH	1800	sp|Q2TAA2|IAH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:188	ms_run[1]:scan=7609	50.483905	3	1770.865881	1770.873137	R	-	232	249
PSM	PLVALLDGR	1801	sp|Q13363|CTBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=8336	55.00112166666667	2	952.571435	952.570566	R	D	28	37
PSM	IIPGFMCQGGDFTR	1802	sp|Q9Y536|PAL4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	7-UNIMOD:4	ms_run[1]:scan=9423	61.685545	2	1598.722223	1597.738119	R	H	56	70
PSM	GGGGNFGPGPGSNFR	1803	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	15-UNIMOD:267	ms_run[1]:scan=4928	33.699708333333334	2	1387.615567	1386.630430	R	G	214	229
PSM	AVTEQGHELSNEER	1804	sp|P31946|1433B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	14-UNIMOD:267	ms_run[1]:scan=1532	12.73387	2	1608.7272	1607.7412	K	N	30	44
PSM	QASDLSLIDKESDDVLER	1805	sp|Q15542|TAF5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=8413	55.484140000000004	3	2031.995705	2031.996044	K	I	509	527
PSM	ASNGDTPTHEDLTK	1806	sp|P11171|41_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	14-UNIMOD:188	ms_run[1]:scan=1387	11.733576666666666	2	1491.683133	1490.694445	K	N	55	69
PSM	VVVLGLLPR	1807	sp|Q15102|PA1B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	9-UNIMOD:267	ms_run[1]:scan=9564	62.56926333333333	2	974.650325	974.651606	R	G	133	142
PSM	FFPLESWQIGK	1808	sp|P30046|DOPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	11-UNIMOD:188	ms_run[1]:scan=11347	73.98407333333333	2	1356.719362	1356.717352	R	I	100	111
PSM	GVLMYGPPGCGK	1809	sp|P43686|PRS6B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:35,10-UNIMOD:4	ms_run[1]:scan=6626	43.826011666666666	2	1250.581627	1250.578765	R	T	201	213
PSM	QQLQQVPGLLHR	1810	sp|Q14166|TTL12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28,12-UNIMOD:267	ms_run[1]:scan=7773	51.523221666666664	2	1408.7782	1408.7809	R	M	133	145
PSM	QGQDNLSSVKETQK	1811	sp|P30040|ERP29_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	10-UNIMOD:188,14-UNIMOD:188	ms_run[1]:scan=1210	10.595063333333334	2	1572.821369	1572.814622	K	K	183	197
PSM	DYQDVRNEIPEEALYK	1812	sp|P20020|AT2B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:267,16-UNIMOD:188	ms_run[1]:scan=7530	49.978071666666665	2	1996.969124	1996.971284	R	V	559	575
PSM	SSSSTGSEVGGQSTGSNHK	1813	sp|Q9UPQ9|TNR6B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	19-UNIMOD:188	ms_run[1]:scan=528	6.266296666666666	2	1798.8172	1798.8022	R	A	561	580
PSM	QASALIDRPAPFFER	1814	sp|Q9H4G0|E41L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28,8-UNIMOD:267,15-UNIMOD:267	ms_run[1]:scan=10058	65.66753833333333	2	1719.8856	1719.8842	R	S	405	420
PSM	IGQLFFGVPPK	1815	sp|Q7L5D6|GET4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	11-UNIMOD:188	ms_run[1]:scan=9557	62.52464333333334	2	1207.705793	1207.706059	R	Q	279	290
PSM	LLLPGELAK	1816	sp|Q96A08|H2B1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=7818	51.80703166666667	2	952.595432	952.595718	R	H	102	111
PSM	LLLPGELAK	1817	sp|Q96A08|H2B1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=6915	45.707190000000004	2	952.595432	952.595718	R	H	102	111
PSM	LLLPGELAK	1818	sp|Q96A08|H2B1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=7345	48.76206333333334	2	952.595432	952.595718	R	H	102	111
PSM	LLLPGELAK	1819	sp|Q96A08|H2B1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	9-UNIMOD:188	ms_run[1]:scan=7338	48.71397833333333	2	958.614649	958.615847	R	H	102	111
PSM	ILTFDQLALDSPK	1820	sp|Q07020|RL18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=10234	66.732285	2	1461.796754	1459.792246	K	G	120	133
PSM	MAASQAVEEMRSR	1821	sp|O15160|RPAC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:1	ms_run[1]:scan=7868	52.11775166666666	2	1507.687944	1506.691897	-	V	1	14